3WOBA

Crystal structure of a prostate-specific wga16 glycoprotein lectin, form i
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
134
structure length
134
Chain Sequence
GQMFGNGKGSYFITSKDNETGITGIRVFVGPVGLIKSIQVRYGSSWSEKYGIPGGKAHELILHPGEHIISIYGRYRTFLQHVTLITNQGRSASFGLETGKGFFAAPNLTGQVLEGVYGQFWLYGITGIGFTWGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery, Primary, and Crystal Structures and Capacitation-related Properties of a Prostate-derived Heparin-binding Protein WGA16 from Boar Sperm
pubmed doi rcsb
molecule keywords hypothetical protein
molecule tags Unknown function
source organism Sus scrofa
total genus 21
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01419 Jacalin Jacalin-like lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.100.10.30 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Jacalin-like lectin domain 3wobA00
1VBPA 3WOBA 1ZGRA 3LL0A 1VBOA 2HYRA 1C3KA 3R51A 3AQGA 1WS4A 4R6QA 1UH1A 2JZ4A 2GUXA 4AK4A 3MIUA 1KU8A 1XEZA 3LM1A 2NUOA 3APAA 1XXQA 5J4TA 1WS5A 1KUJA 2GUDA 4PIKA 4AKBA 1J4TA 1UGWC 2HYQA 3MIVA 2BMYA 2BMZA 2NU5A 4PIUA 4R6NA 1UGYA 2GUEA 4PITA 1PXDA 3LL1A 1J4SA 3MITA 1JACA 1UH0A 1C3MA 5AV7A 1C3NA 4MQ0A 3WOCA 5EXGA 4R6PA 1J4UA 3VZEA 3VY7A 5J50A 1M26A 3VY6A 4DDNA 4AKDA 3R50A 1UGWA 1OUWA 4AKCA 4R6RA 3O44A 3LKYA 2GTYA 5J51A 4GX7A 5BN6E 1WS4C 5J4XA 1UGXA 3P8SA 2GUCA 1ZGSA 2BN0A 1TOQA 3LLZA 1XXRA 4R6OA 3LLYA 1X1VA 3VZFA 1WS5C 5JM1A 3LL2A 4PIFA 3R52A 4WOGA 3VZGA 1JOTA 1TP8A 1UGYC
chains in the Genus database with same CATH superfamily
2QP2A 1VBPA 3WOBA 1DLCA 1ZGRA 3LL0A 1VBOA 2HYRA 1C3KA 3R51A 3AQGA 1WS4A 4R6QA 1UH1A 2JZ4A 4MOAA 2GUXA 4AK4A 3MIUA 4QX3A 1KU8A 1XEZA 1VMOA 3LM1A 2NUOA 3APAA 1XXQA 5J4TA 1WS5A 1KUJA 2GUDA 4PIKA 4AKBA 1CIYA 1J4TA 1UGWC 2HYQA 3MIVA 1W99A 2BMYA 2BMZA 4D8MA 2NU5A 4PIUA 4R6NA 1UGYA 3TOWA 1JI6A 2GUEA 4PITA 2C9KA 1PXDA 3LL1A 1J4SA 3MITA 4ARXA 1JACA 1UH0A 1C3MA 4QX0A 5AV7A 1C3NA 4QX1A 4MQ0A 3WOCA 4W8JA 5EXGA 4R6PA 1J4UA 3VZEA 3VY7A 5J50A 1M26A 3VY6A 3EB7A 4DDNA 4AKDA 3R50A 1UGWA 1OUWA 4AKCA 4R6RA 3O44A 3LKYA 2GTYA 5J51A 4GX7A 5BN6E 1WS4C 5J4XA 1UGXA 3P8SA 2GUCA 1ZGSA 2BN0A 1TOQA 3LLZA 1XXRA 4R6OA 3LLYA 1X1VA 3VZFA 1I5PA 1WS5C 5JM1A 3LL2A 4PIFA 4ARYA 3R52A 4WOGA 3VZGA 4QX2A 1JOTA 1TP8A 1UGYC
chains in the Genus database with same CATH topology
1VBPA 3WOBA 1ZGRA 3LL0A 1VBOA 2HYRA 1C3KA 3R51A 3AQGA 1WS4A 4R6QA 1UH1A 2JZ4A 2GUXA 4AK4A 3MIUA 1KU8A 1XEZA 3LM1A 2NUOA 3APAA 1XXQA 5J4TA 1WS5A 1KUJA 2GUDA 4PIKA 4AKBA 1J4TA 1UGWC 2HYQA 3MIVA 2BMYA 2BMZA 2NU5A 4PIUA 4R6NA 1UGYA 2GUEA 4PITA 1PXDA 3LL1A 1J4SA 3MITA 1JACA 1UH0A 1C3MA 5AV7A 1C3NA 4MQ0A 3WOCA 5EXGA 4R6PA 1J4UA 3VZEA 3VY7A 5J50A 1M26A 3VY6A 4DDNA 4AKDA 3R50A 1UGWA 1OUWA 4AKCA 4R6RA 3O44A 3LKYA 2GTYA 5J51A 4GX7A 5BN6E 1WS4C 5J4XA 1UGXA 3P8SA 2GUCA 1ZGSA 2BN0A 1TOQA 3LLZA 1XXRA 4R6OA 3LLYA 1X1VA 3VZFA 1WS5C 5JM1A 3LL2A 4PIFA 3R52A 4WOGA 3VZGA 1JOTA 1TP8A 1UGYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VBP A;  3WOB A;  1ZGR A;  