3VXSA

The complex between h27-14 tcr and hla-a24 bound to hiv-1 nef134-10(6l) peptide
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection
pubmed doi rcsb
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
molecule tags Immune system
source organism Homo sapiens
total genus 78
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxsA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3vxsA01
3H9ZA 3S5LA 1JVKA 2YPKA 5IR1A 1IZJA 3DXAA 5GSVA 4P48A 3K2MC 4NQCB 4G43B 3H3PH 2P8MA 2VLRD 3NCMA 3VMOA 1TMCB 2IBZX 2VXSL 2VR4A 3VFUB 5T1KA 3T2NH 3UO1H 1LO5A 1JPTL 1G7JB 3AS1A 5DA0B 4CN4A 1NQBA 2CUIA 1G7LB 1IAKB 1OPGH 4LDLB 5FYKE 1U8OB 4NOBA 5HYSB 2EXYC 3DYMA 4MA1B 3PDOA 1FNFA 3JUZA 2Y1VA 4JZJC 1D5ZB 3DX6A 3VI4F 2YSSB 1SEQH 3RWJB 4LIQH 3PL6B 4LVNB 4ZYKB 4KZDH 2JJVA 2J88H 2RAMA 4P2RD 2NY1C 1FLRL 4OQ1A 1BFVL 5MEQB 3VRJA 3G6AA 1EEYB 2CDFA 5AYUL 4QGTA 1JMZA 4DZ8A 4MVBD 5KJRL 3WNKA 1WBZA 4MCYA 3QR2A 3PWPE 1FYHB 4XXCC 2PYEA 3R8BB 5IVXE 1CLZH 3NGBB 4JKLA 2ZKHL 5JOFA 5FDWA 3NCJH 2AABL 1KJ3L 5I8KL 4DFIA 5MHSE 3Q6FA 3QZWG 3MJ7A 3VXQA 1HYSD 5IEHA 3IFNL 4WHCA 5T3ZL 4NFCA 3UTSB 4X6CB 3T09A 5KVFH 1R24A 1UB6A 2X70A 1MCNA 2GJ6D 3IFOA 2F54D 1ZHLA 2H32H 1X7QA 3PQYD 5I19H 1UEYA 3UTTA 3O6FA 2VLKE 4P2CG 3LEYH 1W0WA 3UTQA 3E3QC 3DVIA 4K55A 2X4TB 3DX7A 4K3HA 3R8QA 4MAUL 4NFBA 1YEEH 2YPLD 1HXMA 4QRQB 3UYOD 4AK1A 1A9BA 4GMSL 3QEGL 5E4EB 5BW7C 5BXFA 1YEKH 1M7DA 2VLJA 5D70L 2YD1A 4MJ2A 1NL0H 3NCYS 4RMVA 3PWVA 5GJSH 1H15B 5JDSA 3ULVF 4KJPD 1XGPA 3IDNA 1IILE 1W2KT 3MBXL 3BXNA 1EFXD 4P5TC 1MJJB 4E42B 3DO7A 4F37F 1A6ZB 3U83A 2YD5A 3MOQA 1XR9B 5DWUH 3OR7B 4MCZA 5IOPA 3GHBH 1T3FA 1NEZB 2A9NL 1ZV5A 1A6TA 4WCYH 3E0GA 5BZDB 1Q9LA 3E6HB 5K9KA 5HVWA 3GSUA 3HN3A 2BOCB 1D3CA 1XR8A 1FV1B 4L4VA 1FYTD 2Y36L 5EO1B 1ZT1A 4XRCA 3ALXA 3LMJH 1M7XA 4O2FB 3L9RA 2YN5A 1UH3A 5DJCA 2COQA 4FP8L 2AQ2A 1MIEL 3TCLA 1JGDB 3QH3B 2J3SA 5DJYA 2ITCA 5INCB 4QRTA 2EDDA 1L0XA 4PGBB 1H3UA 2FGWL 1MCPL 3U0TA 1D6EB 1NCBL 3QAZC 4K2UH 4OZGE 4X80H 4XAKD 3MYJA 3TYFB 4PUBH 1HINL 3LKNB 1FL3A 2V7HA 5FM5M 4U3CA 3IAPA 2IPTH 3UPRA 3C6SA 1H3TA 3QUYB 3ESVF 3S3PA 4MNGA 2QTEA 1TETL 4XZUB 1AE6L 5J7CC 4PRHB 3MROB 4RGOL 3EOBB 2EZ0C 5IHZA 2JELL 3FQXB 1UJ3A 4OZHF 1DBAH 1KJMA 1BD2E 3WSQL 1I1FA 5HYQB 1N5AB 1F3JB 4NM4L 2Z92B 5DYOA 2OTPA 1OARH 4EI5C 1K4DA 1TCMA 1LO0H 4J4PA 4DUVA 4M61A 4H5SB 1I3VA 4X4XA 1PG7W 4F37K 3OKDA 3SDXF 1MAML 3FONB 3OKLB 4M7JL 4U1LA 1FFPB 5TE7H 2V2WB 1P84J 3TBSA 1QSFA 3H6JA 4M7KL 3P4MA 2Z31D 3QI9C 5LGJB 1JFQH 3QQ4B 3EFDH 4P2QB 1CZ8L 5E6IB 5EU6B 4NBZB 3SGEI 15C8L 1T22B 2E3VA 4FG6C 4YBQC 4KDTA 5IVXA 1GC1C 4XP4H 3RVUC 2WUCH 2W59A 2Y06H 1AGDA 3BESR 3ZL4H 1YY9D 1TVHB 1T20A 4G59A 5DVMA 5ALCL 4PTUA 5J06A 5IIEB 1CDHA 4OV5A 2OS7A 4GAYB 4PR5B 3RHWF 2DM3A 1ES0A 4I0PA 3BKYL 2EIZB 4KRMB 1UADC 3S35X 5F21B 3CDYA 3SDYL 3QCTL 2K3TA 3IU4H 3B9KA 3GBNL 2B4CH 5DRWA 1CFBA 3O81A 1YMHB 3BI9X 5BVPL 5KN5A 1WFTA 1MJ8L 1QLEL 4M93C 1L8JA 2GT9B 1EV2E 5BOZG 1FE8L 1R3IL 4QRRA 3L7EB 3X14A 3HZKB 3VWJA 5BMFL 5C0CD 2ITDB 4PLJC 3V6BR 1RURL 2HTLD 3JWDL 2VN7A 5D9SB 2XKNB 1F4XL 2CLVB 2X89D 4BZYA 3B4NA 1MHEB 3BP5B 4LIQE 1B88A 5FYKL 4AM0B 5F6HJ 4GAGH 4XP1H 2VUYA 4WUUD 3IT8D 5D7JC 5CMAA 1VEMA 4BM7A 4U6YB 2UV3A 4HFUH 3GI9L 4HJ0D 3BD3A 2FHBA 3I9GL 1EJ6A 3EW3B 2OZ4H 3UPCA 1B6DA 1FRGH 3LKSA 2DDQL 2NX5B 4L5FL 4DUXA 5D7SH 3OB8A 4ODTL 4XBEH 3BZDA 1MH5A 2EXYD 4NRYB 4JVUA 2PXYB 2VITB 1ZSDA 4PJEF 1KLGB 1M1SA 5IBTL 2EH8H 1HHGB 2M1KA 2NW2A 3P4NB 3Q3GA 3VXMA 2MMXA 3VWKB 1U8JA 4M5ZH 2C7UA 3VD9A 2NXYB 2NY1D 5DRZB 5F3BA 3LCYA 3HE6A 4YAQA 4ONGL 1NCWH 5C0IA 2DLTA 1FFRA 5IK3A 4TVPH 1P7QD 1LNUA 3HI6L 3SKNA 5C0AE 1U8LA 1PGRB 1EHAA 3MRIA 1EGJH 4Y8AA 3TM6A 1UWGL 1DUZB 3UBXI 5JORB 4X9BA 4JM4H 2XTJC 4PRDB 2XRAH 3SQOH 4KKBC 3WUWB 1IEAB 4G6JL 2C26A 5TF1L 4JREB 5IB4B 2VDLL 5TQ0H 3HNSH 3LKRA 3P0GB 4QRSA 5IMKA 3S37L 2ZNWA 4EQ3A 5KSBE 4KVNL 5IMOB 1AC0A 4RAUA 4BELD 2XYCA 3ARXA 2BY1A 5KTEL 2ORBL 3IDMA 5AD0A 3CLFL 1LDPH 2DWEA 4OD2A 2APBA 1F4YL 5GRYA 3VFVA 5LQBL 2PW2B 3DIFA 2CKBA 3M17B 4JPIB 5FKAB 1CTNA 2DQCH 4OIIL 4M02A 1NJ9B 1SHMA 2Q7YA 3DGCR 2EO1A 5F88B 2BXYA 3STLA 3KR3L 5DJ6A 5SWSD 1GGYA 3ZSSA 1SY6L 5I1DB 4NGHL 3ZZ1A 1LK3H 5K59E 3BX7C 4N9OB 4M6OL 3V95A 3EHBC 2NY4B 3H7BB 2QQLH 3P9LA 4Y5XA 4PJCB 4ODHH 1MHHA 1NFDE 4OLVL 1FNGA 2P5WA 2XV6B 2UVEA 4LCWA 1NC2A 4P5TD 4QHNA 4S2SB 4WU7B 4NDMB 3DYPA 1OGAA 3GJEB 3SPVA 2JK5A 4HXAH 4M1GL 3MBEC 4JO4L 4IOIA 3FB8A 4MJ6A 2CR3A 5INDA 3P4OA 1NCDH 5C0GB 4KV5E 2H1PL 1J8HA 2X41A 1A14L 4JRYB 1I9IL 2OQJA 3O6LH 3GO1H 1Q9KA 5C09D 5F9JA 4CL7A 1IL1A 1CR9H 3R06A 5DD6B 2A77L 2AJXL 3U2SA 3G5XB 3QUMA 1G0XA 3MMEB 1RI8A 4PJ5E 4KQ4H 5LKNA 3JWDC 4FNLL 1NKRA 3HTLX 5E2UL 1T2JA 1R5WB 3MPCA 5IB2B 3CCHA 4IHOA 2ZG3A 1HWGB 5DJ2A 2VC2H 1EEZA 5L8KB 4H1LB 1G7MA 4HQQL 1TZGH 4WIQA 4X6EB 1FZKA 2DM2A 2VDQL 3SO5A 4U1NA 1IM9B 1FL5A 1AQDA 4YHLL 4JY4B 5HHPA 2YXFA 4KPHL 3MUZ1 2EZ0D 3OQ3B 3FQNB 4BKLB 2D03L 4F9LA 2NY3C 3KPRD 2JCCB 4XNUL 2JJSC 4GRWF 5LBSH 1OGTB 4QNPE 1S7WA 3AS0A 5DDHB 2GUOB 3UTZA 3WFCL 4EI5D 3INUH 3GSRA 2ERJB 2Y5EA 1BIHA 1MY5A 3OJMB 3ARFD 