3VRQA

Crystal structure of the tyrosine kinase binding domain of cbl-c (pl mutant)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
310
structure length
278
Chain Sequence
QWEEARALGRAVRMLQRLEEQCPPSLRDLLPRTAQLLREVAHSRPGGPGGSGDFLLIYLANLEAKSRQVAALSRLRRQLAKLAIIFSHMHAELHALFPGGKYCGHMYQLTKAPAHTFWRESCGARCVLPWAEFESLLGTCHPVEPGCTALALRTTIDLTCSGHVSIFEFDVFTRLFQPWPTLLKNWQLLAVNHPGYMAFLTYDEVQERLQACRDKPGSYIFRLSCTRLGQWAIGYVSSDGSILQTIPANKPLSQVLLEGQKDGFYLYPDGKTHNPDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural flexibility regulates phosphopeptide-binding activity of the tyrosine kinase binding domain of Cbl-c.
pubmed doi rcsb
molecule keywords Signal transduction protein CBL-C
molecule tags Protein binding
source organism Homo sapiens
total genus 95
structure length 278
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02262 Cbl_N CBL proto-oncogene N-terminal domain 1
A PF02761 Cbl_N2 CBL proto-oncogene N-terminus, EF hand-like domain
A PF02762 Cbl_N3 CBL proto-oncogene N-terminus, SH2-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3vrqA02
1.20.930.20 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Adaptor protein Cbl, N-terminal domain 3vrqA01
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3vrqA03
1KWOB 4PCWA 3VS6A 2OTGC 1F70A 1KA6A 2Q91A 1S36A 1H9OA 5EHRA 1DJXA 2LLUA 5HLOA 4K11A 3NSIA 2FO0A 3SG4A 1MUXA 5KSZA 1GQMA 1VRKA 4IL1A 4ZCUA 1QLSA 2R2IA 1QADA 1F4QA 1R6PA 4DCKA 1CFPA 1BHFA 1NZVA 4HRGA 2Y1MA 2P6BB 3BUOB 1I3ZA 1X0NA 3OVEA 3E3RA 1NZLA 1RTP1 1Y6WA 1O41A 1IH0A 2BBMA 2F3YA 4M2QA 5DKQA 1A1BA 2K2FA 3LLEA 1DJZA 4FQOA 3VRYA 1NIWA 1DF0A 3IN7A 3I5GC 4WRIA 1V1FA 1IJRA 1DJIA 2BECA 2BBUA 2HF5A 1CMGA 2O5GA 1PSBA 2M9GA 3CR4X 3SIBA 2HCKA 1CWDL 1V1GA 2JOJA 3KO0A 2L6KA 5J3XA 1CFDA 5AERA 1H4BA 4N1FA 2EO6A 2GE9A 4ICBA 1WLMA 1NX3A 1PALA 1YVLA 2BE6A 1SL9A 2K2AA 3TDIA 1CM1A 3WXAA 2KYCA 3DF0A 2AOAA 4HREE 2OTGB 1AK8A 2ZKMX 1O4HA 2PSRA 4H1OA 2K7OA 1B7TY 2WCFA 4OHLA 1JYUA 4X6SA 1BKMA 1WY9A 3AAKA 2ISDA 1SY9A 3OX5A 2LV7A 3HIZB 3SG5A 2JTTA 3PN7C 4PHMA 3BOWB 4GGFA 3S8OA 2H5KA 2CTNA 1UHJA 5KU1A 1CDMA 3TL0A 1W7JB 5HKWA 3PALA 3VS5A 1NCZA 3EKHA 3CTNA 1MWNA 1DGUA 1ZFSA 2Q4UA 5JJGA 4NDBA 1MF8B 3I5GB 4YI8A 2RVFA 1FU6A 2Y3AB 2NXQA 3EK7A 4NDCA 4CIDA 1SBJA 2L4HA 2A4JA 3NSOA 1TNQA 4GBAA 1LUKA 5HYDA 1KK7Y 1QLKA 2JC2A 5HLVA 4R1EA 1UURA 3IQQA 1TIZA 2JXLA 2LVVA 2OS8C 5D69A 4BY4A 4DIRA 1RQQC 3GQIB 3PQZA 5TNCA 2MLFC 3DD4A 3TUYC 1SKTA 3A4UB 1C07A 3OV1A 3PSJA 5I8NA 1HCTB 2F3ZA 1UHNA 5HKYA 1JWOA 1SL7A 4M4ZA 5IBMA 2BBNA 1QASA 3VGOA 2KFGA 4JEGA 5CSIA 1BM2A 3HHMB 1QG1E 3PN7B 1BOCA 1XFYO 4E93A 1CB1A 2WORA 1C7WA 3RM1A 3TDZA 1XFZO 1YX8A 1WRKA 2KI6D 4XJKB 1BODA 1K2HA 2GV5A 1AYAA 1O4BA 1SKJA 1X6CA 2IUIA 1JU5A 5KTYA 4OV2A 3PJPA 2IUHA 5JOLA 5DC0B 3NSLA 1BLKA 1IWQA 3EAZA 4JPZB 5HKZA 2ABLA 1WRLA 1R1SA 3PFVA 1BFJA 5B8IB 5CSNA 4CFRA 2CS0A 1CDPA 1P13A 4HSZA 3D0YA 1O4LA 2HUWA 1LCKA 2PALA 2WC8A 3OHMB 3VRNA 1O49A 2EYVA 3H4SE 4I5NB 2C0TA 1NYAA 3HX4A 1B1GA 2HMHA 2OS8B 1F2FA 4MSPA 2DLYA 1AB2A 3BUWB 2EL8A 3HCMA 3IMDA 3TUYB 2DX0A 1PSRA 1QVIY 2KQ6A 3TDUA 1A1AA 2GSBA 4U17A 1HT9A 1SPSA 1M63B 1PK0D 2LCPA 2K79B 1NWDA 2MRKA 1FHSA 5AFPA 2M3WA 2KNOA 4GWFA 2I18A 1K95A 1WLZA 3D10A 2I7AA 3I5FC 2KK6A 4MEWA 1MILA 5CSJA 4GUKA 3PLFB 1NP8A 4GNKB 4YGBB 1QJTA 1JWDA 1LUIA 2DVJA 2IZVA 1Y0VH 2KGBC 3FIAA 3ICBA 5EHPA 2ZNDA 3CWGA 1J1EA 3AAJA 5G08A 2LHLA 2CIAA 3SG7A 1R1PA 2LUCA 3MAZA 1S5GY 1OZSA 1NSHA 2LLTA 3VRRA 3IN8A 3N84A 3QWXX 3FWBA 4MZLA 2JYQA 4F5AA 4NQGA 2KI6C 2HETA 2WCEA 2HPSA 2KYFA 1J55A 1TN4A 2AUGA 2EC6C 2GGMA 1SMGA 1U5IB 2MAZA 1AYDA 1YRUB 4ORAB 5PALA 4XZ0A 3UYOA 2GGZA 2OPOA 4MRXA 1S26D 1KFXS 1AYCA 3A8RA 1ZMZA 2ZNEA 2EYZA 5AXIA 1O4EA 2H8HA 4PE0A 1CDLA 2EHBA 1G8IA 4NDDA 1FPWA 2AMIA 1PICA 1S3PA 1EXRA 2I2RE 2ZN8A 1A81A 1NCYA 3MXYA 4LUDA 1AOUF 3US4A 4K44A 4JWQA 3C7IA 1OO3A 4MZJA 3WHTB 1CSYA 3VS7A 1S6CA 3GK1A 3MSEB 3OB1B 4MVFA 1OMRA 3I5FB 1RJVA 3O4YA 2CNPA 4U1PA 2LAPA 2O60A 4OCIA 2EO3A 1QV0A 1JUOA 3M0WA 1YUSA 2L50A 3NXAA 1A1CA 1FYRA 1E8AA 2JXCA 2PASA 1YURA 1DJYA 3VS1A 1IKUA 2G9BA 4N1GA 1CWEA 2BE4A 4AQIA 2L51A 2H2KA 4K2RA 4OHHA 3VS4A 2EC6B 1BMBA 3LCPC 1PVBA 3QRXA 2H46E 4P9VA 2JQ6A 4JE4A 1O4GA 2EGDA 4LUEA 3GOFA 1MR8A 1Q80A 2NCOA 4C0JA 1TRFA 1IGVA 4NWFA 2JPTA 2CI9A 2B1UA 3OP0A 4JQ0D 1PULA 4GGFC 4OVNF 1AYBA 3CXLA 5DC4A 1S6IA 5F6TA 3LL8B 1A75A 5DF6A 4DRWA 1FBVA 4YRUA 2L98A 1OPLA 1Z3KA 3BUNB 1DF0B 1EH2A 1OMDA 2M1UA 4PHKA 1KA7A 1O4PA 4CFQA 1OPKA 2YU7A 3EACA 2V53A 1K96A 1BLQA 5EG3B 2JWWA 1CLLA 3JTDC 3SJSA 2XP1A 1A08A 1AJ5A 2MJWB 3O78A 1QXPA 2KQYA 1CKKA 2WCBA 1KFUS 1JFJA 3DVMA 1BT6A 2M29A 3SIAA 3DF0B 4N5XA 3F45A 5IBWA 1CFCA 1IQ3A 1B9AA 3PS5A 4GL9E 1JC2A 2QACA 3I5HC 1ZUZA 5GJIA 4OHEA 1SR6C 5FYXA 1YX7A 1A75B 2WOSA 2KDHA 1BHHA 3SG6A 4M2PA 2EU0A 1MQ1A 4I5LB 4OHDA 2E30A 5EELA 2PMYA 4K45A 2TN4A 4UPGA 4YGEB 1AD5A 3NHNA 1LXFC 1B8RA 1LKLA 1O4CA 4EIHA 2JU0A 2K7DA 4L1BB 2NLNA 1SW8A 1RJAA 2RORA 2KAXA 2PRUA 4WQ2A 4HRHA 1CFFA 1XA5A 2C0OA 3ZNIA 3N8MA 3KHEA 4P2YB 2L0PA 2JTZA 4YGAA 1O45A 2JT3A 5CSFA 2KGRA 4PE7A 1CMFA 2AUCA 1HQVA 1S6JA 4FTGA 2IS9A 1SCMC 2JULA 3JTDB 1TNPA 4ORCB 1FI6A 2G2BA 1O43A 5IBSA 1DMOA 1ZACA 2ECDA 5CDWA 1BJFA 1M46A 4GFTA 1GRIA 2PTKA 2PLDA 1DVIA 1G33A 1SK6D 3EK4A 2MHHA 4PALA 1LUNA 2M8UA 1O48A 2HDVA 1XFXO 2F2OA 4PE4A 3S8LA 1BFIA 1K8UA 3BUMB 1N65A 1SR6B 4QJ3B 1D1ZA 4FL2A 1TOPA 2MRDA 1LKJA 2KI4C 1XFUO 1BMOA 1AVSA 1LVCD 1NUBA 1SRAA 2KAVA 4E68A 1EL4A 1IS0A 1F1WA 1Y1UA 2LMTA 3KF9A 1QV1A 2CXJA 2C0IA 1OSAA 2NZ0A 3CLNA 4AOMA 3BQ3A 1DT7B 1JBAA 1BR1B 2DOQA 4BY5A 1X27A 1FI5A 1IRJA 2LNXA 1B4CA 3EKJA 2LMUA 3O6BA 2L3TA 4AQJA 1LA3A 2QPTA 2LE9B 1L2OC 2NCPA 3CS1A 1YRTB 1XK4A 3GK2A 4YBHB 2CI8A 4C0LA 1HCSB 2MQIA 2PNBA 2VIFA 1UHIA 3BYAA 2H61A 3SG3A 1FMKA 1JF0A 3IMJA 2LC5A 3CZTX 4MZKA 2D8NA 1DGVA 1SCMB 1QTXA 3D0YB 2C9WA 5I6VA 3S9KA 3LK1A 4I5KA 1F55A 1FU5A 4TNCA 1IQ5A 2IUGA 2SHPA 2MRJA 2EYYA 1QX2A 2JT8A 2MA2A 1XO5A 3VRZA 2L4IA 2EKXA 3MXCA 1OO4A 1XFVO 2CBLA 1KC2A 1KSMA 3OX6A 2LQNA 2M0RA 3FS7A 4MBEA 3S8NA 2Y1NA 1MHOA 3KPXA 3VROA 2LM5A 1YR5A 4A4CA 1O4OA 2YSXA 2BCAA 4NWGA 2BCXA 2JNFA 1A2XA 5ER4X 2SCPA 1O4FA 3DVKA 3EK8A 2LNKA 1TCEA 4ETOA 4GGNA 1UWOA 3ZWHA 3O2PA 5CPVA 2K7CA 4BTFA 1A1EA 2EOBA 4DGXA 1DJWA 1MXEA 1QATA 4DGPA 1S1EA 1ZOTB 4YI9A 3K2MA 1L2OB 1N0YA 2ETZA 3K21A 2KHNA 1KK8C 1J7PA 4OR9B 1JSAA 1O42A 4MLWA 1QX7A 2Y5IA 3CR5X 1K9AA 2BL0C 2MBXA 1O4RA 5I2QA 2PLEA 4Q04A 1ZFPE 2HQWA 1TZEE 4QSYA 4TZIA 2KBMA 1DTLA 5D7FA 3TKZA 1OZOA 2Y4QA 2RGIA 1RECA 2JZIA 1XVJA 3FWCA 1BF5A 2CCMA 2RMXA 1A29A 1CDNA 2HQ8A 1BR4B 1L7ZA 1O4QA 1NPQA 1UUSA 3I5IC 1AJ4A 3VS0A 1WQUA 3KFJA 2KFFA 3DVJA 2KOTA 1M27A 1JF2A 2M1KB 2F33A 2L4KA 2K0JA 2OZOA 1O4AA 1TNWA 3AKAA 3JVTC 2E6WA 4QJ4B 1K9KA 1IJ5A 1QS7A 2DM0A 1WRZA 3TS5C 3NSKA 5I2LA 1KQVA 2LUXA 2AAOA 5ER5A 2I94A 1YUUA 4QJ5B 1LKKA 2LMVA 1TCFA 4F0ZB 1SL8A 1KFXL 2FOTA 1KCYA 1BU3A 1G4YR 1R2UA 1PRWA 1SNLA 2BKHB 2CT9A 2LHIA 3BOWA 1RFJA 1SPRA 1A4PA 3N7YA 1KK8B 1J1DA 3RLZA 1TTXA 1MXLC 1AOTF 1O4MA 1O47A 2K7AB 1M39A 3CR2A 2BL0B 4XYNA 1BG1A 2LANA 1FW4A 5GJHA 3VS2A 1B7TZ 3GK4X 4D8KA 4ORBB 2M97A 1F54A 1D4WA 1D4TA 1JFKA 1CTRA 1K94A 1CLBA 2LNWA 1TCOB 1FF1A 1J7RA 1TNXA 3CD3A 1O4KA 1Y57A 3PSKA 4FBNA 3I5IB 1QX5B 3LK0A 4MRYA 2MC1A 2M7NA 2LQWA 1WDCC 3WA4A 1O4JA 1H8BA 2K7BA 1NX2A 3JVTB 1J7QA 1XFWO 3IQOA 2F2PA 2M49B 2RSYA 4OHIA 3OB2B 2BCBA 1X02A 1FBZA 1QCFA 1SHAA 5BPJA 2CR4A 1GHUA 3TS5B 1CNPA 4H34A 2B3OA 3UF4A 1RROA 2LLSA 5DC9A 2LCTA 1F4OA 1AHRA 1G83A 3QWYA 2WNDA 4ZCVA 1BLJA 1KK7Z 1KQMC 1Y1AA 4C0KA 2DCRA 2DLZA 1C7VA 3IF7A 1B8LA 4XJKA 2LP2A 5DKNA 3HCKA 4CLNA 1XA6A 2COLB 1JYRA 1OOJA 1BHHB 3BKBA 3TZ1A 1DJGA 4PHNA 3PATA 1BKLA 1K90D 1A09A 1UHHA 1YVHA 3VRQA 1XYDA 3WNXB 1ALVA 1B8CA 1PVAA 1YTZC 5D0JA 3CGAA 1F71A 3I5HB 1O4IA 1JYQA 1DJHA 3T04A 1LUMA 1EG3A 4I5JA 2CRHA 3BUXB 2HDXA 1KFUL 2KFHA 2LVIA 1RPYA 4WQ3A 1WDCB 2F8PA 2OQ1A 4F59A 1XK4C 4GPLB 1NCXA 3PSRA 2JRFA 5GQQC 2VRGA 4L9MA 1R1QA 1GJYA 3WHUB 4EY0A 2H61C 4OKHA 1MW4A 2KAYA 1N2DA 1RK9A 3VRPA 1KSOA 4U8DA 2LP3A 1OMVA 2JT0A 4YGDB 4A4BA 5I2OA 4D1EA 4ROJA 3VS3A 1K9UA 2FCEA 1W7IB 3EVRA 4M2OA 3SG2A 1M31A 1CSZA 3DVEA 1Y1XA 1KQMB 2FCIA 2PVBA 2KNEA 2L2EA 2MLEC 3CBLA 3GXXA 4WWQA 1LA0A 2JNXA 1GGWA 1KWOC 1ALWA 4JGHA 4P9ZA 4PDZA 1QVIZ 5K89A 2QMSA 4DUQA 2K61A 2ZN9A 4P5OE 4DS7A 4CPVA 1LCJA 1U5IA 4YGCB 1OE9B 2KSPA 5AEQA 1O4NA 4PE1A 2FCDA 4F5BA 1QIWA 1UHKA 1LINA 3C1VA 1EG4A 5AANA 5EEQA 2LVKA 2ZRSA 3KEVA 1O46A 2AOBA 2SRCA 1F8HA 2BKIB 5BO4A 4MN0A 1GGZA 1NX0A 2KI4B 2L5XB 2ZRTA 1AP4A 1SHDA 1SYMA 3GXWA 4USLA 1D1OA 4GAOA 1CLMA 1EJ3A 3EVVA 1S5GZ 1SCVA 3PM8A 1ODBA 2PNAA 1IJ6A 1NRVA 3AKBA 2LVJA 4PHJA 5KAZA 1QIVA 1SHBA 1O4DA 2FJUB 1RWYA 2ZFDA 5AULA 1B47A 1YUTA 5DKRA 1AUIB 1CM4A 1IG5A 1NX1A 2K8MB 1UP5A 1SPYA 1CJ1A 1O44A 1K93D 2M7LA 1A07A 1M45A 1OQPA 1KSWA 2KBIA 1J7OA 3M7FA 2MK2A 1M61A 4FL3A 3BXKA 1K9PA 2SASA 1A03A 4XZ1A 3EVUA
