3WS3A

Crystal structure of h-2d in complex with an insulin derived peptide
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
273
structure length
266
Chain Sequence
b'PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGLLRTDSPKAHVTHHPRSEVTLRCWALGFYPADITLTWQGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Compensatory mechanisms allow undersized anchor-deficient class I MHC ligands to mediate pathogenic autoreactive T cell responses
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 63
structure length 266
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ws3A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3ws3A01
3C09C 3DMMA 4MDJB 2FZ3B 5HHVL 1KJVA 4QOKD 5CJOH 4BQBA 4NRYA 4M1DL 4PJ5E 4PY7A 2UZYB 1JK8A 3RNKB 4PTUA 2YA0A 2JCCA 3FFCD 4IOIB 1MFAL 2XN9E 4YHPB 3QJHA 2G5RA 1NBVH 4APQC 3PGCA 3VRLF 2EEDA 5FECA 4YUEH 2HG5A 9CGTA 1D5ZB 4EUPG 3CFKA 1PW3A 4APQA 3REVA 4PLJD 3HZKB 3UTSD 5CGMA 4X9IA 3MV9D 2PO6D 3TBVA 1Z6JT 1A0QL 3QUML 3VFNA 1N64L 4H26A 4OD3H 3I85A 4MJIB 1RZGA 3QHZH 1IGFL 1FBIL 1MFEL 1QKZL 3ARSA 4YC2B 1A2YB 2KBGA 4HMCA 3TV3L 2J8UF 1K9TA 1P4BH 2YBRA 3SE9H 3Q1SH 3QCVL 5DJ8A 1W8OA 1QSFD 5IV2A 1CCZA 2DQIH 5JQ6H 3OAYH 4LLUA 1CICC 1YQ2A 4CDGC 5L2JB 4NZUL 2Q7YA 4OCNC 4F9LC 3EDKA 1WT5C 1P7QA 4X5XA 4CVUA 3DVGA 3U7WH 1CICA 1RK0B 5F9JA 4ZPTA 5TH2A 2HT4C 3X11B 4F9LA 5HVHB 1U2HA 1WT5A 5E2WL 5F7HA 3F8UB 1QYGL 4PJDF 1YC7A 1JTOA 3BDXA 4O00A 12E8H 4UINL 4Y88A 4GKSA 3MRJA 4X9HA 5CHNA 4J3XA 3NIGE 2BNQB 5HHVH 1CFTA 4WW1A 5ESVB 4XRCA 1D9KC 5ID0A 4FQXB 2AP2A 1TENA 1NUNB 3X12A 1I3RA 4Y19A 5EZIL 2F54B 1BM3L 3RP1A 4KI5F 4ORGA 1D9KA 3TCXA 5HSFA 5HBBA 1KPRA 4Y2DC 4N0RA 3QXAA 5DUML 4HKZA 3VGBA 5F3HB 2VABB 3FOMA 3U83A 2FGWL 1XEDA 1PLGL 5T1LA 3BGMB 3GSWB 4Y2DA 1SMAA 5GGSA 1NCNA 5C6TL 4HX1B 3R06A 5C08A 1A0QH 3W0WA 3QUMH 1A6PA 1MHCA 5FDWB 2FHBA 1N64H 4HUWB 1NBYB 3BXNA 1I7UB 1BIIB 4Q6YA 1OHQA 1IGFH 1FBIH 1MFEH 3IS1X 3TV3H 1OT2A 3QCVH 3HAEH 2PTVA 1I7ZB 2MSPA 3C6LD 1ZLUK 5C1MB 2DL2A 3QXDA 5ENWB 4LEXL 5CBEA 3T2OA 2Y6SD 4NZUH 5IK3B 1M05A 1AH1A 3ARUA 5DEFA 4WUUB 4HC1L 3RTQC 2PXYB 3RWIA 4N90E 1MH5B 3SQOL 3GJEA 3TH4T 5E2WH 3KPOA 1QYGH 3LB6D 8FABB 3FB8A 3RTQA 4UINH 5A2FA 1MHHB 2Q6WB 4QHLB 4GXUM 4XGZB 1FYTD 4KRPD 3RKDD 2VDOL 1T03H 1AO7A 5EZIH 1BM3H 2ESVD 4DZ8B 3I50L 2WIMA 1T5WA 2VDRL 1FZMB 1L7IL 1DBBL 3CMGA 3SDAD 4NUGL 3BJ91 5DUMH 1FORL 4KDTC 3WFZA 3T4AA 5IB4B 2FGWH 3VJ6B 1E6JL 3T4YA 1EA9C 5JPNB 1IAMA 2VQ1A 3VXOA 1DLHB 3DHMA 4XNQA 4P23D 5C6TH 1UJ3B 1VERA 4KDTA 2J5LB 4EUPH 5FO9B 3FQNA 2AV1A 4PD4J 1WLHA 3K46A 4FQ2L 3MRMB 1LO3H 4S1QH 3PWVA 4HJGB 3B9EA 4JFFD 1Q8MA 1A2YA 3F5WB 3G04B 3HNVL 3WHXB 1NGXA 3A6CL 3QO1B 4YK4C 4LEXH 4WI5A 3GSXB 4R0LB 5LXGL 3PWPE 1AP2B 5A2JH 3RBSA 1CI5A 3T0EB 1J1OL 1I7RB 3RWCB 2MOVA 3WNKA 3GMMA 5GRZA 1VA9A 3ESUF 4NN7C 1KLUB 3SQOH 1NCTA 3MRCB 4P49A 2JJUA 4PRID 2LU4A 3PQYB 1S7XB 1JWSA 4JZJB 4MS8C 2FH6A 3NIFF 1U8HA 1FCGA 1I85C 5GQBA 4P2RB 5MEOB 4G9FE 3B5TA 4ZYKB 3CX5K 3GMPB 2IC2A 3GM0A 3HMWL 4M43L 4MS8A 2VDOH 5MENB 3MXVL 4JM4H 3D0VB 1I85A 3EOBA 3DVNA 3EOAB 4QNPF 4I48A 2AJUH 3T04D 4DFIA 3I50H 4QHNA 1N8ZB 3KAAA 4HJ0C 3LEXA 5EU6E 2VDRH 1L7IH 2AXFB 4E42A 1DBBH 1ZGLP 1VFMA 1T3FA 4NUGH 2QR0A 1NFIB 5L7XL 4Z7UA 3BVNB 1FORH 2GK0A 3B9AA 2ZCKL 4L4VE 1E6JH 1U92A 2FIKA 1HILB 4RGNE 4FFVC 3WFBL 2EECA 3QNYB 3UZVB 4HX1A 4LHUA 4BKLA 1I7UA 5DA4A 2VXUL 5EIIA 1BECA 1KUMA 6FABL 5MI0C 2EZ0C 3JWDC 4LLAA 3HNVH 5HI5D 1YEIL 3V4VL 3RUGE 3A6CH 5H2BB 3JTCA 3QDGA 3K74B 3QWQB 4I2XB 3SDDB 5LXGH 2R0WL 3FCTA 1QVOA 1NQBA 4G8EA 3KYOA 4M7ZC 1J1OH 1V7ML 5BS0E 1X44A 4RIRB 3LZFH 1JPTL 5IK3A 4LASL 1IMHC 4ONGL 1G7MA 2N56A 3V6BR 5I73B 5ESQB 5AG8A 2JLLA 1CD1A 4KUZH 2WAHA 1SQ2N 3GIZL 2VLJD 4JO3L 4M43H 1L4IA 4JO2L 2AABL 3MXVH 2VLKA 1NEZB 5DGQA 2EE6A 5JZ7C 4PJ7B 3CFEB 3ELAT 1EFQA 1T7XA 3AVEA 5EOQL 3DV6B 4LF3B 4X83A 1WV7T 5C0EA 3IFOA 2XKSA 2ZCKH 4U1JB 1LEIB 1DVFC 4ERSL 1M1SA 1QFUL 2BVYA 1TCMA 3VFOA 1J8KA 2VSCA 5IB4A 5JPNA 3NCJL 4NQDD 1DVFA 2ENYA 3WFBH 4BH8B 3MOBL 4OCYH 4WI8A 1JWMB 3GB7A 1W2KT 1VFBA 1HWGB 2VXUH 3HZYB 1DBML 4FTVA 5C0CD 1EXUB 3K4AA 6FABH 1Z5LB 3OKNA 2R23B 1YEIH 5I16A 1KLGB 1A6TA 4DTGL 5DYOB 3C87A 3QO1A 2R0WH 4Z5RB 3ESVF 1ZT4B 4G8IA 1S78C 4GLRI 3CUPB 3S88L 3GSXA 3QNXA 5DFWH 1JPTH 4FQHA 5F6IB 4LASH 4ONFL 5I1EL 5F3BB 4ONGH 4GG6B 5I8EA 2EYSA 4F15B 4M6OL 3H7BB 1SY6L 3X13B 5LBSL 3OG4B 2Z9TA 1RUAH 2W38A 4UBDD 4O2CA 4X98B 2AEQL 5DK0B 3GIZH 1UFUA 2P45B 3QXVA 2WQ8A 2HLFD 4NQSB 4JO2H 3MV7D 3T0WA 1DQQB 4PJFA 1U91A 5JHDB 2CKNA 1N3NB 1QSZA 3QUMB 1IGYA 3U0WL 3ZYIA 2A6IA 3C9NA 5DJCA 3TZVB 3VXME 1A47A 1MHEA 1SBSL 4JFEB 2EIBA 2VIRA 1YMHA 1TNMA 4L8DB 5HGAA 1CFVL 1T1YA 5EC1B 1V3LA 1QFUH 3CFCL 3BVNA 1RIVL 4NO5A 2MHAA 3L95B 3LKOA 4OKVB 4NO0A 1JRHI 4HAGA 2VXSL 3O3BB 3NCJH 4KROD 1NH6A 3MOBH 1ONQB 1T2JA 1T5XA 4YHKL 2JE8A 4P46C 3SDXF 4C4KT 1DBMH 3T3ME 4HBCL 5IHZA 4BK5A 4XX1G 5I74C 5INDA 3BKCL 3S3JA 4IRSD 4OCMC 4GAYA 2ATPA 4DTGH 2QADD 3CFDB 4P46A 1OGTB 1GGTA 1A1NA 5DUPL 1WWAX 1M7IB 3PNWA 3B5GA 4FXLA 1FL6B 3T0AA 3WS3B 4MQSB 3S88H 2D7NA 5ESAA 2LU7A 4ONFH 5I1EH 3CPLA 3K1DA 5BZWA 1Q9KB 2P5WD 4U1KA 