2FH8A 4MLIA 1MLBB 1FGNH 2UUDH 1M7IA 2CUMA 2H3NA 3X11A 5C0JA 4BSVB 3G08B 1G1YA 2IQ9H 4NN6B 4M3JA 4PJIE 3BQUD 4FG6D 4YBQD 4RRPG 3L3GA 1DZBA 2JB6B 3GKZA 3HPLA 3RVUD 2PR4L 4U49A 1J0YA 4NPYA 2YOCA 3S34H 4AG4H 3KPSE 3T2NL 3CX5K 1BECA 3UO1L 3BEVB 1LMKA 3QIBA 4U31A 3NPSB 1J1OL 1A0QH 5HXMA 4IM8A 3DBXB 4RISH 3MRFA 2XZQH 4XCNB 4Z7OE 4H25A 3IF1B 1CI5A 5HHMA 1F2QA 4JRWA 1CIUA 4YHPA 3MNWA 2E27H 3OF6A 1MVUA 4Y19A 4OJFL 1WV7T 1CS6A 3E6FA 1SM3H 5T3ZD 4LIQL 1VFAA 2R29H 5LWYH 4JFED 4ZUSB 5FUCE 3TV3H 4R97C 1F3DH 2VERN 5ISZE 1AFVH 1KFAH 3W0WB 4LRIA 1YEJH 1YMMA 2BNRD 1ZE3C 4LLVA 4V1DE 4X7CC 5F1SA 2W9EH 4XCFL 4MA3B 5JLZA 3I6KA 1NBQA 4RZCB 4R26H 1CLZL 4FTVA 1GVIA 3ZKXC 3EOAB 5D7JD 4MQSB 3NCJL 4LLUB 2NY5H 3Q2CA 5DZOA 5F7UA 1AD0A 4JO2H 3WO4C 4RWYH 3VFPB 3WN5A 1ZLWK 3W5NA 1KELL 1FZJB 3UAJC 1XH3A 2HN7B 3NN8B 3HZMB 1FHGA 4Y7MA 5KVFL 3P73B 1U3HD 3KJ4C 2F5BH 3S36L 2X4NB 4N0CC 2YRPA 3WJJA 1LEIA 2HJLA 3MLZH 4IIQA 1YN6A 1K5NB 1AO7E 3LEYL 4NN7B 4L4TB 3V5DB 3JZ7A 1FG2A 3LPGA 2GY5A 1NANH 1S7SB 2FX7H 4X7DC 3T4AA 1KG0A 4H26A 3I3EA 2CKNA 1YEKL 2RGSA 4PJ5A 1EAPA 4UNTA 1WC7A 1NL0L 5E1AB 1XGTB 1JWUB 4XNMA 1INDH 1FNLA 5MERA 3I6GA 1T03H 4TSAH 4DKEL 3GSOB 1A4KB 5IJKC 2ICWI 4OD3H 5IB3A 2XTJD 4LDEB 4Z78B 4KKBD 4FQQB 3P3YA 4YO0B 2GCYA 4AIXA 4EDXA 2AQ3A 2QEJA 3O4LB 2XXMB 4LL9A 5MENB 3UX9B 5AG9A 2ZCLL 1RZJL 1MPAL 3WJLA 5SWZA 2NYYC 1N59A 3D48R 3GHBL 5A3IC 1MFEL 1IKFH 5EPMA 4P5KB 5IHUH 4CUCA 4NRZB 1UB5A 1E4XI 5TPWL 1OTTD 2NNAA 3RAJH 4KUCD 4U1SA 1AGCB 3TBWB 4AIZA 4X98B 3HPJB 1MWAL 4Y5YC 3IDIA 2XTLA 3VCLA 1UZ8B 1Y6MR 2AJVH 4C56D 4X6BA 1AD9A 5MEPA 4XCYA 4LMQE 1I8MB 2OR9H 1IT9H 4LVHB 1ONQA 2C5DC 3EHBD 4NO3A 5D7LD 2OBGA 5JQ6H 5E5MA 2OI9C 2IPTL 1K2DB 5T33L 1JI1A 4JJ5A 4OZHB 1S9WA 1P9MC 4HCRL 3K0WA 3OKEB 1JFMA 2B20A 1CDUA 3I02B 4M1DL 4KVCH 2XIDA 5IHLB 1HXYB 2BK8A 3CUPB 4KJYB 2ESVB 3CH1B 1OT1A 4G9FD 5C2UB 1M6OB 4CNIA 1FO0L 3SDXB 1LO0L 4OTXH 2LV4A 5FUOH 1A1MA 3ROLA 3V0VA 1YNTB 2OZ4A 4ETYA 3MV8D 1MRCH 3LEVH 1B0GA 3OJ2C 2E8ZA 4DZBB 4E0RB 3U4AA 3T0EB 1W8OA 3EOTH 3V0WH 5E00B 3M8OL 4HS3A 3T3PE 4V1DA 2NXZB 3EFDL 4XHQA 3U30C 4FQ1H 4JO3L 2WWKT 2VUOA 3MJ8B 4GAFB 3MA7B 5GS1A 4JFFA 3FQRB 1GZQB 5HI3C 3U4EB 4XMLL 1FL6A 3SEPA 3ZL4L 1QLFB 1I8IA 3BE1H 4NHUE 2AXJA 3LN4A 4I3GA 4LSRH 4PGEA 1G6RB 1KB5A 5FYKD 2ZPKL 2CSPA 4KMLB 5ANME 4Y16C 2V9QA 1KBGH 1DVFD 2DIAA 2WMPA 3RWDA 2V9TA 2R9HC 3IU4L 2PW1A 5ID1A 4X4YA 2GK2A 2XZCL 4O00A 3QT2A 2GAZA 3QQ3A 4PDCE 4PLOB 3RPKA 1HSAB 3WNPA 3SCMA 2A6KA 2NY6B 3G5VB 4QYOA 4L29A 1QRNB 3D18B 4R96B 4R9HA 4U1HB 3C5ZB 1WLHA 5C9JB 3VH8G 4S11A 3W39A 4KRPC 4OGZA 2MOVA 2H6PA 4PS4H 1FFOB 2J8HA 4NQDA 4TVSa 5DFTA 1CDJA 3QDGA 4S1SH 3OHXB 1ETZB 4S0TD 4OLUH 5EOQL 1JPSL 1RK0B 1PG7X 3BZEB 5FGCE 4AENA 1PKQB 5F7NC 3V4PH 4TYUA 2VSDA 5C92A 1FRGL 4XCCH 4A6YB 1DN0B 1U41A 3EJJX 4G8GD 2G60L 3KXFD 1S5HB 5I18H 1MI5A 2AK4D 4PJEB 3GMRB 4XBEL 3GSNA 4EUPB 1RZJC 3P77B 3O3UN 3RX5A 3BPOB 3QEHA 2DQDL 4ORZC 4XNZC 4I4WB 3MACL 5IEKA 2W60A 4X9FA 3TESA 1RZ8A 2E9JA 4M5ZL 1VGKA 5CJXA 2RFXA 2EC9U 4XGZA 4OF5A 4KROC 1NCWL 3FAXA 2MKLC 5DGRA 1WICA 3VGGA 5BZWB 4HHAB 1EGJL 3B5GA 1G7HA 5EBLA 2WUBL 1IEBA 1PZ5B 2FRGP 5ID0B 1VGEH 5E8EB 4PG9B 3NIDE 1JK8A 5C9KA 1X5GA 1Z3GH 2X4PA 4JLRA 4MZ3A 5TF0A 4G8EB 4ORGA 3X3GL 4X4ME 4QHUA 1VB9A 3BKCL 5HPOA 4CW1A 5D7IF 5E6ZA 3PWLA 1U91B 4Y2DB 3T77B 3TBVB 3WS3B 2E7CA 2VDNH 4LP4A 4DVBB 3UAJD 1LP9F 4XP5L 1P1ZA 3LQZB 2ZSVB 4F15C 2NY0B 1T1ZA 2BVPB 3VE0A 3QIWB 2AEPH 4C4KO 4XNYH 3SDAC 1IEHA 2KZ1B 4ZOBA 3EFFB 1H5BC 1Q9WA 1AQKL 3DX9B 1R3KA 3I2CL 1NPUA 1NEUA 1S5IH 4U05A 4KJQC 1H9VA 3OKMA 2C3VB 2Z91A 1D7FA 1L9NA 3KPNB 1DE4B 4BK4A 1EFQA 3D87B 2V2TA 1MCWM 1DFBH 8FABA 3Q1SH 2R56H 2DMCA 4XWGH 4YH6A 43CAA 5DEFB 3SBWC 4Z18A 3QEUB 4ODHL 4MQXD 3LZFH 4PJDF 3U30B 5E9DA 3W82A 5ESVA 3V52H 2BSRB 5D93B 1BD2D 2CDEB 3MRHB 5CEXB 1CG9A 5DI8A 2UY6A 3DHMA 3WIHL 3FN3A 1QBAA 4HXAL 4UT7H 2NYYD 3QHFL 5A3ID 3TA3C 4HUVB 2IH3A 4PJFA 4Z7WF 4GSDL 5L6YL 1LE5A 4WY7H 4PJBF 4Y16B 4OLXL 2MHAB 3JTCA 4X8JB 2AQ1A 1KCUH 3LEXB 3O6LL 3D85A 4O4YH 2XOTA 4ESKA 4JFHE 1KJ2A 5CILL 5JUEH 1P4BH 1QHOA 4PYHA 3NCEB 4U1KA 2DQGH 5TQ2H 3RY5A 1FJ1B 5JW4Q 3EYOB 3WNMA 3MV01 3I85A 1QBBA 4M7ZB 2MTPA 1D9KD 4PJ7F 4QOKB 3NFPB 5ESAA 3UXFA 4RX4D 1T21A 4Y2OA 1INQA 3L7FB 4U33A 3EO9H 1KC5H 4KRPB 5L0QC 4P23B 5J0BA 1XIWA 4H20H 2FHCA 5CWSA 4GRWB 5T1LD 4WWID 2OSLB 4P57A 4DKFH 1RIUH 5I1GL 2V7NA 3KYMA 3FO0L 1WT5A 2P5EB 2GK0B 4YDKL 4HFWA 3INUL 3TIDA 2DYPD 1X5AA 4P9HH 5EC2A 1AGBA 4PJAE 1DBKH 5K93A 3MRQA 4JANA 2Y4SA 3SDDC 1FGNL 4BFGA 1KGCD 4PRIB 1JGUH 2OTWB 5D1QC 5EOTB 4MD0B 3WKML 5F7EL 4DWHA 3HR6A 4ZD3H 2IQ9L 1MNUL 2VMFA 2QSQA 3DGGB 4R7NA 3DUUB 1OWRM 5HI3D 4LPVA 5J9PA 4ZXBD 6CGTA 3FOLA 1JNLL 4LU5L 3TPKA 2VDPL 1A0QL 2C3WA 1YEGL 2XZQL 4YHIA 3U9UB 3VFOB 5JPMA 1OAYL 1OL0A 1VPOL 3O3AB 4HIJB 3D3VE 2O26U 2WBJD 4WFEE 5T5FH 2VWEE 5HVGB 4GQ9H 1I85A 3S35L 3PIQA 3QQNA 1A7RL 4PBWD 5LWYL 2OP4H 3BJLA 4HKBA 1AFVL 5JZ7C 3L3HA 5C0AD 1NAMH 3HI5H 3VDCA 4UB0H 4ZAKD 1A7NL 1U8IA 2DQFB 3IDUA 4TQEH 1H5BB 2CMRH 4RGMC 1HHIA 1J86A 2DTML 4I3SH 1KOAA 5I76A 5CHNA 3MCKB 2FL5B 4HKZB 5KBNC 