chains in the Genus database with same CATH superfamily
1F70A 5EHRA 3SS3A 1OOGA 4K11A 2FO0A 5KSZA 4ZCUA 1BHFA 2Y1MA 3BUOB 3OVEA 3E3RA 2BBMA 2F3YA 3LLEA 1DJZA 1NIWA 1DF0A 2BBUA 2O5GA 1PSBA 3KO0A 2GE9A 4N1FA 1YVLA 3DF0A 2OTGB 2K7OA 1TUZA 2XEGA 1WY9A 1SY9A 1NCZA 3CTNA 1MWNA 1ZFSA 4NDBA 1FU6A 3S0FA 4CIDA 2QEVA 2XPNA 1EO0A 3IQQA 2FJYA 2OS8C 3GQIB 2WCJA 5TNCA 3PQZA 3TUYC 3A4UB 3PSJA 2XPLA 1UHNA 1JWOA 5IBMA 3VGOA 3HHMB 4E93A 1CB1A 2WORA 3RM1A 1X6CA 1O4BA 3PJPA 2ABLA 1DELA 1O4LA 2EYVA 2BNXA 3HX4A 1B1GA 1F2FA 2DLYA 2DX0A 2GSBA 1A1AA 4U17A 1FHSA 5AFPA 2M3WA 1QWVA 1K95A 3I5FC 1MILA 4GUKA 3PLFB 4YGBB 2DVJA 3FIAA 3AAJA 3MAZA 1S5GY 1OZSA 2LLTA 2KI6C 2WCEA 2AUGA 2KYFA 2MAZA 3U88C 1YRUB 4XZ0A 4MRXA 2EYZA 1O4EA 2H8HA 1CDLA 1FPWA 1EXRA 2ZN8A 1AOUF 4OC4A 4JWQA 4OCIA 4KYNA 1FYRA 1E8AA 4JZ0A 2L51A 4OHHA 3VS4A 3GOFA 1MR8A 2NCOA 4C0JA 1TRFA 1AYBA 4GGFC 4OVNF 5DC4A 3LL8B 3FEEA 1OPLA 2PYQA 4CFQA 3EACA 3SJSA 2KQYA 3F45A 1IQ3A 1YX7A 1BHHA 5D29A 4M2PA 1MQ1A 4I5LB 3FE9A 3HPGG 4K45A 2JBKA 4YGEB 1LXFC 2K7DA 4L1BB 2RORA 3ZNIA 3KHEA 4P2YB 4YGAA 1CMFA 3JTDB 2KLEA 1O43A 5IBSA 1ZACA 5CDWA 1SK6D 4PALA 2HDVA 2M8UA 1K8UA 2MRDA 1LKJA 1BMOA 1NUBA 3OAKA 4E68A 4JYWA 3R72A 1QV1A 2CXJA 2C0IA 1OSAA 1DT7B 1JBAA 4AOMA 2DOQA 3O6BA 1LA3A 1YRTB 1XK4A 2QEOA 4C0LA 3BYAA 3IMJA 1JF0A 1DGVA 1SCMB 1QTXA 3D0YB 2C9WA 1Z8LA 2SHPA 1QX2A 2MA2A 2EKXA 1KSMA 3OX6A 2LQNA 3K2TA 3S8NA 4A4CA 3KPXA 1YR5A 2BCAA 2BCXA 3D7FA 4ETOA 1UWOA 3ZWHA 2K7CA 1MXEA 1QATA 4DGPA 1S1EA 3K2MA 1L2OB 1N0YA 4OR9B 2MBXA 2LRAA 4Q04A 1ZFPE 1TZEE 2Y4QA 2QEHA 3FWCA 2HQ8A 1L7ZA 5BY0A 1NPQA 1O4QA 3I5IC 1AJ4A 3VS0A 2KFFA 2KOTA 2L4KA 1O4AA 1TNWA 3AKAA 1C3YA 1QS7A 3NSKA 1KQVA 4QJ5B 1TCFA 4P4DA 4F0ZB 2KLDA 1BU3A 2CT9A 5EL2A 1AOTF 1O47A 4XYNA 3GK4X 4D8KA 1D4WA 1JFKA 1CLBA 1TCOB 3CD3A 1OW4A 1QX5B 3LK0A 3SJGA 2M7NA 3WA4A 1XFWO 2CR4A 1X02A 3S0AA 2B3OA 4OZDA 2WNDA 1KK7Z 3BFAA 4C0KA 1B8LA 2CIJA 1DC1A 1DJGA 3PATA 3O8ZA 4F7FA 3VRQA 1XYDA 3WNXB 1PVAA 5D0JA 1F71A 2CRHA 4F59A 1W9ZA 1NCXA 2JRFA 5GQQC 1GJYA 2H61C 1ORGA 1N2DA 3VRPA 4INWA 4YGDB 4ROJA 4M2OA 3SG2A 1KQMB 4MCPA 2JNXA 2P71A 5K89A 2PVWA 1OE9B 2KSPA 5EEQA 5AANA 3C1VA 2ERBA 2SRCA 1NX0A 2ZRTA 2XEIA 3GXWA 4USLA 4GAOA 1SCVA 1ODBA 2LVJA 1SHBA 2FJUB 1YUTA 1O44A 1CM4A 1CJ1A 1UP5A 1SPYA 1J7OA 1M61A 4FQTA 4XZ1A 3VS6A 1KA6A 1H9OA 3NSIA 3SG4A 1GQMA 1VRKA 1QLSA 1F4QA 1R6PA 1TUJA 4DCKA 3S9NA 2KPHA 2P6BB 3L4AA 1O41A 4M2QA 5DKQA 1A1BA 2K2FA 4FQOA 1IJRA 2BECA 3BHXA 1CMGA 3CR4X 1CWDL 1V1GA 5J3XA 2K2AA 3WXAA 2BE6A 2XEJA 2UV8G 1JYUA 3CDNA 1BKMA 2ISDA 2JTTA 1LS8A 1UHJA 3TL0A 1W7JB 3VS5A 1DGUA 1Z2CB 2Q4UA 2Y3AB 4YI8A 2NXQA 4NDCA 2A4JA 3NSOA 1WJTA 1LUKA 3OGNA 5HLVA 4R1EA 1UURA 1TIZA 2JXLA 2LVVA 3OV1A 1HCTB 2F3ZA 1SL7A 2BBNA 1QASA 5CSIA 1QG1E 1BOCA 1XFYO 1YX8A 2KI6D 1K2HA 2IUIA 3QWYA 2GV5A 1AYAA 1JU5A 2IUHA 1OOHA 2DLAA 5HKZA 5CSNA 2CS0A 1CDPA 4HSZA 3D0YA 1LCKA 2WC8A 3H4SE 2C0TA 2OS8B 3D7HA 3IMDA 3TUYB 1PSRA 2KQ6A 1SPSA 1M63B 1PK0D 2KNOA 2H8VA 4GWFA 1WLZA 2KK6A 4MEWA 2IZVA 1Y0VH 1XFRA 2ZNDA 3CWGA 1R1PA 3QWXX 1NSHA 1DEKA 3FWBA 4F5AA 4NQGA 2HPSA 1J55A 1TN4A 1SMGA 1U5IB 1AYDA 2YGUA 2OPOA 2AMIA 1S3PA 4LUDA 4INXA 1NCYA 3VS7A 1S6CA 3MSEB 3SJFA 3I5FB 1QV0A 3M0WA 3NXAA 2K60A 2JXCA 2PASA 3LCPC 3BFBA 3QRXA 4JE4A 1O4GA 2EGDA 3OBVA 1IGVA 4NWFA 2B1UA 1PULA 1S6IA 5F6TA 1A75A 2N3AB 1FBVA 5F13A 1EH2A 1O4PA 1KA7A 1K96A 1BLQA 3DZTA 2WCHA 4PT1A 1CLLA 5EG3B 2XP1A 3O78A 1QXPA 3RZSA 4N5XA 1CFCA 4GL9E 1JC2A 5GJIA 4OHEA 3HPHE 3SG6A 4LQGA 2EU0A 4OHDA 3NHNA 1B8RA 3D75A 4EIHA 2NLNA 1RJAA 2PRUA 4WQ2A 1CFFA 1XA5A 1O45A 5CSFA 2AUCA 2IS9A 1M46A 1G33A 3EK4A 3CZ0A 2F2OA 1D1ZA 1XFUO 1AVSA 1LVCD 2KAVA 1Y1UA 2LMTA 2NZ0A 3BQ3A 1BR1B 1X27A 1IRJA 3NGVA 2L3TA 2QPTA 2LE9B 2NCPA 2MQIA 1HCSB 3PJIA 2LC5A 3CZTX 3UO9A 2D8NA 4I5KA 1F55A 1IQ5A 3FS7A 4MBEA 1MHOA 2LM5A 1O4FA 3S9LA 1Z4HA 4DGXA 4BTFA 4OC3A 1ZOTB 1KK8C 1O42A 4MLWA 1QX7A 3CR5X 1K9AA 2PLEA 4QSYA 2HQWA 5D7FA 3TKZA 4P4IA 1RECA 1XVJA 1BF5A 2CCMA 1A29A 1BR4B 1UUSA 1WQUA 1JF2A 3CZ2A 2OZOA 3JVTC 1K9KA 3R1VA 2XPOA 1WRZA 3BI1A 5I2LA 2LUXA 2I94A 1KFXL 1SNLA 2BKHB 1PRWA 1A4PA 3RLZA 1MXLC 2K7AB 1BG1A 3VS2A 1B7TZ 4ORBB 1F54A 1K94A 1FF1A 1J7RA 1TNXA 1Y57A 3PSKA 3I5IB 2MC1A 2LQWA 1WDCC 1DE4C 1NX2A 2M49B 2RSYA 1GHUA 3IWWA 1RROA 5DC9A 4ZCVA 2WC6A 1BLJA 4BPXB 5DKNA 3FECA 3HCKA 1XA6A 1JYRA 1OOJA 3DY9A 3BKBA 3TZ1A 4PHNA 1BKLA 3FEDA 3CGAA 3I5HB 1JYQA 1DJHA 1EG3A 4I5JA 2KFHA 3FE6A 4OMEA 4L9MA 3WHUB 4U8DA 2LP3A 5I2OA 2JT0A 1M31A 3HMJG 1CSZA 2FCIA 2L2EA 4P45A 3DXLA 2JBJA 3GXXA 1LA0A 1KWOC 4PDZA 1QVIZ 2QMSA 2K61A 2ZN9A 1U5IA 4YGCB 5AEQA 4PE1A 1UHKA 2ZRSA 3KEVA 1O46A 2AOBA 4MN0A 2KI4B 4NGPA 1CLMA 1EJ3A 3EVVA 5AULA 3SS4A 2K8MB 4P4EA 2M7LA 4P4JA 1A03A 3VRYA 4PCWA 3L47A 1S36A 4RR2B 2L2CA 4IL1A 1QADA 3V2LA 1CFPA 1NZVA 4P44A 1X0NA 1I3ZA 1Y6WA 3D76A 4NGRA 3I5GC 4WRIA 3FF3A 1DJIA 2HCKA 3SIBA 2L6KA 2JOJA 4NGQA 1CFDA 5AERA 1H4BA 2EO6A 4ICBA 1WLMA 1NX3A 4NGTA 1SL9A 2AOAA 4HREE 4H1OA 2PSRA 3F9KC 3OX5A 2LV7A 3HIZB 3SG5A 3PN7C 4PHMA 3BOWB 4GGFA 2H5KA 2CTNA 3PALA 3EKHA 3KASA 2JPOA 5JJGA 2RVFA 3EK7A 1SBJA 1TNQA 4GBAA 5HYDA 1KK7Y 1QLKA 4DIRA 3Q8IA 3DD4A 1SKTA 5I8NA 4OC0A 5HKYA 2C6CA 4JEGA 2XEFA 1XFZO 4XJKB 1WRKA 5KTYA 4OV2A 3B86A 5JOLA 3NSLA 1BLKA 3EAZA 4JPZB 1R1SA 1BFJA 2HUWA 2BAPA 3VRNA 3OHMB 3BUWB 2EL8A 5D3OA 3TDUA 1HT9A 2LCPA 2MRKA 3D10A 2I7AA 1LUIA 1NP8A 4GNKB 1JWDA 2KGBC 5EHPA 3ICBA 2LHLA 3SG7A 2LUCA 3N84A 2L5YA 2EC6C 3UYOA 5PALA 3CYZA 2GGZA 1S26D 1KFXS 1AYCA 1ZMZA 3S0DA 4TZIA 3UF4A 4PE0A 4NDDA 1PICA 2EHBA 1G8IA 2I2RE 1A81A 1OO3A 4MZJA 1CSYA 3OB1B 4MVFA 1OMRA 1RJVA 2CNPA 4U1PA 2LAPA 2O60A 2L50A 1A1CA 3VS1A 1IKUA 2BE4A 2WCLA 2H2KA 4K2RA 4P9VA 3K1EA 4LUEA 3OP0A 3CXLA 4DRWA 4YRUA 2L98A 1Z3KA 3D7DA 1OPKA 2YU7A 3O4XA 2WCBA 3DVMA 1IIOA 5IBWA 1ZUZA 1SR6C 2WOSA 5EELA 2TN4A 2JU0A 1CX8A 4BPUB 2L0PA 2KGRA 4ORCB 1TNPA 3R1OA 2G2BA 1DMOA 1OOIX 2PTKA 1DVIA 3BJHA 2MHHA 3FE8A 1LUNA 3S8LA 1XFXO 4PE4A 2WC5A 3BUMB 1N65A 4FL2A 3C7IA 2VIFA 2WCKA 1IS0A 1EL4A 3RBUA 3KF9A 4BY5A 1FI5A 1B4CA 3EKJA 2LMUA 4YBHB 2PNBA 2H61A 1FMKA 3B6XA 1T14A 3S9KA 3LK1A 1FU5A 3LYVA 4TNCA 1GM0A 2EYYA 1XO5A 1OO4A 2CBLA 2M0RA 1O4OA 4OC2A 4NWGA 5ER4X 2SCPA 3DVKA 3EK8A 2LNKA 1A1EA 3O2PA 5CPVA 3BI0A 4YI9A 2ETZA 5HL1A 3K21A 1J7PA 3EG5B 2BL0C 5I2QA 2KBMA 1DTLA 2RGIA 2RMXA 1CDNA 2M1KB 2F33A 2K0JA 3D7GA 2E6WA 4QJ4B 2DM0A 3TS5C 5ER5A 2AAOA 1LKKA 1YUUA 1SL8A 2FOTA 1KCYA 1R2UA 2JYQA 3BOWA 2LHIA 1RFJA 1KK8B 3CR2A 2LANA 2M97A 2LNWA 4FBNA 4MRYA 4BPWB 1O4JA 2XPPA 3JVTB 3IQOA 4OHIA 3US4A 3B88A 3OB2B 5BPJA 3S0GA 4H34A 3D73A 1Y1AA 2DCRA 1C7VA 3IF7A 4XJKA 4CLNA 3S9MA 1K90D 1UHHA 1YVHA 1ALVA 2C6GA 1B8CA 1YTZC 2VKZG 3T04A 3BUXB 1KFUL 2LVIA 2QEBA 4WQ3A 1WDCB 2F8PA 