3WP9A

Crystal structure of antifreeze protein from an antarctic sea ice bacterium colwellia sp.
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
224
structure length
224
Chain Sequence
AGPYAVELGEAGTFTILSKSGITDVYPSTVTGNVGTSPITGAALLLNCDEVTGAMYTVDSAGPLPCSINSPYLLELAVSDMGIAYNDAAGRVPADHTELGTGEIGGLTLEPGVYKWSSDVNISTDVTFNGTMDDVWIMQISGNLNQANAKRVTLTGGALAKNIFWQVAGYTALGTYASFEGIVLSKTLISVNTGTTVNGRLLAQTAVTLQKNTINAPTEQYEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antifreeze protein
molecule keywords Ice-binding protein
publication title Hyperactive antifreeze protein from an Antarctic sea ice bacterium Colwellia sp. has a compound ice-binding site without repetitive sequences
pubmed doi rcsb
source organism Colwellia
total genus 87
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11999 DUF3494 Protein of unknown function (DUF3494)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...