1N3NA 4E41B 2Q8AL 1GAFH 3T1FB 4LKCB 2BNQE 3VXRB 1RPQA 4XTRC 3TWCH 3NIGF 1FVEB 1L6ZA 1U58A 3FHQA 5EIIB 2B1HH 5TFSH 3VXUA 5F9AC 2KPNA 4BFEA 1C5BL 4QTIH 3NH7H 1CT8A 3TBYA 1LD9B 2GJ6B 1TPXB 4OBSA 5IVOA 4LOUD 4X5WA 1PG7H 7CGTA 2E5EA 2JIXD 5DTFB 4LF3A 4GRLD 3RKDC 2A1WL 3U0PB 5FM5O 4QRPB 3UBXB 2WIIB 4RA0C 3MZTA 4UIMA 3QA3A 3IFPB 2H9GA 3FOMB 3G9VA 4HJGA 3DMMC 4ZUTA 2FX7L 3FRPG 2UWEF 5J56B 2VQ1B 3D69B 4KROD 1N2RB 3VRIB 4OCXH 5C0BD 2XPGA 1ZLSH 1INDL 1G7PB 2FZ3B 4JFXB 1T03L 2X09A 5GIRA 2RR3A 4WJ5B 2FX9L 4OD3L 3MLUL 3QNZB 4FQPA 4ODXA 3PDDA 5D2LE 1F3RB 3ARBB 3JVGC 1RIHH 3CFEA 3L3DB 4LCUB 3CDCA 4PJ8C 1AHWB 3DUHA 4LPYA 4FZ8H 3GRWH 4EVNB 4Z0BH 3HR5A 2J8OA 5JHLH 4NZUH 5IF0A 1L6XA 3RZWA 4Z6AT 2EDHA 5JOEA 1FYTB 4QWWC 2LU7A 4MNQD 1ODAA 4NSKA 1BX2A 1YJDH 3SDAD 2VKWA 4HDIA 5DHYA 3D39B 3GMLB 1MFBH 5F7DA 2I60L 1CD0A 2DMKA 1NDMA 2YKLL 3WDJA 4UINH 4APQC 4HWZA 1IT9L 1YDPB 5I1EL 3OKKB 1JN6A 4HX1B 2WINB 1XCQB 3KLAA 3KYOB 1CWVA 1TVBB 4LAQH 5HDBE 4LEOB 2FR4A 3TBTB 2EDFA 4RFNC 5D96C 1KUMA 2EICA 1NFIB 4YX2H 1YY8A 4NNYA 4RMQA 1URLA 2LAAA 5A16A 3RIFK 3RDTB 4OLZH 3TA3D 2R2EA 3EAKA 2ZZUT 4XC3H 4Y4KB 1SBSH 4O51B 5FUOL 1S7TA 3MC0A 1FPTH 1A8JH 3HZYA 4JHBA 4QTHB 3CXHK 3V0WL 3EOTL 4KRLB 3DVGB 3MLPA 2DJ4A 3DX8B 1D5MB 1QQDA 5L2KE 4FQ1L 5EU5A 5C07B 5IVZB 2W9DH 4P3CH 3KPSD 4JQVC 2JJUA 2G9HB 2V5RA 3VFNB 4YC2B 5DUBA 1S7RB 2DQIL 3BE1L 5L88L 3X3FL 4K3EH 4LSRL 4NQCA 3HS0B 5GS0H 4G43A 4EN3C 3SDCC 1MRFH 1WZMA 2X1XR 3OXSB 1KXTB 5GJTH 4WNQB 4HWUA 4R7DB 3VFUA 1MRDH 1RAMA 2FD6H 2HP4A 1U0QA 2MPAH 4WFGE 1CK0L 2L0DA 25C8H 2EO9A 4KAQL 1IAKA 1OF2A 1U8NB 1OOAA 4G6MH 1WIPA 5HYSA 3BDBA 5C0CB 4GKSB 2I24N 4CVZB 7FABH 2QADB 1D5ZA 5DQ9A 1S7UA 2YSSA 3TCXA 4IDLA 3PL6A 2AEQH 5F7MC 3L3IA 4FQXC 3SDDD 3DTXB 5FYJU 2DM7A 4FRWA 5IVXF 4NP4L 5D1QD 5D1XC 2EDYA 4JE4B 4YUEL 2EIDA 5AG8A 4MJ5B 4LPCA 3TF7A 1EEYA 5T3XH 4WUUB 4P9ML 4BH8B 1ACZA 5DMYA 3VW3H 4MZ2A 2GSIB 5K9QG 3QRGH 4XBGB 2F8VA 4PS4L 4OFVA 4S1SL 4L3CA 1ED3A 3QZWB 2QR0A 1UYWH 4Z76B 1XGQB 3OJDA 5FM4A 3V4PL 4Y1AB 3DROA 3GIZL 1YC8A 1QR1B 2WQRA 2IANB 4HPYH 5CJQH 3EJYC 5I18L 1KCRH 3NMEA 5EC1B 1AO7D 2DQEH 3SGDI 5JW5B 4YDLB 3DSFL 5I8OH 1JGLH 1QZ1A 1SYVB 5HGAB 3H42L 2ZUXA 1KIPB 2IJ0C 3HMWL 3OZ9H 3DHJA 4JVWA 2D4DA 1BFTA 2VL5B 1DQDL 4DVRL 3TNNA 3D0LB 4L3EB 3N85L 4QRQA 5E95B 5T1MB 2FNBA 3EYFA 3QDJD 1RHHB 1Z3GL 5D7IB 4ZS6C 2YK1H 1YUHB 4YHMH 1H15A 3Q5OA 5IFJA 1MLCA 3MRNB 1AXTH 5JA8B 5A2FA 2XICA 3BKJH 3UZEA 1D5IL 1MJUH 1TFHA 3ME0A 4GBXA 4TTDD 4F7TB 3VD3A 4Z5RB 1S9VB 1A2YB 2VIRB 3OKOB 4NHCH 4NO0D 1U8PA 2AEPL 4V2BA 3X12B 1KT2A 1MCIA 3RKDD 5E5RB 1EUUA 1NEZA 1QFWL 2C4XA 5BZDA 2ICWB 1OAUL 1S5IL 2BOCA 2CLRB 5DFVC 5SWSB 3DMMD 4QHLB 1DQML 1JHTB 1FSKC 3S96A 4OT1H 5GGTA 3Q1SL 2R56L 4UMGA 4OZGF 4JY5H 3NIFF 4XWGL 4ODWB 1JGVH 4U7SA 4PJDB 1WK0A 3VXNB 1JGDA 4JZNB 5EBWB 2HKHH 3OAYK 2IALA 3QH3A 5EBGA 3HRZB 4X5XA 1F97A 4WW1B 4PRPB 4WFFE 1IAOB 1LEGB 1T5WB 3IS1X 3TZVB 2C1PA 4CDHA 3C60B 4PGBA 3ZKMC 2HT3C 3TYFA 3HMXA 5KVMC 1WZLA 4PJ8D 3ALWA 4Z7WB 2FYYB 2VLLB 1A6PA 4UT7L 3TPUA 1CGVA 3QUYA 4PJBB 4EJ1C 3FRUB 4S10A 3T3ME 3OAUL 5TGBA 3EOBA 3KVQA 3G6JE 5FV2A 4QWWD 3B9AA 4GW5B 1TIUA 1NDGA 3TNMB 1EA9C 5HYQA 1QSEE 1DTUA 3EZJB 1N5AA 1GGCH 1F3JA 4O02H 2Z92A 4WI7A 1Q9OB 4FHBD 5JUEL 1I7UB 3CAFA 4IJ3C 5E8PB 1IRAY 1T89A 1KCKA 1QUNA 1IQWL 4PJ7B 1MCWW 4N90D 5EOCH 1J1XH 4ZS7L 1SJHB 3QQ4A 1RZKH 3O6FC 5E6IA 2DQHH 1T22A 4WUKH 4W4OA 1OCWH 1IC7H 4GXVH 1WWBX 1LQVA 1KV3A 2LE9A 1ZLVH 3TO2B 3CX2A 1TVHA 3MNZB 2GTWB 2NCMA 5TE6H 4XNQB 5IIEA 2ICCA 4GAYA 3RGVD 3D1MC 4DKFL 1RIUL 1F8TH 3BPCB 2EIZA 4YGVB 3IXTB 3AC0A 4J1UB 3ARFB 1FBIH 1WZ1H 2FEDC 2Q86B 1JHLH 2YHGA 1YMHA 2EDWA 2OJEB 4DTGH 1CLYH 1QYGH 2WWMC 5FXCH 4ZOCA 5H8DA 4R0LA 3BQUB 3L7EA 3NPZB 3HZKA 4YJZL 3MFFB 1I1AD 4Q0XL 4KUZH 2CLVA 4XCEB 3QFJE 3MLTA 1AGEB 2AJSH 1Z5LB 4J3XA 1BJ1H 2WK2A 5TJWK 2C4FU 3I50H 1MHEA 3BP5A 3GBLA 3W5MA 5JXEA 4X5LA 4LARH 4Y5VB 4AM0A 4EN3D 3JV5A 3MV9A 3KYNA 3O9WD 5JHDE 2D0HA 4PYGA 4N0FA 3CVIL 5T3XE 2IBZY 4U6YA 3T2PA 1U8KB 1KYOK 5KG9B 5T5FL 4RQQB 5AYQA 1ZKAA 2YMXL 4ISVA 4G42A 5FECB 5I6XC 2J5LC 4OGAC 4KMQA 4JFEB 1MQKL 1IGMH 4U1GC 2YPKB 3BIAX 5F7WC 1MIML 5IR1B 3DXAB 4IOSD 1NGPH 5GGSB 2VITA 4UB0L 3WHE1 1T6VN 2H41A 4YXKH 5CZVH 5C0EB 1HHGA 4TQEL 4O2CA 2CMRL 3LSOA 4JFDD 3QXVA 2AJUL 1UACL 1P5UA 5T1DL 4I3SL 1KCGC 4L8SA 1U92A 4IDJH 3MLSH 3EKCA 2GJJA 4UTAL 4J4PC 5KSBF 2ZUWA 1OTUC 3TWCL 3CFKA 1AXSA 1F6AB 5ECJE 5JORA 2B1HL 5TFSL 4OCRH 3ZDZE 3OTTA 1TZIB 1F90H 3DX6B 3WUWA 5I1LA 1IEAA 3NH7L 4F33B 1U3HB 3MGTA 3BPLC 2IPUG 3MLVH 5GRUH 2B8OT 3QWQB 3EJYD 3MREA 1PG7L 5ENWB 4KDTC 2CIIB 3QG6A 3G6JA 4P2OC 3MRDB 3G6AB 4G7YL 3MCLH 4IS6A 5B21A 4DZ8B 1QSEA 2ZG2A 1WBZB 2UWEB 5B8CA 2KL6A 3W9DA 2PW2A 5D6DA 5K59F 4I0PC 1XF1A 3M17A 2YD3A 2IGFH 3BP6A 4YEEA 3B9KC 5B38G 5I9QB 5EZJB 5F88A 1V7MH 4KZEH 2CRZA 4MD4B 3Q6FB 3MJ7B 4LMQI 1J0KA 3VXQB 5I1DA 5IEHB 2XA8H 2YD8A 4ZS6D 3H7BA 1R24B 2ENSA 1UB6B 2APTA 4G9DB 3BWUC 3VWJC 3QEQE 1P4LA 4PJCA 4KK8D 1BOYA 1ZHLB 4BH7B 2B5IC 3GRWL 1BM3L 4Z0BL 1X7QB 3UTTB 4NZUL 1W0WB 3Q6GL 2R8SL 4RSVA 4KV5F 5DT1L 1RZIB 4S2SA 3FTGB 