3VZGA

Crystal structure of human pancreatic secretory protein zg16p with o-(alpha-d-mannosyl)-l-threonine
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
138
structure length
138
Chain Sequence
RSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Multiple Sugar Recognition of Jacalin-related Human ZG16p Lectin
pubmed doi rcsb
molecule keywords Zymogen granule membrane protein 16
molecule tags Sugar binding protein
source organism Homo sapiens
total genus 25
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01419 Jacalin Jacalin-like lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.100.10.30 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Jacalin-like lectin domain 3vzgA00
1XEZA 3LL2A 1J4SA 4R6QA 1ZGRA 4GX7A 2BMZA 1OUWA 4R6OA 2JZ4A 4DDNA 3VZFA 1UGXA 4PIKA 1M26A 2GUEA 3LLZA 1JACA 1C3NA 1PXDA 3VY7A 4MQ0A 1J4UA 3WOBA 1TP8A 1WS5C 1UGYC 1VBOA 3LL0A 5J4XA 4AKDA 1WS5A 1J4TA 1UGYA 1XXRA 2BN0A 4R6RA 3WOCA 5J50A 1JOTA 5J4TA 5J51A 5JM1A 4R6PA 4R6NA 3APAA 3O44A 2GUDA 1C3KA 2HYRA 3MIVA 2HYQA 3AQGA 4PITA 3R51A 4AKCA 3LM1A 5BN6E 3LLYA 2GTYA 1KUJA 1WS4C 3VZGA 3P8SA 1WS4A 3VZEA 1UH0A 1UGWC 3LL1A 1UGWA 1KU8A 1XXQA 5AV7A 2NUOA 1C3MA 2BMYA 4PIFA 2GUXA 3LKYA 1VBPA 1ZGSA 3R50A 3VY6A 1X1VA 1TOQA 2GUCA 1UH1A 4AKBA 3MITA 4WOGA 3MIUA 4AK4A 4PIUA 3R52A 5EXGA 2NU5A
chains in the Genus database with same CATH superfamily
1XEZA 3LL2A 4ARXA 1J4SA 4R6QA 1I5PA 1ZGRA 4GX7A 2BMZA 3TOWA 1OUWA 4R6OA 2JZ4A 4QX2A 4DDNA 3VZFA 1UGXA 4PIKA 1M26A 2GUEA 3LLZA 1JACA 1C3NA 1PXDA 3EB7A 3VY7A 4MQ0A 1J4UA 3WOBA 1TP8A 1DLCA 1WS5C 1UGYC 1VBOA 3LL0A 5J4XA 4AKDA 1WS5A 1J4TA 1UGYA 1XXRA 2BN0A 4R6RA 3WOCA 5J50A 4QX0A 1JOTA 5J4TA 5J51A 5JM1A 4D8MA 2C9KA 4R6PA 4R6NA 3APAA 3O44A 2GUDA 1C3KA 2HYRA 3MIVA 2QP2A 2HYQA 3AQGA 4PITA 1CIYA 3R51A 4AKCA 3LM1A 5BN6E 3LLYA 2GTYA 1KUJA 1WS4C 3VZGA 3P8SA 1WS4A 3VZEA 1UH0A 1UGWC 3LL1A 1UGWA 1KU8A 1XXQA 5AV7A 1JI6A 2NUOA 4W8JA 1C3MA 4QX1A 2BMYA 4PIFA 2GUXA 3LKYA 1VBPA 1ZGSA 3R50A 4MOAA 3VY6A 1X1VA 1TOQA 4QX3A 2GUCA 1VMOA 1UH1A 1W99A 4AKBA 3MITA 4WOGA 3MIUA 4AK4A 4PIUA 3R52A 5EXGA 4ARYA 2NU5A
chains in the Genus database with same CATH topology
1XEZA 3LL2A 1J4SA 4R6QA 1ZGRA 4GX7A 2BMZA 1OUWA 4R6OA 2JZ4A 4DDNA 3VZFA 1UGXA 4PIKA 1M26A 2GUEA 3LLZA 1JACA 1C3NA 1PXDA 3VY7A 4MQ0A 1J4UA 3WOBA 1TP8A 1WS5C 1UGYC 1VBOA 3LL0A 5J4XA 4AKDA 1WS5A 1J4TA 1UGYA 1XXRA 2BN0A 4R6RA 3WOCA 5J50A 1JOTA 5J4TA 5J51A 5JM1A 4R6PA 4R6NA 3APAA 3O44A 2GUDA 1C3KA 2HYRA 3MIVA 2HYQA 3AQGA 4PITA 3R51A 4AKCA 3LM1A 5BN6E 3LLYA 2GTYA 1KUJA 1WS4C 3VZGA 3P8SA 1WS4A 3VZEA 1UH0A 1UGWC 3LL1A 1UGWA 1KU8A 1XXQA 5AV7A 2NUOA 1C3MA 2BMYA 4PIFA 2GUXA 3LKYA 1VBPA 1ZGSA 3R50A 3VY6A 1X1VA 1TOQA 2GUCA 1UH1A 4AKBA 3MITA 4WOGA 3MIUA 4AK4A 4PIUA 3R52A 5EXGA 2NU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XEZ A;  3LL2 A;  1J4S A;  4R6Q A;  1ZGR A;  4GX7 A;  2BMZ A;  1OUW A;  4R6O A;  2JZ4 A;  4DDN A;  3VZF A;  