3WS3B

Crystal structure of h-2d in complex with an insulin derived peptide
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
b'MIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Compensatory mechanisms allow undersized anchor-deficient class I MHC ligands to mediate pathogenic autoreactive T cell responses
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 16
structure length 100
sequence length 100
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ws3B00
2Z31D 2X4SB 3FT2B 3RPIB 3QCTL 1N26A 1J87A 3IVKA 3ARQA 1UA6L 5CJXC 4NQCB 4KQ3H 5GZOD 4Z7OE 1OLLA 1B90A 2VIRA 3GSXB 4KKBC 1XT5A 1HHHB 3O6FD 4X4ZA 4C4KT 2XKSA 5F6HI 1RUKL 2X1QA 2V5TA 1BF2A 3WDIA 3T1FA 5IEKB 1ORQB 2LAGB 1WBXB 2R0KH 4OGAD 4EI5B 3SO3B 2Y6SD 5HTSA 5DJ6B 4U6XB 4XXDB 1EO8H 4M9OA 4ZD3H 4N0CC 1IAII 1E6JL 1HHGB 1FRGH 3ZE0E 4QGYA 4J7RA 2FGWL 1K2DB 3ZE1E 4GS7C 5IQ7H 3BVNB 3WFHA 2NY1C 1T4KB 5DO2C 1T20A 2NX5B 2IADA 4XNXL 3FHAA 5E94A 3OAYH 1HCVA 3QT2A 4MNGE 4YDKL 4I8DA 1S3KH 3VJ6A 2VH5H 5MENE 1NCWH 3WNLA 4KTDH 3QEHA 1T7WA 2PO6B 4JLRA 5KSBF 2ARJB 5HHOE 4EBQH 5AZEH 5JQ6L 3HA0A 4ELME 4KKBD 2IH1B 1VGKB 3QIUB 5D72L 1DUZA 4P59L 2AABH 1QSFD 1BJMA 2OTWA 1BFOA 1XR9A 4D9RE 4BSVA 2DQEL 4L8DA 3C8KB 1LK3L 1JNJA 4M6OL 3SCMC 4MAYB 2K1MA 3QDGD 1MFDL 5C0GB 1ZA3A 2I60H 5GRUL 2AJSH 4UB0L 2Q1EA 3HR6A 1IBGL 1SYSA 1CD8A 5FGRA 1EEZA 1IRAY 1RVFL 3RDTD 1ULVA 1CE6B 4N0CD 1IC7L 1JWSA 2AJXL 1S7VA 2N56A 3GSWB 3VD7A 5MENB 3HC3H 1J8KA 1BMGA 4R2GD 5HHOB 4Y4KB 1UADC 4NNXA 4ELMB 5DO2D 1QQDB 4MDIA 1W0VB 2P5WA 2OS7A 2X4PA 4ODSH 3LIZH 4ZNCD 1NGWA 3UJJL 1RY7B 3ZKMC 3W9EA 4NJ9H 1VEOA 5C8JA 4XP5L 4HBCH 4I1NB 3VH8B 3GMRB 5IQ9A 3ARBC 2AK4D 3EFFA 5CKAA 2XWTB 3NA9L 3GRWH 4A6YL 1P6AB 2VYRE 1Q9WA 2V5SA 4Y5YB 3GHBL 3SCMD 5GRXG 4JRXA 1NCNA 1JGUH 5GGRB 3DVFA 3O81A 3MLRH 4CUCA 3A6CL 4MXVF 2XZCL 3IGAA 5EO1B 1E4JA 1QSFA 1RK0A 1FH5H 2HJFA 4U1JB 3GJFA 3WJLC 