1HXMB 1JZ5A 3TO4C 3GJEA 4JFHD 3MXVH 4HXBH 3VFWB 3BW9B 1JZ2A 1E4WH 5HDQL 4N8VG 1M7DB 1K6QL 2AAVA 1CF8H 4W81A 1CIDA 4E9LA 5C0GA 4L8DB 1MFBL 4JRYA 5KW9L 3OL2A 3LKPA 2PKDA 3BXNB 1R3JB 5DURB 3U7WH 5CCKL 1UH4A 5FHBL 1Y0LA 3Q48A 1ZXQA 2ZUSA 5DD6A 3O6MH 3DURA 4LAQL 2VAJA 1J5OH 1BAFL 1OTSD 3MMEA 1UM5H 4MCZB 3B6SB 1DBJH 1T3FB 1TQBC 3WS6C 1R5WA 4NC1E 4O5LH 4YHZH 1A6TB 5IB2A 2ZWLT 2HT3D 1XF2B 3HE6C 3SJVD 1HIMH 1I4FB 3BZFA 5K9KB 4ACPA 1XR8B 5I75C 5JHDA 4AL8L 2CPCA 2D3VA 4JG1L 4X6EA 3AMLA 1G7IA 1YEHH 1ZT1B 1IM9A 5IUSA 3L9RB 4QNPF 5DJCB 4HEME 2PYED 1KJVA 3TVMB 1SBSL 4D9QD 2K7PA 4HUXA 4BKLA 5LG1A 5DJYB 2ITCB 1FPTL 2JCCA 4EDWH 1LO2H 1XT5A 3LS4L 5DZLA 3FO2B 5CGTA 4YR6B 5J3HC 4NKDB 2W92A 5I6XB 5HHQA 5DDHA 3U0TB 3MYJB 1XF3B 4PJIF 2HFGH 4HV8B 5HHOE 4U1GB 1FL3B 2V7HB 4FN0A 2ID5A 2W9DL 2P7TB 3C6SB 3O2VL 3RWIB 1MLBA 2XWJA 2X9YA 1A7QL 2BP3A 5E8OB 5IHZB 3QWOB 1UJ3B 3O6FD 4K3EL 1KJMB 3IGAB 3VA2C 4CVUA 4Z7OF 1I1FB 1MRFL 1ZA6A 4RWHA 3D3VD 1BGXL 1KTDB 1U8MB 2JB6A 4K94L 2HH0H 4ZG1A 1RUPH 1UA6H 1IBGH 4OM0H 1LQSR 1FDLH 1MRDL 2BDNH 2KUTA 4PB0H 5K9QI 2QKIB 4OQTA 1K4DB 3BEVA 4FQHB 2NTSP 4PP2A 4K8RL 4L3AA 4FFWC 1ADQH 3DBXA 1OWWA 2P42B 1CFSA 2BSSB 2VE6B 4MQ7B 4C57C 1DQLH 3OKDB 4XCNA 1U6AL 3IF1A 2O5ZL 4U1LB 1SJVA 3FT3B 3SKOB 1QSFB 3P4MB 5ELIA 4OIAA 5CJOH 4G6AC 3KHOA 3PWPB 2X7LA 2F53D 4OGYL 3LDBC 2LVEA 3RU8H 5IVXB 2AEQL 3T1WA 2BMKA 1V8HA 2WWMD 2VZTA 4ZUSA 5C0RH 2DQJH 3TJEH 1T20B 3NZ8A 3L3KB 4DW2L 2FO4B 2BNQD 2XKSA 3KPQB 4PTUB 4OV5B 5T3XL 1B4JH 3VW3L 4L4VD 3DVFA 4HGWB 5DQJA 4DOHB 4MA3A 3QUKB 4U3XA 1FFNA 4RZCA 3B9KB 5E70A 5D2NE 2AI0H 1NANI 1W72B 3LRGA 5CP3H 4FFEX 1LO3H 4YDIH 2VLKB 2CUHA 2W38A 4LLUA 4FFYH 1KCRL 1OD9A 4ONHB 3VFPA 4QRRB 5DMIL 2DQEL 5CZKA 3X14B 3V4UL 1B3JA 1FZJA 4OGAD 3NN8A 2HN7A 2B5IB 4KGLA 5FA4B 4FQ2H 3HZMA 1JGLL 3P73A 4D3CL 3ZKSD 1KPUB 3RY6A 2HG5A 1C1EH 2GSGB 4DGYL 2UZIL 1D6VH 1W8NA 3MRCB 4NJAH 3OZ9L 1A7PH 1K5NA 4L4TA 4JRXE 3V5DA 5CMAB 1NMAL 1JUFA 4EOWH 1S7XB 2XFXB 3CPLB 4HWEL 4JG0L 3UYRH 4YXHH 4NKIL 4I18B 3V6OE 1A47A 1BWWA 3B43A 3CX5J 3HUJE 3X13B 3ZE1F 3PV6B 4F80A 1KTRL 1FORH 3V8CA 3RUGE 1QFUH 4NBXB 1XGTA 1JWUA 2YK1L 4CMHC 2IMMA 1ZT7B 3ZYIA 2Q7NA 3UJTH 3GSOA 3ZDXE 1MH5B 4I0CC 1Q0XH 1AXTL 4Z78A 5DVNA 2P1YA 3C8HA 4YO0A 3BKJL 4H8WL 3RX8A 1G9NH 2ATPA 5F7LB 3O4LA 3VXMB 2OR7A 1AKJB 3D0VB 1U8JB 5ACMA 5F3BB 4P2OD 1GXEA 1IKNA 3NABH 5I30H 5C0IB 3RY4A 2F58L 3GHEH 1MVFA 4P5KA 3SKNB 3QIBC 4NRZA 5ALBH 4UT9L 3CD4A 4QXGH 2C1OB 4OZGB 4OT1L 1AGCA 3TBWA 3HPJA 3QDME 5B22A 4QRSB 4JVPA 4NC2B 4X7TA 2Z8WC 4Y88A 5DJ8B 1CXLA 3IU3A 1PSKL 1I8MA 1HNFA 3GEWB 1BD2B 4JM2D 1MAJA 5IT2H 3G04B 3IDMB 4LRIC 3VWJD 4L9LA 4OD2B 5L7XH 5FGBA 2Z93A 2EC8A 4XC1H 3QYCA 2CKBB 1PQZB 4K94C 4OZHA 5IB1A 5IM7B 4M6AA 1Z9MA 4LLMA 1RUMH 1KB5L 3GBML 5F1NB 5ICZB 3B5TA 3TO4D 3I02A 4JQXA 5DJ6B 3G6DH 4K8RC 1HXYA 2K7QA 1KXQE 4W68A 3W2DL 2CR6A 4KJYA 1C16B 1GGCL 2ESVA 1D5BB 3ELAT 3CH1A 3ARYA 3T3PF 4CMMB 5L2KD 4R4BA 4UV7H 3WN5C 3S8WA 3SDXA 4Y5XB 5FO7A 2NPLX 1F02I 1MHHB 1ZHKB 2C3HA 1GGTA 2P5WB 2NY2C 1RZ7L 4LCWB 2UYLA 1D9KB 4DZBA 1A1NB 1NC2B 3T0EA 4E0RA 1CDCA 3N1QC 1GRWA 4K3DH 5E00A 3NZHH 1J1XL 4PP8C 3WJJC 3D9AH 3HE7D 4IIQC 4DN3L 2DQHL 2DQTL 3SPVB 4WUKL 2JK5B 4DAGH 1DL7H 4GXVL 1DQJB 3MA7A 4KHTH 2CJUH 4NCC2 3FQRA 1GZQA 2A2QT 1AGFA 5JXAL 3FB8B 4OCYH 4WFGD 5INDB 4MXQA 1WAAE 3HE6D 2FECI 2XG4A 3KLSA 3VGDA 5KSAB 5T1LB 3VXSE 5TE6L 2AXFA 3BVNB 1G6RA 5C3LD 5BV7H 4R90L 2X40A 3QCUH 1Q9KB 1F8TL 1IL1B 4XVTL 1P69B 4LP5A 3R06B 3U2SB 1S3KH 4QHMB 1FBIL 4UI2A 4F7MA 1T2QL 1CQKA 4OCWL 3CVHH 4KHXL 1CLYL 3CCHB 4GQPH 3WD5H 5J3HD 4IHOB 3WJLC 5DJ2B 1X44A 5GGRB 3VH8B 1HSAA 4JRXA 4MS8A 3G5VA 3C6LD 1QRNA 1G7MB 2VTFA 3QUXD 4U1HA 5HVHC 4KUZL 1TNNA 4OAWB 4U1NB 4ZXBB 3GSXB 3C5ZA 1FL5B 1AQDB 2AJSL 2FSEA 5HHPB 4HLJA 4KQ3L 3I50L 5I0ZA 3MLWH 3ZTNH 2GITB 3RVVC 1ZS8B 4KTEL 3FKUS 4WEBH 1F42A 1WBXB 4JKMA 4WW2C 1FFOA 3OHXA 3F58L 1ETZA 4KI5E 2FB4H 4WWKD 3QNXA 3EYSH 4LCIH 4MMZC 1RK0A 4Z77A 4FFWD 3BZEA 5IP4A 1RUKL 1PKQA 3MRMB 3RL1A 4H8WC 5C08A 1DSFH 2UUDK 5CGYD 2I07B 4WENB 4A6YA 1DN0A 5BCAA 1N7ML 4R3SB 4KMTH 4PJEA 5C0JB 3GMRA 5C0AB 1QKZL 3R0NA 3P77A 3ZE2E 4ZAKB 2VISB 4I4WA 4BFBD 1KCVH 3T0AA 3K8KA 3BH8B 4L8BB 4PG2A 5CZVL 3HPLB 4MXVF 3M45A 1G9MH 3ARWA 3JWOL 1BP3B 1RIVL 4WDIB 1FLTX 3CU1A 5KSBB 1CFVL 1V05A 2X2YA 3LHPH 3PP4L 4IDJL 2R0KH 5BZWA 4HHAA 1J8HD 2RHEA 2YUVA 2VLRE 4NOFA 4YHPB 3MNWB 3PGFL 5DMGC 3U79A 4B41A 4NBYB 1PZ5A 4OCRL 1MVUB 5ID0A 5E8EA 2R0LH 4PG9A 3WO3B 1YECH 5GISH 4ZFZA 4JPVH 2AKRA 4G8EA 1VFAB 3WLBB 1DEEA 1QP1A 2OJZH 2JIXB 2W65B 4GRLB 5E8DL 5GS1C 4CJ0A 2R69L 5I8EB 4Y2DA 4Y4HA 3WS3A 1YMMB 4Z7UE 5DD5L 1IJ9A 4DVBA 4LLVB 1BMGA 1QBLL 2N7AA 4HK3J 3LQZA 2IAMA 2ZSVA 4PRAA 1MFAH 2A9ML 5GSRB 2I26N 3QIWA 2CO6B 4P2RE 5DUPH 3DX9A 2A0LD 2IGFL 2X5PA 3V2AR 3RZCA 4WFFD 2C3VA 1V7ML 3KPNA 1MEXL 1BF2A 3WN5B 1JYXA 4PJ9A 1KJ2L 4WFHE 4F7EB 5IWLA 1SQ2N 1UZ6E 2APWA 1XH3B 3SCMC 4UV4H 3VGAB 3VG0L 5IMLB 3RFZC 3QEUA 3ARDB 3S6CA 3JTSB 3CZFA 3VXSA 2HJLB 2UZYB 3F5WB 1YN6B 2CRYA 3ARGA 2BSRA 5CEXA 5ITFA 2BSED 4ZNEA 2P8PA 3CIQA 3MXVL 4HXBL 4U6VH 1KG0B 2RCSH 4PV8B 