3LL0 A;  1VBO A;  2HYR A;  1C3K A;  3R51 A;  3AQG A;  1WS4 A;  4R6Q A;  1UH1 A;  2JZ4 A;  2GUX A;  4AK4 A;  3MIU A;  1KU8 A;  1XEZ A;  3LM1 A;  2NUO A;  3APA A;  1XXQ A;  5J4T A;  1WS5 A;  1KUJ A;  2GUD A;  4PIK A;  4AKB A;  1J4T A;  1UGW C;  2HYQ A;  3MIV A;  2BMY A;  2BMZ A;  2NU5 A;  4PIU A;  4R6N A;  1UGY A;  2GUE A;  4PIT A;  1PXD A;  3LL1 A;  1J4S A;  3MIT A;  1JAC A;  1UH0 A;  1C3M A;  5AV7 A;  1C3N A;  4MQ0 A;  3WOC A;  5EXG A;  4R6P A;  1J4U A;  3VZE A;  3VY7 A;  5J50 A;  1M26 A;  3VY6 A;  4DDN A;  4AKD A;  3R50 A;  1UGW A;  1OUW A;  4AKC A;  4R6R A;  3O44 A;  3LKY A;  2GTY A;  5J51 A;  4GX7 A;  5BN6 E;  1WS4 C;  5J4X A;  1UGX A;  3P8S A;  2GUC A;  1ZGS A;  2BN0 A;  1TOQ A;  3LLZ A;  1XXR A;  4R6O A;  3LLY A;  1X1V A;  3VZF A;  1WS5 C;  5JM1 A;  3LL2 A;  4PIF A;  3R52 A;  4WOG A;  3VZG A;  1JOT A;  1TP8 A;  1UGY C; 
#chains in the Genus database with same CATH topology
 2QP2 A;  1VBP A;  3WOB A;  1DLC A;  1ZGR A;  3LL0 A;  1VBO A;  2HYR A;  1C3K A;  3R51 A;  3AQG A;  1WS4 A;  4R6Q A;  1UH1 A;  2JZ4 A;  4MOA A;  2GUX A;  4AK4 A;  3MIU A;  4QX3 A;  1KU8 A;  1XEZ A;  1VMO A;  3LM1 A;  2NUO A;  3APA A;  1XXQ A;  5J4T A;  1WS5 A;  1KUJ A;  2GUD A;  4PIK A;  4AKB A;  1CIY A;  1J4T A;  1UGW C;  2HYQ A;  3MIV A;  1W99 A;  2BMY A;  2BMZ A;  4D8M A;  2NU5 A;  4PIU A;  4R6N A;  1UGY A;  3TOW A;  1JI6 A;  2GUE A;  4PIT A;  2C9K A;  1PXD A;  3LL1 A;  1J4S A;  3MIT A;  4ARX A;  1JAC A;  1UH0 A;  1C3M A;  4QX0 A;  5AV7 A;  1C3N A;  4QX1 A;  4MQ0 A;  3WOC A;  4W8J A;  5EXG A;  4R6P A;  1J4U A;  3VZE A;  3VY7 A;  5J50 A;  1M26 A;  3VY6 A;  3EB7 A;  4DDN A;  4AKD A;  3R50 A;  1UGW A;  1OUW A;  4AKC A;  4R6R A;  3O44 A;  3LKY A;  2GTY A;  5J51 A;  4GX7 A;  5BN6 E;  1WS4 C;  5J4X A;  1UGX A;  3P8S A;  2GUC A;  1ZGS A;  2BN0 A;  1TOQ A;  3LLZ A;  1XXR A;  4R6O A;  3LLY A;  1X1V A;  3VZF A;  1I5P A;  1WS5 C;  5JM1 A;  3LL2 A;  4PIF A;  4ARY A;  3R52 A;  4WOG A;  3VZG A;  4QX2 A;  1JOT A;  1TP8 A;  1UGY C; 
#chains in the Genus database with same CATH homology
 1VBP A;  3WOB A;  1ZGR A;  3LL0 A;  1VBO A;  2HYR A;  1C3K A;  3R51 A;  3AQG A;  1WS4 A;  4R6Q A;  1UH1 A;  2JZ4 A;  2GUX A;  4AK4 A;  3MIU A;  1KU8 A;  1XEZ A;  3LM1 A;  2NUO A;  3APA A;  1XXQ A;  5J4T A;  1WS5 A;  1KUJ A;  2GUD A;  4PIK A;  4AKB A;  1J4T A;  1UGW C;  2HYQ A;  3MIV A;  2BMY A;  2BMZ A;  2NU5 A;  4PIU A;  4R6N A;  1UGY A;  2GUE A;  4PIT A;  1PXD A;  3LL1 A;  1J4S A;  3MIT A;  1JAC A;  1UH0 A;  1C3M A;  5AV7 A;  1C3N A;  4MQ0 A;  3WOC A;  5EXG A;  4R6P A;  1J4U A;  3VZE A;  3VY7 A;  5J50 A;  1M26 A;  3VY6 A;  4DDN A;  4AKD A;  3R50 A;  1UGW A;  1OUW A;  4AKC A;  4R6R A;  3O44 A;  3LKY A;  2GTY A;  5J51 A;  4GX7 A;  5BN6 E;  1WS4 C;  5J4X A;  1UGX A;  3P8S A;  2GUC A;  1ZGS A;  2BN0 A;  1TOQ A;  3LLZ A;  1XXR A;  4R6O A;  3LLY A;  1X1V A;  3VZF A;  1WS5 C;  5JM1 A;  3LL2 A;  4PIF A;  3R52 A;  4WOG A;  3VZG A;  1JOT A;  1TP8 A;  1UGY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...