4HWBL 4MX7A 5HXMA 4HH9B 1FJ1A 5EBMB 4CVXA 4UDTA 3GKWL 3QDGA 4OLVL 4X7TA 3CH1B 4GUPB 3FB7B 5FDWB 5AYUH 5CJOH 2Q8BH 3RWIA 1FVCB 2BNQE 3KYOA 1KJMA 1NGXA 3BHBB 3NCMA 2C9AA 3FL7A 5KVGL 1RURH 4OF7A 5FHAH 5IBLC 3U2SA 1FFNB 3ZKMD 3VI3E 2J6EH 2OR7A 3N1QC 2AQ1A 2BMKA 4ODTH 3PWLB 5B4MC 5J12B 5DURD 3ARBD 4LLWB 4HLZH 3I2CH 3OKLA 3GSNH 5E5RB 3WXWH 5C9KA 4LSUL 3EZ8A 4Z7NF 3U36A 5HYJD 1HYSC 3UZVB 5I1AB 1WAAA 1MCOH 1AH1A 3ECBB 3ZE2F 1EAPB 3CX5J 4D0DA 3V0WH 3N06B 2Z93B 3KPRA 3MRNB 1FVEA 2BNQB 2O5ZL 3STBA 4DN4L 2DIAA 2NY3C 1N0XH 4GAGL 4AYFA 4M5YL 3GSVA 5A2KH 4NO0D 3CXDH 4YHIA 1KTDB 2XTJD 3P9LA 1AXSA 3NABL 3WE6A 4KK9C 4ZSOE 1T1WA 1U9KA 5GSRA 5I1EH 3LMJH 3VG0L 5A2LH 4RMVA 5T3ZE 3D1MC 3VD5A 3IDMB 4FQQA 5INCA 3L5WA 4WUUA 4U1SB 4P5MA 4MJIA 5SX5H 3CK0L 1RIVH 4JRYA 1P7QD 4YHPA 2XKUA 3CSYA 1KIQA 3F8UB 4K9EL 1T1ZB 4QXTB 4R4NC 5B4MD 1Q9KA 1IGTA 2VISA 1IC4L 5CKGA 1F4YL 2YA2A 3HAEA 1A22B 1JBJA 3DVIA 5E2VH 4QY8A 4NGHH 2D7TH 3UTSD 5DHXB 4J3OC 1R5WB 1HYSD 4JZNB 1OGTB 1CF8H 5EWIL 1S9WA 2VO5A 1EHAA 5D1QA 4KJWD 2XYCA 4ZSOB 4NDMB 2F74A 3MV11 4IRJA 4H20L 2BHZA 2CJUL 2R4RL 3ARFC 4Q0XL 5ALBH 2IAMC 4RA3A 5I1IH 3G08B 3DUSA 4DVRL 3DETC 3W0WB 5CLTA 1T5XB 3MXVL 5DC9B 5F96H 5BO1L 7FABH 3UPRB 3MA7B 4B53A 4BYHA 1DQDL 4KK9D 2EDQA 3KYMB 1JTPA 1YYLL 4GXVL 3RX7A 4FNLH 1FIEA 1U6AL 3BEVB 1SMAA 1OWWA 1KG0B 2DLHA 4LVOB 5DQDH 1GCFA 4LASL 5FKPB 2O5XH 5HGGS 5T5NG 1OP9A 4OZHB 1BVLA 2CGRL 2YA1A 4NKOA 4R4ND 4LSSL 3K74B 4MLSA 3UDWC 4PG2A 1A6AB 2CK0L 4EUPG 5B8CB 1VACA 1HKLL 1KELL 1S7UB 1OW0A 5JW4N 3D3VE 1IL1B 4EI5C 3SO3C 1WFUA 3L5IA 4OD2B 3E6HB 5J1SC 1AO7E 2UY6A 4UT9H 5IW6B 4NQTA 1A1OB 3VGGA 5E99L 3CLEH 3EGSA 2X7LA 4OI8A 2JB5L 3ARFD 2DRUA 4Y4HD 4WO4A 1ONQA 2VN4A 2DS4A 3JUYA 4URTB 3HR5B 4WI8A 2YKLH 3QCVL 4RMSA 1B2WH 3V5KB 1YC7A 5TF1L 2X09A 3TYFA 1GZQB 1NFDA 4NQCD 3GHEH 3JV4B 3QXDA 4L3CB 1NJ9B 3RUGE 2PO6C 4PJIE 4JFFB 2CR6A 2BVUA 2V9TA 5MEPB 