1XK4C 3PSRA 4EY0A 2OR4A 4OKHA 1MW4A 2KAYA 1RK9A 1OMVA 4A4BA 4OC1A 3VS3A 1W7IB 2B4JC 3DVEA 2MLEC 3CBLA 3CZ1A 3S0EA 1ALWA 4JGHA 4P9ZA 4DUQA 4P5OE 4CPVA 1LCJA 2FCDA 1QIWA 1LINA 1EG4A 4P4FA 1F8HA 2BKIB 1GGZA 1AP4A 1SHDA 1SYMA 1S5GZ 2PNAA 1NRVA 5KAZA 1QIVA 1RWYA 1B47A 1IG5A 1A07A 1M45A 3M7FA 2KBIA 2SASA 3EVUA 3CABA 1KWOB 2OTGC 2Q91A 1DJXA 2LLUA 5HLOA 1MUXA 2R2IA 4MCRA 4HRGA 1NZLA 1RTP1 1IH0A 4P4BA 3IN7A 1V1FA 2HF5A 2M9GA 1PALA 3TDIA 1CM1A 2KYCA 1AK8A 1O4HA 2ZKMX 1B7TY 2WCFA 4OHLA 4X6SA 3AAKA 3S8OA 1SSEB 5KU1A 1CDMA 5HKWA 3UNWA 1MF8B 3I5GB 3R1PA 2KGYA 2L4HA 2JC2A 1TWOA 5D69A 1RQQC 4BY4A 3D78A 2MLFC 1C07A 4M4ZA 3DYEA 2KFGA 1BM2A 3PN7B 4NGNA 1C7WA 3TDZA 1BODA 1SKJA 1IWQA 1WRLA 3PFVA 5B8IB 4CFRA 1P13A 2PALA 1O49A 4I5NB 1NYAA 2HMHA 4MSPA 1AB2A 3PM2A 3HCMA 1QVIY 1OOFA 2K79B 1NWDA 2I18A 3QMEA 5CSJA 1QJTA 5G08A 1J1EA 2CIAA 3NHIA 4W9YA 3IN8A 3VRRA 2C6PA 4MZLA 2HETA 2GGMA 4ORAB 1C3ZA 3A8RA 2ZNEA 5AXIA 5DC0B 3B87A 4MCQA 3MXYA 4K44A 3WHTB 3GK1A 3O4YA 2EO3A 1JUOA 1YUSA 3D77A 1YURA 1DJYA 2G9BA 4N1GA 1CWEA 4AQIA 3L4LA 2EC6B 1BMBA 1PVBA 2H46E 2JQ6A 2WCMA 1Q80A 3B7AA 2JPTA 2CI9A 4JQ0D 5DF6A 3BUNB 1DF0B 1OMDA 2M1UA 4PHKA 3D74A 2V53A 2GTEA 2JWWA 3JTDC 1A08A 1AJ5A 2MJWB 1CKKA 1JFJA 1KFUS 1BT6A 2M29A 3SIAA 3DF0B 1B9AA 4NGSA 3PS5A 2QACA 3I5HC 5FYXA 1A75B 2KDHA 2QDIA 2E30A 2PMYA 4UPGA 1AD5A 1LKLA 1O4CA 1SW8A 2KAXA 4HRHA 2C0OA 3N8MA 2JTZA 2JT3A 4PE7A 1HQVA 1S6JA 4FTGA 2JULA 1SCMC 3SJXA 1FI6A 2ECDA 1BJFA 4GFTA 1GRIA 2PLDA 1O48A 1BFIA 4QJ3B 1SR6B 1TOPA 2KI4C 1F1WA 1SRAA 3CLNA 2LNXA 4AQJA 1L2OC 3CS1A 3GK2A 2CI8A 3NFQA 1UHIA 3SG3A 4X3RA 4MZKA 5I6VA 4JD9A 2IUGA 2MRJA 2JT8A 2L4IA 3MXCA 1XFVO 1KC2A 3BFHA 2Y1NA 3VROA 2YSXA 2JNFA 1A2XA 1TCEA 4GGNA 2EOBA 5FI7A 1P28A 1DJWA 5ELYA 4OC5A 2KHNA 1JSAA 2Y5IA 1O4RA 5FI6A 1OZOA 2P70A 2JZIA 3KFJA 3DVJA 1M27A 1IJ5A 2PQLA 2LMVA 1G4YR 1SPRA 1Z9EA 3N7YA 1J1DA 1TTXA 5F09A 1O4MA 1M39A 5GJHA 2BL0B 1FW4A 1D4TA 1CTRA 4IJ7A 1O4KA 1H8BA 2K7BA 1J7QA 2F2PA 3VRZA 3N7HA 2BCBA 1FBZA 1QCFA 1SHAA 3TS5B 1CNPA 2LLSA 2LCTA 1F4OA 1AHRA 1G83A 3IVTA 1KQMC 2PVVA 2DLZA 2OOTA 2LP2A 2COLB 4NGMA 1BHHB 3S0BA 3NHTA 4JKTA 1A09A 1O4IA 1LUMA 2HDXA 5I94A 1RPYA 2OQ1A 4GPLB 2VRGA 1R1QA 1DQEA 3SJEA 3SS5A 4MCSA 1KSOA 4D1EA 1K9UA 2FCEA 3EVRA 1Y1XA 2PVBA 3VB1A 2KNEA 4WWQA 1GGWA 5FI2A 4DS7A 3PT1A 1O4NA 4F5BA 2LVKA 5DICA 5BO4A 2L5XB 1D1OA 3PM8A 1IJ6A 3AKBA 4PHJA 1O4DA 2ZFDA 5DKRA 1AUIB 1NX1A 3BXMA 1K93D 1KSWA 1OQPA 2MK2A 4FL3A 3BXKA 1K9PA
chains in the Genus database with same CATH topology
1KWOB 4PCWA 3VS6A 2OTGC 1F70A 1KA6A 2Q91A 1S36A 1H9OA 5EHRA 1DJXA 2LLUA 5HLOA 4K11A 3NSIA 2FO0A 3SG4A 1MUXA 5KSZA 1GQMA 1VRKA 4IL1A 4ZCUA 1QLSA 2R2IA 1QADA 1F4QA 1R6PA 4DCKA 1CFPA 1BHFA 1NZVA 4HRGA 2Y1MA 2P6BB 3BUOB 1I3ZA 1X0NA 3OVEA 3E3RA 1NZLA 1RTP1 1Y6WA 1O41A 1IH0A 2BBMA 2F3YA 4M2QA 5DKQA 1A1BA 2K2FA 3LLEA 1DJZA 4FQOA 3VRYA 1NIWA 1DF0A 3IN7A 3I5GC 4WRIA 1V1FA 1IJRA 1DJIA 2BECA 2BBUA 2HF5A 1CMGA 2O5GA 1PSBA 2M9GA 3CR4X 3SIBA 2HCKA 1CWDL 1V1GA 2JOJA 3KO0A 2L6KA 5J3XA 1CFDA 5AERA 1H4BA 4N1FA 2EO6A 2GE9A 4ICBA 1WLMA 1NX3A 1PALA 1YVLA 2BE6A 1SL9A 2K2AA 3TDIA 1CM1A 3WXAA 2KYCA 3DF0A 2AOAA 4HREE 2OTGB 1AK8A 2ZKMX 1O4HA 2PSRA 4H1OA 2K7OA 1B7TY 2WCFA 4OHLA 1JYUA 4X6SA 1BKMA 1WY9A 3AAKA 2ISDA 1SY9A 3OX5A 2LV7A 3HIZB 3SG5A 2JTTA 3PN7C 4PHMA 3BOWB 4GGFA 3S8OA 2H5KA 2CTNA 1UHJA 5KU1A 1CDMA 3TL0A 1W7JB 5HKWA 3PALA 3VS5A 1NCZA 3EKHA 3CTNA 1MWNA 1DGUA 1ZFSA 2Q4UA 5JJGA 4NDBA 1MF8B 3I5GB 4YI8A 2RVFA 1FU6A 2Y3AB 2NXQA 3EK7A 4NDCA 4CIDA 1SBJA 2L4HA 2A4JA 3NSOA 1TNQA 4GBAA 1LUKA 5HYDA 1KK7Y 1QLKA 2JC2A 5HLVA 4R1EA 1UURA 3IQQA 1TIZA 2JXLA 2LVVA 2OS8C 5D69A 4BY4A 4DIRA 1RQQC 3GQIB 3PQZA 5TNCA 2MLFC 3DD4A 3TUYC 1SKTA 3A4UB 1C07A 3OV1A 3PSJA 5I8NA 1HCTB 2F3ZA 1UHNA 5HKYA 1JWOA 1SL7A 4M4ZA 5IBMA 2BBNA 1QASA 3VGOA 2KFGA 4JEGA 5CSIA 1BM2A 3HHMB 1QG1E 3PN7B 1BOCA 1XFYO 4E93A 1CB1A 2WORA 1C7WA 3RM1A 3TDZA 1XFZO 1YX8A 1WRKA 2KI6D 4XJKB 1BODA 1K2HA 2GV5A 1AYAA 1O4BA 1SKJA 1X6CA 2IUIA 1JU5A 5KTYA 4OV2A 3PJPA 2IUHA 5JOLA 5DC0B 3NSLA 1BLKA 1IWQA 3EAZA 4JPZB 5HKZA 2ABLA 1WRLA 1R1SA 3PFVA 1BFJA 5B8IB 5CSNA 4CFRA 2CS0A 1CDPA 1P13A 4HSZA 3D0YA 1O4LA 2HUWA 1LCKA 2PALA 2WC8A 3OHMB 3VRNA 1O49A 2EYVA 3H4SE 4I5NB 2C0TA 1NYAA 3HX4A 1B1GA 2HMHA 2OS8B 1F2FA 4MSPA 2DLYA 1AB2A 3BUWB 2EL8A 3HCMA 3IMDA 3TUYB 2DX0A 1PSRA 1QVIY 2KQ6A 3TDUA 1A1AA 2GSBA 4U17A 1HT9A 1SPSA 1M63B 1PK0D 2LCPA 2K79B 1NWDA 2MRKA 1FHSA 5AFPA 2M3WA 2KNOA 4GWFA 2I18A 1K95A 1WLZA 3D10A 2I7AA 3I5FC 2KK6A 4MEWA 1MILA 5CSJA 4GUKA 3PLFB 1NP8A 4GNKB 4YGBB 1QJTA 1JWDA 1LUIA 2DVJA 2IZVA 1Y0VH 2KGBC 3FIAA 3ICBA 5EHPA 2ZNDA 3CWGA 1J1EA 3AAJA 5G08A 2LHLA 2CIAA 3SG7A 1R1PA 2LUCA 3MAZA 1S5GY 1OZSA 1NSHA 2LLTA 3VRRA 3IN8A 3N84A 3QWXX 3FWBA 4MZLA 2JYQA 4F5AA 4NQGA 2KI6C 2HETA 2WCEA 2HPSA 2KYFA 1J55A 1TN4A 2AUGA 2EC6C 2GGMA 1SMGA 1U5IB 2MAZA 1AYDA 1YRUB 4ORAB 5PALA 4XZ0A 3UYOA 2GGZA 2OPOA 4MRXA 1S26D 1KFXS 1AYCA 3A8RA 1ZMZA 2ZNEA 2EYZA 5AXIA 1O4EA 2H8HA 4PE0A 1CDLA 2EHBA 1G8IA 4NDDA 1FPWA 2AMIA 1PICA 1S3PA 1EXRA 2I2RE 2ZN8A 1A81A 1NCYA 3MXYA 4LUDA 1AOUF 3US4A 4K44A 4JWQA 3C7IA 1OO3A 4MZJA 3WHTB 1CSYA 3VS7A 1S6CA 3GK1A 3MSEB 3OB1B 4MVFA 1OMRA 3I5FB 1RJVA 3O4YA 2CNPA 4U1PA 2LAPA 2O60A 4OCIA 2EO3A 1QV0A 1JUOA 3M0WA 1YUSA 2L50A 3NXAA 1A1CA 1FYRA 1E8AA 2JXCA 2PASA 1YURA 1DJYA 3VS1A 1IKUA 2G9BA 4N1GA 1CWEA 2BE4A 4AQIA 2L51A 2H2KA 4K2RA 4OHHA 3VS4A 2EC6B 1BMBA 3LCPC 1PVBA 3QRXA 2H46E 4P9VA 2JQ6A 4JE4A 1O4GA 2EGDA 4LUEA 3GOFA 1MR8A 1Q80A 2NCOA 4C0JA 1TRFA 1IGVA 4NWFA 2JPTA 2CI9A 2B1UA 3OP0A 4JQ0D 1PULA 4GGFC 4OVNF 1AYBA 3CXLA 5DC4A 1S6IA 5F6TA 3LL8B 1A75A 5DF6A 4DRWA 1FBVA 4YRUA 2L98A 1OPLA 1Z3KA 3BUNB 1DF0B 1EH2A 1OMDA 2M1UA 4PHKA 1KA7A 1O4PA 4CFQA 1OPKA 2YU7A 3EACA 2V53A 1K96A 1BLQA 5EG3B 2JWWA 1CLLA 3JTDC 3SJSA 2XP1A 1A08A 1AJ5A 2MJWB 3O78A 1QXPA 2KQYA 1CKKA 2WCBA 1KFUS 1JFJA 3DVMA 1BT6A 2M29A 3SIAA 3DF0B 4N5XA 3F45A 5IBWA 1CFCA 1IQ3A 1B9AA 3PS5A 4GL9E 1JC2A 2QACA 3I5HC 1ZUZA 5GJIA 4OHEA 1SR6C 5FYXA 1YX7A 1A75B 2WOSA 2KDHA 1BHHA 3SG6A 4M2PA 2EU0A 1MQ1A 4I5LB 4OHDA 2E30A 5EELA 2PMYA 4K45A 2TN4A 4UPGA 4YGEB 1AD5A 3NHNA 1LXFC 1B8RA 1LKLA 1O4CA 4EIHA 2JU0A 2K7DA 4L1BB 2NLNA 1SW8A 1RJAA 2RORA 2KAXA 2PRUA 4WQ2A 4HRHA 1CFFA 1XA5A 2C0OA 3ZNIA 3N8MA 3KHEA 4P2YB 2L0PA 2JTZA 4YGAA 1O45A 2JT3A 5CSFA 2KGRA 4PE7A 1CMFA 2AUCA 1HQVA 1S6JA 4FTGA 2IS9A 1SCMC 2JULA 3JTDB 1TNPA 4ORCB 1FI6A 2G2BA 1O43A 5IBSA 1DMOA 1ZACA 2ECDA 5CDWA 1BJFA 1M46A 4GFTA 1GRIA 2PTKA 2PLDA 1DVIA 1G33A 1SK6D 3EK4A 2MHHA 4PALA 1LUNA 2M8UA 1O48A 2HDVA 1XFXO 2F2OA 4PE4A 3S8LA 1BFIA 1K8UA 3BUMB 1N65A 1SR6B 4QJ3B 1D1ZA 4FL2A 1TOPA 2MRDA 1LKJA 2KI4C 1XFUO 1BMOA 1AVSA 1LVCD 1NUBA 1SRAA 2KAVA 4E68A 1EL4A 1IS0A 1F1WA 1Y1UA 2LMTA 3KF9A 1QV1A 2CXJA 2C0IA 1OSAA 2NZ0A 3CLNA 4AOMA 3BQ3A 1DT7B 1JBAA 1BR1B 2DOQA 4BY5A 1X27A 1FI5A 1IRJA 2LNXA 1B4CA 3EKJA 2LMUA 3O6BA 2L3TA 4AQJA 1LA3A 2QPTA 2LE9B 1L2OC 2NCPA 3CS1A 1YRTB 1XK4A 3GK2A 4YBHB 2CI8A 4C0LA 1HCSB 2MQIA 2PNBA 2VIFA 1UHIA 3BYAA 2H61A 3SG3A 1FMKA 1JF0A 3IMJA 2LC5A 3CZTX 4MZKA 2D8NA 1DGVA 1SCMB 1QTXA 3D0YB 2C9WA 5I6VA 3S9KA 3LK1A 4I5KA 1F55A 1FU5A 4TNCA 1IQ5A 2IUGA 2SHPA 2MRJA 2EYYA 1QX2A 2JT8A 2MA2A 1XO5A 3VRZA 2L4IA 2EKXA 3MXCA 1OO4A 1XFVO 2CBLA 1KC2A 1KSMA 3OX6A 2LQNA 2M0RA 3FS7A 4MBEA 3S8NA 2Y1NA 1MHOA 3KPXA 3VROA 2LM5A 1YR5A 4A4CA 1O4OA 2YSXA 2BCAA 4NWGA 2BCXA 2JNFA 1A2XA 5ER4X 2SCPA 1O4FA 3DVKA 3EK8A 2LNKA 1TCEA 4ETOA 4GGNA 1UWOA 3ZWHA 3O2PA 5CPVA 2K7CA 4BTFA 1A1EA 2EOBA 4DGXA 1DJWA 1MXEA 1QATA 4DGPA 1S1EA 1ZOTB 4YI9A 3K2MA 1L2OB 1N0YA 2ETZA 3K21A 2KHNA 1KK8C 1J7PA 4OR9B 1JSAA 1O42A 4MLWA 1QX7A 2Y5IA 3CR5X 1K9AA 2BL0C 2MBXA 1O4RA 5I2QA 2PLEA 4Q04A 1ZFPE 2HQWA 1TZEE 4QSYA 4TZIA 2KBMA 1DTLA 5D7FA 3TKZA 1OZOA 2Y4QA 2RGIA 1RECA 2JZIA 1XVJA 3FWCA 1BF5A 2CCMA 2RMXA 1A29A 