4YNYB 3BIKB 3LH2L 1AY1H 3AAZA 4M6OH 4NZTL 1A6UL 4I0CC 1SY6H 3BW9B 1OF2A 2I27N 5LBSH 3O11B 4ZNEE 1XCTA 2GTWB 5SWSD 5SWQA 1SJXA 3DETD 2N1KA 2AEQH 4Y8AA 3HE7C 3MA7A 4IDJL 4P4KC 5JORB 4QT5A 1BVKA 1SJHA 4EUPB 3U0WH 1G7LB 1DN0B 3HE7A 2LVEA 3KXFD 1I3VA 4P4KA 2C3GA 1JIBA 1SBSH 3C6SB 3KPSE 3NN8A 2QKIB 1A7NH 1CFVH 4Z7WB 4OLWL 5K9JL 2C1PA 5GZNC 1NGYA 1JNLL 5JW4M 1XGRB 2XWTB 4HDIB 5F89A 2Q87A 2OK0L 5BRZD 3L3GB 1BFTA 3FO0L 4X6BB 3UBXG 5EORL 2FBJL 1WBXB 3P11L 4G7YL 3V4PL 1C08B 4YHKH 3KNBB 3VH8G 4HBCH 3QWRA 3PGDB 5E99L 3K4ZA 3HI1A 3S8WA 3BKCH 3H9YA 5JW5B 4N8PA 1GL4B 3CX2A 2EE9A 3I75A 1Q9OB 1TITA 5DUPH 1KLGA 4X7CC 1EVUA 5DHYA 2JB6A 1HYSC 4MNGB 2IPUG 2YUXA 2Y9RT 1UB5B 4IOFC 3PL6B 2DQHL 3CXHK 5DS8B 4C58B 5DJYB 3LH2H 2DIJA 2Y5TB 4NZTH 5IJKC 1TVHA 3QUZC 3OTTA 4LLVB 5HHNB 3SCMB 1OW0C 3BZ4A 4R97C 5IMLB 2G2RB 1I9JL 1S9XB 4UDTA 3X13A 3I2CL 4N0UA 4OZIB 5IJKA 5JHLL 1DTUA 1U3HD 3LRHA 1NBZA 3QUZA 1DZBA 4IDJH 3GHBL 1OW0A 1SJVA 4Y2OA 3NIGF 4WU5A 3SKOB 3SKNA 3WN5C 3BYYA 1D7FA 2VE6A 4PRHB 4KDWA 3VFRB 3EYFB 3FN0L 1AXSB 1AXTL 3FO1B 2YOCA 4XCEA 4PJGA 3BDBA 3Q48A 3WN5A 3IVKA 2K9UA 1YDPA 2ZUTA 4OLWH 3EYVA 1KJ2B 5JLZB 1RUML 1JNLH 4JHAL 4NGHL 3HAEA 3UEZA 1KPVA 4HWUA 2OK0H 2KDGA 3FO0H 5D1QD 5KJRL 1J87A 5EORH 1NFDB 2FBJH 5D96C 1MFCL 1MRCH 4G7YH 2NY1D 3OAZK 1A7BA 2AGJL 1XF3A 4B5EA 4EI6B 2X42A 5E99H 4HS8L 2D9QB 3RVXC 1U95B 3X14B 1OAQH 1S5HB 2JJVA 1QTYT 2LV4A 2FD6L 4WWKD 3CFDA 3U6RA 5H94A 2I9TA 3GIVA 2MCPL 4GRLD 3EDJA 1GGUA 1JV5A 2Z31D 1CD8A 3R8BB 4NWTL 2DQHH 3OSKA 2VQTA 1ZLWH 1XGQA 5EU5B 4RGOL 4QRSA 4Y5VB 1MRDL 4E5XA 1ZTXL 5GSRB 5AAMA 1D6EB 3BIKA 4IS6B 5TE6L 4FQQA 1I9JH 1JMXA 2HN7B 3I2CH 4YHNB 4ZXBD 5JHLH 1LO4L 1U8QA 5LAXA 4DVBB 3GHBH 3QHTC 5ID1A 5IVXE 2VSDA 5I30H 2LTQB 4AEEA 4KAQL 2H1PL 3MUJA 4R7NA 2PN5A 2JF1A 3QPQC 5D7JC 3W2DL 3FN0H 1AXTH 4ZODA 1G7LA 5SV4A 4HS6B 1MWAB 1CL7L 2ZP0T 4MCZB 3PV6A 1DCLA 2CQVA 5D7JA 3PHQA 3ZT5A 2X4SB 5DEGB 4JHAH 4NGHH 1K3ZA 4OLXL 3T0BA 3SGJC 3U2SA 3N85L 4OGZA 5KJRH 1QEWA 4Z7NE 2XWTA 1MFCH 1IEAB 3B9DA 3MCKB 2OZ4L 1W72L 1I9EA 3CU7A 4FHBD 2AGJH 4Y4FB 4CVWA 5HHOE 2X70A 4HC1A 1NCWL 1NGWB 1Q38A 4HS8H 4S2SB 1NUDA 3CC5B 1S7SB 4MNQB 1M7DB 1A02N 1XCQB 1IC4L 2PYEE 1OTSC 4J6RL 2FD6H 1QRKA 4XXDB 5D1ZC 2X41A 5CJQL 1DDHA 1T1ZB 3CK0L 5KW9L 1CVSC 3TVMD 4NWTH 3QDJD 4WIQA 3VFWB 1Q9WA 2HLAA 2OQJB 4HUKB 4NSKA 1II4E 2P4AB 1MRDH 4X99B 5D1ZA 4LCWA 2ZSVB 1ZTXH 4O58L 4LSTL 4D0DB 1I8KA 5JR1H 3DARA 1LVEA 4HJJL 3RNQA 1FL5A 3EDDA 1LP9F 3V6OC 3AM8C 3JUYA 1TMCA 1LO4H 5IMLA 2JB5L 3BWUC 2NX5A 5J13C 4DEPB 5C9KA 5JOPD 4KAQH 3V6OA 3AM8A 1D5IH 2H1PH 3WE6B 1IE5A 5C9JA 3R8QA 3W2DH 3MLXL 5F7MC 4PJCA 4M4PA 1CL7H 1WZKA 4JVUA 4GW4A 1ZSDA 5IBTH 2NXZB 4U6YB 1CE1H 5D5MA 2A2QT 1JHKL 1UH2A 4X5LA 2XWJA 4OLXH 1HHGA 3VXUB 4G8GD 2KUTA 2O5XL 1I8MA 3N85H 1C1EH 3WUZA 1MCHA 1C7TA 4F2MA 5BVPL 5DEZA 2OZ4H 1J88A 3DGGB 1NFDA 2WWMD 1GIGL 1NCWH 1AGDB 1XZ0B 5CZVL 3DX7A 3QUXC 1WCBA 3VMOA 1BOYA 1FO0L 3BN9C 4J6RH 1DUYB 1AC6A 1NDMA 3BKML 1YEKH 4GRMA 5HGBB 3RUGF 5CJQH 5IFAL 3QUXA 4PJ8B 3CK0H 1RJYA 4H0HB 4JCMA 2BCKB 2F53B 5FAAA 5LWYL 2GJZB 2VZ3A 2UWEB 3VXRD 5JPMB 2YSSA 4O58H 5LGJB 4LSTH 1F4HA 2DQFA 2OYPA 4HUVB 1JP5A 2DBJA 3ULUD 4POZC 4J8RB 3EOTH 4BQCA 2FR4A 2IQAA 4OB5L 2JB5H 1QD0A 3WLWC 2DM7A 5TDPB 5E6IB 4OJFL 4YBQC 2HTLC 4BELD 3MLWL 5I9QB 5DQJA 3G5ZB 1OQXA 2IBZY 3MLXH 4F7MA 4JANA 1WIPA 1KXVC 3LQZB 2EE3A 4JZNA 3P73A 2XA3A 2B4CL 4M00A 3VD3A 5C3LD 2VZSA 4MCZA 1JHKH 4HUNB 1A9EA 1RFDL 4LKXA 3HE6C 5HHME 2O5XH 4EXPX 4PJHE 4C56B 5D7KD 3C2SA 1IL1A 4ZSOA 2A73B 3FONB 1ZKAA 3NFPB 5FXCH 1F3JA 5BVPH 2VNCA 1IAIL 3RGHA 3HC4L 2UZIL 2DLTA 4DGVL 4PJIA 3X3FL 1GIGH 2CH8A 4JDTL 4JDZA 4OKDA 5CZVH 4QY8A 3LVEA 4PRAA 2YD6A 2XY1A 4X7TB 3OKMB 1FO0H 5DDHA 1KYOK 3QEUB 1RHHA 2J8HA 3BKMH 1ZGLB 1OP5K 5IFAH 1XIWD 3CFBA 3MJ8B 4AEFA 4AMKL 3IU3B 3HC0A 5E7BA 5DT1L 4LPTA 1HIML 1Q0XL 1SJEA 2DMCA 2IQ9L 2Y36L 4RFEA 2G9HB 5K9OA 3BIAX 4KQ4L 4X6CE 2AK4A 2CK2A 1N0XH 2W65B 5F9AC 1JPFA 1KCLA 3BFOA 3T08A 1RY7B 2WWKO 4OB5H 4DEPC 2EIDA 5A16B 3OKLB 1LEKB 5HVGB 1KACB 4OF0A 1KTLB 3QA3B 2YHGA 4OJFH 4XC3H 2NLJA 3EFFB 1ORSA 3FQRB 5F1IB 2OP4L 1KULA 5J6GA 4HWNA 3H6JA 1KG0A 2IPUK 1MQ8A 2CUIA 5J3HD 3CD4A 1NBQA 3JSSA 3TO4C 4LRIC 2B4CH 3D85D 1RFDH 4KMQA 2H32A 3MJ6A 2VLRD 4F80A 4LRIA 4MYWB 1K8DA 4MCYB 1KCGC 5KBNC 4EDXA 1IAIH 5SWZD 3HC4H 4L8BA 2UZIH 5C0AD 5F70A 4DGVH 5HYJE 1IGIL 1U42A 1J12A 3VXPB 3FZUD 3OV6A 4G6FB 1A6ZA 1GZPA 1J8HD 1IQDB 4AM0A 4WU7A 1KTRL 2ED9A 4LAQL 4KJPD 2CDEB 1MAML 1PFCA 4KTYA 3BWAB 3I9GL 3T3MF 1RZ7L 4W6WB 3GHEH 4CMMB 4LPCA 2X4PB 4JM2D 5B39A 5KTEH 3VWJC 3UO1L 2BVTA 3MCLL 4AMKH 1ZHKB 4HIXL 4AIZA 1M7XA 3O0RH 5DT1H 3VWJA 1HIMH 1GC1L 1Q0XH 3NCCB 2IQ9H 2ZOLB 3QWOB 2GITA 1UB6A 4KQ4H 3GJFH 1I1YA 2NY5L 2PNDA 4X80L 1WBZA 1TPXC 3C5ZB 2GSIB 1ZT1B 3NPZB 5EUOB 1CFSA 5IVNA 1G0XA 4A2LA 4L3EA 1MFBL 1YPZE 4PJAE 2P8PB 5CGYC 5K93A 2K7QA 4GS7B 2HT2C 2YPLE 1AFVL 2OP4H 3DO3A 4NJ9L 3H9SE 3KJ4B 4PJ5A 2G75B 4OZHE 2V7NB 5CZXC 2BVPB 4G9DB 3UBXB 2XN9A 4V1DB 1LO0L 4LQ1A 3VH8B 1UXWB 4Q9QL 5JDSA 4H25A 5E2VL 4C56A 1B4JL 4WEUD 1IT9L 3EHBD 1IGIH 1JMZA 3KHQA 4WRLA 4RGMB 1T1XB 4LAQH 2DQDL 1KC5L 