2VNCA 3KJ6H 4PJ5B 1EAPB 1O5DT 1OAXH 4HC1L 1WC7B 4U6XB 3QIBD 4XI5D 2P49B 2MHAA 4NUGL 4X8JA 4C55A 5HHMD 5IB3B 2VH5H 2W0PA 2YPLE 4MAYA 1P6AB 2GCYB 2E9IA 1EVTC 5F9OH 5B39G 4OKVB 5TDNB 3V6ZA 1EAJA 1I1CA 4IRJC 3O6ML 5HYJD 2KH2B 5I1HL 2J7LA 2R1WB 1DBJL 1N59B 4MA7H 5CJXC 4M7LL 3MRRA 4QOKA 3NFPA 1HIML 5AUMB 3F7PC 3NACL 1N64H 4TSBH 4PJHE 4PBVC 4P46A 2NNAB 1KSRA 1YEHL 2G75A 1NMBH 2BNUB 4Q6IA 1CDBA 2KQMA 5F9WC 3IETB 1MSPA 4P23A 3VCLB 3EO1A 2YA0A 3T65B 4FTVD 4PJAF 2WP3O 4K8RD 2O5XL 1P4IH 4P4KB 1NUGA 4MB3A 5KZCB 2RIKA 1OW0C 1LO2L 1MCSA 3HC3L 2OSLA 4KC3B 1OP3K 1YYMH 1ONQB 2IC2A 2OLDA 2X1WL 4PJIB 4Y89A 5E1HB 2P5EA 1BFOB 1IC1A 3KPSB 3C2AH 1ZWIB 4Z7QE 4JHWH 1RJZA 4OFPA 3H9SD 1J7VR 2NY2D 4PFEA 4TNWF 4PRIA 3TN0C 2E9BA 3MGAA 2OTWA 5EOTA 3JWOC 4U4BA 1CICC 2EDJA 2VLRA 3QHTC 2ENYA 3DGGA 4XAKE 1VFBA 4AT6B 5T3XD 3S3SA 3DUUA 1RJYB 4IRZH 1BLNA 4WO4D 2HH0L 3UTSE 1RUPL 4X6CE 1IBGL 4HK3N 1N6QH 1FDLL 3AB0B 3KLHC 3EGSB 1O7VA 1I9JH 2BDNL 4KDVA 3H3KA 4PB0L 3P11H 3ARPA 4YEFA 1IE5A 2F19L 4HIXH 5ITBL 1AI1L 1A1MB 3O0RL 3VJ6B 1ADQL 5ISZB 1B0GB 4RFOL 3VFOA 4QGYA 1CE1L 5AAMA 1FIGH 4Z7UA 3TH3T 4V1DB 5CJOL 4XVSL 3LIZH 5LCVH 5JW4M 3CSYA 5EUOE 4ZO6A 2ZOLA 4JFFB 3TT3H 4YZFE 4P2RA 3F7RA 5I73C 1I8IB 3MXWL 1CU4H 2DQJL 3TJEL 4D2NA 3LN4B 2D7QA 4OF6A 4PGEB 1D5XA 4RIRB 4MVBA 1B4JL 4RBPH 3RNQA 3LN9A 5C0FB 2DQFA 2VXSH 2LVCA 2UZXB 1NGQH 3BN9D 3NVQA 3IAGC 3RWDB 3FQUA 4RAHA 3RVVD 2ICWJ 3MCKA 2FL5A 4HKZA 4D0BB 2AI0L 4E41A 5D4QA 1F45A 1LO3L 3VXRA 5ABDE 4LK4A 1JF6A 2YD7A 1FVEA 3QQ3B 3SGJA 4FFYL 3SCMB 3A67L 4QYOB 2B2XH 1QSZA 1CXEA 4TNWK 5B3JF 3QXTA 1LD9A 2GJ6A 1MQ8A 4N0RA 4BQCA 5EU7C 3NFSL 2F54A 1UKQA 2IADA 4U1JB 2QV2A 4YBHA 3BYYA 3PQYA 1BFVH 2YN3A 4GKOA 3WFBH 3EO0B 3RVXD 2XWTB 9CGTA 3U0PA 4WEMB 5AYUH 1A7PL 1P53A 1GC1H 2WIIA 1XIWC 4TULL 5KJRH 2J8UA 3QDGB 1H3GA 4NQED 1NMCC 1QNZH 4WI4A 2VXVL 3UYRL 5ICYB 5D2LF 2VQ1A 5J4MA 3D69A 1N2RA 1WT5C 2C3GA 3K4AA 4BSWA 3VRIA 2ZKHH 4LHUG 4ONFL 1FORL 1QFUL 2DICA 4X9GA 1RJLB 2FZ3A 4JY6B 1KJ3H 3UJTL 5I8KH 1UCTA 4XP9L 5DMGD 4WJ5A 2DKMA 1EFXA 5F1KC 3V0AC 3QEHB 3QNZA 1T4KB 3ARED 3PNWB 3N1MC 1G9NL 3MUY1 2W60B 3L3DA 4LCUA 2ZUTA 1XGRB 1RZ8B 4MJIE 1VGKB 3K3QA 1AHWA 3RJDA 5GS2D 5KS9E 3GHEL 1Z9LA 1Q8MA 3EZ8A 5C86A 3ZYOA 3SGKC 4H1LH 4MAUH 5ALBL 1FYTA 1JRHI 3H0TB 4LSTL 2OTUB 5EBLB 1FC2D 4P2QE 4QXGL 3O3DA 1IEBB 5EU6E 4HKJB 2A38A 1CN4A 3VD7A 3QEGH 3BIKB 5D70H 2IPUK 5IKCB 4QHUB 3QXDA 3K1DA 1I85C 4NQSB 5H2BA 3MBXH 3CVHA 4O2EA 4BZ1L 2EDOA 5CSZA 3OKKA 4M03A 3GJFH 2WINA 1XCQA 1DBMH 4OZIA 2A6JB 1TVBA 4LEOA 1T1ZB 3VE0B 5K9JL 32C2A 5DHVH 4XC1L 4PRNB 1F13A 4WI6A 2HWZH 1ORQA 1R3KB 2FEEI 1NFIA 4U1IB 4JFYA 1K8IA 1RUML 5JIHA 2HFEB 3L3OB 1NGXA 3MTRA 5FYJH 2Y36H 3WFDH 5F71A 3G6DL 4EIGB 1CD1A 1TQCB 5EORH 3QCVH 8FABB 1UCBH 5EUOA 5HHOD 3LKOA 1X5HA 4UV7L 4FP8H 1MIEH 1ZVYA 4MDJA 4XVUC 4O51A 4PB9L 1HH6B 3E3QE 4NHUB 4LFHG 4P3DB 5IESL 3E1F1 3NZHL 2FGWH 1MCPH 2EYTB 3OG6B 1NC4B 1NCBH 3DX8A 5ANMB 2HRPL 1HINH 4IRJD 1CG9B 3KNBA 2WNGA 4FQIH 5C07A 1KEMH 5IVZA 4YNYB 3KS0J 1LWRA 4DAGL 4KI5C 2G9HA 1TETH 3S97C 3VFNA 2IH3B 4RGOH 2NX5E 2JELH 4RMTA 1KTKE 2BY2A 1YQVL 1KULA 2ZSWB 3HS0A 4Y4FB 1KTLB 3RGVB 1IAII 3D85B 5IG7B 3VMNA 3QCUL 4R7DA 4FABH 3BISA 4NM4H 4YQXH 3SKMB 1UFUA 2G5RA 4LLWB 1MELA 1S3KL 4OF8A 3ZDYE 3ULUL 4GG6E 3WL9B 3S7GA 1JTTA 4LNVA 4CBPA 1MCJA 5ESAB 4MSWB 1U36A 4QEGA 2WSKA 5IHBA 1EJOH 1T21B 5C0CA 1CZ8H 4MXWL 5C09E 3VG9B 2X89A 5BO1L 4G8FB 5F6IB 5D5ME 3MRPB 5FYLH 5FGCB 3S4SG 3DTXA 1HKFA 4LLYB 3TN0D 5ADPH 4RCAA 1QVOB 5CINH 1CICD 5ALCH 3AGVA 3E2HC 5CWSB 4WUUA 2CRIA 4BH8A 3O9WB 4RGNC 1CGSL 3ILQD 1GL4B 3QNYA 4POUB 4W6XB 5J13B 3CDFA 4P57B 4XBGA 5EDXA 3KYMB 4UAOC 3BKYH 3UCRA 2HT2D 5F3HA 3KLHD 1BOGA 4FQJL 4HFWB 2FB4L 4IMLB 3TIDB 3QCTH 4N0UE 4Z76A 5EC2B 2MWCA 1TCRB 4LCIL 1UM6L 2EKJA 4JR9H 5CD3A 1AGBB 3RVTC 3N06B 4JANB 4UT6H 1QLEH 1JTOA 4NO2B 2W1NA 1XF5A 3KPRE 2FWOA 5HHXH 3GM0A 4GOSA 1EK3A 2W91A 3NCCB 1H0DB 3F7YB 1RURH 3JWDH 4GO6B 1JNNH 4PLNC 1I3UA 3QXUA 2PO6C 5J9PB 5F97E 5FV1L 4B0MM 1G9ML 1KIPA 1TJGL 4ODBD 2VL5A 2R0KL 2P45B 3O4OC 1U3ZA 3AVEA 2R0ZL 4XXCA 5D8JL 4S1DC 1I3GL 2ARJQ 4PGJA 3GI9H 5D72H 3DV6A 3I9GH 1RHHA 5F1IB 2R0LL 4E5XA 2HVKB 2R4RL 1YECL 5GISL 4N8PA 2DM4A 5J6HB 5MI0C 5E08H 2DDQH 1S8DB 2OJZL 1YUHA 4L5FH 4G80A 4ODTH 3FB7A 4W70A 4HKBB 4R4NC 1TJIL 5FK9B 3HMXL 5IBTH 1JF5A 4F7TA 1XF4A 2PTTB 1U8IB 2WBWB 4CAGA 1A2YA 2VIRA 3ISWA 1X5XA 2PYFA 3QDMD 1WGOA 2WLZA 4WTZG 4ONGH 3X12A 5J1TC 5CHNB 4ZFGL 2MFNA 1FG9C 5DUPL 1T0MB 4LVOC 2FATL 2BVEA 2ICWA 3GMNB 3HI6H 3OMZA 5EU3B 4JFZH 1M71B 2CLRA 2BNRE 4KKLD 4YK4C 5SWSA 1UWGH 4QHLA 4EEEA 1MCRA 1C08B 5HTSA 5TF1H 3T4YB 2VDLH 1NCAH 5A2JH 5F96L 3MLXH 4J12A 4MA1C 3KHQA 3U4BH 4D9RD 1CCZA 4ODWA 4UV4L 2ZG1A 4PJDA 4KVNH 4JZNA 5EBWA 2ADJB 3PL6C 4LVNC 4WW1A 4PRPA 1A4JB 3BP4A 4P5TA 3TP4A 4R2GD 1IAOA 1LEGA 1T5WA 2IPKB 2R0WL 2V6HA 3I3DA 5KTEH 3G6JF 2ORBH 3QA3B 4BQ9A 2H9GB 3L6FA 4EXKA 3TF7C 5HYIA 1F4YH 4ZUTB 5LQBH 4Z7WA 2FYYA 5AEAA 4ZUWB 1EBAA 2R1XB 1YEFL 4PJBA 5M95B 3KJ6L 4OIIH 4WV1B 1OAXL 5GGQH 2XPGB 5H35B 1RVFH 4GW5A 1MHCB 5GIRB 3UTOA 3NCBB 2VH5L 4LCCB 