1UGX A;  4PIK A;  1M26 A;  2GUE A;  3LLZ A;  1JAC A;  1C3N A;  1PXD A;  3VY7 A;  4MQ0 A;  1J4U A;  3WOB A;  1TP8 A;  1WS5 C;  1UGY C;  1VBO A;  3LL0 A;  5J4X A;  4AKD A;  1WS5 A;  1J4T A;  1UGY A;  1XXR A;  2BN0 A;  4R6R A;  3WOC A;  5J50 A;  1JOT A;  5J4T A;  5J51 A;  5JM1 A;  4R6P A;  4R6N A;  3APA A;  3O44 A;  2GUD A;  1C3K A;  2HYR A;  3MIV A;  2HYQ A;  3AQG A;  4PIT A;  3R51 A;  4AKC A;  3LM1 A;  5BN6 E;  3LLY A;  2GTY A;  1KUJ A;  1WS4 C;  3VZG A;  3P8S A;  1WS4 A;  3VZE A;  1UH0 A;  1UGW C;  3LL1 A;  1UGW A;  1KU8 A;  1XXQ A;  5AV7 A;  2NUO A;  1C3M A;  2BMY A;  4PIF A;  2GUX A;  3LKY A;  1VBP A;  1ZGS A;  3R50 A;  3VY6 A;  1X1V A;  1TOQ A;  2GUC A;  1UH1 A;  4AKB A;  3MIT A;  4WOG A;  3MIU A;  4AK4 A;  4PIU A;  3R52 A;  5EXG A;  2NU5 A; 
#chains in the Genus database with same CATH topology
 1XEZ A;  3LL2 A;  4ARX A;  1J4S A;  4R6Q A;  1I5P A;  1ZGR A;  4GX7 A;  2BMZ A;  3TOW A;  1OUW A;  4R6O A;  2JZ4 A;  4QX2 A;  4DDN A;  3VZF A;  1UGX A;  4PIK A;  1M26 A;  2GUE A;  3LLZ A;  1JAC A;  1C3N A;  1PXD A;  3EB7 A;  3VY7 A;  4MQ0 A;  1J4U A;  3WOB A;  1TP8 A;  1DLC A;  1WS5 C;  1UGY C;  1VBO A;  3LL0 A;  5J4X A;  4AKD A;  1WS5 A;  1J4T A;  1UGY A;  1XXR A;  2BN0 A;  4R6R A;  3WOC A;  5J50 A;  4QX0 A;  1JOT A;  5J4T A;  5J51 A;  5JM1 A;  4D8M A;  2C9K A;  4R6P A;  4R6N A;  3APA A;  3O44 A;  2GUD A;  1C3K A;  2HYR A;  3MIV A;  2QP2 A;  2HYQ A;  3AQG A;  4PIT A;  1CIY A;  3R51 A;  4AKC A;  3LM1 A;  5BN6 E;  3LLY A;  2GTY A;  1KUJ A;  1WS4 C;  3VZG A;  3P8S A;  1WS4 A;  3VZE A;  1UH0 A;  1UGW C;  3LL1 A;  1UGW A;  1KU8 A;  1XXQ A;  5AV7 A;  1JI6 A;  2NUO A;  4W8J A;  1C3M A;  4QX1 A;  2BMY A;  4PIF A;  2GUX A;  3LKY A;  1VBP A;  1ZGS A;  3R50 A;  4MOA A;  3VY6 A;  1X1V A;  1TOQ A;  4QX3 A;  2GUC A;  1VMO A;  1UH1 A;  1W99 A;  4AKB A;  3MIT A;  4WOG A;  3MIU A;  4AK4 A;  4PIU A;  3R52 A;  5EXG A;  4ARY A;  2NU5 A; 
#chains in the Genus database with same CATH homology
 1XEZ A;  3LL2 A;  1J4S A;  4R6Q A;  1ZGR A;  4GX7 A;  2BMZ A;  1OUW A;  4R6O A;  2JZ4 A;  4DDN A;  3VZF A;  1UGX A;  4PIK A;  1M26 A;  2GUE A;  3LLZ A;  1JAC A;  1C3N A;  1PXD A;  3VY7 A;  4MQ0 A;  1J4U A;  3WOB A;  1TP8 A;  1WS5 C;  1UGY C;  1VBO A;  3LL0 A;  5J4X A;  4AKD A;  1WS5 A;  1J4T A;  1UGY A;  1XXR A;  2BN0 A;  4R6R A;  3WOC A;  5J50 A;  1JOT A;  5J4T A;  5J51 A;  5JM1 A;  4R6P A;  4R6N A;  3APA A;  3O44 A;  2GUD A;  1C3K A;  2HYR A;  3MIV A;  2HYQ A;  3AQG A;  4PIT A;  3R51 A;  4AKC A;  3LM1 A;  5BN6 E;  3LLY A;  2GTY A;  1KUJ A;  1WS4 C;  3VZG A;  3P8S A;  1WS4 A;  3VZE A;  1UH0 A;  1UGW C;  3LL1 A;  1UGW A;  1KU8 A;  1XXQ A;  5AV7 A;  2NUO A;  1C3M A;  2BMY A;  4PIF A;  2GUX A;  3LKY A;  1VBP A;  1ZGS A;  3R50 A;  3VY6 A;  1X1V A;  1TOQ A;  2GUC A;  1UH1 A;  4AKB A;  3MIT A;  4WOG A;  3MIU A;  4AK4 A;  4PIU A;  3R52 A;  5EXG A;  2NU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...