1MAMH 3I9GH 1BX2A 4MB4A 3QIWB 1XGPB 1F8TL 3BT2L 4DOHB 4GUPB 3UO1H 3MCLH 4RFNC 1DL7L 3PDOB 1WJ3A 1ZGLA 4NBZB 4HIXH 3MLZH 2X4QB 2H9GA 4D3CL 5E1AB 1GC1H 2WMPA 1MCJA 3VMNA 4HK0B 3C5SB 2NY5H 3O6FB 4X80H 3E6FB 3V7AG 3E3QE 4WHTB 2J8OA 4H20L 2VRAA 4XP5L 5KSAC 1I8LC 2DYPD 5HGHA 2GJ6D 5DJ6A 3OKYA 4GAFB 1AFVH 1G1CA 5I18L 2R39A 4ZTPL 5KANI 4NJ9H 4LOUD 5KSAA 1P2CA 1I8LA 2OX5A 3ZHLA 2BNUB 1CGYA 3MRBA 3Q6FA 4YX2L 4B50A 1IM9B 1L7TL 3PJSA 4RDQF 4F7TA 2X4TB 2FJHA 3NPSB 5CEZL 1V05A 3D18B 2DQEL 1LO0H 3OKKA 5ACMA 3C8KB 3WNNA 4GH7B 2IADA 4Q9QH 2CRMA 5FGBC 1IM3A 4QRPB 2MPAL 5E2VH 1B4JH 1IT9H 2DIBA 2XTJD 4BFIB 2H6PB 1A21A 2VN4A 2EDHA 5FGBA 4ODWA 1U8KA 4U7KA 5C09B 3DURA 3MRPB 2DQDH 1C16A 2I60L 1KC5H 4TN9A 2BSTB 3H9HB 1KELL 4OLZL 2HFFA 1U6AL 4M1CC 3GI9L 4N8VG 3BT2H 3ZKXB 3O8XD 2ARJQ 1CXFA 1DL7H 2YWYA 3GI8L 3EIFA 3JXAA 2Q3ZA 4K2UL 2X4PA 3MRRB 5INCA 4LHQB 4PD4K 4YXLL 2JTDA 3AGVA 2E7BA 3ALXA 4CNIA 2PW2B 4QYOA 3L3DB 4CVXB 1S7UA 2FX7L 4CBPA 4JEGB 3U36B 3H9ZA 5LGHH 5D6DC 1WF5A 2W07A 5F6HJ 3QZWG 3AS3A 1FN4B 4H20H 3QHFL 1FL3B 4L9DA 4XP5H 2CO6B 3VCLB 2FEDD 2R2CA 3WD5L 1JZ4A 3DUSA 1HOCB 5D6DA 3V79C 1E4XL 5I18H 5IHLB 4ZTPH 5DO2D 3RWFB 1ZMYA 5DK3A 2R0ZL 5JXAL 2AXJA 5TF1L 1CS6A 1MIEL 2A6KB 2XKNB 5IVXF 5SX5K 5IB3A 4J4PC 4YX2H 5TDNB 2A74A 3MREA 3P0GB 1L7TH 1G7HB 2BK8A 1BVLB 2VLMD 5CEZH 1GZQA 1FNEA 2DQEH 2X9YA 4L8SC 4F7CA 2BVPA 4J4PA 4OV5A 1KIUA 4V1DA 2FCBA 3T3PE 3STZB 4L8SA 1ZE3C 4RBPK 4XNUL 2YXFA 3SDCC 3IDNB 4NM4H 2YPVH 3DMMD 4Z7NF 3G6AB 4PBWD 5ETUA 2I60H 5C0IB 1MSPA 4R4ND 3RPKA 5CMAB 1KELH 5MERA 1BQSA 1JNHB 1PAMA 1T20A 3C5JA 1JGVL 3F58L 4NFBA 4OLZH 2ADJB 4LMQI 3SDCA 4FNLL 3V5HB 3GI9H 1B0GB 5KOVC 1N6VA 5DRZA 5E95B 3ZKMC 5D7LB 1UM4L 5E94B 3GI8H 43CAB 4K2UH 5ISZB 5F7NC 4YXLH 4ODXB 5C86A 4HAFA 4RA0C 1G7IB 3BQUC 4A2MA 3PWPA 2FX7H 1U8IB 4R2GC 4J3VA 4APQD 3W5MA 3RRQA 5E1AA 5T1KA 4UUJB 3ZT7A 1KTDA 2Q86A 3BQUA 5IQ9B 3QHFH 4X7SL 4Q9CA 3WD5H 3KYAA 4BSJA 4XVUD 3ZSSA 1K6QH 4HUUB 1E4XH 4HKJB 4G9FA 5JXAH 2OJEA 3E6HB 1MIEH 1VKXA 2VUYA 2ICCA 4ZOEA 4KRNA 2OZ4A 1W72A 1YN6B 2E7MA 3A67L 5IVZA 4OZGB 1U8JB 1OTTC 1P7QD 3DTXB 5EU6A 2I25N 2ZG1A 3MXWL 4ETQA 4PP2B 3HPJA 1CICD 2OJZH 2X4RA 3L5JA 4U1IB 4RGNC 3U82B 4NKOB 2DWEA 4L4VA 3S3SA 4BUGA 4L3CB 4HUXA 2AQ3A 1R6VA 2V17L 4XNUH 4UOJA 5FIEA 2NY3B 1B2WL 2E9IA 3O45B 4XAKD 2B20A 4HFUL 3S5LG 1A6AA 3VXNB 4I3GA 5FO8A 3BZEB 3PE9A 4Y4HC 2QBWA 1JGVH 1UGNA 2W1NA 1FSKC 3F58H 5EOCL 4X6DE 1O7SA 4Y19D 3H9HA 1X5FA 3FO9A 5KS9E 4U1GC 1UM4H 3IDMB 1D9KD 3IDGB 4Y4HA 5ELIA 3BUYB 3RUGA 2F15A 4HV8A 5JOFB 3U46B 5JMOC 4JR9L 5C0DB 3DUUB 3BD4A 2C3WA 4MJ6A 5M7QA 5FK9B 5BS0A 5T1LD 1LNUA 4Y2DD 3U4EA 2PCPB 4X7SH 5C08D 3W0WD 5DLML 3VE0A 2CLZA 4JG1L 1FLTX 3F7VA 1QFWL 1YEJL 4QRRE 3KDMB 4Y5XB 5GS1C 1P1ZB 1J05A 5CP3A 3N50A 3RU8L 4PLOB 4ZAKC 3ZDZF 5KVDL 3VGAB 1ERNA 4MMXC 3ECBB 5GS1A 5E8NB 5GGSY 1CGSL 1N0LA 1X5AA 3RGVC 2XWBB 1RJLA 1F11A 3A67H 3FN9A 4ZAKA 4BZ2L 1LE9B 3W5NA 3PDGA 1P5UA 1G7HA 5GRJL 3MXWH 4C55A 3ARBC 1H15B 5DJZB 5DHVB 3RGVA 5IEKB 4OF8A 1FO0A 3KPMA 1KF9B 4PRPE 3MGOA 4UQ3B 4PJHF 3RTQD 3ARBA 2V17H 3NZ8A 4CMHB 3STZA 3MOQA 4KK9C 1B2WH 2DJ4A 4HFUH 1IARB 2YZ8A 5GZOC 2I9LA 1OCWL 3NCMA 5D2NB 3IDNA 5T1MB 1PG7W 2GSGB 3DYMA 5EOCH 5K33A 1AO7D 1U8LA 3PWJA 4QCIA 1KIQB 2ZUQB 3FRUB 4WNQB 4GKZA 3GMNB 3IDIA 1Y18B 2ADJA 1W0VB 3G6JE 2GYSA 4U7SA 1B0GA 1R3HB 4HGWB 2F8XC 1NANH 3ES6B 4K7PY 3TNMA 2MMXA 2VAAB 4JR9H 4G8GE 4NHUB 2ZJSL 5L9DL 4QF1A 4RNRB 4M93C 2B4CC 3OKEB 1AQKL 2WM0A 1MI5E 5EOTB 1TVDA 1DE4B 4JG1H 4TUOA 1QFWH 3MLTB 3QUYB 1YEJH 4JHZA 1N4XH 1FVEA 2HJKB 3G5VA 5KVEL 2BVQB 2EDYA 3SGDI 5DURB 2VOTA 3RU8H 1FIGL 1TVBA 1KSRA 5KVDH 5TFSL 2VTFA 3HZVA 1CGSH 4RZCA 4ODUA 3NH7L 4BZ2H 2EEBA 4KK6C 5EBMB 1JI2A 3N1PC 1X3DA 4NQEE 5GRJH 2FSEB 3VXMA 3QFJE 1U8JA 4LKCB 3ULUE 1IC7L 2FJGB 5ICYB 3TA3C 4JRYB 4FQCL 4LLWB 3BP4B 2NY3C 1I4FA 3GMLA 4KMTL 3BSZL 5F1OB 3QG6A 3PWLA 1UG9A 5C6PB 5DTFA 3TA3A 4IRJC 3UPAA 3ILPB 4PGCA 4MS8D 4PIRF 3KJ6L 4HH9B 3NGBC 2DF3A 5D1XB 2BVEA 4U33A 5CEXB 3GJFA 4IRJA 1JNJA 2YKLL 1T21A 4NKDB 3STLB 3BUYA 2ZJSH 4K71C 2IFFL 5L9DH 4FMKA 3GSVA 4HJ0D 4HWZB 3U46A 4A6YL 1K85A 1INQA 4KKCC 2J8UB 3VFUB 2R4SH 1HHHA 3ARDB 3VD7A 5GS0H 1NJ9A 2E6JA 3UCRA 4UIMB 1DBAL 2W0KA 3P0YL 4LHUD 5KVEH 4QEGA 1FIGH 1YMMB 2KL6A 4PJAF 4X0KB 4MJ5A 5C2BL 4H8WL 1JPGB 5KG9B 4LCCC 5TFSH 1KGCD 2DRUA 3RJQB 3O4OC 3CNKA 3QDGD 3HRZA 5EUKA 1XF4B 2DLHA 3NH7H 3G6DL 3QULA 1IILE 1MFDL 4OZHF 4PJDB 1RUQL 5EH1A 4UQ2A 2VYRE 3VXSB 4LNVA 3KPSA 4U0QB 1EBAA 2B8OT 3JWOH 2JK5B 1OM3L 3VD4A 3MLPA 1RZ8A 1IC7H 1QR4A 4RQQB 5FO7B 4FQCH 5GRUL 1FFNA 1XR8A 4KMTH 5IF0B 2AERT 3BSZH 2CR3A 5FYJU 4NQVB 1P4LB 2PKDA 4Y1AB 2AV7A 2V2XB 2VLKD 4NCDA 3MACL 3B4NA 4NO2A 1GGBL 2WBWB 4Y5YB 2YKLH 2YPKB 1MEXL 2LE9A 1TQBC 4LGRB 4NQXB 5JZ7D 2AI0L 5T3XD 1R3HA 4WI6A 2IFFH 1RZIB 4XP4L 4CADB 4DKEH 2EH8L 5HGGS 5SWZE 3X17A 5F21B 2O5YL 1HHJB 4FN0A 2Q76A 4MSWB 4GRWF 1DVFD 5A43C 3MFGB 2ILLA 4PG9B 3T0DA 1U0QA 1DBAH 3P0YH 2BY2A 1GVIA 3Q2CA 4FTVD 1NCAL 4OIIL 5EO9B 2COQA 3I3BA 1N59A 5C2BH 4H8WH 4ZO8A 3LRSA 4ELKA 5TJWK 1KCSL 5E8OA 5C07E 5I8KL 3WXVL 1ED3A 3ZDXE 3G6DH 3QQ9C 3QXUA 1MFDH 1OQOA 