3ULUC 4ODXB 2ZUYA 3WYRA 4NGHH 4AEFA 2E7HA 5FYJE 2J1KA 5HYEA 4M6OH 2PETA 4NIKB 3WHE0 1ZVHA 1Q9OA 1I7UA 4K07A 5E8PA 3UDWA 3BPNB 4I9WD 5BS0D 1ROWA 3MRBB 5DA4A 1DANT 1RMFH 4TSBL 5DUML 4M1GH 3QPQC 2P48B 4JO4H 4PJAB 4NZTH 4YLQT 5DHYB 3MNZA 1YEIL 2GTWA 5E4EC 5IQ7H 5F7DB 1AY1H 3KPRA 4UAOB 2APVA 2OL3H 3W0WE 1IQDB 4LSVH 1UENA 5DSCB 3V9FA 1Y18B 1YYML 4HD9A 3BPCA 4YGVA 3IXTA 5D1ZB 2YD6A 2ADFL 2A77H 2AJXH 5GRZA 3WHXA 2FR4B 4XVUD 4J1UA 3ARFA 2Q86A 4JHWL 1E28A 2ADIB 4FNLH 4C56E 4EI6B 1FNSH 1PJ9A 3BZ4A 4PREA 5FO9A 3GIVA 1YY8B 2BCKA 3TIEA 1P7HL 3PHOB 2ZP0T 5SX4H 3BQUA 2EECA 3SE4A 4HQQH 3MFFA 3WE6B 3QBTB 4KI5D 2D0GA 5FF6B 4YHLH 5C0NC 5HJ3A 1AP2A 1K85A 4KPHH 1HOCB 1WFOA 3QUZD 5FYLE 2X4OA 3RL2A 2D03H 4Y5VA 1S7TB 4HH8A 4XNUH 1CVSC 3BEWB 4DQOL 4LPTA 3LPFA 1LE9A 4RQQA 1NFKA 5EU5B 3LIZL 4FXLA 4JZOA 4HMEA 5FECA 5HI4C 2D9QB 5DVOA 4KKNA 4JFEA 1MREL 1KLUA 2V5SA 5AZ2H 3TT3L 3MV7E 3MV8E 5DUBB 3K81A 3GUTB 2GW5A 2BNQB 1CU4L 5C3TA 3QUYC 3U48A 5GGSA 2BNRA 4B7IA 2EIEA 4KH2A 1RZFL 5C0EA 2PR4H 1VFOA 1NGQL 2YWYA 5KAQF 4OF3A 5MENE 1NGYB 3PGCA 5C6TL 3ARUA 4LVOB 1J1OH 4YK4B 1KN2L 1RUQL 4NT6B 1FH5L 4RGND 1RULH 2OYPA 1OF2B 2BVQB 3GGWA 3FHAA 1I7RB 1T89C 3QISA 1RFDL 4KWUA 1F6AA 3HA0A 3WEXA 5E4IA 2B2XL 4OJFH 1EHNA 1TZIA 3QWRD 4U6HB 5DQ9B 1S7UB 4F33A 3RVTD 4BZ2L 2YXMA 1U3HA 3O2DH 3ZTJH 3L3IB 5E6IC 4M62L 5GHWH 1DQTA 5ENWA 2CIIA 5J12B 3U36A 4G6KL 3MRDA 3WFBL 3J7HA 2M26A 3RWGB 3GKWL 5C1MB 3BSZL 2WAHA 1GC1L 1IARB 4YHKL 3O41B 5B38B 2PO6D 2UWEA 4WFHD 5D2LB 4XCFH 4L3CB 1ED3B 1QNZL 2QR0B 5KSVB 2Z0BA 4Z95L 3ZSTA 2SEBB 5FFLA 2KBGA 5M7QA 4W4NA 2B7DT 3OJDB 4HAGA 3DROB 2FLRT 5EZJA 3PUCA 4S1DD 5ADOL 2FGZA 4MD4A 1KIQA 1KELH 1KYOJ 1BEYH 4G9DA 4I5BA 3FZUC 2AGJL 1HEZB 3S36H 5B3NA 2CGRL 2JLLA 4CJ1A 1OSZA 5DEGA 4BH7A 4N8VB 4X6DE 1A6WL 4R4ND 4G8GE 5E56A 1QHPA 3KXFE 3O8XB 2AK4E 4MHHG 3BKML 5IMMA 5IROA 3WFHA 3TNNB 5I1CL 4FXGA 5JXEC 4XAWL 2GHWB 1RZIA 1IGYA 3FTGA 4KKAD 5B4MC 1UT9A 3EYFB 3R0MA 4M48L 3VFWA 3BW9A 4M6MH 1CL7L 4YIQB 3UJJH 2DL9A 5F70A 5JQHC 3K4ZA 5HPMB 2FO1A 3GZKA 4ODVH 5KVGL 2F5AL 3WIFA 4L8DA 4DKEH 3N1GC 5IFJB 1MLCB 4H88L 4OLEA 1MFNA 4HMCA 1R3JA 5D7LA 1X5ZA 1GGUA 4GBXB 2BXZA 1DBML 2PXYC 1OD7A 2ZCLH 1RZJH 1MPAH 1U8PB 1HK6A 5IB5A 1KT2B 3B6SA 5I2IA 3VWKC 1J0IA 2HWZL 4ODUA 1MFEH 2NXYC 2Z4QB 1BBJB 1XF2A 4LLAA 1I4FA 2I5YL 4GFTB 5FYJL 1UQSA 5TPWH 3WFDL 2DJSA 5DK2B 3S96B 4WHDA 4G9FA 3TYGH 5EORL 5C7XH 3QCVL 1UCBL 3LQAL 4OQTL 3OKNB 1MWAH 4YDVB 4MWFB 3TVMA 1A1OA 3H2WA 2W9LA 4JREC 2IALB 3D5OF 4X5XB 5LJYH 1WSST 3RNKA 3ULUD 2O61B 3FO2A 4YR6A 2C1PB 4NKDA 3U0WH 1MCOL 3HE7B 3SO3B 3ZMRA 1XF3A 4XPAH 5AWNL 4HV8A 4FQIL 1KEML 3UTSD 4RRPA 4XT1C 4QXTB 3L5WB 2P7TA 5T33H 3RWIA 3TPUB 4HMDA 1U93A 1L0YA 5E0QA 2DIBA 4HCRH 3ABZA 5TGBB 5E8OA 3QWOA 3AM8A 5C71A 4M1DH 5IQ9A 1OB1B 4LSPH 3IGAA 1NDGB 3KPPB 1NLBL 5HI5C 3QPQD 3UMTA 1KTDA 1U8MA 1KB9J 3N1FC 5L9DH 3CK0H 3F6IA 5DC0A 4FABL 4D94A 4YQXL 1DVFA 1CVRA 3MV11 4K7FB 2QKIA 1FO0H 4N5ED 3CXDH 4FQHA 2Y25A 3F12A 5EFIB 2NY4C 4MQ7A 3BO8A 2VE6A 2BSSA 4KGJA 2Y23A 1P5VA 3PE9A 5E2VH 3FT3A 3SKOA 3M8OH 4JFQB 3C6LB 1R3LA 1EJOL 3RTQB 3QUXB 1NAMB 4FA8A 2R4SL 3PWPA 4JO3H 2DWDB 1ZLVK 4OD1H 5FYLL 4XMLH 4NQVB 4X6FA 5ADPL 5JR1L 1R5VB 3L3KA 5CINL 2FO4A 2CXKA 3KPQA 4NN5C 2LTQB 1IZKA 2ZPKH 3AXLA 3W81A 4N1EA 5C0ND 5E2WL 4HGWA 1UM4H 3QUKA 4WWKB 4KI1A 5IFAL 1TZHA 4MLSA 2EDEA 4JR9L 2RB8A 4MD5B 1QG3A 1W72A 2XZCH 3ARZA 4G8GA 3CMOL 3KXFA 4M1CC 4UT6L 4OB5H 4IOFC 1Z9OA 2VLKA 1RD6A 1S9YA 4ONHA 2ICEB 4R0LB 5HHXL 3B3IA 1R0AL 2I27N 1JNNL 5FA4A 3MLTB 3Q5TA 4GMTL 4P2YA 1KPUA 2CK0L 5HGHB 2VO5A 2GSGA 2KZWA 1NLDL 3QUYD 3MRCA 1KGCE 1OQOA 4PRHD 3RUGF 3MV9B 1XGYL 3KYNB 5C2BL 4G8IA 4U1MB 4N0FB 4ZFFA 1S7XA 2XFXA 3CPLA 5EOQH 5D72L 5HHNB 1SY6A 1JPSH 1Q94A 2QSVA 4I18A 5TDPB 4KJWC 4ISVB 3RPIB 4G42B 2YWZA 5TH2B 3X13A 4QO1A 3PV6A 4MJID 2DI9A 2ERJC 5CIPH 5E08L 1IVLA 3VGEA 2G60H 1ZT7A 4KRNA 3U7YL 2DQDH 3T04D 3MACH 3MJ9A 1ZGLP 4P2QD 5E6ID 5I1JL 5EU6D 4NN6C 1QBMH 1AKJA 3C5SB 3NCFB 3D0VA 4O2CB 3LSOB 4QXUL 2YC1A 3BRFA 2R2HA 1ACYL 4L8SB 1U92B 3LQAC 5EIQA 4JFZL 2CDGB 3NPSC 5EU4B 3VFSB 3CFKB 2FH6A 4F9PA 1AXSB 4MDIA 2WUBH 4GUPA 2C1OA 4OZGA 1EH9A 5I1LB 4RMWA 1CTOA 3MA9H 1NCAL 3MGTB 3X3GH 3MLXL 3U4BL 2AV1B 3QQ9C 3BKCH 3ZHLA 1JZ3A 3FQWB 3D2UD 3MREB 1E4KA 5DJ8A 4K7PX 3QG6B 3G6JB 1BBDH 5I74B 4CN6A 5MP6L 1BD2A 4IS6B 1DDHB 3P40A 3BD4A 1QSEB 2EYSB 3G04A 3N0PB 4XP5H 5B8CB 4K23L 3FZUD 3STZA 3W9DB 4XHJC 2GQHA 3VDBA 4CVXB 4GG8A 1AQKH 1PQZA 3I2CH 2HFTA 5IM7A 2VN4A 4M5YL 5GGQL 3BP6B 3FCTB 4CVWA 3REWB 4OFDA 5F1NA 5ICZA 2EE2A 5DHXB 1RVFL 3K7UA 1HKLL 4H0HB 5SV4A 4HT1L 2JTDA 3BP7B 1C16A 1D5BA 4CMMA 1E6OH 3F62A 2ED9A 1KCSH 4JHZA 1P4LB 4YBLB 4X7SL 1ZHKA 5C0BE 1WQVT 4PGCB 1MF2L 2NX5D 3RY6C 4X83A 1D9KA 1A1NA 1WAAF 3IDGA 1VEOA 4O58L 2ZCKL 2PXYD 1RMFL 1GGIH 1V3LA 5DJ0A 3WIHH 4NN7C 3DRTA 3CZJA 4F7CB 3FFDA 1DQJA 3QHFH 2VXTL 3VWKD 4MGXA 4RMSA 4NN5B 1EEQA 4GSDH 1REIA 4NZTL 3KLDA 5L6YH 1ZHNA 4UBDC 5KANG 5KSAA 5T1LA 4OLXH 6FABL 5IQ7L 4OCMC 3BVNA 1AY1L 5IW1B 2OL3L 4LLDA 3ULVC 1DUYB 1S9XB 3KPMB 3LKPB 2P24B 2XI9A 4LSVL 5A1AA 5F93C 4MNQE 4AEHL 