1CDNA 2HQ8A 1BR4B 1L7ZA 1O4QA 1NPQA 1UUSA 3I5IC 1AJ4A 3VS0A 1WQUA 3KFJA 2KFFA 3DVJA 2KOTA 1M27A 1JF2A 2M1KB 2F33A 2L4KA 2K0JA 2OZOA 1O4AA 1TNWA 3AKAA 3JVTC 2E6WA 4QJ4B 1K9KA 1IJ5A 1QS7A 2DM0A 1WRZA 3TS5C 3NSKA 5I2LA 1KQVA 2LUXA 2AAOA 5ER5A 2I94A 1YUUA 4QJ5B 1LKKA 2LMVA 1TCFA 4F0ZB 1SL8A 1KFXL 2FOTA 1KCYA 1BU3A 1G4YR 1R2UA 1PRWA 1SNLA 2BKHB 2CT9A 2LHIA 3BOWA 1RFJA 1SPRA 1A4PA 3N7YA 1KK8B 1J1DA 3RLZA 1TTXA 1MXLC 1AOTF 1O4MA 1O47A 2K7AB 1M39A 3CR2A 2BL0B 4XYNA 1BG1A 2LANA 1FW4A 5GJHA 3VS2A 1B7TZ 3GK4X 4D8KA 4ORBB 2M97A 1F54A 1D4WA 1D4TA 1JFKA 1CTRA 1K94A 1CLBA 2LNWA 1TCOB 1FF1A 1J7RA 1TNXA 3CD3A 1O4KA 1Y57A 3PSKA 4FBNA 3I5IB 1QX5B 3LK0A 4MRYA 2MC1A 2M7NA 2LQWA 1WDCC 3WA4A 1O4JA 1H8BA 2K7BA 1NX2A 3JVTB 1J7QA 1XFWO 3IQOA 2F2PA 2M49B 2RSYA 4OHIA 3OB2B 2BCBA 1X02A 1FBZA 1QCFA 1SHAA 5BPJA 2CR4A 1GHUA 3TS5B 1CNPA 4H34A 2B3OA 3UF4A 1RROA 2LLSA 5DC9A 2LCTA 1F4OA 1AHRA 1G83A 3QWYA 2WNDA 4ZCVA 1BLJA 1KK7Z 1KQMC 1Y1AA 4C0KA 2DCRA 2DLZA 1C7VA 3IF7A 1B8LA 4XJKA 2LP2A 5DKNA 3HCKA 4CLNA 1XA6A 2COLB 1JYRA 1OOJA 1BHHB 3BKBA 3TZ1A 1DJGA 4PHNA 3PATA 1BKLA 1K90D 1A09A 1UHHA 1YVHA 3VRQA 1XYDA 3WNXB 1ALVA 1B8CA 1PVAA 1YTZC 5D0JA 3CGAA 1F71A 3I5HB 1O4IA 1JYQA 1DJHA 3T04A 1LUMA 1EG3A 4I5JA 2CRHA 3BUXB 2HDXA 1KFUL 2KFHA 2LVIA 1RPYA 4WQ3A 1WDCB 2F8PA 2OQ1A 4F59A 1XK4C 4GPLB 1NCXA 3PSRA 2JRFA 5GQQC 2VRGA 4L9MA 1R1QA 1GJYA 3WHUB 4EY0A 2H61C 4OKHA 1MW4A 2KAYA 1N2DA 1RK9A 3VRPA 1KSOA 4U8DA 2LP3A 1OMVA 2JT0A 4YGDB 4A4BA 5I2OA 4D1EA 4ROJA 3VS3A 1K9UA 2FCEA 1W7IB 3EVRA 4M2OA 3SG2A 1M31A 1CSZA 3DVEA 1Y1XA 1KQMB 2FCIA 2PVBA 2KNEA 2L2EA 2MLEC 3CBLA 3GXXA 4WWQA 1LA0A 2JNXA 1GGWA 1KWOC 1ALWA 4JGHA 4P9ZA 4PDZA 1QVIZ 5K89A 2QMSA 4DUQA 2K61A 2ZN9A 4P5OE 4DS7A 4CPVA 1LCJA 1U5IA 4YGCB 1OE9B 2KSPA 5AEQA 1O4NA 4PE1A 2FCDA 4F5BA 1QIWA 1UHKA 1LINA 3C1VA 1EG4A 5AANA 5EEQA 2LVKA 2ZRSA 3KEVA 1O46A 2AOBA 2SRCA 1F8HA 2BKIB 5BO4A 4MN0A 1GGZA 1NX0A 2KI4B 2L5XB 2ZRTA 1AP4A 1SHDA 1SYMA 3GXWA 4USLA 1D1OA 4GAOA 1CLMA 1EJ3A 3EVVA 1S5GZ 1SCVA 3PM8A 1ODBA 2PNAA 1IJ6A 1NRVA 3AKBA 2LVJA 4PHJA 5KAZA 1QIVA 1SHBA 1O4DA 2FJUB 1RWYA 2ZFDA 5AULA 1B47A 1YUTA 5DKRA 1AUIB 1CM4A 1IG5A 1NX1A 2K8MB 1UP5A 1SPYA 1CJ1A 1O44A 1K93D 2M7LA 1A07A 1M45A 1OQPA 1KSWA 2KBIA 1J7OA 3M7FA 2MK2A 1M61A 4FL3A 3BXKA 1K9PA 2SASA 1A03A 4XZ1A 3EVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KWO B;  4PCW A;  3VS6 A;  2OTG C;  1F70 A;  1KA6 A;  2Q91 A;  1S36 A;  1H9O A;  5EHR A;  1DJX A;  2LLU A;  5HLO A;  4K11 A;  3NSI A;  2FO0 A;  3SG4 A;  1MUX A;  5KSZ A;  1GQM A;  1VRK A;  4IL1 A;  4ZCU A;  1QLS A;  2R2I A;  1QAD A;  1F4Q A;  1R6P A;  4DCK A;  1CFP A;  1BHF A;  1NZV A;  4HRG A;  2Y1M A;  2P6B B;  3BUO B;  1I3Z A;  1X0N A;  3OVE A;  3E3R A;  1NZL A;  1RTP 1;  1Y6W A;  1O41 A;  1IH0 A;  2BBM A;  2F3Y A;  4M2Q A;  5DKQ A;  1A1B A;  2K2F A;  3LLE A;  1DJZ A;  4FQO A;  3VRY A;  1NIW A;  1DF0 A;  3IN7 A;  3I5G C;  4WRI A;  1V1F A;  1IJR A;  1DJI A;  2BEC A;  2BBU A;  2HF5 A;  1CMG A;  2O5G A;  1PSB A;  2M9G A;  3CR4 X;  3SIB A;  2HCK A;  1CWD L;  1V1G A;  2JOJ A;  3KO0 A;  2L6K A;  5J3X A;  1CFD A;  5AER A;  1H4B A;  4N1F A;  2EO6 A;  2GE9 A;  4ICB A;  1WLM A;  1NX3 A;  1PAL A;  1YVL A;  2BE6 A;  1SL9 A;  2K2A A;  3TDI A;  1CM1 A;  3WXA A;  2KYC A;  3DF0 A;  2AOA A;  4HRE E;  2OTG B;  1AK8 A;  2ZKM X;  1O4H A;  2PSR A;  4H1O A;  2K7O A;  1B7T Y;  2WCF A;  4OHL A;  1JYU A;  4X6S A;  1BKM A;  1WY9 A;  3AAK A;  2ISD A;  1SY9 A;  3OX5 A;  2LV7 A;  3HIZ B;  3SG5 A;  2JTT A;  3PN7 C;  4PHM A;  3BOW B;  4GGF A;  3S8O A;  2H5K A;  2CTN A;  1UHJ A;  5KU1 A;  1CDM A;  3TL0 A;  1W7J B;  5HKW A;  3PAL A;  3VS5 A;  1NCZ A;  3EKH A;  3CTN A;  1MWN A;  1DGU A;  1ZFS A;  2Q4U A;  5JJG A;  4NDB A;  1MF8 B;  3I5G B;  4YI8 A;  2RVF A;  1FU6 A;  2Y3A B;  2NXQ A;  3EK7 A;  4NDC A;  4CID A;  1SBJ A;  2L4H A;  2A4J A;  3NSO A;  1TNQ A;  4GBA A;  1LUK A;  5HYD A;  1KK7 Y;  1QLK A;  2JC2 A;  5HLV A;  4R1E A;  1UUR A;  3IQQ A;  1TIZ A;  2JXL A;  2LVV A;  2OS8 C;  5D69 A;  4BY4 A;  4DIR A;  1RQQ C;  3GQI B;  3PQZ A;  5TNC A;  2MLF C;  3DD4 A;  3TUY C;  1SKT A;  3A4U B;  1C07 A;  3OV1 A;  3PSJ A;  5I8N A;  1HCT B;  2F3Z A;  1UHN A;  5HKY A;  1JWO A;  1SL7 A;  4M4Z A;  5IBM A;  2BBN A;  1QAS A;  3VGO A;  2KFG A;  4JEG A;  5CSI A;  1BM2 A;  3HHM B;  1QG1 E;  3PN7 B;  1BOC A;  1XFY O;  4E93 A;  1CB1 A;  2WOR A;  1C7W A;  3RM1 A;  3TDZ A;  1XFZ O;  1YX8 A;  1WRK A;  2KI6 D;  4XJK B;  1BOD A;  1K2H A;  2GV5 A;  1AYA A;  1O4B A;  1SKJ A;  1X6C A;  2IUI A;  1JU5 A;  5KTY A;  4OV2 A;  3PJP A;  2IUH A;  5JOL A;  5DC0 B;  3NSL A;  1BLK A;  1IWQ A;  3EAZ A;  4JPZ B;  5HKZ A;  2ABL A;  1WRL A;  1R1S A;  3PFV A;  1BFJ A;  5B8I B;  5CSN A;  4CFR A;  2CS0 A;  1CDP A;  1P13 A;  4HSZ A;  3D0Y A;  1O4L A;  2HUW A;  1LCK A;  2PAL A;  2WC8 A;  3OHM B;  3VRN A;  1O49 A;  2EYV A;  3H4S E;  4I5N B;  2C0T A;  1NYA A;  3HX4 A;  1B1G A;  2HMH A;  2OS8 B;  1F2F A;  4MSP A;  2DLY A;  1AB2 A;  3BUW B;  2EL8 A;  3HCM A;  3IMD A;  3TUY B;  2DX0 A;  1PSR A;  1QVI Y;  2KQ6 A;  3TDU A;  1A1A A;  2GSB A;  4U17 A;  1HT9 A;  1SPS A;  1M63 B;  1PK0 D;  2LCP A;  2K79 B;  1NWD A;  2MRK A;  1FHS A;  5AFP A;  2M3W A;  2KNO A;  4GWF A;  2I18 A;  1K95 A;  1WLZ A;  3D10 A;  2I7A A;  3I5F C;  2KK6 A;  4MEW A;  1MIL A;  5CSJ A;  4GUK A;  3PLF B;  1NP8 A;  4GNK B;  4YGB B;  1QJT A;  1JWD A;  1LUI A;  2DVJ A;  2IZV A;  1Y0V H;  2KGB C;  3FIA A;  3ICB A;  5EHP A;  2ZND A;  3CWG A;  1J1E A;  3AAJ A;  5G08 A;  2LHL A;  2CIA A;  3SG7 A;  1R1P A;  2LUC A;  3MAZ A;  1S5G Y;  1OZS A;  1NSH A;  2LLT A;  3VRR A;  3IN8 A;  3N84 A;  3QWX X;  3FWB A;  4MZL A;  2JYQ A;  4F5A A;  4NQG A;  2KI6 C;  2HET A;  2WCE A;  2HPS A;  2KYF A;  1J55 A;  1TN4 A;  2AUG A;  2EC6 C;  2GGM A;  1SMG A;  1U5I B;  2MAZ A;  1AYD A;  1YRU B;  4ORA B;  5PAL A;  4XZ0 A;  3UYO A;  2GGZ A;  2OPO A;  4MRX A;  1S26 D;  1KFX S;  1AYC A;  3A8R A;  1ZMZ A;  2ZNE A;  2EYZ A;  5AXI A;  1O4E A;  2H8H A;  4PE0 A;  1CDL A;  2EHB A;  1G8I A;  4NDD A;  1FPW A;  2AMI A;  1PIC A;  1S3P A;  1EXR A;  2I2R E;  2ZN8 A;  1A81 A;  1NCY A;  3MXY A;  4LUD A;  1AOU F;  3US4 A;  4K44 A;  4JWQ A;  3C7I A;  1OO3 A;  4MZJ A;  3WHT B;  1CSY A;  3VS7 A;  1S6C A;  3GK1 A;  3MSE B;  3OB1 B;  4MVF A;  1OMR A;  3I5F B;  1RJV A;  3O4Y A;  2CNP A;  4U1P A;  2LAP A;  2O60 A;  4OCI A;  2EO3 A;  1QV0 A;  1JUO A;  3M0W A;  1YUS A;  2L50 A;  3NXA A;  1A1C A;  1FYR A;  1E8A A;  2JXC A;  2PAS A;  1YUR A;  1DJY A;  3VS1 A;  1IKU A;  2G9B A;  4N1G A;  1CWE A;  2BE4 A;  4AQI A;  2L51 A;  2H2K A;  4K2R A;  4OHH A;  3VS4 A;  2EC6 B;  1BMB A;  3LCP C;  1PVB A;  3QRX A;  2H46 E;  4P9V A;  2JQ6 A;  4JE4 A;  1O4G A;  2EGD A;  4LUE A;  3GOF A;  1MR8 A;  1Q80 A;  2NCO A;  4C0J A;  1TRF A;  1IGV A;  4NWF A;  2JPT A;  2CI9 A;  2B1U A;  3OP0 A;  4JQ0 D;  1PUL A;  4GGF C;  4OVN F;  1AYB A;  3CXL A;  5DC4 A;  1S6I A;  5F6T A;  3LL8 B;  1A75 A;  5DF6 A;  4DRW A;  1FBV A;  4YRU A;  2L98 A;  1OPL A;  1Z3K A;  3BUN B;  1DF0 B;  1EH2 A;  1OMD A;  2M1U A;  4PHK A;  1KA7 A;  1O4P A;  4CFQ A;  1OPK A;  2YU7 A;  3EAC A;  2V53 A;  1K96 A;  1BLQ A;  5EG3 B;  2JWW A;  1CLL A;  3JTD C;  3SJS A;  2XP1 A;  1A08 A;  1AJ5 A;  2MJW B;  3O78 A;  1QXP A;  2KQY A;  1CKK A;  2WCB A;  1KFU S;  1JFJ A;  3DVM A;  1BT6 A;  2M29 A;  3SIA A;  3DF0 B;  4N5X A;  3F45 A;  5IBW A;  1CFC A;  1IQ3 A;  1B9A A;  3PS5 A;  4GL9 E;  1JC2 A;  2QAC A;  3I5H C;  1ZUZ A;  5GJI A;  4OHE A;  1SR6 C;  5FYX A;  1YX7 A;  1A75 B;  2WOS A;  2KDH A;  1BHH A;  3SG6 A;  4M2P A;  2EU0 A;  1MQ1 A;  4I5L B;  4OHD A;  2E30 A;  5EEL A;  2PMY A;  4K45 A;  2TN4 A;  4UPG A;  4YGE B;  1AD5 A;  3NHN A;  1LXF C;  1B8R A;  1LKL A;  1O4C