4XC1L 1RUQH 2PW1B 2V2WB 3ILQC 5IB1A 4LVHC 4QKXB 3GSOB 4HIHA 1B0RA 5D2LE 1OM3H 2AQ2A 5GRVL 3C60B 4DUXA 1S78D 2I26N 5GRUH 1I1AB 4PJ9C 3L3JB 5L2KE 3DVFA 5CEYA 1AGCA 2FJGA 4N8VB 4U1NB 5DVKA 1HKLL 4PJ9A 1PYWB 1JWUB 3EGSB 5JUEL 3MACH 4WO4B 1QLRA 4CN4A 3ARXA 4ODTH 2P7TA 1P6FA 3L6FB 5DA0B 3DXAE 5ACZB 1LILA 2DJSA 3QZWB 3ARFB 2AI0H 2HRPL 4LNRA 1CXLA 3RQ3A 4XP4H 1HINL 2EH8H 2QTEA 5FA4B 1PKQB 3WIHL 2C7UA 2Z8SA 3LKPA 2O5YH 2RFXA 2ITDB 4NO0D 3BPOC 5DSCB 4DN3L 5DRWB 1C12B 5DJDB 2OXGA 4OLVL 4BFEA 5IJVB 5DUBA 1KEGL 2FH8A 4JPKL 1CDYA 3VFMB 1NCAH 3SKJL 4X9FA 4OIIH 1QFPA 1T22B 4KXZH 4D9QE 1YMMA 5DWUL 5IVXA 1KCSH 4P5TB 4LVNB 4P46D 5I8KH 3GZKA 5AG9A 3QQ3A 5FYJD 3WXVH 1JHTA 3AREB 4XC1H 4XPFL 5CUSL 3T65A 4OGAC 5IB2A 3WDHA 4F7PB 1S8DA 1EAPB 4IHOA 3WFEL 3SGEI 3VXSA 3WHE1 5SV3A 4HMDA 4POUB 3MC0A 1ETZA 3WO3B 3L5WB 1K4CA 1BQHG 4AIXA 3D39E 3MUY1 1R3JA 5EZOL 1HKLH 4XMPL 5HDBE 1QA9B 4P2QB 1MCBA 5I1LA 5JUEH 5HHOA 2YC1A 1BEYL 3HE7D 1BQLL 3DO7A 3AU1A 3ZE1F 3FQWA 1N6UA 4P4KD 3CDGA 2PYEA 3QCUL 4F58L 1CVRA 2ARWA 5T33L 2J1KA 4PJBE 2HRPH 4U1SB 1VGKA 1HINH 1MELA 5EPMB 1F3DH 5IMKB 4CVZB 4JFDB 1MUJB 4MD0A 1OAZL 3GDBA 3K8LA 3L3IA 3FB7B 3D3VB 4RRPA 4DN3H 3K2UL 3T09A 3ET9F 4OLVH 5GZND 5CIPH 4WW2B 5I19H 1JPSL 1KEGH 2ZUXA 4ZUTA 3QWRD 3SKJH 4MNHB 2D4FA 5IEHA 1YEGL 4AH2B 3QXTA 5DWUH 4MZ2A 3F7YB 2W0FB 3JWNC 2R1XB 3OPZL 1LQSR 5L6YH 4JDVA 3O3DA 2NY2B 3MRQB 4XPFH 3FRPG 5CUSH 4MA3A 5I6XC 2WBJB 3HI6H 1B6UA 3IDYC 2Z93B 3HG1E 2Z91A 4W68A 1MIML 4NCC2 1AIFB 4K8RC 1NGQH 4NUJB 4F3FA 3S5LB 3WFEH 1HYSD 3BH9B 1QR1A 5FF6B 4E41B 4V3DB 3D25B 4WFHD 4IOFD 4PGZA 4F33A 3RPIA 4F7EA 4HFWA 1X5ZA 1AC0A 2NY4C 2HJLB 4OGXL 5EZOH 4CW1B 5CSZB 1P53A 3QUZD 2V2TB 2ADIB 1A6VL 2BNRE 3JTSA 1IEBB 4JREB 4BUHA 4RWHA 5A2KH 1UCBL 1IC1A 2KH2B 1BEYH 1BQLH 4WO4A 3REWB 5EO1A 4PR5B 4X6DF 3QCUH 2AQ1A 3SEPA 5T33H 2G60L 1RJZB 1FFQA 1HSAB 1E0OB 4DKAA 4HW6A 3CFJB 5E1HB 5DMIL 5IR1A 1TZIB 1QRNB 1EEZA 2D7OA 2IJ0C 2KPNA 1OAZH 4JY6A 4Z0XA 3K2UH 1S3KH 4FXKB 1GOGA 5ANME 1JPSH 2QSCL 4TPRH 5AD0A 4LBEA 3WNLA 4PV8A 3DOSA 1YEGH 3WXWL 5IMMB 1WZLA 1Y6MR 2UVEA 1ES0A 1T22A 2WINA 3OPZH 2FHFA 2Q3AA 2UY6A 4MD4B 3RVXD 1T0MA 2VKWA 4NFDA 2CR6A 3RY4A 2EYTA 2QSVA 1JTPA 5TE4L 1MIMH 1BWWA 1SBBA 1KIRA 3ZDYE 1EAPA 4ZFGL 2Q7NA 8CGTA 5IOPA 4XCNB 1AHWC 3RZCC 4I13B 3V0WL 1LD9A 5K9QG 1EZVX 5HHMA 3FFDA 1N6QL 4PJHA 4ONHA 1U41A 1D5MA 4D9LL 3L1OL 4K9EC 4ZUSB 2VZOA 4OTXL 4OGXH 4OFVA 4LLYB 4X8JA 1AHWA 3RZCA 4EVNB 3SJVB 1A6VH 1LK2A 5D9SA 2PTTB 2A83B 2NCMA 5IT2L 2A0LC 3RDTC 1UCBH 1JYXA 5DFVC 5BXFB 3QDMB 2N4IA 4LPWA 3IGAB 1FFPB 3F7QA 1BWMA 2G60H 3RDTA 3G6JF 3LKQB 3QPQD 5D7JD 4JAMB 2XZAL 4PGBB 4LCIL 2KKQA 4L29B 1C5CL 2ZOKA 3VD5A 2CKBL 1CQKA 1JF6A 3SDXB 1CQYA 1UQSA 1HH6A 1NAKL 4NT6A 2BSRA 3ULSA 3BKYL 4UDUA 4X6CA 1SVCP 3FN3A 1YEDB 2QSCH 4N5EC 1AGBB 4LHJB 2DKUA 3D9AH 4D0CA 1FYHB 1MCQA 2ADGA 3CSBA 1KJMA 3DI2B 4XNZC 4RAUA 1EMTL 2OTWA 3WXWH 1X9QA 1KB5B 4N5EA 2ICWJ 4HLZH 1FC1A 1BBJB 2P8LB 4G6AC 5MEPB 4YDJB 1IGCL 2EYRB 5EU7E 3IFLL 3D87B 5T5FH 3E0GA 5KANG 5J9PB 3MNZB 5TE4H 2BOCB 1OTSD 3N0PB 3O4LE 1QSEB 4Z78B 4IOSD 5D1ZD 4LCWD 2W91A 3T8XB 3LN5A 1X5HA 4KK5C 3V0WH 5C08E 5IGXL 4KVNL 1N6QH 4MDIB 5FCUL 4D9LH 3ULUF 3PWNB 2HH0H 3K8MA 3BAEL 4OTXH 2NTFB 5HYJA 4NN6C 2NX5D 5E4EB 5J11B 3B3IB 4CDHA 5IT2H 1P7KA 1HNFA 4XCYB 3OXRA 5EDXA 1FAKT 4GBXC 2EIZA 5DJ0B 2EDKA 1ZHBA 1G7PA 1UWXK 2AAVA 4JJ5A 4YHMH 2HJFA 4GBXA 3BHBB 5BO1H 1XH3A 2GUOB 4YIQA 2XZAH 1J86A 3DRQB 4LCIH 1A7PL 5IROA 2CKBH 5HHQA 1S7VA 1I1CA 1NAKH 1E27B 3BD5A 4Y16B 3V5KA 4PYGA 3BKYH 4FFZL 5IW6A 1TZHB 4UV7L 1XMWA 5I75C 4YPGB 1MVUA 2VLLA 1EMTH 1S7TB 1YPZA 4JN2B 2FX8L 4PJAA 3I02B 3DWTA 1UACL 3H3KA 3ARRA 2YPLA 3CVHB 2ZUVA 1IGCH 3H9SA 5I0ZA 3IFLH 3LKNB 4O2FB 3QUXD 4QHUA 3GKZA 3HA0A 3NABL 4XT1C 1E28A 1OLLA 2MNUA 3BN9D 5E8EA 5IBLC 4NC2B 2BMKB 4FG6C 3O9WB 4KVNH 1KOAA 3BPLC 4PP1C 4MA7L 5FCUH 3BAEH 3HNTL 3OR7B 3JV4A 1MCEA 5H35A 3ORJA 1QZ1A 5J1AB 4GMSL 4MJIE 2VO5A 1AGEB 2CIKB 4LLYA 1ZA3A 4POZD 5F9WC 5IW3A 4YE4L 2MKWA 2HWZL 3GGWB 4W81A 4A6YA 1KIPB 1EV2E 4WDIB 2DLIA 3IRZA 4JFOB 3WLWD 5CIPB 3MRDA 4I3SL 1K8IB 4I1NB 5BXFA 4YBQD 1Y0LA 2HTLD 5ICXA 4H8WC 3OKDA 4RDQG 4NQCB 4L9LB 4DJMA 5DMJB 1J5OL 4PS4L 3IXAA 3UTPD 1A7PH 3VI4E 4U31A 1Q72L 4G8FB 3MRNB 3NMEA 1ACYL 3E3QC 3WNOA 3IFNL 1KT2A 3AC0A 4FQPA 2F74A 1NCBH 4MLIA 4FFZH 4X4XB 2Y07H 3E3QA 2BNQE 4UV7H 5I66B 3P3YA 4X4ME 3EW3B 1MQKL 2ZPKL 4X6EB 3MRGB 2FX8H 5I71C 3S4SG 1CDJA 1UACH 2CLRB 1NGZA 2V5MA 2F54E 2W60B 3L5HA 3OJMB 3BJLA 5CCKL 3MYJB 3BGFB 4X5WA 3T77A 5HYQA 1SEBB 3NABH 1ZGLM 3TT1H 3DETC 2FO4B 1ZWIB 4F8QA 2BSED 3CXDL 4YPJA 4Z78A 4FA8A 1S7WB 4HZLB 5D2LF 4MA7H 4K7FA 5ILTL 2AK4D 4M3KB 1YY9C 3HNTH 4YAQA 5LKNA 5E4EC 1GPOL 3MUGA 3UPCA 5I15L 4GMSH 1FE8L 4LL9A 5CWSA 4N1HB 2YD8A 4MA1C 4YE4H 5IG7B 4NPYB 4QHMA 5F9OL 3QQ4A 1U8MA 4I3SH 5KN5B 3P2TA 1T0NA 2PYFA 5KOMC 4L8CB 1J5OH 3P9LB 4PS4H 3NACL 4WUUE 1T4KB 1H3TA 3GKWL 3ULVE 5DHXB 3BHBA 1ACYH 2ZCHH 1HXYA 4WJ5B 3IFNH 1UZ8A 2OTPA 4J3SA 3WDJA 5T3ZE 5F88A 2A1WL 3TN0C 1JF1A 3V6ZB 4QRQB 1Z9MA 3P4NB 5KSBB 2ZPKH 4YDVB 4B7LA 1TZHA 3WIFB 3QFDA 3TN0A 2R29H 4YO0A 2FATL 3QI9B 5IMOA 2RJMA 