1JNHA 5CILH 4MNHB 1Y0LB 5EIVA 2DYPA 3QFJB 1N6VA 3SKJH 3DURB 1MCBA 4CKVX 4NM8H 4QHMA 4A6YL 1FNSL 2C3XA 1WTGT 2HMIC 1BZ7B 1IKNC 5GGRA 3VH8A 3BZFB 5JHDB 2P4AB 4M6NH 1G7IB 4OAWA 4ZXBA 12E8L 3GSXA 1N5YL 4U0RB 1GPOH 5DD0L 5BJTB 1KJVB 2LAGB 2GITA 4HUXB 3HG1E 1ZS8A 1GGBH 5HI5D 1WBXA 5HDOA 3GK8L 5I1GH 2E7LC 1NBZA 3FO0H 2WBJA 4D0CB 3LKQB 1J12A 1JWSB 4OF0A 2W07A 3OSKA 5HHQB 4YDKH 4FMKA 4PJXE 3M07A 3ARTA 3THML 4LVHC 4JCLA 2Q1EA 1JPST 4LASH 4UTBL 3MRMA 3VI3F 4B50A 2FJFA 1GZPB 1RZGA 2I07A 2XWJB 4EXPX 1R6VA 1W0VA 5AZ2L 5FGBC 1IMHC 2CQVA 4R3SA 3QI9D 3WKMH 5F7EH 2H32A 5EA0H 5C0AA 2J6EH 3DYOA 3GNMH 2D9CA 1MNUH 4LEXL 1JNJA 1WWAX 3STBA 4ZAKA 2VISA 1ZA6B 3BH8A 4L8BA 4S0SD 2OR8A 4ETQA 4KXZH 1JNLH 1CLOL 4WDIA 4XPTL 4LU5H 2A83A 4PP2B 1CGUA 2VDPH 5KSBA 1FFQA 1CFSB 1TJHL 5AAWA 1YEGH 3EYUH 1RULL 4LSDA 1OAYH 5JTWA 1VPOH 4JQIL 4OZFH 4PY8I 1MJ7L 5A2IH 4Z7UF 3T0EC 4BFIB 2VR9A 2X7LB 4JDVA 3RI5K 3RWFA 3S35H 2NXZC 3O2DL 3WLBA 3DVNB 4IOFD 1A7RH 1GHFL 1XGUB 2BMKB 3GSVB 2JIXA 5GHWL 2W65A 4GRLA 1EO8L 3NZ8B 1YYLL 1PZUB 5I8EA 3U1SL 1A7BA 4URTB 4MXQC 4PLJD 1I3RA 1A7NH 5DQJB 3LD8B 4DEPB 5GSRA 1FFNB 5DR5H 2DTMH 1IM9D 3QEQB 4B5EA 1AR1C 3L5IA 3F8UB 1NFDA 2Q8AH 4ONOA 3KPTA 1X5FA 2NW3A 3ES6A 3VXTB 5I71B 3AREB 3MFGB 5I1IL 4FMFA 4F7EA 1C5BH 4KJWD 3CFIC 3HFML 2YPVH 1FVDB 1CE6B 2JJWA 5ERWB 3FN0H 4MS8C 2NY6C 3VDAA 4NRXA 2EH7H 1BEYL 5DEZA 2CIKA 5IMLA 3BUTA 5IV2B 2HG5B 2APFA 3ARDA 4GKZB 3C5ZC 1PYWB 1RJCA 3JTSA 2A1WH 4HUMB 3F5WA 2Q6WA 4F57L 2EE3A 4PGDA 5E03A 1DN2A 1JUFB 4ZO9A 4M8QB 5GRVL 3H3BC 5FYJD 3SDAA 2J8UF 1FZMB 4M6ML 4UZGA 1J88A 4PV8A 3UJJL 1F58H 4N5UA 2PTVA 4FZEL 3ZT7A 2BVYA 4U6XA 4ODVL 3PWUA 3OX8B 3CFBB 3WLWC 1ITBB 4UQ3B 2IFGA 3VFMA 1HSBB 2FX9H 3MLUH 4YE4L 5E5UB 1FP5A 1EEUA 4OUOA 4K9EC 3QDJE 1HILA 1E0OB 2ATPB 4OKVA 2ARJB 5TDNA 4DN4H 3BPOC 4PJHF 4G3YL 4JEGB 1CXIA 4A2MA 2R1WA 1K3ZA 3FFCE 5FGRA 1F3DJ 2Y5TA 1G84A 3SE9L 4K7PH 5AUMA 3W0WD 3IDYB 1QTYT 4LPXA 4OSUL 4UQ2B 4XHJD 2QQKH 1X5LA 3TA3A 3P30L 4NQXA 2BNUA 3TYGL 3S37X 5C7XL 4HK0B 3HNTL 3IETA 4JFPA 3MSPA 4X7TB 5E7FA 3T65A 3DJ9A 4Z7QF 2I60H 4H0IA 4P4KA 2YKLH 3IU3B 5I1EH 4GKNA 2IF7A 2VSCA 4PJIA 1OP3H 5SWQB 3U0WL 4Y2DC 1BFOA 3H9YA 4XPAL 4L9LB 3KPSA 1ITCA 1ZWIA 2Z93B 4XPBL 4OZIF 1E6JH 4HIHB 2IAMC 3GB7A 3GSWA 4JPWL 5FYLD 2NY0C 5IB1B 4Y1AE 1AIFB 2DAVA 4LLMB 3QIWC 4ELME 1A22B 2MSPA 4LSPL 5GXBB 4AT6A 3CGTA 4QCIB 2J4WL 1N0LA 2QHRH 1RJYA 4ELKA 3MBED 4GRMB 5L9DL 3CK0L 4R4BB 4TOYH 3EGSA 1M4KA 1PLGH 4UBDD 3CXDL 5FO7B 5IWLC 5EUOF 3VJ6A 3O11B 3MV7D 5ISZA 5ACZB 1HNGA 4PRBB 5EBMB 2UYLB 4XPFH 2AJZB 3T08A 4BJLA 5E2VL 3QFDA 1CGYA 4L3EE 4D8PA 4HS8L 3GMMB 4JAMB 1JCKA 5D93C 5MEND 3SDDA 2BOBA 4OD1L 1AGFB 5D7IE 5D1QA 5D2NB 4AEIL 1CLCA 2DQIH 4UILH 4ZDHB 3WFZA 2HMID 2DKSA 3PABB 5L88H 4N90E 3X3FH 1B9ZA 1WIOA 2QSCL 5FB8B 2AXFB 3QP3A 4RIRA 1LP9E 4Z7NE 5DJAA 2KQNA 2GFBB 4OCLC 4HWBL 5C0FA 1EGJA 4KTDH 4LKXB 2EE9A 1UM4L 3O3EB 4J8RB 2EYRB 3EDKA 2D7TH 1CK0H 5HHVH 4EBQH 4F7MB 4D0BA 2NY3D 4KAQH 1VSCA 4OB5L 2V17H 4BUHA 1AO7A 1O7SA 4NKMB 4JRXB 1X4YA 2BFVH 4M7ZC 4ALAL 4NJ9L 1R3HA 3ZTJG 2FSEB 3HHRB 4P46C 2RJMA 4U1JA 4NP4H 3FRPA 2BHZA 4YUEH 4NWTH 3RUGB 2BJML 3EO0A 1QFHA 2XWTA 3BN3B 4P9MH 4LHUB 4P23C 5GGVH 4WTWA 3QIUB 1VA9A 3QDJA 1A5FH 5ICYA 3QRFM 3QNXB 5BRZE 5IGXL 2IBBA 2ESVD 4Z77B 1DP0A 2FDBP 3RL1B 5EZLB 5C08B 3GIZH 3ARRA 1T1XB 4GS7B 5DF0A 1RJLA 4JY6A 3T0ED 1T4KA 3PNWA 2F9BT 3DSFH 3M1BB 4WTXA 3C8KB 2NXZD 5ETUB 4IBLT 1XGRA 1QBML 4NO0A 3H42H 3WIHA 1J05A 2PCPB 3HMWH 4ZTPL 4PJ7E 1XMWA 1DQDH 1OLZA 4DVRH 5DK0B 4S0UC 1LK2B 3QJHA 3F7QA 5EO9A 3N85H 3H0TA 4QT5B 4JDZB 2OTUA 2VOTA 2HYMA 1LVEA 4HKJA 3IAQA 3BIKA 5DK3A 4JFDE 3MOAL 4ZFZB 3FT2B 2AKRB 3MA9L 4AY0A 1DEEB 5IKCA 4KK5C 3ZE0E 3NBNA 1ZGLB 2CD0A 4R2GB 5CP7B 4ELMA 4TN9A 2A74A 1BBDL 4NQSA 1GJIA 5EH1A 4Y4HB 3JVGA 1D5IH 4NZDA 3MODH 4F8TA 3E8UL 2NY6D 5EB9A 5KVDH 4PJ8A 2A6JA 1QRND 2IAMB 1UJTA 2XN9E 4JB9L 4PRAB 3U46A 1SMAA 1HH9B 2P47B 4N0CD 1HHJB 3C5ZD 1C5DB 4PRNA 3WIIH 1QFWH 3OPZL 4U1IA 1OAUH 1OVZA 4LNRA 5CEYB 2J12B 3RZCB 2HFEA 5FAAA 3L3OA 1CFTA 2FJGA 4MQTB 4NWUH 3VRLE 3H9HA 3ZHKA 1DQMH 4PJ9B 1UGNA 4FFVC 1II4E 3SGJC 1E6OL 4ZMAT 1HYSC 4J3VA 1KCSL 3WLWD 3IXAB 1HH6A 4MYWB 1QLRB 2BVUA 4NHUA 4P3DA 1TPXC 3SKUD 5I16A 2BHUA 3EIFA 3CZFB 3VXSB 4IRSB 4LHQB 3ARGB 5CZXC 2EYTA 1NC4A 4QY8A 4PY7B 5ITFB 5ANMA 1H3VA 5F7HA 1GGIL 1GH7A 2P8PB 4YNYA 1H3PL 3MUHL 3DWTA 1MOEA 3OAUH 4X9HA 3JSSA 3ZDYF 2ZSWA 3DXAE 4GG6F 4NNPL 2NZ9C 3NA9H 4Y4FA 1KTLA 3RGVA 5IG7A 1JTPA 5CLTA 4MAYB 2XQYG 3KG5A 4CDGC 1FZOA 1DR9A 3SKMA 1UVQA 4OZFA 3V6ZB 4LLWA 1QRKA 1MCCA 2AV7B 1IAIM 3SKJL 4V2CB 3VXOA 5D5MF 3ARBC 1IQWH 4NM8L 2F8OA 5E94B 2VDRL 3WL9A 3S4SB 2VKXA 2CRMA 1AHWC 4ZS7H 3MRRB 4MSWA 4WEUD 4Y2DD 3GMQB 1I1AA 2I9LB 3OAZK 5KSUB 4P46B 4G8FA 4M6NL 1TVDA 4RMRA 2G75B 1P2CA 3MRPA 4Q6IB 1FNHA 1L9MA 1GPOL 3QUZB 4F2MB 4LLYA 3QIWD 1QVOA 3EO1B 4P4RA 5MEOB 2GJZA 1S7QB 3RP1A 1GGBL 3SJVE 1I9RH 3O9WA 5E8NA 43C9B 2RBLA 3UC0H 5AZEH 4XVJL 1KF9B 4YFEA 4IMLA 1IGCL 4CGTA 2PYEE 1TCRA 2XZAH 4LASL 1RJZB 1X6LA 4LQ1A 3ZO0A 4D9QE 2VXUL 4NO2A 4OM1L 4HZLA 5EA0L 3VFGH 3R4DA 4QHKI 2J6EL 