A;  4EIH A;  2JU0 A;  2K7D A;  4L1B B;  2NLN A;  1SW8 A;  1RJA A;  2ROR A;  2KAX A;  2PRU A;  4WQ2 A;  4HRH A;  1CFF A;  1XA5 A;  2C0O A;  3ZNI A;  3N8M A;  3KHE A;  4P2Y B;  2L0P A;  2JTZ A;  4YGA A;  1O45 A;  2JT3 A;  5CSF A;  2KGR A;  4PE7 A;  1CMF A;  2AUC A;  1HQV A;  1S6J A;  4FTG A;  2IS9 A;  1SCM C;  2JUL A;  3JTD B;  1TNP A;  4ORC B;  1FI6 A;  2G2B A;  1O43 A;  5IBS A;  1DMO A;  1ZAC A;  2ECD A;  5CDW A;  1BJF A;  1M46 A;  4GFT A;  1GRI A;  2PTK A;  2PLD A;  1DVI A;  1G33 A;  1SK6 D;  3EK4 A;  2MHH A;  4PAL A;  1LUN A;  2M8U A;  1O48 A;  2HDV A;  1XFX O;  2F2O A;  4PE4 A;  3S8L A;  1BFI A;  1K8U A;  3BUM B;  1N65 A;  1SR6 B;  4QJ3 B;  1D1Z A;  4FL2 A;  1TOP A;  2MRD A;  1LKJ A;  2KI4 C;  1XFU O;  1BMO A;  1AVS A;  1LVC D;  1NUB A;  1SRA A;  2KAV A;  4E68 A;  1EL4 A;  1IS0 A;  1F1W A;  1Y1U A;  2LMT A;  3KF9 A;  1QV1 A;  2CXJ A;  2C0I A;  1OSA A;  2NZ0 A;  3CLN A;  4AOM A;  3BQ3 A;  1DT7 B;  1JBA A;  1BR1 B;  2DOQ A;  4BY5 A;  1X27 A;  1FI5 A;  1IRJ A;  2LNX A;  1B4C A;  3EKJ A;  2LMU A;  3O6B A;  2L3T A;  4AQJ A;  1LA3 A;  2QPT A;  2LE9 B;  1L2O C;  2NCP A;  3CS1 A;  1YRT B;  1XK4 A;  3GK2 A;  4YBH B;  2CI8 A;  4C0L A;  1HCS B;  2MQI A;  2PNB A;  2VIF A;  1UHI A;  3BYA A;  2H61 A;  3SG3 A;  1FMK A;  1JF0 A;  3IMJ A;  2LC5 A;  3CZT X;  4MZK A;  2D8N A;  1DGV A;  1SCM B;  1QTX A;  3D0Y B;  2C9W A;  5I6V A;  3S9K A;  3LK1 A;  4I5K A;  1F55 A;  1FU5 A;  4TNC A;  1IQ5 A;  2IUG A;  2SHP A;  2MRJ A;  2EYY A;  1QX2 A;  2JT8 A;  2MA2 A;  1XO5 A;  3VRZ A;  2L4I A;  2EKX A;  3MXC A;  1OO4 A;  1XFV O;  2CBL A;  1KC2 A;  1KSM A;  3OX6 A;  2LQN A;  2M0R A;  3FS7 A;  4MBE A;  3S8N A;  2Y1N A;  1MHO A;  3KPX A;  3VRO A;  2LM5 A;  1YR5 A;  4A4C A;  1O4O A;  2YSX A;  2BCA A;  4NWG A;  2BCX A;  2JNF A;  1A2X A;  5ER4 X;  2SCP A;  1O4F A;  3DVK A;  3EK8 A;  2LNK A;  1TCE A;  4ETO A;  4GGN A;  1UWO A;  3ZWH A;  3O2P A;  5CPV A;  2K7C A;  4BTF A;  1A1E A;  2EOB A;  4DGX A;  1DJW A;  1MXE A;  1QAT A;  4DGP A;  1S1E A;  1ZOT B;  4YI9 A;  3K2M A;  1L2O B;  1N0Y A;  2ETZ A;  3K21 A;  2KHN A;  1KK8 C;  1J7P A;  4OR9 B;  1JSA A;  1O42 A;  4MLW A;  1QX7 A;  2Y5I A;  3CR5 X;  1K9A A;  2BL0 C;  2MBX A;  1O4R A;  5I2Q A;  2PLE A;  4Q04 A;  1ZFP E;  2HQW A;  1TZE E;  4QSY A;  4TZI A;  2KBM A;  1DTL A;  5D7F A;  3TKZ A;  1OZO A;  2Y4Q A;  2RGI A;  1REC A;  2JZI A;  1XVJ A;  3FWC A;  1BF5 A;  2CCM A;  2RMX A;  1A29 A;  1CDN A;  2HQ8 A;  1BR4 B;  1L7Z A;  1O4Q A;  1NPQ A;  1UUS A;  3I5I C;  1AJ4 A;  3VS0 A;  1WQU A;  3KFJ A;  2KFF A;  3DVJ A;  2KOT A;  1M27 A;  1JF2 A;  2M1K B;  2F33 A;  2L4K A;  2K0J A;  2OZO A;  1O4A A;  1TNW A;  3AKA A;  3JVT C;  2E6W A;  4QJ4 B;  1K9K A;  1IJ5 A;  1QS7 A;  2DM0 A;  1WRZ A;  3TS5 C;  3NSK A;  5I2L A;  1KQV A;  2LUX A;  2AAO A;  5ER5 A;  2I94 A;  1YUU A;  4QJ5 B;  1LKK A;  2LMV A;  1TCF A;  4F0Z B;  1SL8 A;  1KFX L;  2FOT A;  1KCY A;  1BU3 A;  1G4Y R;  1R2U A;  1PRW A;  1SNL A;  2BKH B;  2CT9 A;  2LHI A;  3BOW A;  1RFJ A;  1SPR A;  1A4P A;  3N7Y A;  1KK8 B;  1J1D A;  3RLZ A;  1TTX A;  1MXL C;  1AOT F;  1O4M A;  1O47 A;  2K7A B;  1M39 A;  3CR2 A;  2BL0 B;  4XYN A;  1BG1 A;  2LAN A;  1FW4 A;  5GJH A;  3VS2 A;  1B7T Z;  3GK4 X;  4D8K A;  4ORB B;  2M97 A;  1F54 A;  1D4W A;  1D4T A;  1JFK A;  1CTR A;  1K94 A;  1CLB A;  2LNW A;  1TCO B;  1FF1 A;  1J7R A;  1TNX A;  3CD3 A;  1O4K A;  1Y57 A;  3PSK A;  4FBN A;  3I5I B;  1QX5 B;  3LK0 A;  4MRY A;  2MC1 A;  2M7N A;  2LQW A;  1WDC C;  3WA4 A;  1O4J A;  1H8B A;  2K7B A;  1NX2 A;  3JVT B;  1J7Q A;  1XFW O;  3IQO A;  2F2P A;  2M49 B;  2RSY A;  4OHI A;  3OB2 B;  2BCB A;  1X02 A;  1FBZ A;  1QCF A;  1SHA A;  5BPJ A;  2CR4 A;  1GHU A;  3TS5 B;  1CNP A;  4H34 A;  2B3O A;  3UF4 A;  1RRO A;  2LLS A;  5DC9 A;  2LCT A;  1F4O A;  1AHR A;  1G83 A;  3QWY A;  2WND A;  4ZCV A;  1BLJ A;  1KK7 Z;  1KQM C;  1Y1A A;  4C0K A;  2DCR A;  2DLZ A;  1C7V A;  3IF7 A;  1B8L A;  4XJK A;  2LP2 A;  5DKN A;  3HCK A;  4CLN A;  1XA6 A;  2COL B;  1JYR A;  1OOJ A;  1BHH B;  3BKB A;  3TZ1 A;  1DJG A;  4PHN A;  3PAT A;  1BKL A;  1K90 D;  1A09 A;  1UHH A;  1YVH A;  3VRQ A;  1XYD A;  3WNX B;  1ALV A;  1B8C A;  1PVA A;  1YTZ C;  5D0J A;  3CGA A;  1F71 A;  3I5H B;  1O4I A;  1JYQ A;  1DJH A;  3T04 A;  1LUM A;  1EG3 A;  4I5J A;  2CRH A;  3BUX B;  2HDX A;  1KFU L;  2KFH A;  2LVI A;  1RPY A;  4WQ3 A;  1WDC B;  2F8P A;  2OQ1 A;  4F59 A;  1XK4 C;  4GPL B;  1NCX A;  3PSR A;  2JRF A;  5GQQ C;  2VRG A;  4L9M A;  1R1Q A;  1GJY A;  3WHU B;  4EY0 A;  2H61 C;  4OKH A;  1MW4 A;  2KAY A;  1N2D A;  1RK9 A;  3VRP A;  1KSO A;  4U8D A;  2LP3 A;  1OMV A;  2JT0 A;  4YGD B;  4A4B A;  5I2O A;  4D1E A;  4ROJ A;  3VS3 A;  1K9U A;  2FCE A;  1W7I B;  3EVR A;  4M2O A;  3SG2 A;  1M31 A;  1CSZ A;  3DVE A;  1Y1X A;  1KQM B;  2FCI A;  2PVB A;  2KNE A;  2L2E A;  2MLE C;  3CBL A;  3GXX A;  4WWQ A;  1LA0 A;  2JNX A;  1GGW A;  1KWO C;  1ALW A;  4JGH A;  4P9Z A;  4PDZ A;  1QVI Z;  5K89 A;  2QMS A;  4DUQ A;  2K61 A;  2ZN9 A;  4P5O E;  4DS7 A;  4CPV A;  1LCJ A;  1U5I A;  4YGC B;  1OE9 B;  2KSP A;  5AEQ A;  1O4N A;  4PE1 A;  2FCD A;  4F5B A;  1QIW A;  1UHK A;  1LIN A;  3C1V A;  1EG4 A;  5AAN A;  5EEQ A;  2LVK A;  2ZRS A;  3KEV A;  1O46 A;  2AOB A;  2SRC A;  1F8H A;  2BKI B;  5BO4 A;  4MN0 A;  1GGZ A;  1NX0 A;  2KI4 B;  2L5X B;  2ZRT A;  1AP4 A;  1SHD A;  1SYM A;  3GXW A;  4USL A;  1D1O A;  4GAO A;  1CLM A;  1EJ3 A;  3EVV A;  1S5G Z;  1SCV A;  3PM8 A;  1ODB A;  2PNA A;  1IJ6 A;  1NRV A;  3AKB A;  2LVJ A;  4PHJ A;  5KAZ A;  1QIV A;  1SHB A;  1O4D A;  2FJU B;  1RWY A;  2ZFD A;  5AUL A;  1B47 A;  1YUT A;  5DKR A;  1AUI B;  1CM4 A;  1IG5 A;  1NX1 A;  2K8M B;  1UP5 A;  1SPY A;  1CJ1 A;  1O44 A;  1K93 D;  2M7L A;  1A07 A;  1M45 A;  1OQP A;  1KSW A;  2KBI A;  1J7O A;  3M7F A;  2MK2 A;  1M61 A;  4FL3 A;  3BXK A;  1K9P A;  2SAS A;  1A03 A;  4XZ1 A;  3EVU A; 
#chains in the Genus database with same CATH topology
 1F70 A;  5EHR A;  3SS3 A;  1OOG A;  4K11 A;  2FO0 A;  5KSZ A;  4ZCU A;  1BHF A;  2Y1M A;  3BUO B;  3OVE A;  3E3R A;  2BBM A;  2F3Y A;  3LLE A;  1DJZ A;  1NIW A;  1DF0 A;  2BBU A;  2O5G A;  1PSB A;  3KO0 A;  2GE9 A;  4N1F A;  1YVL A;  3DF0 A;  2OTG B;  2K7O A;  1TUZ A;  2XEG A;  1WY9 A;  1SY9 A;  1NCZ A;  3CTN A;  1MWN A;  1ZFS A;  4NDB A;  1FU6 A;  3S0F A;  4CID A;  2QEV A;  2XPN A;  1EO0 A;  3IQQ A;  2FJY A;  2OS8 C;  3GQI B;  2WCJ A;  5TNC A;  3PQZ A;  3TUY C;  3A4U B;  3PSJ A;  2XPL A;  1UHN A;  1JWO A;  5IBM A;  3VGO A;  3HHM B;  4E93 A;  1CB1 A;  2WOR A;  3RM1 A;  1X6C A;  1O4B A;  3PJP A;  2ABL A;  1DEL A;  1O4L A;  2EYV A;  2BNX A;  3HX4 A;  1B1G A;  1F2F A;  2DLY A;  2DX0 A;  2GSB A;  1A1A A;  4U17 A;  1FHS A;  5AFP A;  2M3W A;  1QWV A;  1K95 A;  3I5F C;  1MIL A;  4GUK A;  3PLF B;  4YGB B;  2DVJ A;  3FIA A;  3AAJ A;  3MAZ A;  1S5G Y;  1OZS A;  2LLT A;  2KI6 C;  2WCE A;  2AUG A;  2KYF A;  2MAZ A;  3U88 C;  1YRU B;  4XZ0 A;  4MRX A;  2EYZ A;  1O4E A;  2H8H A;  1CDL A;  1FPW A;  1EXR A;  2ZN8 A;  1AOU F;  4OC4 A;  4JWQ A;  4OCI A;  4KYN A;  1FYR A;  1E8A A;  4JZ0 A;  2L51 A;  4OHH A;  3VS4 A;  3GOF A;  1MR8 A;  2NCO A;  4C0J A;  1TRF A;  1AYB A;  4GGF C;  4OVN F;  5DC4 A;  3LL8 B;  3FEE A;  1OPL A;  2PYQ A;  4CFQ A;  3EAC A;  3SJS A;  2KQY A;  3F45 A;  1IQ3 A;  1YX7 A;  1BHH A;  5D29 A;  4M2P A;  1MQ1 A;  4I5L B;  3FE9 A;  3HPG G;  4K45 A;  2JBK A;  4YGE B;  1LXF C;  2K7D A;  4L1B B;  2ROR A;  3ZNI A;  3KHE A;  4P2Y B;  4YGA A;  1CMF A;  3JTD B;  2KLE A;  1O43 A;  5IBS A;  1ZAC A;  5CDW A;  1SK6 D;  4PAL A;  2HDV A;  2M8U A;  1K8U A;  2MRD A;  1LKJ A;  1BMO A;  1NUB A;  3OAK A;  4E68 A;  4JYW A;  3R72 A;  1QV1 A;  2CXJ A;  2C0I A;  1OSA A;  1DT7 