4O51A 3NBNA 4JHAH 3HPJA 3QIUC 3TYGH 2RJMA 1T89C 1UM4H 2A9NL 2GJ6A 1H5BA 1X7QB 4ALAH 1TVDA 2EH7L 5MEQA 3NCBB 1AO7B 4XCNA 1WFTA 4ZOEA 3MV8E 3C5JB 1UEMA 4NO3B 3HZMB 1DBAH 1D3CA 2HT2C 4MAYC 4UV7H 3B2VL 1PKQA 1DR9A 3QWRA 2FBOJ 1QFWL 5EFIB 4NQDE 1OGAE 1PZUB 1XGRB 3DVGA 1IC1A 1A7RL 1U8OB 1CGYA 3RUGB 3MLVH 4PJIB 3WUWG 5BOPA 3WIHA 4Y4KC 5ELIA 1CWVA 4AIOA 2A6IB 5KSAB 1IJ9A 3RL1B 4KVNL 5L2KA 4GG6F 1BJ1H 3EYOB 4JEGB 2BSRB 4WI7A 3JWOC 3P4NA 2BOCB 5C2UB 4PLJC 1G6RA 1F58L 1JNNL 1KLFA 4GLRI 3MRIB 1T5WB 4TOYL 1TTFA 4HIHA 3G5VA 4U6VL 4EDXB 5SWQB 4L8CB 1ZE3C 3NFPB 2AJUH 1VGEH 2XNAA 4YR6B 1T22A 5FYJL 4ODUA 5GGTA 4WI5A 1ES0B 2FR4B 4TVPD 4NQDB 3OKDA 5D7LE 3CPLB 5SWZD 3SGDI 4Y5YC 5L8LB 2HT2D 5D7JA 4MAYD 2J7LA 4Y16A 3K46A 5DUBB 5L6YH 4FTVA 3OXSA 4AEHL 1NCDH 4PJ5A 4XNQA 5CEYA 4EOWH 2QLVB 2EYRA 3MRDB 4KKNA 2Q6WB 5MEND 5HYQA 3BKCL 1FO0A 1KCKA 4KJQC 1Q9LB 5HHOD 3BRDA 4OZFG 1IKFL 2OL3B 4HWUA 1G9NC 4MWFB 5E2JA 1RJYB 5JTWA 2F58H 3T0XA 15C8H 4QEGA 5IMMA 5AD0B 2A38A 4QHLB 4PRAA 1WFNA 3WL9B 2P7TB 4PLJD 4D9RD 3L7FA 5ERWA 1SY6A 5D7LB 2W9EL 3VXRE 4Z18A 5DRWA 2R0KL 5J12C 5JW5A 1I8KB 3STLB 2JK5A 1JUFA 4S1RL 4C83B 2W0KA 1EO8L 1TENA 3THML 3WFDH 4OT1H 4ZD3L 3VFMA 1XGUA 3UYRH 4OSUL 1A3LH 3FB6A 4OUUA 3U7YH 5I1KH 3H9SE 1IM3A 1ZK9A 1BVKA 4U3CA 4BK5A 4FQJL 1X5AA 5D2LA 4FQLH 2QSCL 1W8NA 2D2OA 4OGYH 5T3XE 3KXFE 1T1YA 3KJ6H 1S3KL 1XF3A 2VE6B 4KKAC 5T1MB 3VWKD 3KPMB 1F6FB 4HJ0C 1NCWL 3QNZA 1J10A 4MD0B 4AL8H 2FJGB 4ZUVA 3OX8A 5HD8C 5TE6H 3WHE0 1J1OL 1HXMA 2NY7L 5FHBL 3FQNB 3VXRB 3PGDA 4JR9L 5EUOA 1BQLH 3OSKA 4CKVX 1QBML 4OF3A 5TE4L 2AJZA 1M71A 3VFGL 4WU7B 2V2TB 1JPGB 2UWEA 1RZFH 1SJEA 2V9QA 3ARDD 1CDHA 1A6PA 3EYFA 3H9SB 4QO1A 5DS8A 3SQBA 1FYTA 3VRJA 2H32H 4D9QE 5C3LD 2VLRD 1MIMH 2PYEA 3TO2B 3IXTB 4KMLB 1O7VA 4FZEL 3ROLB 5DJ2B 3WNOA 1U58A 1U91B 4I9WE 5F9JB 4HUVA 1PD6A 1U8QB 3Q6FB 3RVWD 3CMOL 2WUCH 1CVSC 3BO8A 3ZL4H 2R2BA 1EGJL 