4XZUA 1KXQE 2YD9A 3LDBC 4XCFL 1JPST 5CP7B 1YZZA 1JZ6A 2IANB 3ZLQC 5JA8B 4UU9B 1AQDB 3DX6A 1BQHB 1LP9B 3WMSA 1VADA 2LVCA 3VWJD 4S10A 3CXDH 3FKUS 2OI9C 2K1MA 1R5IB 5GRYA 1K5NB 4ZOAA 4CGTA 1Z9SA 5ILTH 3G5YA 2APWA 1WICA 3GMOB 1A1OB 2I5YL 1GPOH 4OZFA 1XAUA 4L3ED 2P24B 2OI9A 1FE8H 4RMVA 4M7LL 2X9WA 3B8SA 5CILL 1QOKA 3BP7A 3WIHA 2FJFB 3RWHA 2F5AH 2P5EB 2OL3B 5F9OH 5EN2B 2VC2L 5TDOB 5E6YA 5HDBF 4PJ5D 5GGQL 5CGYD 3UPRB 1B9ZA 1BJ8A 2HT2D 5DRNA 4EN3B 3T0EE 3QNZA 2XN9D 3NACH 1N2RB 2FYYA 3GKWH 3OHXB 5CZXD 4LVOC 1KNOA 3K2MC 3BZFB 4G8FA 3PQYE 4DN4L 4C56D 1RQ5A 2A1WH 2XT1B 5FB8B 5HYEA 4P2RE 1RZJL 4NO3B 4Q9BA 2P42B 3SE4C 5MENE 2DAVA 5AYQA 2VDLL 2DQJL 2Z35A 4LLMA 4XPHL 4ZUUB 5L8KB 1V7NL 3AXLA 4PTTB 2FATH 3TF7C 4XCFH 1A14H 5FHBH 3SE4A 4H1LH 3IETB 3NTCL 4MAYB 5DRXA 1VSCA 3TF7A 3IB4A 1ZHNA 3T1FA 1YJDC 1SEBA 2G5BA 3NFNB 1L9NA 5SX4H 3NFSL 4KY1L 2A6JB 3ZL4L 4NRZB 2W9DL 2OSLB 2I5YH 3EJYC 3FT3A 5CILH 5DD1L 5J56B 2BHYA 1X5IA 3U9UA 4M8QA 1JZ3A 3VA6A 3CFIC 2DLEA 2VC2H 5KSAD 1NC4B 3FQUB 1GXEA 4P9HC 1NGPL 4X6DA 4DFHA 4I2XE 3GSQA 3E2HB 1IGTB 5KS9A 3HN3A 4PRBA 1ZVSA 1EEYB 1U8PA 1RZKL 2X44D 5MP6L 3LPGA 3RWDA 5HY9A 5E00A 2EDFA 3QUKA 1SYSB 4DN4H 3SY0A 4Z8FL 3EYOB 3KS0J 4XTRC 1LQVA 2FEEL 1LK3H 1RZJH 4ODHL 3TBSA 4ZUVB 5D7IF 3WCYA 1R3LB 5TGBA 5KZCD 2VDLH 2DQJH 4QRRA 3DROA 2ERJC 4XPHH 1CLZL 1V7NH 4PJ7E 5F71A 4F37F 4EXKA 2JCCF 4QRTA 2R69L 2XACC 3MLYL 5DC0A 2MJWA 3NTCH 4JLRA 4M1CD 4JRXB 3D0LB 3V4UH 2SEBB 4V2CB 4EDWL 3LKSA 3WJJC 4M02A 3GMRB 1RK1A 4MB3A 5FA3B 3NFSH 4KY1H 2A6DB 1UYWH 1FV1B 1BD2B 2IH1A 1V3JA 1YNTB 2DMBA 4J1UA 3ZDYF 2W9DH 3WJJA 3G9VA 1HDMA 4PRPA 2ZCLL 5DD1H 2EIEA 2NZ9C 3RAJL 4JN1H 1M4KA 4JY4B 5F7LB 3KLSA 2YS4A 4XP6L 4WI7A 4YHIB 1UT9A 3DV4B 1CE6B 4BSVB 2UUDH 4IMLB 2FJFA 2CRYA 1NGPH 1YN7B 4DCQA 2Q1EA 2NYYC 4YFEA 1BFOA 1G6VK 4Q0XL 2MQCA 1J18A 1JN6B 4B0MM 3QQNA 1RZKH 2Z92B 4J4PD 1JJUA 3DX8A 3TIEB 5MP6H 4XPTL 5I2IA 3T1WA 4V1DD 1BLNB 3B9KB 3KYMA 4HHAB 3WLBA 4GG6E 1EFXA 4Z8FH 3HR5B 2YD3A 1NUFA 3VRIB 1BFSA 1MI5A 4ODHH 4P2OB 2X4UB 5EFIB 3QO0B 4WI3A 4M6AA 4ZS7L 3VI3E 5A3IC 5JHDE 5I1KL 3MX0A 4U6HA 3SDCD 2DI9A 3BRFA 4EI5C 5IFJB 3VG9C 2R69H 3L7FB 3O6LL 3TCLB 4M9OA 1I3GL 3FB5B 3MLYH 5I1IL 2FDBP 2H8PB 3H3PH 2XZZA 4K7PL 1A22B 2UYLA 4EI5A 3WL9B 4PJEB 4MWFA 4EDWH 2MQ0A 1MLCB 5DD6B 1HN1A 3ZKMD 3PWPD 3ULUC 1FH5L 3OX8B 2ICEA 4NQEA 4PGEB 2UVFA 4OZ4B 3QFJA 4I4WA 5T1KD 3UTZA 3VWKC 2V5SA 3BQUD 3FHAA 5FDYA 3HCVA 1PEZA 4LQFL 4M6MH 4R2GD 4X7FC 2ZCLH 3WS6C 4Q9RL 3O2DA 1Q94B 3RAJH 1VEPA 3KPRB 4B41A 5IW1A 3BEVA 3VWKA 1XF1A 4XP6H 1C7SA 4GG8B 2WP3T 3I6GA 3O3AB 4G9FD 4YGVB 5ALCL 5E9DB 2CKBA 1JZ5A 3LAFA 3G5XA 4EOWL 4LFHD 4ODSH 3IDUA 4HS3B 1IAIM 2WY3A 4JFPA 3W39A 4X4YA 4MXWL 4O51B 4Y4KB 2AXGB 2R2HA 3RL1A 4NC0B 5EU6D 3H0TA 4NKMB 3OJVC 4XPTH 3VFTA 3MR9B 5EBLB 4MLSA 2DTML 4R4BB 1EK3A 4URTB 1NC2B 3TPUB 1YY8A 4L4VD 3S7GA 4MHHI 2AJYL 4C83B 1AD9A 3EFDL 3FQXB 3EYOA 3OB8A 4RGND 4TUJB 5E7FA 5IIEA 4OAWB 4ZS7H 4E0RB 4ZFFA 3OJ2C 5I1KH 1HHIB 4LRNL 3OKOB 4ZOBA 2B1HL 3WDIA 3O6LH 2H26A 1FJ1B 2ZSWA 2HMIC 1I3GH 5L0QB 1VEMA 4Y4HD 4D0BB 2B5IB 5EULV 2GAZB 4Y8DC 5BQ7A 3A6BL 5EBWA 1NPUA 4Z7WE 1FH5H 3S9DB 4JRXA 2SEBA 3RWGB 2BVOA 5BS0D 4O2EA 5E56A 5KSUA 2WZPD 2APVA 1WC7B 3ARGC 3IF1B 1NL0L 1F6AB 3LD8C 4MD5A 1U8NB 4Q9RH 1NDGB 2C1OA 3P4MB 1HSBB 2OTUB 3E8UL 4I0PC 3SDYL 3ARGA 3V8OA 5ALCH 1X7QA 5IB5B 2CDFB 5C3TA 1DQLH 1MJUL 1H3PL 4ZFOA 4EOWH 4I0PA 2ED7A 1EVTC 1TQCB 2OR8A 5EO0B 4MXWH 1DUZB 4ZAKD 4MNGE 1JHLL 4OF6A 4DGYL 3W9DB 5I1AB 4G7VH 2DTMH 2Z92A 3RGVD 2C4FU 3I6KA 4X6FB 1S9YA 4QOKB 1OD7A 4WTZG 3S4SB 2AJYH 1OT1A 2H41A 5B8CC 5C0GB 1H8OA 3ARBD 4PB9L 1QBML 4K23L 4UOW0 3KPNA 3FFCB 4OZIE 1D6VL 3A6OA 5EZLA 5H37G 1VB9A 5C7XL 5B8CA 3G08B 4R6UA 1U8OA 5CD3A 1CG9B 4O4YL 1GCFA 3HHRB 4KK9D 4LRNH 2ZNWA 2B1HH 5GZOD 4PRHE 3P4OA 5DD0L 4EIGB 1IZKA 5DJAB 3FB6B 1RUKH 4XWOC 3UTSB 5C07A 4HEME 3A6BH 3OZ9L 4TTGA 3MV9B 2PO6B 5FOBA 5T3ZL 4Z7UF 4U3XA 1A64A 3TJEL 1IVLA 2BXZA 2H3NA 2E7CA 1ZAGA 5D2LA 4KDVA 5DK2A 43C9A 1NFDE 1NL0H 1VFAB 1CFQB 2Y06L 2VH5H 2VITB 3U0TB 1QSFB 4N9GA 3UTTB 5L2KA 3E8UH 3SDYH 3U0PB 4MAUL 3IAPA 2R1YB 3N1QC 4JQIL 5KSVA 1CLYH 2IPTH 1MJUH 1H3PH 5DFTA 1HYRC 4YGVA 4AT6B 3GUTB 3GM8A 5CGTA 5JNYB 1JHLH 3ZTNL 4DGYH 3DXAA 3IXTB 4YDLB 3QH3A 4O5LL 3VXMD 3MRFB 5DGRA 3PWUB 3RWEB 2Z8WC 4NKMA 4WTWA 4KK6D 5IWLC 3BPNC 2WLZA 3ULVF 5DF0A 1F6LL 1FFOA 1UKSA 1QBMH 2FL5A 4K23H 4PB9H 3SO3B 1CZ8H 1RIUL 5JO5A 1D6VH 1A4KB 2CLVB 3Q5TA 5C7XH 3HRPA 3TNNA 4KTEL 3TA3D 2NY3D 3MNVB 1KCVH 4FXGA 1JGUL 4HQQL 4O4YH 2DS4A 2GTZB 4FQLL 3QBTB 3CH1B 5DJ2B 5GIRB 3HS0A 3IDJB 4IRJD 1YEHL 2GT9A 2FWOB 1JFMA 5DD0H 5EU4A 2NW3A 5F7YC 2YN3A 2DICA 3OZ9H 5T3ZH 3EYUH 5I76A 2CDGA 3MCG1 4LEOB 1AD0B 3CSYA 4DZBA 3D2UA 4Q74A 4Q97A 4AIOA 2JJWA 3THML 4XBPA 3BH8A 4JVPA 5CBAB 2Y06H 1I7TA 1ADQH 1JGEA 3C6LB 4LOUC 4N1CA 4KKCD 3EBAA 2AJ3B 4MAUH 3L7EB 4WV1C 5GISL 4CL7A 5HHPA 3D39A 3SE8H 1HH9B 4MNQE 1XR9B 4K3JL 3QIUC 3QJFA 1KCKA 5FGSA 4WV1A 3ZTNH 4KKBC 3QIUA 4O5LH 3DYOA 2V7HB 3UZEA 3KPSD 4RMSA 4WFFD 4PJBA 3ZTJH 5I1AA 3C8HA 5KVGL 1FZKA 4OM0L 5L88L 3T0VA 1FYTB 2VXVH 4QRUB 4KRPB 1MLBA 4XVTL 4D9RE 4H1LA 