B;  1JBA A;  4AOM A;  2DOQ A;  3O6B A;  1LA3 A;  1YRT B;  1XK4 A;  2QEO A;  4C0L A;  3BYA A;  3IMJ A;  1JF0 A;  1DGV A;  1SCM B;  1QTX A;  3D0Y B;  2C9W A;  1Z8L A;  2SHP A;  1QX2 A;  2MA2 A;  2EKX A;  1KSM A;  3OX6 A;  2LQN A;  3K2T A;  3S8N A;  4A4C A;  3KPX A;  1YR5 A;  2BCA A;  2BCX A;  3D7F A;  4ETO A;  1UWO A;  3ZWH A;  2K7C A;  1MXE A;  1QAT A;  4DGP A;  1S1E A;  3K2M A;  1L2O B;  1N0Y A;  4OR9 B;  2MBX A;  2LRA A;  4Q04 A;  1ZFP E;  1TZE E;  2Y4Q A;  2QEH A;  3FWC A;  2HQ8 A;  1L7Z A;  5BY0 A;  1NPQ A;  1O4Q A;  3I5I C;  1AJ4 A;  3VS0 A;  2KFF A;  2KOT A;  2L4K A;  1O4A A;  1TNW A;  3AKA A;  1C3Y A;  1QS7 A;  3NSK A;  1KQV A;  4QJ5 B;  1TCF A;  4P4D A;  4F0Z B;  2KLD A;  1BU3 A;  2CT9 A;  5EL2 A;  1AOT F;  1O47 A;  4XYN A;  3GK4 X;  4D8K A;  1D4W A;  1JFK A;  1CLB A;  1TCO B;  3CD3 A;  1OW4 A;  1QX5 B;  3LK0 A;  3SJG A;  2M7N A;  3WA4 A;  1XFW O;  2CR4 A;  1X02 A;  3S0A A;  2B3O A;  4OZD A;  2WND A;  1KK7 Z;  3BFA A;  4C0K A;  1B8L A;  2CIJ A;  1DC1 A;  1DJG A;  3PAT A;  3O8Z A;  4F7F A;  3VRQ A;  1XYD A;  3WNX B;  1PVA A;  5D0J A;  1F71 A;  2CRH A;  4F59 A;  1W9Z A;  1NCX A;  2JRF A;  5GQQ C;  1GJY A;  2H61 C;  1ORG A;  1N2D A;  3VRP A;  4INW A;  4YGD B;  4ROJ A;  4M2O A;  3SG2 A;  1KQM B;  4MCP A;  2JNX A;  2P71 A;  5K89 A;  2PVW A;  1OE9 B;  2KSP A;  5EEQ A;  5AAN A;  3C1V A;  2ERB A;  2SRC A;  1NX0 A;  2ZRT A;  2XEI A;  3GXW A;  4USL A;  4GAO A;  1SCV A;  1ODB A;  2LVJ A;  1SHB A;  2FJU B;  1YUT A;  1O44 A;  1CM4 A;  1CJ1 A;  1UP5 A;  1SPY A;  1J7O A;  1M61 A;  4FQT A;  4XZ1 A;  3VS6 A;  1KA6 A;  1H9O A;  3NSI A;  3SG4 A;  1GQM A;  1VRK A;  1QLS A;  1F4Q A;  1R6P A;  1TUJ A;  4DCK A;  3S9N A;  2KPH A;  2P6B B;  3L4A A;  1O41 A;  4M2Q A;  5DKQ A;  1A1B A;  2K2F A;  4FQO A;  1IJR A;  2BEC A;  3BHX A;  1CMG A;  3CR4 X;  1CWD L;  1V1G A;  5J3X A;  2K2A A;  3WXA A;  2BE6 A;  2XEJ A;  2UV8 G;  1JYU A;  3CDN A;  1BKM A;  2ISD A;  2JTT A;  1LS8 A;  1UHJ A;  3TL0 A;  1W7J B;  3VS5 A;  1DGU A;  1Z2C B;  2Q4U A;  2Y3A B;  4YI8 A;  2NXQ A;  4NDC A;  2A4J A;  3NSO A;  1WJT A;  1LUK A;  3OGN A;  5HLV A;  4R1E A;  1UUR A;  1TIZ A;  2JXL A;  2LVV A;  3OV1 A;  1HCT B;  2F3Z A;  1SL7 A;  2BBN A;  1QAS A;  5CSI A;  1QG1 E;  1BOC A;  1XFY O;  1YX8 A;  2KI6 D;  1K2H A;  2IUI A;  3QWY A;  2GV5 A;  1AYA A;  1JU5 A;  2IUH A;  1OOH A;  2DLA A;  5HKZ A;  5CSN A;  2CS0 A;  1CDP A;  4HSZ A;  3D0Y A;  1LCK A;  2WC8 A;  3H4S E;  2C0T A;  2OS8 B;  3D7H A;  3IMD A;  3TUY B;  1PSR A;  2KQ6 A;  1SPS A;  1M63 B;  1PK0 D;  2KNO A;  2H8V A;  4GWF A;  1WLZ A;  2KK6 A;  4MEW A;  2IZV A;  1Y0V H;  1XFR A;  2ZND A;  3CWG A;  1R1P A;  3QWX X;  1NSH A;  1DEK A;  3FWB A;  4F5A A;  4NQG A;  2HPS A;  1J55 A;  1TN4 A;  1SMG A;  1U5I B;  1AYD A;  2YGU A;  2OPO A;  2AMI A;  1S3P A;  4LUD A;  4INX A;  1NCY A;  3VS7 A;  1S6C A;  3MSE B;  3SJF A;  3I5F B;  1QV0 A;  3M0W A;  3NXA A;  2K60 A;  2JXC A;  2PAS A;  3LCP C;  3BFB A;  3QRX A;  4JE4 A;  1O4G A;  2EGD A;  3OBV A;  1IGV A;  4NWF A;  2B1U A;  1PUL A;  1S6I A;  5F6T A;  1A75 A;  2N3A B;  1FBV A;  5F13 A;  1EH2 A;  1O4P A;  1KA7 A;  1K96 A;  1BLQ A;  3DZT A;  2WCH A;  4PT1 A;  1CLL A;  5EG3 B;  2XP1 A;  3O78 A;  1QXP A;  3RZS A;  4N5X A;  1CFC A;  4GL9 E;  1JC2 A;  5GJI A;  4OHE A;  3HPH E;  3SG6 A;  4LQG A;  2EU0 A;  4OHD A;  3NHN A;  1B8R A;  3D75 A;  4EIH A;  2NLN A;  1RJA A;  2PRU A;  4WQ2 A;  1CFF A;  1XA5 A;  1O45 A;  5CSF A;  2AUC A;  2IS9 A;  1M46 A;  1G33 A;  3EK4 A;  3CZ0 A;  2F2O A;  1D1Z A;  1XFU O;  1AVS A;  1LVC D;  2KAV A;  1Y1U A;  2LMT A;  2NZ0 A;  3BQ3 A;  1BR1 B;  1X27 A;  1IRJ A;  3NGV A;  2L3T A;  2QPT A;  2LE9 B;  2NCP A;  2MQI A;  1HCS B;  3PJI A;  2LC5 A;  3CZT X;  3UO9 A;  2D8N A;  4I5K A;  1F55 A;  1IQ5 A;  3FS7 A;  4MBE A;  1MHO A;  2LM5 A;  1O4F A;  3S9L A;  1Z4H A;  4DGX A;  4BTF A;  4OC3 A;  1ZOT B;  1KK8 C;  1O42 A;  4MLW A;  1QX7 A;  3CR5 X;  1K9A A;  2PLE A;  4QSY A;  2HQW A;  5D7F A;  3TKZ A;  4P4I A;  1REC A;  1XVJ A;  1BF5 A;  2CCM A;  1A29 A;  1BR4 B;  1UUS A;  1WQU A;  1JF2 A;  3CZ2 A;  2OZO A;  3JVT C;  1K9K A;  3R1V A;  2XPO A;  1WRZ A;  3BI1 A;  5I2L A;  2LUX A;  2I94 A;  1KFX L;  1SNL A;  2BKH B;  1PRW A;  1A4P A;  3RLZ A;  1MXL C;  2K7A B;  1BG1 A;  3VS2 A;  1B7T Z;  4ORB B;  1F54 A;  1K94 A;  1FF1 A;  1J7R A;  1TNX A;  1Y57 A;  3PSK A;  3I5I B;  2MC1 A;  2LQW A;  1WDC C;  1DE4 C;  1NX2 A;  2M49 B;  2RSY A;  1GHU A;  3IWW A;  1RRO A;  5DC9 A;  4ZCV A;  2WC6 A;  1BLJ A;  4BPX B;  5DKN A;  3FEC A;  3HCK A;  1XA6 A;  1JYR A;  1OOJ A;  3DY9 A;  3BKB A;  3TZ1 A;  4PHN A;  1BKL A;  3FED A;  3CGA A;  3I5H B;  1JYQ A;  1DJH A;  1EG3 A;  4I5J A;  2KFH A;  3FE6 A;  4OME A;  4L9M A;  3WHU B;  4U8D A;  2LP3 A;  5I2O A;  2JT0 A;  1M31 A;  3HMJ G;  1CSZ A;  2FCI A;  2L2E A;  4P45 A;  3DXL A;  2JBJ A;  3GXX A;  1LA0 A;  1KWO C;  4PDZ A;  1QVI Z;  2QMS A;  2K61 A;  2ZN9 A;  1U5I A;  4YGC B;  5AEQ A;  4PE1 A;  1UHK A;  2ZRS A;  3KEV A;  1O46 A;  2AOB A;  4MN0 A;  2KI4 B;  4NGP A;  1CLM A;  1EJ3 A;  3EVV A;  5AUL A;  3SS4 A;  2K8M B;  4P4E A;  2M7L A;  4P4J A;  1A03 A;  3VRY A;  4PCW A;  3L47 A;  1S36 A;  4RR2 B;  2L2C A;  4IL1 A;  1QAD A;  3V2L A;  1CFP A;  1NZV A;  4P44 A;  1X0N A;  1I3Z A;  1Y6W A;  3D76 A;  4NGR A;  3I5G C;  4WRI A;  3FF3 A;  1DJI A;  2HCK A;  3SIB A;  2L6K A;  2JOJ A;  4NGQ A;  1CFD A;  5AER A;  1H4B A;  2EO6 A;  4ICB A;  1WLM A;  1NX3 A;  4NGT A;  1SL9 A;  2AOA A;  4HRE E;  4H1O A;  2PSR A;  3F9K C;  3OX5 A;  2LV7 A;  3HIZ B;  3SG5 A;  3PN7 C;  4PHM A;  3BOW B;  4GGF A;  2H5K A;  2CTN A;  3PAL A;  3EKH A;  3KAS A;  2JPO A;  5JJG A;  2RVF A;  3EK7 A;  1SBJ A;  1TNQ A;  4GBA A;  5HYD A;  1KK7 Y;  1QLK A;  4DIR A;  3Q8I A;  3DD4 A;  1SKT A;  5I8N A;  4OC0 A;  5HKY A;  2C6C A;  4JEG A;  2XEF A;  1XFZ O;  4XJK B;  1WRK A;  5KTY A;  4OV2 A;  3B86 A;  5JOL A;  3NSL A;  1BLK A;  3EAZ A;  4JPZ B;  1R1S A;  1BFJ A;  2HUW A;  2BAP A;  3VRN A;  3OHM B;  3BUW B;  2EL8 A;  5D3O A;  3TDU A;  1HT9 A;  2LCP A;  2MRK A;  3D10 A;  2I7A A;  1LUI A;  1NP8 A;  4GNK B;  1JWD A;  2KGB C;  5EHP A;  3ICB A;  2LHL A;  3SG7 A;  2LUC A;  3N84 A;  2L5Y A;  2EC6 C;  3UYO A;  5PAL A;  3CYZ A;  2GGZ A;  1S26 D;  1KFX S;  1AYC A;  1ZMZ A;  3S0D A;  4TZI A;  3UF4 A;  4PE0 A;  4NDD A;  1PIC A;  2EHB A;  1G8I A;  2I2R E;  1A81 A;  1OO3 A;  4MZJ A;  1CSY A;  3OB1 B;  4MVF A;  1OMR A;  1RJV A;  2CNP A;  4U1P A;  2LAP A;  2O60 A;  2L50 A;  1A1C A;  3VS1 A;  1IKU A;  2BE4 A;  2WCL A;  2H2K A;  4K2R A;  4P9V A;  3K1E A;  4LUE A;  3OP0 A;  3CXL A;  4DRW A;  4YRU A;  2L98 A;  1Z3K A;  3D7D A;  1OPK A;  2YU7 A;  3O4X A;  2WCB A;  3DVM A;  1IIO A;  5IBW A;  1ZUZ A;  1SR6 C;  2WOS A;  5EEL A;  2TN4 A;  2JU0 A;  1CX8 A;  4BPU B;  2L0P A;  2KGR A;  4ORC B;  1TNP A;  3R1O A;  2G2B A;  1DMO A;  1OOI X;  2PTK A;  1DVI A;  3BJH A;  2MHH A;  3FE8 A;  1LUN A;  3S8L A;  1XFX O;  4PE4 A;  2WC5 A;  3BUM B;  1N65 A;  4FL2 A;  3C7I A;  2VIF A;  2WCK A;  1IS0 A;  1EL4 A;  3RBU A;  3KF9 A;  4BY5 A;  1FI5 A;  1B4C A;  3EKJ A;  2LMU A;  4YBH B;  2PNB A;  2H61 A;  1FMK A;  3B6X A;  1T14 A;  3S9K A;  3LK1 A;  1FU5 A;  3LYV A;  4TNC A;  1GM0 A;  2EYY A;  1XO5 A;  1OO4 A;  2CBL A;  2M0R A;  1O4O A;  4OC2 A;  4NWG A;  5ER4 X;  2SCP A;  3DVK A;  3EK8 A;  2LNK A;  1A1E A;  3O2P A;  5CPV A;  3BI0 A;  4YI9 A;  2ETZ A;  5HL1 A;  3K21 A;  1J7P A;  3EG5 B;  2BL0 C;  5I2Q A;  2KBM A;  1DTL A;  2RGI A;  2RMX A;  1CDN A;  2M1K B;  2F33 A;  2K0J A;  3D7G A;  2E6W A;  4QJ4 B;  2DM0 A;  3TS5 C;  5ER5 A;  2AAO A;  1LKK A;  1YUU A;  1SL8 A;  2FOT A;  1KCY A;  1R2U A;  2JYQ A;  3BOW A;  2LHI A;  1RFJ A;  1KK8 B;  3CR2 A;  2LAN A;  