3LQMA 3GNML 2VLRB 2APXA 1JGEB 1H0DA 3F7YA 4Q0XH 1VFBB 2BY3A 5DJXA 4UNVA 4B7LA 1BLNB 1T7YA 4ZTOL 3RDTC 4I48A 1N0XH 4X4MA 3C09B 3RGHA 2D7NA 3RWEA 3UTTE 4JCMA 1BZ9A 3EYUL 4Y4KC 1J8KA 4Y16D 4Z7UB 3CVIH 3LB6C 3RWHA 5TDOB 2R9HD 3AUVA 2YMXH 5F1IA 3CSYB 4G7VL 4HW6A 2HVKA 5JA9A 3OBAA 3BWAB 2ZOLB 5J6HA 4ZOAA 2D4FA 3HRPA 2VLJE 1MQKH 1S8DA 2MKWA 4P2RB 4N68A 1MIMH 5I0DA 1J0ZA 4ZPVA 1JYWA 1E4XL 4P49A 1D5XB 4YC2C 4RBPK 4QOKD 5FK9A 3PHQA 3RNQB 2PTTA 4ZFOB 3O6KL 5A43C 2AP2A 4L8CA 4LGPB 1PD6A 1YEDA 2F53E 4JHAL 1MCEA 2AJUH 1UACH 1QA9A 3I3BA 5DR5L 5T1DH 3FQUB 4KRPD 1A9EA 4WVRA 1T0MA 3GMNA 5EU3A 4UTAH 4DK6A 4Q9QH 4YHNB 1M71A 3RA7H 4WRLA 3ET9F 2R1YA 4L4VE 1C08A 1F00I 5F7KC 1G0YR 4BQBA 5JW4R 3T4YA 1KIRB 1JF1B 1WZKA 3HAEH 4OZ4A 2YPVL 3FN0L 2EH7L 2QADC 2HTLC 2F54B 4PP1C 2IADB 3DV4A 3PQYB 3V4VH 2ADJA 1NKOA 1NCNA 1A4JA 3RKPA 4G7YH 2EIBA 2IPKA 4TSCH 4PRID 4YHYB 4HEPG 1OAZH 5IW6A 2YPLB 1A6UL 3L1OL 3ZT5A 2J8UB 5I1KH 3LS5H 3HCVB 1ZOXA 4ZUWA 4LGRB 3RIFF 2WWKO 4BSWB 1F58L 1K8DB 2R1XA 4HJ0C 5CEZE 4MNGE 2IG2L 4WV1A 1VDGA 4F3FA 5FCUL 5H35A 1MHCA 2H26B 1EFXB 5EZIL 3FQTB 1DBBL 2LQRA 1YPZE 4LCCA 4OFIA 4PJHB 2DLFH 4IEFB 3EOYG 3QUMH 4DN4L 4YDLC 4OBRA 4KK5D 1SJEB 5CJBA 4HKXA 1BM3H 5FO8A 3V79C 3ARSA 5E2TL 4OCNC 3SJVA 2HJKA 3MRBA 3Q6GH 2R8SH 4K7PL 2VXQL 4K71B 1QSFE 2MQCA 3KDMB 5DT1H 4WGWB 2NLJA 1I8LA 5BV7B 3O3DB 2QQKL 5HDQH 1W0YT 1ZHBB 5SX4I 5DC9B 4LCYB 1K6QH 4KUCF 1CDIA 3DETC 4PJAA 2BERA 4KJQD 2XQBL 3QXDB 3DUSA 4E41D 5EN2B 3FT4B 5KW9H 1HHHB 3VXRD 1IQDA 4XB8A 5EWIL 3CVHB 5H2BB 5DSCA 3V6FB 4O2EB 1Y18A 4FFVD 4O9HH 5CSZB 5CCKH 3GJFK 5FHBH 5D1ZA 1U8HA 1FVCA 2EDNA 4OZIB 1BIIA 2NZIA 4DOHE 1BAFH 5CFHA 3EUUA 32C2B 1Q0YH 1XCTA 1RSFA 2ADIA 5JIPA 1E6JL 4EI6A 1J1PH 3C5JA 1ORQB 1T83A 1RQ5A 4JFYB 3HG1D 5GGUB 4P59L 5CZXD 1K8IB 3PHOA 4AL8H 2EEDA 5JPNB 1GOFA 1NGXB 2GTZA 4QRPD 4QRRE 3WE6A 3D3VA 4JG1H 3AAZB 1CD1B 4AIOA 3MJGX 1EX0A 2QHRL 3QDAA 1AR2A 1BQHA 5FF6A 5EUOB 1HOCA 4TOYL 3LKOB 3OB0H 3VD5A 1PLGL 5DRXB 8CGTA 3BGFC 4MDJB 2QQNL 3SGDH 1KCLA 3EYQC 2NZ9D 3FAWA 1U8QA 1A6VH 1SEBA 3LS4H 1ZMYA 4XPFL 2Z31B 1YZZA 4OGXL 4M4PA 3L95B 4FQCL 3BEWA 2QJDA 2XT1B 3KNBB 1BQLH 2HA1A 2F53A 3PG2A 3TZVC 2E7MA 2AEWA 3C60C 2Q3ZA 3ARBD 2FJHB 3O2VH 2AVGA 3GSQB 1E27B 5IFHL 2OK0H 4OLWL 1A7QH 4UILL 3GUTA 2BNQA 5I66A 4ZUUB 2I25N 4JJHA 5HGBB 1PFCA 1RV6X 3MR9A 3RRQA 2R23B 3CFDB 1BGXH 4K94H 1L7IH 2Y07H 2GEEA 2R39A 4KTDL 1NGYA 2B0SH 5CKGA 3VXME 3WCYA 3IKCB 1LO4L 3HLAA 1UXWA 2D7TL 1XZ0B 2JKXA 4K8RH 1VEPA 1WVZA 5LXGL 4NZRL 4NT6A 5HHVL 4EBQL 1NUNB 1RK1B 1WTLA 1U6AH 3D39D 2O5ZH 1B0WA 4MA8L 3UDWC 2BVQA 4RNRB 4WI9A 1I7RA 2V17L 1HQ4B 4BSJA 4OZFG 5J6GA 2ZUQB 5F1OB 1H3XA 2BFVL 3NOIA 1KXVC 4U6HA 1ZANH 5DRNA 4OGYH 3NIFE 3WDHA 5JO5B 4XMKL 5ICXA 4OI7A 4U6TA 1JZ6A 1BQSA 4DW2H 4NWTL 1HHKB 3RWGA 5KOMC 1OM3H 4P5MB 3QNYB 1JL8A 1JIBA 3O41A 5B38A 1YPZA 1SJXA 5GGVL 5D2LA 5CBEA 3RDTD 5F3HB 1BOGB 3LRSB 5KSVA 1A5FL 2SEBA 5CD3B 4MJIB 1IC4L 1WEJH 4FQLL 5JOPD 4Y4KD 3ARFC 1XF5B 5KS9B 4X6DF 3LB6D 5LAXB 2FWOB 4JZJB 5DMIH 1YN7B 3VGFA 3V4UH 3B2VL 4PTTA 3VXPA 1JWMA 2P8LA 2FBJL 4D3CH 3BQUC 3WXWH 5C07D 3SE4C 2NY1B 4P2OA 1HEZA 3FB6A 4DGYH 2X1QA 2UZIH 1O0VA 1HI6B 3RWCB 4N8VA 4Z0XA 1P7QB 5JZ7D 3O8XA 2P5WE 4LCWE 3JXAA 1NMAH 3CFCH 4Y5VC 4HWEH 4JG0H 1FCGA 1ZGLM 4NKIH 2BRRL 1OGAE 3DV6B 1FC1A 4YIQA 4E5XB 3TFKA 3VA6A 5HPMA 3D2UB 4XTRD 4G80B 3FFCD 3OGCB 3OV6A 3FB7B 3KYAA 5C6PB 1J8HE 4JM2A 4H8WH 1XF4B 3MODL 3B2UC 3HC4H 2QADD 5KVDL 2DD8H 4PP1D 4F58L 5CEZL 1TTUA 2PYFB 3BJ91 4P0DA 4WU5B 3QXAB 3WIIL 2FBOJ 4I77L 1SBBA 2F74A 2D31A 2F58H 3S88L 5J89A 3ALPA 2Z4QA 1BBJA 4UT9H 3TO4A 3KPLB 1JHKH 3B8YA 4NWUL 3NFNB 5EG6C 5DK2A 1T7VA 2DQUL 1A3RH 3JTTB 5L2KA 3BGFB 4Y8DC 5FUZH 3OKNA 1WCBB 3C8DA 3X17A 4YDVA 4HJJL 4MWFA 4XMPH 3IJYA 1BVLA 3R1GL 1BF8A 1U3HC 4Y1AD 5HGGS 3BP4B 4P5TB 4OLYL 1PSKH 2ED8A 5CD5C 2IAND 2O61A 2ILLA 4N1CA 1XFPA 1ZA3B 5DLMH 3HE7A 3L6FB 4QXTA 3L5WA 5GS2H 3S5LG 3WS6A 1OP9A 5IJVA 3RHWK 3DRQA 4GG6B 5FOJA 1B2WL 1PDKA 1KB5H 3GBMH 2YZ8A 1UH2A 5BOPA 1HQRB 1OB1A 5H94A 2JE8A 3KPPA 3NA9L 1ZT4A 1P7KA 5C09B 1HDMB 3W2DH 5I9QC 4JKPL 4L3ED 4D0DB 1DJSA 1CXFA 3AY4A 3DETD 1IGJA 4XPGL 5D5MB 5HD8C 3IJSA 4K7FA 2LU3A 2V2XB 1W72L 5EFIA 3ZYZA 5H37H 4UOJA 5I15H 3Q5YA 1RZ7H 4HUNB 4YPGA 3CU7A 4APQD 2BRQA 5HHME 1MUJA 3QAZB 4KK6C 2AK1H 4JFQA 3C6LA 5CKAA 3RTQA 3QUXA 4DN3H 2AW2A 1NAMA 3BT2L 2DQTH 4UDUA 5IROC 4Q58C 2DWDA 4XP6L 4Y19E 4N0UB 5HYJE 1FNEB 5JXAH 3TJHA 1OTTC 4NQVA 3WV0A 4S1RH 4PJGE 4R4FH 4J2XA 1R5VA 3RIAF 4CADB 3N9GL 3KPRB 5EZOL 4R90H 4IMKA 1I9RL 1BJ8A 1YMME 4G5ZH 3UC0L 5AZEL 2N1KA 4EI5B 1T0NB 2AXHA 4WWKA 4XVTH 4DGVH 3WHXB 2BVTA 2ZNXA 1QOKA 3EYQD 1T2QH 2XZAL 1E28B 3HAEA 4MD5A 1X6NA 4OCWH 3BZ4B 4FTVE 3HC0B 4PREB 5BVJB 2N7BA 4OI9A 1JJUA 4KHXH 5D6CA 1PKOA 3GIVB 3QI9B 3GSNH 3V5KA 5FO9B 5HYFA 2BCKB 4PRPD 3TIEB 1T5XA 2WLYA 1WIUA 2ICEA 2WQ8A 2XNAB 3QULA 3VFGL 3WXVL 3MJ9L 3TZVD 3C60D 3QHZH 1H3WM 5HJ3B 5BRZD 1AP2B 1QSVA 2CLZB 1K4CA 3NTCH 3H9SE 5HGHA 4KQ3H 1N0XL 2X4OB 3RL2B 4KTEH 3SDCD 3TVMC 3LV3B 1XEDA 3CFJA 1BQHG 4U1MA 3F58H 1LE9B 2IBGA 5HHNA 2WW8A 5TDPA 3RPIA 4JZOB <