5ICZA 4Q2ZB 1RIUH 4NC1E 3L9RA 3B2UC 2ICES 2ESVB 4HBQA 4UMGA 3OB0H 3PIQA 4HQQH 5J89A 1AI1L 2EDOA 5E8DL 2XNAB 4PJFF 2YEZA 4QXTB 3SDAB 4LSSL 3OXSB 4IJ3C 4MX7A 4LPXA 2Z4QA 3I3DA 1YEHH 4XI5C 5B38B 3AMLA 2E9BA 1T1WA 1I8IB 5D6CB 2Y5EA 3CDYA 4P23B 1BJ1J 3FAXA 5I1CL 1G6RL 4YUEL 2VL5A 3VXUE 3HG1A 4PV9B 1ZLUH 4KV5E 4BJLA 1KYOJ 3THMH 2AJXH 4JFFB 2H45A 3QEHA 5AAWA 3M17B 4KJYB 4U49A 4ZNCD 2QHRL 1BOGB 1MCDA 1H0DB 5GISH 1LEGB 2NW2B 3UTTA 1T7VA 5IM7B 2VISA 3IT8D 3D69A 4MGXA 4K3JH 3D6GA 1RZJC 3SE9L 4OF3A 2BNRA 4F9PC 4FP8L 2EDEA 1ZS8B 1JUFA 1IZJA 2XPGB 5ERWB 2R2EA 4LDOB 3MBEC 3MGTA 5DJXA 3P9MA 3GUTA 1J0YA 2NPLX 2EKJA 4PRIB 3RIFF 2IBBA 4JPIA 4F9PA 2IEPA 3BDYL 1OSZB 4LIQE 1XGUB 2F53E 2EDNA 3MBEA 3BN3B 2UWEE 4KGLA 3VFPB 5KVGH 3QQ9D 1C5BL 4QLRA 4OM0H 3FT2B 3ILQD 5L88H 2E27L 2ARJB 1F13A 4XVTH 3VFSA 5J8OA 5GGUB 4G42B 5J6HB 3KPLA 4BH7B 1ZT7A 3BEWB 2VJXA 4PJ9D 1AI1H 5E8DH 4POYA 1EHAA 5ITFA 4LSSH 2NY6C 2HFEA 4RISL 2QL1A 5BZDB 5E4IA 4QGTA 1XF2A 4PY8J 4PJ7F 1A5FL 4GMTH 4GKNB 1YUHA 5I1CH 2V9RA 1G6RH 4JCLA 5E6ZA 4PJXB 3CSGA 5LCVL 4C56E 1R5WB 2NXYC 2ITCB 5F1NB 3SGKC 4XVUC 2M1KA 3STBA 3HZMB 3OJDB 4YR6B 2NY0B 1BZ7B 2QHRH 5F97E 3SGKA 1JGDB 1F6FB 2W92A 3QIBC 4ZFZA 1VESA 1TJHL 3L7EA 1A9BB 4FP8H 4PREB 1YMMD 4HK3J 1S7QB 3QIBA 3MOAL 3RI5F 4EZMA 2V6HA 3PABB 3ZKQD 2D3VA 3AS1A 3BDYH 4S0SD 1VDGA 2E8ZA 2OCFD 2DDQL 4KHTL 1MJJB 1C5BH 3VXSD 2HVJB 2E27H 2BSSB 4OGAD 4P4RA 4RAVA 1EGJL 1I1FB 2VLJB 1U93B 4C4KO 4W70A 1RHFA 4F8TA 3O6KL 4RFOL 4YH6A 2J4WL 3LMJH 1NMBL 1PZ5B 1V8HA 4DK3A 3U9PL 3W9EB 1LO5B 4YHYB 5HHOD 5I17B 5AUMA 4ISVA 1T03L 4RISH 4ALAH 2IH3A 4NNXB 1IC5H 1D5XB 3A0OA 5EU7C 3V0VA 1E6OL 4HIJA 3MRHB 3OXSA 2PYED 1G0DA 1A5FH 1XF5B 1WISA 1PD6A 5B38A 4PJGF 4L4TA 1XFPA 1K4DA 4R90L 1QFWM 4I18B 4NQDB 4GW5B 2WIIB 4NQTA 3OB0K 5LCVH 1R3KA 1U3ZA 2C5DC 3O4LA 4XX1E 3RKPA 5C0CB 1OB1A 1KB9J 3MRIB 1HI6A 5FM8A 5GJSL 2NTSP 2X4OA 3CDFA 2ORBL 1PQZA 4LDLB 3AROA 4OBRA 1LO3L 3MMEB 4S1QL 5FKPB 5B21A 4Z77A 1BOGA 3M8OL 1TJHH 4U1LB 1LEGA 3MROA 4R3SB 3MOAH 1JI1A 3NAAH 4PRDA 1X5XA 4AENA 3PP3K 2DDQH 4DWHA 4KHTH 2ICWB 2JIXA 5C0BA 1FVDA 3VXTA 3V6FB 1EGJH 4L5FL 1RI8A 1OP9A 1YYLH 2XKUA 3EZJB 3MV7B 3BI9X 4K8RD 1LE5B 3O6KH 4DUWA 4LCYB 5EUOE 4GSDL 4RFOH 2J4WH 2X5PA 1NMBH 4KKNA 1QBBA 1VACA 4KI1A 3TO2A 4TTDD 3U9PH 3FOLB 4AQOA 4QHKI 5GGRB 4MDJA 2FZ3A 2R0KH 3ZE2F 2OMBA 2NY4D 4JM4L 1N26A 5FGCB 5E0QA 2AJUL 1E6OH 4WO4D 3RNKA 3B8YA 4ZDHB 1D5BB 4IOIA 4YLQT 1ZK9A 1A8JH 4R90H 4GRWB 4KROB 2XYCA 4V1DE 4YHPA 1X5KA 3BPCB 3RZWA 1CT8B 2APTA 5DVLA 1HEZB 1D5ZA 2DM3A 3V95A 1B0WA 3EOYG 5GJSH 4IRSB 3HZKA 4YC2C 1S9VB 2QADB 2ORBH 4HKXB 1ZXQA 2ZNXA 4HKBB 5FM5M 2WW8A 4Z76B 5F7WC 1YC8A 3M8OH 3QRGH 4MJIA 4U1HB 5GGTA 1KJ2L 4NYLB 1XGYL 4DOHE 1V5JA 2P5WB 1JCKA 3WUWG 3UJTL 2E6PA 3CSPA 4UAOB 5SWSB 2HAZA 5FHAL 5L2JA 2F5BL 5HVHC 3LZFL 2QLVB 2QHLA 4L5FH 4FQJL 2IAMB 1H8SA 5HHMD 1RK0A 2PR4H 1I1FA 3X11A 4KUZL 4GSDH 5FKAB 3LV3B 5AYUL 3RZCD 5D71L 3QAZB 3KXFB 4FQXC 5C0NC 1OSPL 5J12B 3GRWH 2BNQA 5ESVA 4HF5L 4XPGL 2XFXB 3MYZA 2O26U 4FMFA 4X4MA 4QXGL 4FQXA 5I17A 5T1DL 2A9NL 5CSBA 4LVEA 4PJCF 2F54A 2A0LD 3RDTD 4AK1A 5DFVD 1X4XA 2BC4B 5BRZB 5D5MF 5EA0L 3IU4H 1A1MB 3MPCA 3S34L 4M61B 5BV7L 4FFEX 2IGFH 2I24N 4QRPE 5F3HA 2VABA 1WITA 5HYIA 4WEBL 3BGMA 3GSWA 3PXHA 5TF0A 3CIQA 1HHKB 4KRLB 1JL8A 4OCYL 1NFDF 5GS2H 2F9BT 1J1XL 1Y6KR 5C09E 5FDWA 1CDUA 1PY4A 4HUWA 1NBYA 1MWAL 2EDDA 1BIIA 1MCKA 2YD2A 3TT3H 3LPFA 4OLYL 3MMEA 2XY2A 4N5ED 1KJ2H 5AZEL 1XGYH 1FG9C 4O9HL 3IAQA 1I7ZA 3CH8A 4ODVL 3UJTH 4R3SA 2PXYC 5ENWA 1VPOL 3ULVC 3TC9A 5FHAH 4XWGL 3WNPA 2MWCA 2F5BH 4G6AD 2ED8A 1PBYA 5J7CC 4Z0BH 4WUUA 1U3HB 2AKRB 2GI7A 4X7EC 4FQJH 2FRGP 4M5ZL 2PXYA 3CZFB 1MH5A 1W0YT 4RMQA 2VB5A 4U3CA 4MZ3A 4R96B 1RUAL 1G6RB 4TOYL 5AYUH 8FABA 5D71H 4KK5D 3UTQB 5HYJD 1MHHA 2Q6WA 1OSPH 5HYSG 5HPOA 1UXSB 4QHLA 3ZYZA 4F57L 3LRGA 3MJ7B 4N0FB 4HF5H 4XGZA 4NP4L 3FOLA 4XPGH 1OWRM 3KGRA 4QXGH 5GGRA 2D2OA 4WFEE 2QQLL 5T1DH 4D8PB 2A9NH 3IDXL 4WY7H 1RU9H 4DK6A 3ARQA 4LARL 4DZ8A 5D1QB 2EDQA 2L7JA 2GFBB 4GBXD 4KJWC 5EA0H 1FZMA 2OS7A 3W11C 1ZVYA 3S34H 4R4FL 3V5DB 2NY1B 5BV7H 5BJTB 1IAOB 1WSST 1HXMB 1UJ3C 1T04B 2J5LC 3BPCA 3VJ6A 4WEBH 1MFNA 3NIDE 5GXBB 1DLHA 3LKRB 1UJ3A 2RBLA 5FO9A 4PJIF 1J1XH 1DQTA 4X9GA 1QO3B 1MWAH 4WWKB 2R56L 1FGVL 4RA3A 4GRLB 4OLYH 1CN4A 4IIQB 4R7DB 3MRMA 1RJCA 4HJGA 2Z31B 4U1MB 2YPLD 5AZEH 2HKFL 1MF2L 4O9HH 4R0LC 1HZHL 3TBYB 1U9KA 3F5WA 3G04A 5D7LE 3H9SD 4XBGB 3WHXA 4ODVH 3T0EC 2MQ3A 5C8JB 5ISZE 2BFVL 3E1F1 1VPOH 5AZ2L 4XWGH 3KPQB 4R0LA 1ORQB 5ALBL 4XH2B 1AP2A 3RJDA 2IAMC 4ZXBB 3T0EA 1I7RA 1R5VB 4JZJC 3RWCA 4PBXA 1AY1L 3K4DA 4M5ZH 1KLUA 3HI5L 4P5MB 5IBLD 1UH4A 3MRCA 2IAMA 4TOYH 3PQYA 1S7XA 3GBMH 2OXHA 4FG6D 4JZJA 1JZ7A 5E8PB 3BP5B 5FKAA 4PP1D 5LG1A 3BO8B 4F57H 4P2RA 5MEOA 1EUTA 4Q6IB 4ZYKA 4NP4H 1BZ9B 3GMPA 4LIQL 5MENA 1CU4L 2QQLH 3HUJB 3IDXH 2AVGA 2XFXA 3D0VA 3VMPA 1MCPL 3EOAA 3OAZH 5HHXH 4LARH 3KLDA 1N8ZA 4OZGE 3TPKA 2AXFA 1A7NL 3EKCA 5JW4R 1G7JB 3U4AA 4R4FH 3B5HA 3UYRL 3LQAC 1NFIA 2XZQL 3L3KB 4Z7VB 3MRLB 4M61A 4PUBL 2V9QA 3GMQB 4QHKJ 5MEQB 3LOWA 3R4DA 5HI3C 1M71B 1HILA 4S1SL 1RVFH 4XP1H 1N5AB 