2M97 A;  2LNW A;  4FBN A;  4MRY A;  4BPW B;  1O4J A;  2XPP A;  3JVT B;  3IQO A;  4OHI A;  3US4 A;  3B88 A;  3OB2 B;  5BPJ A;  3S0G A;  4H34 A;  3D73 A;  1Y1A A;  2DCR A;  1C7V A;  3IF7 A;  4XJK A;  4CLN A;  3S9M A;  1K90 D;  1UHH A;  1YVH A;  1ALV A;  2C6G A;  1B8C A;  1YTZ C;  2VKZ G;  3T04 A;  3BUX B;  1KFU L;  2LVI A;  2QEB A;  4WQ3 A;  1WDC B;  2F8P A;  1XK4 C;  3PSR A;  4EY0 A;  2OR4 A;  4OKH A;  1MW4 A;  2KAY A;  1RK9 A;  1OMV A;  4A4B A;  4OC1 A;  3VS3 A;  1W7I B;  2B4J C;  3DVE A;  2MLE C;  3CBL A;  3CZ1 A;  3S0E A;  1ALW A;  4JGH A;  4P9Z A;  4DUQ A;  4P5O E;  4CPV A;  1LCJ A;  2FCD A;  1QIW A;  1LIN A;  1EG4 A;  4P4F A;  1F8H A;  2BKI B;  1GGZ A;  1AP4 A;  1SHD A;  1SYM A;  1S5G Z;  2PNA A;  1NRV A;  5KAZ A;  1QIV A;  1RWY A;  1B47 A;  1IG5 A;  1A07 A;  1M45 A;  3M7F A;  2KBI A;  2SAS A;  3EVU A;  3CAB A;  1KWO B;  2OTG C;  2Q91 A;  1DJX A;  2LLU A;  5HLO A;  1MUX A;  2R2I A;  4MCR A;  4HRG A;  1NZL A;  1RTP 1;  1IH0 A;  4P4B A;  3IN7 A;  1V1F A;  2HF5 A;  2M9G A;  1PAL A;  3TDI A;  1CM1 A;  2KYC A;  1AK8 A;  1O4H A;  2ZKM X;  1B7T Y;  2WCF A;  4OHL A;  4X6S A;  3AAK A;  3S8O A;  1SSE B;  5KU1 A;  1CDM A;  5HKW A;  3UNW A;  1MF8 B;  3I5G B;  3R1P A;  2KGY A;  2L4H A;  2JC2 A;  1TWO A;  5D69 A;  1RQQ C;  4BY4 A;  3D78 A;  2MLF C;  1C07 A;  4M4Z A;  3DYE A;  2KFG A;  1BM2 A;  3PN7 B;  4NGN A;  1C7W A;  3TDZ A;  1BOD A;  1SKJ A;  1IWQ A;  1WRL A;  3PFV A;  5B8I B;  4CFR A;  1P13 A;  2PAL A;  1O49 A;  4I5N B;  1NYA A;  2HMH A;  4MSP A;  1AB2 A;  3PM2 A;  3HCM A;  1QVI Y;  1OOF A;  2K79 B;  1NWD A;  2I18 A;  3QME A;  5CSJ A;  1QJT A;  5G08 A;  1J1E A;  2CIA A;  3NHI A;  4W9Y A;  3IN8 A;  3VRR A;  2C6P A;  4MZL A;  2HET A;  2GGM A;  4ORA B;  1C3Z A;  3A8R A;  2ZNE A;  5AXI A;  5DC0 B;  3B87 A;  4MCQ A;  3MXY A;  4K44 A;  3WHT B;  3GK1 A;  3O4Y A;  2EO3 A;  1JUO A;  1YUS A;  3D77 A;  1YUR A;  1DJY A;  2G9B A;  4N1G A;  1CWE A;  4AQI A;  3L4L A;  2EC6 B;  1BMB A;  1PVB A;  2H46 E;  2JQ6 A;  2WCM A;  1Q80 A;  3B7A A;  2JPT A;  2CI9 A;  4JQ0 D;  5DF6 A;  3BUN B;  1DF0 B;  1OMD A;  2M1U A;  4PHK A;  3D74 A;  2V53 A;  2GTE A;  2JWW A;  3JTD C;  1A08 A;  1AJ5 A;  2MJW B;  1CKK A;  1JFJ A;  1KFU S;  1BT6 A;  2M29 A;  3SIA A;  3DF0 B;  1B9A A;  4NGS A;  3PS5 A;  2QAC A;  3I5H C;  5FYX A;  1A75 B;  2KDH A;  2QDI A;  2E30 A;  2PMY A;  4UPG A;  1AD5 A;  1LKL A;  1O4C A;  1SW8 A;  2KAX A;  4HRH A;  2C0O A;  3N8M A;  2JTZ A;  2JT3 A;  4PE7 A;  1HQV A;  1S6J A;  4FTG A;  2JUL A;  1SCM C;  3SJX A;  1FI6 A;  2ECD A;  1BJF A;  4GFT A;  1GRI A;  2PLD A;  1O48 A;  1BFI A;  4QJ3 B;  1SR6 B;  1TOP A;  2KI4 C;  1F1W A;  1SRA A;  3CLN A;  2LNX A;  4AQJ A;  1L2O C;  3CS1 A;  3GK2 A;  2CI8 A;  3NFQ A;  1UHI A;  3SG3 A;  4X3R A;  4MZK A;  5I6V A;  4JD9 A;  2IUG A;  2MRJ A;  2JT8 A;  2L4I A;  3MXC A;  1XFV O;  1KC2 A;  3BFH A;  2Y1N A;  3VRO A;  2YSX A;  2JNF A;  1A2X A;  1TCE A;  4GGN A;  2EOB A;  5FI7 A;  1P28 A;  1DJW A;  5ELY A;  4OC5 A;  2KHN A;  1JSA A;  2Y5I A;  1O4R A;  5FI6 A;  1OZO A;  2P70 A;  2JZI A;  3KFJ A;  3DVJ A;  1M27 A;  1IJ5 A;  2PQL A;  2LMV A;  1G4Y R;  1SPR A;  1Z9E A;  3N7Y A;  1J1D A;  1TTX A;  5F09 A;  1O4M A;  1M39 A;  5GJH A;  2BL0 B;  1FW4 A;  1D4T A;  1CTR A;  4IJ7 A;  1O4K A;  1H8B A;  2K7B A;  1J7Q A;  2F2P A;  3VRZ A;  3N7H A;  2BCB A;  1FBZ A;  1QCF A;  1SHA A;  3TS5 B;  1CNP A;  2LLS A;  2LCT A;  1F4O A;  1AHR A;  1G83 A;  3IVT A;  1KQM C;  2PVV A;  2DLZ A;  2OOT A;  2LP2 A;  2COL B;  4NGM A;  1BHH B;  3S0B A;  3NHT A;  4JKT A;  1A09 A;  1O4I A;  1LUM A;  2HDX A;  5I94 A;  1RPY A;  2OQ1 A;  4GPL B;  2VRG A;  1R1Q A;  1DQE A;  3SJE A;  3SS5 A;  4MCS A;  1KSO A;  4D1E A;  1K9U A;  2FCE A;  3EVR A;  1Y1X A;  2PVB A;  3VB1 A;  2KNE A;  4WWQ A;  1GGW A;  5FI2 A;  4DS7 A;  3PT1 A;  1O4N A;  4F5B A;  2LVK A;  5DIC A;  5BO4 A;  2L5X B;  1D1O A;  3PM8 A;  1IJ6 A;  3AKB A;  4PHJ A;  1O4D A;  2ZFD A;  5DKR A;  1AUI B;  1NX1 A;  3BXM A;  1K93 D;  1KSW A;  1OQP A;  2MK2 A;  4FL3 A;  3BXK A;  1K9P A; 
#chains in the Genus database with same CATH homology
 1KWO B;  4PCW A;  3VS6 A;  2OTG C;  1F70 A;  1KA6 A;  2Q91 A;  1S36 A;  1H9O A;  5EHR A;  1DJX A;  2LLU A;  5HLO A;  4K11 A;  3NSI A;  2FO0 A;  3SG4 A;  1MUX A;  5KSZ A;  1GQM A;  1VRK A;  4IL1 A;  4ZCU A;  1QLS A;  2R2I A;  1QAD A;  1F4Q A;  1R6P A;  4DCK A;  1CFP A;  1BHF A;  1NZV A;  4HRG A;  2Y1M A;  2P6B B;  3BUO B;  1I3Z A;  1X0N A;  3OVE A;  3E3R A;  1NZL A;  1RTP 1;  1Y6W A;  1O41 A;  1IH0 A;  2BBM A;  2F3Y A;  4M2Q A;  5DKQ A;  1A1B A;  2K2F A;  3LLE A;  1DJZ A;  4FQO A;  3VRY A;  1NIW A;  1DF0 A;  3IN7 A;  3I5G C;  4WRI A;  1V1F A;  1IJR A;  1DJI A;  2BEC A;  2BBU A;  2HF5 A;  1CMG A;  2O5G A;  1PSB A;  2M9G A;  3CR4 X;  3SIB A;  2HCK A;  1CWD L;  1V1G A;  2JOJ A;  3KO0 A;  2L6K A;  5J3X A;  1CFD A;  5AER A;  1H4B A;  4N1F A;  2EO6 A;  2GE9 A;  4ICB A;  1WLM A;  1NX3 A;  1PAL A;  1YVL A;  2BE6 A;  1SL9 A;  2K2A A;  3TDI A;  1CM1 A;  3WXA A;  2KYC A;  3DF0 A;  2AOA A;  4HRE E;  2OTG B;  1AK8 A;  2ZKM X;  1O4H A;  2PSR A;  4H1O A;  2K7O A;  1B7T Y;  2WCF A;  4OHL A;  1JYU A;  4X6S A;  1BKM A;  1WY9 A;  3AAK A;  2ISD A;  1SY9 A;  3OX5 A;  2LV7 A;  3HIZ B;  3SG5 A;  2JTT A;  3PN7 C;  4PHM A;  3BOW B;  4GGF A;  3S8O A;  2H5K A;  2CTN A;  1UHJ A;  5KU1 A;  1CDM A;  3TL0 A;  1W7J B;  5HKW A;  3PAL A;  3VS5 A;  1NCZ A;  3EKH A;  3CTN A;  1MWN A;  1DGU A;  1ZFS A;  2Q4U A;  5JJG A;  4NDB A;  1MF8 B;  3I5G B;  4YI8 A;  2RVF A;  1FU6 A;  2Y3A B;  2NXQ A;  3EK7 A;  4NDC A;  4CID A;  1SBJ A;  2L4H A;  2A4J A;  3NSO A;  1TNQ A;  4GBA A;  1LUK A;  5HYD A;  1KK7 Y;  1QLK A;  2JC2 A;  5HLV A;  4R1E A;  1UUR A;  3IQQ A;  1TIZ A;  2JXL A;  2LVV A;  2OS8 C;  5D69 A;  4BY4 A;  4DIR A;  1RQQ C;  3GQI B;  3PQZ A;  5TNC A;  2MLF C;  3DD4 A;  3TUY C;  1SKT A;  3A4U B;  1C07 A;  3OV1 A;  3PSJ A;  5I8N A;  1HCT B;  2F3Z A;  1UHN A;  5HKY A;  1JWO A;  1SL7 A;  4M4Z A;  5IBM A;  2BBN A;  1QAS A;  3VGO A;  2KFG A;  4JEG A;  5CSI A;  1BM2 A;  3HHM B;  1QG1 E;  3PN7 B;  1BOC A;  1XFY O;  4E93 A;  1CB1 A;  2WOR A;  1C7W A;  3RM1 A;  3TDZ A;  1XFZ O;  1YX8 A;  1WRK A;  2KI6 D;  4XJK B;  1BOD A;  1K2H A;  2GV5 A;  1AYA A;  1O4B A;  1SKJ A;  1X6C A;  2IUI A;  1JU5 A;  5KTY A;  4OV2 A;  3PJP A;  2IUH A;  5JOL A;  5DC0 B;  3NSL A;  1BLK A;  1IWQ A;  3EAZ A;  4JPZ B;  5HKZ A;  2ABL A;  1WRL A;  1R1S A;  3PFV A;  1BFJ A;  5B8I B;  5CSN A;  4CFR A;  2CS0 A;  1CDP A;  1P13 A;  4HSZ A;  3D0Y A;  1O4L A;  2HUW A;  1LCK A;  2PAL A;  2WC8 A;  3OHM B;  3VRN A;  1O49 A;  2EYV A;  3H4S E;  4I5N B;  2C0T A;  1NYA A;  3HX4 A;  1B1G A;  2HMH A;  2OS8 B;  1F2F A;  4MSP A;  2DLY A;  1AB2 A;  3BUW B;  2EL8 A;  3HCM A;  3IMD A;  3TUY B;  2DX0 A;  1PSR A;  1QVI Y;  2KQ6 A;  3TDU A;  1A1A A;  2GSB A;  4U17 A;  1HT9 A;  1SPS A;  1M63 B;  1PK0 D;  2LCP A;  2K79 B;  1NWD A;  2MRK A;  1FHS A;  5AFP A;  2M3W A;  2KNO A;  4GWF A;  2I18 A;  1K95 A;  1WLZ A;  3D10 A;  2I7A A;  3I5F C;  2KK6 A;  4MEW A;  1MIL A;  5CSJ A;  4GUK A;  3PLF B;  1NP8 A;  4GNK B;  4YGB B;  1QJT A;  1JWD A;  1LUI A;  2DVJ A;  2IZV A;  1Y0V H;  2KGB C;  3FIA A;  3ICB A;  5EHP A;  2ZND A;  3CWG A;  1J1E A;  3AAJ A;  5G08 A;  2LHL A;  2CIA A;  3SG7 A;  1R1P A;  2LUC A;  3MAZ A;  1S5G Y;  1OZS A;  1NSH A;  2LLT A;  3VRR A;  3IN8 A;  3N84 A;  3QWX X;  3FWB A;  4MZL A;  2JYQ A;  4F5A A;  4NQG A;  2KI6 C;  2HET A;  2WCE A;  2HPS A;  2KYF A;  1J55 A;  1TN4 A;  2AUG A;  2EC6 C;  2GGM A;  1SMG A;  1U5I B;  2MAZ A;  1AYD A;  1YRU B;  4ORA B;  5PAL A;  4XZ0 A;  3UYO A;  2GGZ A;  2OPO A;  4MRX A;  1S26 D;  1KFX S;  1AYC A;  3A8R A;  1ZMZ A;  2ZNE A;  2EYZ A;  