1WBYB 2EEAA 3QNYA 2R56H 1FGVH 3S96B 3GBNH 3TVMB 2HKFH 3QDJB 1ZA6B 1MF2H 1HZHH 3SDDC 2BRQA 2YD7A 5EZJB 2Q20A 1P69B 4NDMB 5H2BA 2BFVH 2I07B 3ZE0E 4JGJA 3FHQA 5AZ2H 3WFCL 3QDAA 4I2XA 2VWEE 4TYUA 3FT4B 5ALBH 3SDDA 5I73C 4ESKA 4RIRA 3EYQC 3ZHKA 3HI5H 4YXHL 4RAHA 5ESQA 3VRJB 4LLDB 2EC9U 4JFXB 3Q3GB 3CVIL 1A7RL 3K1KC 1YY9D 5B3JF 4MHHG 3WEXB 1MAKA 1CDHA 4LIQH 2X7LB 1VGEH 1CU4H 4R26L 1NEZA 1B4RA 1QPXA 1NLDL 1MCPH 1U3JA 4PJ7A 3CFEA 1CDBA 4CKVX 1DEEB 4W4OA 1SYVB 1TIUA 3DV6A 4LLQB 4LF3A 4OD1L 4WFFE 1S9WB 3BOVA 1PG7X 4EJ1C 3UYRH 1KPUB 2IBGA 2AEIT 2XZQH 3R1GL 4PGDB 4U1JA 5E2UL 1LEIA 4PUBH 1IAOA 1T04A 1MCSA 4U6XB 5IUSA 4S1SH 3DPBA 1MRCL 4P59H 2J2ZA 1UH3A 4BH8A 5D2NE 5CLTA 1OTUD 1JWMA 5BVJB 4WHYG 3TN0D 3HZYA 1EXUA 5JXEC 5HGDB 1OAQL 4OUOA 1Z5LA 1IKNC 2R23A 3VXRB 4U1MA 3GK8L 1IAKB 4XNMB 5F6IC 5DYOA 3WFCH 5JXEA 1K2DB 1H8NA 3FJTA 5GPRA 2B7DT 2DIAA 4NHUE 4Z5RA 1IKNA 2BOBB 1ZT4A 4F15C 3CUPA 3KPQA 4L1DA 4BZYA 5F3BA 5D93B 4YXHH 1CFNB 4GG6A 1EAJA 2EXWC 3H7BA 3CVIH 2YUZA 1A7RH 3FQTB 2R1WB 2DMKA 1H5BB 5EC2B 3TYFB 4X98A 5DK0A 4XB8A 5F8QC 2CK0H 5I30L 2YUVA 4U7MA 4MXVE 4JZOB 4NQSA 4R26H 1AGFB 1DQQA 4OF5A 2H2SD 5JHDA 3TZVC 1NLDH 3LS4H 1N3NA 4OV6F 1X5GA 3QUMA 2EKSB 4KH2A 4OD1H 5E5RB 1EO5A 3TZVA 3QR2A 4Y7MA 1MCOH 4JFEA 4GQPH 3R1GH 4L8DA 5E2UH 5EC1A 4JRYE 4JHBA 2E9JA 5CJ8A 4P57B 1U36A 3L95A 3DSFH 4OKVA 4KKLC 4ELMB 4PB0L 4V2BA 1Q9LB 3O3BA 4KJQC 4GXVH 1Q1JL 5ACLA 3LCYA 1ONQA 2P8MB 4H5SB 1JFQL 1XIWB 2FNBA 3PDDA 3TBWB 3VRLE 1EGJA 5DC9B 3S96A 1EIBA 4TQEL 3WKMH 1ZA6A 3GK8H 2R2BB 1OGTA 5EZJA 5TE7H 1CIDA 1WGOA 2NNAB 3RVVC 1QLFB 1CGXA 1M7IA 2Y4SA 1J0HA 1FL6A 3WS3A 4S1DD 4I0KA 2J8UE 1Q9KA 4YNYA 4FQIH 5JR1L 5CEZE 4NNYB 3BW9A 3O11A 2GTWA 3VRJA 5BV7B 1HK6A 3TBTB 1NMCB 3U30B 5ADOL 4OCXL 5CZKA 1YMME 3MRKB 4YBLB 3EJYD 2WQRA 3ZHDA 3RY5A 3R0NA 1D5IL 5JORA 3D85B 32C2B 2X7LA 4QXWA 1BF2A 4EUPA 2VLRB 1DN0A 1FAIL 3PUCA 4IBLT 4PJDE 5IBTL 1G7QB 1CE1L 4RMRA 2E9WA 3VXSE 5C0AB 3C6SA 2QKIA 4JFQB 2E5EA 2CJUL 4K3DL 4Z7WA 1CLCA 1J8HB 1FZJB 2X09A 1C1EL 3MGAA 1OP5H 5C0RL 3FTGB 3RWJB 1XGRA 4HDIA 4PB0H 5CD5C 3T0XA 3RA7L 1NAML 3L3GA 3FO2B 5L8LB 4X6BA 1W8NA 3WUWB 5F7DB 1Q1JH 1WBXA 4JM2B 4U0RB 4OUUB 4XTRD 1JFQH 4Y1AE 3ARTA 1C08A 4QRRD 3KNBA 3PGDA 3WV0A 2CUMA 3BP6B 4TQEH 5I1DB 3C2AL 4WHYH 5JW5A 3PL6C 1YEKL 3MV11 1ND0B 1Q9OA 3V7AE 2FGZA 1IAKA 1ROWA 4MNGA 2X4NB 3KLAB 1UB5A 3SCMC 2X1XR 3PL6A 4HULB 4BQ9A 5DS8A 5DJYA 2Y5TA 1HQRB 4UZGA 3X3GL 4XMKL 1H5BC 4LLVA 3SCMA 5HHNA 4PRPD 3EOTL 4KKAC 3TEUA 2G2RA 1S9XA 3SPVB 4OCXH 5ADOH 4OZIA 4LHUG 3WFHB 2FECL 2R1WA 1H5BA 3TYFA 1TTGA 2APFA 1J0JA 2NZ9D 2DQCL 3ARVA 3SKOA 1HNGA 2EDXA 2XIDA 3HFML 1FAIH 4PRHA 3VFRA 3QB7C 3EYFA 5HI4C 4GQ9L 1AXSA 3FO1A 1BZQK 4ZO7A 3VW3L 1W0WB 2NYYD 2CJUH 4I5BB 4K3DH 1EFXD 4ZUWB 3MNWB 1KJ2A 3LS5L 3VXQB 5JLZA 1CDIA 3SO5A 4LSPL 1HQ4B 3QG7L 3JV6B 5C0RH 4DW2L 4GOSA 1NAMH 3RA7H 1MI5D 3OMZA 5T5NF 5AWNL 1KFAL 3JVGC 1OAKL 1I3UA 5GSVB 4EI6A 3HNSL 4H5SA 3L3OB 1U95A 3UBXI 3JVGA 3C2AH 1HWHB 5A3ID 3X14A 3HC3H 1S5HA 3L5IA 1QQDB 1L0QA 3S36X 4EI5D 4Y5VC 5F9DC 2NNAA 3MSPA 1PKQE 4NQED 2DYPB 2GJ6B 4OD2B 4P5KB 4UILL 3QFJD 2IPKB 5J4MA 4ODBD 5EU5A 3EO1B 1CF8H 4Y5VA 3TP4A 3ROOB 5GSRA 3X3GH 4XMKH 1N0XL 1D6EA 1FNGB 1C5DB 1NMCC 4IS6A 3CDCA 3DRTB 3I6LE 3IJSB 3O41B 1NSNH 2LTQC 3VWKD 4J2XA 1UEMA 2HN7A 3IFPB 2NR6C 4JB9L 4OCLC 4YHNA 4U2ZA 4F37K 1DANT 2WLYA 4XB7A 4XC3L 4W4NA 4DVBA 5LGKA 4M5YL 2DQCH 3WO4B 3IJHB 3HFMH 3P77B 1WAAE 32C2A 5ITBL 4GQ9H 2C3VB 3NIFE 3VW3H 2XTJB 4HS6A 4H88L 1MWAA 1L6XA 2JELL 1CL7I 2DWDB 3LS5H 2X4SA 3FAWA 4JFQA 3HTLX 4LSPH 5DEGA 3QG7H 4DW2H 2YWZA 3RIAF 3VDAA 4Y4FC 4K3EL 3SOBL 1OP3K 5AWNH 3M1BB 5K59E 2DQUL 1KFAH 1DQJB 3ROLB 3NIDF 1IEAA 3HLAB 4KPHL 3MCKA 3H42L 3O8XB 4BYHA 1OAKH 2Y7QB 2YMXL 4P2QE 4Y4FA 1NGWA 3HNSH 4S2SA 3SKMB 1G9ML 1S7SA 3CC5A 3GHEL 3L3HB 1VHPA 1M7DA 4MNQA 1XCQA 3F12B 2BXYA 1GOFA 5KTEL 3WFDL 5FYLL 4WUKL 1CGWA 3BKJL 3MLRL 4TRPL 4XXDA 3O3EB 2HMID 1MRFL 1T1ZA 1PX3A 4JRXD 3CMOH 3O0RL 4Z95H 2VZ1A 1KCRL 4UILH 3KLAA 3VFWA 2OQJA 3KYNB 3D3VE 2HVKB 4X99A 4NC1C 4YHZL 2ZSVA 2HYMA 4D0DA 1MPAL 3RVUC 4GW1B 5IKCB 4JB9H 3ARGD 1X5LA 3GSRB 1ZHLB 5DQ9B 5EU3B 4M5YH 2ATKB 4I0PD 3O2VL 4EQ3A 2NXZC 3WE6A 2YRPA 3TWCL 5ITBH 5BCAA 3IKCB 2RB8A 2VR4A 4H88H 3K3QA 2JELH 3EUUA 4U6YA 4J23A 4OZGF 2VDKL 3ZSTA 5D7IB 3ARWA 5ANMB 4E41E 3DMMB 1KJVB 3JWDH 4NRYB 3VXUA 4M7KL 4HT1L 3MNWA 4PY7B 1JK8B 4K3EH 4PTUB 3SOBH 2JCCB 4XHJC 1YEFH 3C09B 2DQUH 1WWBX 4KPHH 3H42H 2YMXH 3DGGA 3AS2A 3QJHB 1OD9A 2IMNA 1AGDA 3PGCB 3SBWC 1XZ0A 5FECB 4HCRL 1SY6A 1G9MH 1RAMA 4PJ8C 1WIOA 4NOBA 3RFZC 3UC0L 4APQB 3REVB 3WFDH 5FYLH 5C07D 1DUYA 3SBWA 4WUKH 3BKJH 3LEYL 3MLRH 4TRPH 3EDEA 5HGBA 5ANMA 3TBVB 1MJ8L 1MRFH 4PJ8A 1CXHA 3MLZL 1QRNE 3VFNB 4H26B 2EICA 4YHLL 1I9RL 4XWOD 1KCRH 5SX5H 1RZGB 2BCKA 2F53A 2GJZA 4CJ1A 2UWEA 3V9FA 1EUUA 4N68A 4YHZH 5JPMA 5MHSE 5LGJA 4WFGE 4HUVA 1MPAH 3EO1A 4RX4A 5IV2B 5L2KD 5E6IC 4J8RA 4BFGA 5A2IH 4LLUB 5I9QC 2ZUSA 3RX5A 4MQXC 3IJSA 1L8JA 2Q7YB 1R24B 1Q0YH 5TDPA 4RSVA 4PLNC 4X5XB 5E6IA 4RBPH 3O2VH 3V52L 3DVGB 1CICB 1NCUA 5F9JB 3G5ZA 4ZPTB 5TH2B 3TWCH 2J6EL 3DXAD 4XVJL 3LQZA 3P77A 5JDJA 5DZLA 4GKSB 1J0IA 2VDKH 5FYJL 5CHNB 1K3IA 1CFTB 4WW1B 4IRZH 4M7KH 4HT1H 4XRCB 5ID0B 2AEWA 4UB0H 1L0XA 1KJ3L 2A73A 3FONA 3NFPA 3X12B 4Y19B 3M07A 4N9OB 4P3WA 4ORGB 4DGIL 1IAII 1D9KB 1KPRB 1SVZA 1MOEA 4XPAH 4HCRH 1RD6A 5DHVH 3QDME 4HKZB 1KB9K 3D5OF 2YR3A 3FOMB 3UC0H 4D9QD 4X7TA 3OKMA 3QEUA 5T1LB 2R4RH 4Y2DB 3LEYH 5GGSB 2DM2A 1SEQL 1MJ8H 3R06B 3W0WB 1MHCB 3MJ8A 4YHLH 1I9RH 3IU3A 4M4RA 3SDXE 2BY0A 5JIPA 3D2UD 3HAEG 2OM5A 5LGHL 4JQXC 4YEEA 1BF8A 2G9HA 3KYNA 1PSKL 1F4WL 2W65A 2OR9L 3QXDB 5CBEB 4JQXA 2MTPA 5FYKE 5CJ5A 3D39D 5A16A 5JIKA 5IKCA 4AG4L 3OKLA 1LEKA 1M05B 3KLHC 5FV2A 1KTLA 5DEFB 3QA3A 3EFFA 3FQRA 1NAMB 5F1IA 5EB9A 3V52H 2QV2A 5EWIL 3RWIB 3GJEB 2J6EH 2J3SA 3TJHC 4JPWL 3KPOB 3QIUD 4XVJH 3FB8B 3RTQB 4PLKC 4KUCD 1QSEE 1FLRL 4YFLF 1UENA 5FYJH 1PG7L 3TJHA 4KKBD 4NKQB 4JFHE 2P47B 1KJ3H 4CU8A 1AO7B 4HSQA 4MCYA 1GAFL 4EEEA 5FFLA 4NM4L 4DGIH 2YPVL 3VXPA 4PGJA 1T5WB 1EX0A 2XG4A 2ZWLT 1IQDA 2B0SH 3B2UD 5IQ7H 3UYOD 5DMKB 1JVKA 2CDEA 4TVPL 1QLEH 3BWAA 4G3YL 3T4AB 3T4YB 4JG0L 3DUHA 2VQ1B 3VXOB 4S0TD 4FOMA 2W59A 4XNQB 4CMMA 1SEQH 4XI5D 25C8L 3FQNB 3HG1D 1DFBL 2AV1B 2LU3A 1ZHKA 3PWVB 3C5ZC 1MHPL 3ZO0A 2ZOLA 3QWOA 1DBJL 2WV3A 1PSKH 1F4WH 1NGXB 2XRAL 4GS7C 2OR9H 5EG6C 2DJUA 3C5ZA 2GSIA 1ZT1A 4HIIB 1K6QL 2D4DA 5EUOA 3UTTD 3KJ4C 4AG4H 2P8PA 2BNRD 1WTGT 3U1SL 1R24A 3N06B 3GBLA 2XI9A 3GMMB 4YK4B 5EWIH 5HVWA 4I3RL 4FRWA 3IJYB 1X5JA 2G75A 4JPWH 1BBDH 1JWSB 2V7NA 3BMVA 4OQ1A 5I0DA 4OLEA 4NN7B 1FLRH 1U8HB 4G9DA 1J0KA 1KV3A 3MBED 3UBXA 5IFHH 4IDLA 4FQ1L 1PG7H 2OJZL 1F4YL 3CU1A 3KPTA 1MCRA 1UXWA 4JFZL 3VH8A 1A6WL 1TCRB 3EOBB 4M1DH 3DVNB 4RGMC 1GAFH 4I48B 2CO7B 4QHNB 2E3VA 4KK8C 3LEXB 1MFAH 4E42B 3QIWC 1T3FB 1T1XA 2QR0B 4Z7UB 2EXYC 2GK0B 2VXTL 4TVPH 4G3YH 4YFLI 15C8L 1U92B 3BISA 4JG0H 2FIKB 3QIWA 5KVMC 1OARL 1XGPA 2L0DA 3UJIL 4AJ0A 2YZ1A 2NY6D 3P30L 4GUPA 4NQCE 3ME0A 25C8H 3PDOA 1DFBH 3WSQL 3O6FC 2X4QA 4LHUB 4BKLB 1MHPH 5EIIB 1QKZH 1BP3B 4HK0A 1DBJH 3C5SA 2NXYD 3O6FA 2XRAH 1GGIL 3E6FA 4WHTA 5F1SA 3QDGB 5MI0B 3FCTB 1QVOB 4G8EB 3KYOB 4GAGL 3U1SH 3W82A 4I3RH 3QIBD 4LK4A 4DKDC 1G7MB 3NPSC 3PXJA 2BNUA 1NAMA 4M7ZB 4X4ZA 1IM9A 1CD1B 2DLFL 2YA2A 5C2UB 1V3MA 2X4TA 1WK0A 4YBHA 3CCHB 3V2AR 3D18A 4FQ1H 4NZRL 1F4YH 3C8KA 4JFZH 4HEPG 1A6WH 2VLKB 4QRPA 3LSOB 5A40E 4BFIA 2H6PA 5I1GL 5C71A 4P2CG 5C0EB 3ZKXC 5C09A 3IFOB 3MRPA 1CGVA 2VXTH 2BSTA 2N7AA 2W0LA 4MQTB 3U79A 15C8H 3VFOB 1PZUB 4Y0GA 3RIFK 5DMKA 1OARH 3UJIH 3P30H 4L4TD 1B90A 1PLGH 2YUWA 4L3AA 4DUVA 1DVFB 4UNTA 3MRRA 1OWWA 3WSQH 1X5YA 3GB7B 3T2QA 2PW2A 3L3DA 3O4LD 4AEIL 2F19L 1VFBB 4CVXA 5F7KC 4FTVB 3U36A 3OKNB 3NZHL 5I16B 1GGIH 1A6TB 1FN4A 2FX9L 5KSBE 1FL3A 1DQML 3VCLA 1N4XL 4ZPVB 4M6NL 4NZDA 4Z9KB 1HOCA 4G8IB 4HIIA 4GAGH 3QNXB 4FQHB 3RWFA 4WGWB 1E4XI 5HDOA 4HC1H 3UMTA 2IANE 2A6KA 2XKNA 2EYSB 4MB5A 5I8EB 5TDNA 2RHEA 4R8WL 3IJYA 4Z6AT 2DLFH 3KVQA 1LP9E 1BVLA 1WAAF 2JIXD 3BZDA 5C0BD 4NFCA 4O2CB 4NZRH 4BSWB 1F2QA 5AEAA 3OAYK 1H3XA 4PJFB 1U91B 5E2TL 5B4MC 4JKMA 3V0AC 3P9WB 1IGYB 1TCRA 2IALB 2X1QA 4LDEB 5I1GH 2A6IB 3C9NB 5DJCB 2VDPL 3MA9L 5K59F 5IVOA 1MHEB 1KEML 3G6AA 2P5EE 2VIRB 1YMHB 5HGAB 1QHPA 3RI5K 1T1YB 3RHWF 5C0IA 5CMAA 4EBQL 1JNHA 2DBLL 4NO5B 2MHAB 3V5HA 1JRHL 3LKOB 1P7HL 4NO0B 5JW4N 5D7LA 5E94A 3UXFA 43CAA 1T2XA 5ISZA 1H3VA 4ODXA 3S36L 1G7IA 1T5XB 4AEIH 2F19H 1DN2A 1U8IA 5IHZB 4FQ2H 2ZZUT 3FMGL 5INDB 5D72L 3NZHH 4GAYB 4UUJA 2R4SL 2ATPB 5GS0L 3IAGC 1EZVY 4P46B 2FX9H 2NY0D 4X6CF 5IQ9A 1EHXA 1A1NB 3WIIL 1DQMH 4M6NH 4WW2F 3PNWB 4GLRH 5I74B 4MJID 4HUUA 4HKJA 4OM1L 5ESAB 2WANA 4TSAL 4QWWC 1EO7A 3CPLB 2RAMA 1BHGA 5BZWB 3E6HA 4U1KB 3AAZB 5IHBA 1TDQA 1T83C 5B39G 4R8WH 4TNVF 1OF2B 4BQ6A 1XCTB 1G9MC 5SWQB 4ORZC 4KGJA 1CFBA 1YN6A 4OZGA 3MO1B 3DTXA 1T83A 1DJSA 3JWOL 4MVBC 3VA2C 3MA7B 3CCHA 4PP2A 1CYGA 4DKFL 4QO1A 4U1IA 5E2TH 2GCYB 1GOHA 3HMWH 4NKOA 4QT5B 1BVKB 3I84A 1SJHB 4MVBA 3LSOA 3HE7B 4L3CA 2IWGA 1NUGA 4P4KB 2VDPH 3O45A 3MA9H 3MV8B 1KEMH 2BNQD 3VXNA 1OAXL 4TUKL 3NN8B 2BY1A 3BZEA 4EBQH 5C0ND 4FQXD 4ZO6A 4BK4A 2C1PB 5L7XH 1OAYL 2DBLH 2X9XA 1NGYB 3KR3L 1JRHH 2F54D 2VWEC 5F89B 4ETYA 3C8DA 3VDCA 3IDMA 1FNAA 3IDGA 2GEEA 1RIHL 5JOFA 3S36H 4V3EB 2WK2A 2LQRA 5FM5O 4DKEL 1NANI 5C0DA 4YDKL 3HMXL 2HT3C 3DUUA 1S9KC 3HI1B 3FMGH 5FK9A 2P49B 1FGNL 5D72H 1CLOL 2EDWA 2PCPA 2E7LE 2DI8A 4Y5XC 1X6NA 3I75B 3WIIH 3V4VH 1FNSL 5DHYB 2JB6B 3OGOE 3VGAC 4HXAL 1AE6L 1QFWI 3KDMA 4OM1H 4G6JL 1YPZF 4Y5XA 4ZPVA 5GRWA 1P1ZA 4TSAH 3UZQA 3BMWA 1V7MH 1TVHB 5DZNA 3ECBA 4WI4A 4JRXE 5E8NA 2GKIA 2XWBA 3BZ4B 1WUNT 2Z8RA 1FNLA 1LE9A 4UDTB 4N0UB 1PDKA 4WUUD 1NBZB 3KHOA 4HCRA 3QUZB 1H15A 3INUL 4CMHC 5DJZA 3UX9B 5DHVA 2PXYD 4DKFH 1BD2E 3ULVD 5FYKL 2R8SL 1NCCL 5IEKA 4BSWA 4R97B 4LP5A 4WU5B 4JO3H 1GC1C 1A7OL 1KB5L 2AABH 1OAUL 3SKNB 2VE6B 4UQ3A 5D2NC 5T3ZD 1CWVA 2NY5C 4LU5L 2IALA 4XCEB 5E03A 4PJGB 5EOQH 1OAXH 2ZUQC 4TUKH 3WN5B 3IVKB 5D2NA 4NJAL 1YDPB 5T1MA 2NMSA 3EYVB 4ODTL 2GSGA 1OAYH 3KR3H 3HAEB 1KIQA 1KPVB 3FRUA 4WNQA 4ERSH 3GMNA 1WVZA 1Y18A 1W0VA 1CR9L 4HXBL 1RIHH 4HGWA 3ES6A 4G6ML 4B53A 2VAAA 4YDKH 4NHUA 5F93C 1XF3B 3HMXH 3PF2A 1T66C 4ZTOL 4RNRA 4KJWD 2MCG1 1FGNH