5AXI A;  1O4E A;  2H8H A;  4PE0 A;  1CDL A;  2EHB A;  1G8I A;  4NDD A;  1FPW A;  2AMI A;  1PIC A;  1S3P A;  1EXR A;  2I2R E;  2ZN8 A;  1A81 A;  1NCY A;  3MXY A;  4LUD A;  1AOU F;  3US4 A;  4K44 A;  4JWQ A;  3C7I A;  1OO3 A;  4MZJ A;  3WHT B;  1CSY A;  3VS7 A;  1S6C A;  3GK1 A;  3MSE B;  3OB1 B;  4MVF A;  1OMR A;  3I5F B;  1RJV A;  3O4Y A;  2CNP A;  4U1P A;  2LAP A;  2O60 A;  4OCI A;  2EO3 A;  1QV0 A;  1JUO A;  3M0W A;  1YUS A;  2L50 A;  3NXA A;  1A1C A;  1FYR A;  1E8A A;  2JXC A;  2PAS A;  1YUR A;  1DJY A;  3VS1 A;  1IKU A;  2G9B A;  4N1G A;  1CWE A;  2BE4 A;  4AQI A;  2L51 A;  2H2K A;  4K2R A;  4OHH A;  3VS4 A;  2EC6 B;  1BMB A;  3LCP C;  1PVB A;  3QRX A;  2H46 E;  4P9V A;  2JQ6 A;  4JE4 A;  1O4G A;  2EGD A;  4LUE A;  3GOF A;  1MR8 A;  1Q80 A;  2NCO A;  4C0J A;  1TRF A;  1IGV A;  4NWF A;  2JPT A;  2CI9 A;  2B1U A;  3OP0 A;  4JQ0 D;  1PUL A;  4GGF C;  4OVN F;  1AYB A;  3CXL A;  5DC4 A;  1S6I A;  5F6T A;  3LL8 B;  1A75 A;  5DF6 A;  4DRW A;  1FBV A;  4YRU A;  2L98 A;  1OPL A;  1Z3K A;  3BUN B;  1DF0 B;  1EH2 A;  1OMD A;  2M1U A;  4PHK A;  1KA7 A;  1O4P A;  4CFQ A;  1OPK A;  2YU7 A;  3EAC A;  2V53 A;  1K96 A;  1BLQ A;  5EG3 B;  2JWW A;  1CLL A;  3JTD C;  3SJS A;  2XP1 A;  1A08 A;  1AJ5 A;  2MJW B;  3O78 A;  1QXP A;  2KQY A;  1CKK A;  2WCB A;  1KFU S;  1JFJ A;  3DVM A;  1BT6 A;  2M29 A;  3SIA A;  3DF0 B;  4N5X A;  3F45 A;  5IBW A;  1CFC A;  1IQ3 A;  1B9A A;  3PS5 A;  4GL9 E;  1JC2 A;  2QAC A;  3I5H C;  1ZUZ A;  5GJI A;  4OHE A;  1SR6 C;  5FYX A;  1YX7 A;  1A75 B;  2WOS A;  2KDH A;  1BHH A;  3SG6 A;  4M2P A;  2EU0 A;  1MQ1 A;  4I5L B;  4OHD A;  2E30 A;  5EEL A;  2PMY A;  4K45 A;  2TN4 A;  4UPG A;  4YGE B;  1AD5 A;  3NHN A;  1LXF C;  1B8R A;  1LKL A;  1O4C A;  4EIH A;  2JU0 A;  2K7D A;  4L1B B;  2NLN A;  1SW8 A;  1RJA A;  2ROR A;  2KAX A;  2PRU A;  4WQ2 A;  4HRH A;  1CFF A;  1XA5 A;  2C0O A;  3ZNI A;  3N8M A;  3KHE A;  4P2Y B;  2L0P A;  2JTZ A;  4YGA A;  1O45 A;  2JT3 A;  5CSF A;  2KGR A;  4PE7 A;  1CMF A;  2AUC A;  1HQV A;  1S6J A;  4FTG A;  2IS9 A;  1SCM C;  2JUL A;  3JTD B;  1TNP A;  4ORC B;  1FI6 A;  2G2B A;  1O43 A;  5IBS A;  1DMO A;  1ZAC A;  2ECD A;  5CDW A;  1BJF A;  1M46 A;  4GFT A;  1GRI A;  2PTK A;  2PLD A;  1DVI A;  1G33 A;  1SK6 D;  3EK4 A;  2MHH A;  4PAL A;  1LUN A;  2M8U A;  1O48 A;  2HDV A;  1XFX O;  2F2O A;  4PE4 A;  3S8L A;  1BFI A;  1K8U A;  3BUM B;  1N65 A;  1SR6 B;  4QJ3 B;  1D1Z A;  4FL2 A;  1TOP A;  2MRD A;  1LKJ A;  2KI4 C;  1XFU O;  1BMO A;  1AVS A;  1LVC D;  1NUB A;  1SRA A;  2KAV A;  4E68 A;  1EL4 A;  1IS0 A;  1F1W A;  1Y1U A;  2LMT A;  3KF9 A;  1QV1 A;  2CXJ A;  2C0I A;  1OSA A;  2NZ0 A;  3CLN A;  4AOM A;  3BQ3 A;  1DT7 B;  1JBA A;  1BR1 B;  2DOQ A;  4BY5 A;  1X27 A;  1FI5 A;  1IRJ A;  2LNX A;  1B4C A;  3EKJ A;  2LMU A;  3O6B A;  2L3T A;  4AQJ A;  1LA3 A;  2QPT A;  2LE9 B;  1L2O C;  2NCP A;  3CS1 A;  1YRT B;  1XK4 A;  3GK2 A;  4YBH B;  2CI8 A;  4C0L A;  1HCS B;  2MQI A;  2PNB A;  2VIF A;  1UHI A;  3BYA A;  2H61 A;  3SG3 A;  1FMK A;  1JF0 A;  3IMJ A;  2LC5 A;  3CZT X;  4MZK A;  2D8N A;  1DGV A;  1SCM B;  1QTX A;  3D0Y B;  2C9W A;  5I6V A;  3S9K A;  3LK1 A;  4I5K A;  1F55 A;  1FU5 A;  4TNC A;  1IQ5 A;  2IUG A;  2SHP A;  2MRJ A;  2EYY A;  1QX2 A;  2JT8 A;  2MA2 A;  1XO5 A;  3VRZ A;  2L4I A;  2EKX A;  3MXC A;  1OO4 A;  1XFV O;  2CBL A;  1KC2 A;  1KSM A;  3OX6 A;  2LQN A;  2M0R A;  3FS7 A;  4MBE A;  3S8N A;  2Y1N A;  1MHO A;  3KPX A;  3VRO A;  2LM5 A;  1YR5 A;  4A4C A;  1O4O A;  2YSX A;  2BCA A;  4NWG A;  2BCX A;  2JNF A;  1A2X A;  5ER4 X;  2SCP A;  1O4F A;  3DVK A;  3EK8 A;  2LNK A;  1TCE A;  4ETO A;  4GGN A;  1UWO A;  3ZWH A;  3O2P A;  5CPV A;  2K7C A;  4BTF A;  1A1E A;  2EOB A;  4DGX A;  1DJW A;  1MXE A;  1QAT A;  4DGP A;  1S1E A;  1ZOT B;  4YI9 A;  3K2M A;  1L2O B;  1N0Y A;  2ETZ A;  3K21 A;  2KHN A;  1KK8 C;  1J7P A;  4OR9 B;  1JSA A;  1O42 A;  4MLW A;  1QX7 A;  2Y5I A;  3CR5 X;  1K9A A;  2BL0 C;  2MBX A;  1O4R A;  5I2Q A;  2PLE A;  4Q04 A;  1ZFP E;  2HQW A;  1TZE E;  4QSY A;  4TZI A;  2KBM A;  1DTL A;  5D7F A;  3TKZ A;  1OZO A;  2Y4Q A;  2RGI A;  1REC A;  2JZI A;  1XVJ A;  3FWC A;  1BF5 A;  2CCM A;  2RMX A;  1A29 A;  1CDN A;  2HQ8 A;  1BR4 B;  1L7Z A;  1O4Q A;  1NPQ A;  1UUS A;  3I5I C;  1AJ4 A;  3VS0 A;  1WQU A;  3KFJ A;  2KFF A;  3DVJ A;  2KOT A;  1M27 A;  1JF2 A;  2M1K B;  2F33 A;  2L4K A;  2K0J A;  2OZO A;  1O4A A;  1TNW A;  3AKA A;  3JVT C;  2E6W A;  4QJ4 B;  1K9K A;  1IJ5 A;  1QS7 A;  2DM0 A;  1WRZ A;  3TS5 C;  3NSK A;  5I2L A;  1KQV A;  2LUX A;  2AAO A;  5ER5 A;  2I94 A;  1YUU A;  4QJ5 B;  1LKK A;  2LMV A;  1TCF A;  4F0Z B;  1SL8 A;  1KFX L;  2FOT A;  1KCY A;  1BU3 A;  1G4Y R;  1R2U A;  1PRW A;  1SNL A;  2BKH B;  2CT9 A;  2LHI A;  3BOW A;  1RFJ A;  1SPR A;  1A4P A;  3N7Y A;  1KK8 B;  1J1D A;  3RLZ A;  1TTX A;  1MXL C;  1AOT F;  1O4M A;  1O47 A;  2K7A B;  1M39 A;  3CR2 A;  2BL0 B;  4XYN A;  1BG1 A;  2LAN A;  1FW4 A;  5GJH A;  3VS2 A;  1B7T Z;  3GK4 X;  4D8K A;  4ORB B;  2M97 A;  1F54 A;  1D4W A;  1D4T A;  1JFK A;  1CTR A;  1K94 A;  1CLB A;  2LNW A;  1TCO B;  1FF1 A;  1J7R A;  1TNX A;  3CD3 A;  1O4K A;  1Y57 A;  3PSK A;  4FBN A;  3I5I B;  1QX5 B;  3LK0 A;  4MRY A;  2MC1 A;  2M7N A;  2LQW A;  1WDC C;  3WA4 A;  1O4J A;  1H8B A;  2K7B A;  1NX2 A;  3JVT B;  1J7Q A;  1XFW O;  3IQO A;  2F2P A;  2M49 B;  2RSY A;  4OHI A;  3OB2 B;  2BCB A;  1X02 A;  1FBZ A;  1QCF A;  1SHA A;  5BPJ A;  2CR4 A;  1GHU A;  3TS5 B;  1CNP A;  4H34 A;  2B3O A;  3UF4 A;  1RRO A;  2LLS A;  5DC9 A;  2LCT A;  1F4O A;  1AHR A;  1G83 A;  3QWY A;  2WND A;  4ZCV A;  1BLJ A;  1KK7 Z;  1KQM C;  1Y1A A;  4C0K A;  2DCR A;  2DLZ A;  1C7V A;  3IF7 A;  1B8L A;  4XJK A;  2LP2 A;  5DKN A;  3HCK A;  4CLN A;  1XA6 A;  2COL B;  1JYR A;  1OOJ A;  1BHH B;  3BKB A;  3TZ1 A;  1DJG A;  4PHN A;  3PAT A;  1BKL A;  1K90 D;  1A09 A;  1UHH A;  1YVH A;  3VRQ A;  1XYD A;  3WNX B;  1ALV A;  1B8C A;  1PVA A;  1YTZ C;  5D0J A;  3CGA A;  1F71 A;  3I5H B;  1O4I A;  1JYQ A;  1DJH A;  3T04 A;  1LUM A;  1EG3 A;  4I5J A;  2CRH A;  3BUX B;  2HDX A;  1KFU L;  2KFH A;  2LVI A;  1RPY A;  4WQ3 A;  1WDC B;  2F8P A;  2OQ1 A;  4F59 A;  1XK4 C;  4GPL B;  1NCX A;  3PSR A;  2JRF A;  5GQQ C;  2VRG A;  4L9M A;  1R1Q A;  1GJY A;  3WHU B;  4EY0 A;  2H61 C;  4OKH A;  1MW4 A;  2KAY A;  1N2D A;  1RK9 A;  3VRP A;  1KSO A;  4U8D A;  2LP3 A;  1OMV A;  2JT0 A;  4YGD B;  4A4B A;  5I2O A;  4D1E A;  4ROJ A;  3VS3 A;  1K9U A;  2FCE A;  1W7I B;  3EVR A;  4M2O A;  3SG2 A;  1M31 A;  1CSZ A;  3DVE A;  1Y1X A;  1KQM B;  2FCI A;  2PVB A;  2KNE A;  2L2E A;  2MLE C;  3CBL A;  3GXX A;  4WWQ A;  1LA0 A;  2JNX A;  1GGW A;  1KWO C;  1ALW A;  4JGH A;  4P9Z A;  4PDZ A;  1QVI Z;  5K89 A;  2QMS A;  4DUQ A;  2K61 A;  2ZN9 A;  4P5O E;  4DS7 A;  4CPV A;  1LCJ A;  1U5I A;  4YGC B;  1OE9 B;  2KSP A;  5AEQ A;  1O4N A;  4PE1 A;  2FCD A;  4F5B A;  1QIW A;  1UHK A;  1LIN A;  3C1V A;  1EG4 A;  5AAN A;  5EEQ A;  2LVK A;  2ZRS A;  3KEV A;  1O46 A;  2AOB A;  2SRC A;  1F8H A;  2BKI B;  5BO4 A;  4MN0 A;  1GGZ A;  1NX0 A;  2KI4 B;  2L5X B;  2ZRT A;  1AP4 A;  1SHD A;  1SYM A;  3GXW A;  4USL A;  1D1O A;  4GAO A;  1CLM A;  1EJ3 A;  3EVV A;  1S5G Z;  1SCV A;  3PM8 A;  1ODB A;  2PNA A;  1IJ6 A;  1NRV A;  3AKB A;  2LVJ A;  4PHJ A;  5KAZ A;  1QIV A;  1SHB A;  1O4D A;  2FJU B;  1RWY A;  2ZFD A;  5AUL A;  1B47 A;  1YUT A;  5DKR A;  1AUI B;  1CM4 A;  1IG5 A;  1NX1 A;  2K8M B;  1UP5 A;  1SPY A;  1CJ1 A;  1O44 A;  1K93 D;  2M7L A;  1A07 A;  1M45 A;  1OQP A;  1KSW A;  2KBI A;  1J7O A;  3M7F A;  2MK2 A;  1M61 A;  4FL3 A;  3BXK A;  1K9P A;  2SAS A;  1A03 A;  4XZ1 A;  3EVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...