1AQDB 4XCFH 5TDNA 1KSRA 3PV6B 4L5FH 3RVUD 4E41A 2I9LA 4P5TA 5IM7A 2H2SC 4H0GA 4MCYB 5IJVA 4NJ9L 4QTIH 3VFOB 4HBCL 4ISVA 4U2ZA 4HH8A 3MMEA 3PIQA 3KPNB 2B0SH 3C5ZA 2EDRA 2ENSA 2YPLA 3FRUB 3AU1A 4Y0GA 4HWNA 3VWKA 5JDJA 2IPUK 12E8H 3KPPA 4Q6YA 4X5LA 3TVMD 4FZ8L 3PE9A 3MJ6A 2X4TA 4LVOC 5CSZA 1CG9A 3OAYK 2OYPA 2WQRA 5HYEA 2XFXB 4GJTB 3ARYA 4JPVL 1A3RL 4WNQB 1UB5B 3L3JA 1JFQH 4TSAH 1FH5L 4PGJA 4LF3B 3T4AA 1XIWA 2JB6B 1TCRB 3IF1B 2HVJA 5B8CC 2FYYA 2A6JA 3T4YB 3KPLB 2F19H 2YXFA 3MOAH 3P0GB 4C56A 1EEUA 1JYWA 2C4XA 3QEUB 5AYUL 3HTLX 2FHCA 3G6JA 3N1FC 2Q8BL 4MJ6A 3MRHB 5IB2A 1OB1A 1C7SA 5EOQH 4X4YB 2W1NA 3FT3A 3WCYA 2L7UA 5CIPB 4NZTH 1E4KA 3HN3A 1RFDL 5HGDA 3B9DA 4OZFA 4WJ5A 4X4XA 3BEWA 3RWEB 2J6EL 1MCWW 5E2UL 1F11B 2YC1A 4ODTL 4Y89A 1MCRA 1I8IA 2GK0A 4TTDD 2AAVA 4O58H 2DLFH 3GSNL 4Z78A 2ID5A 1K8DB 3MR9B 4HUXB 4G42A 2NY5C 1QFOA 3IB4A 4C4KO 3I50H 2R8SL 1S7WA 1ODAA 2A6DA 3CFEB 4OFYD 3QDJD 5EO0B 1FV1B 5DQJB 3UPAA 3HUJA 3LPWA 4Y5XA 4I3RH 4MHHI 3JTSB 3FQXA 3QWOA 1INQA 4P99A 3VGHA 5L2JB 4GG8B 4IIQA 4L8SA 4ZAKA 3CXDL 1JVKA 1ERNA 4KUCF 3DIFB 3DMMB 4R4BA 1B4RA 4JPWL 1VB9A 1KJVB 3I85A 5MEOB 2B1AH 5CBEA 5I1EL 1P7KA 3CVHB 4FQHB 2R69H 3QFJA 5T1LD 4NKMB 4XC3H 1EPFA 3P11L 3GNML 4PJ9B 1RIVL 2ADIB 3PXHA 3MBXL 4K8RD 4IOSD 5IG7B 5KSAC 2YN5A 4UMGA 4UI2A 4LFHD 1U8JB 2V7HA 2A74B 4NPYB 4HFWB 2KQMA 2ZSWB 3K0WA 5KS9A 1JZ4A 3IVKB 4ZTPH 2HTLC 2X05A 4ETQB 4ZS6C 5KVFH 4F7EB 3D3VD 1DDHB 3SEPA 4XRCA 5CGTA 1AO7D 2VIRB 5B38G 3B5GA 1KN2H 5IVXA 4UQ2B 1UXSA 1QPPA 5IVOA 1RHHA 4Z95H 2HT3C 2FH6A 4K7PL 1QRNA 2A9ML 2ZSVA 5F96L 1IQDB 1TJGH 7FABL 4LHJB 2EE9A 3T1FB 1EA9C 2FRGP 3OJMB 1PY9A 4MJ5B 3MGTA 2YD9A 2H26A 3CDCA 3LKPB 4K7PX 5IESH 4XNZB 4GW1B 4XCYB 4YXKL 1NSNL 5DQDL 5BJTA 4OTXH 3WLWD 3HNTH 4FOMA 4HWBA 4LU5H 1QA9A 5T1LA 3GMQA 5KSAD 3DX8B 4P9HL 3RKDC 4MDJA 4N1CA 4UTBH 1TETH 5EZOL 3GI9H 2H8PA 3VG9B 2KQNA 3MV8D 1T20B 2IADB 1R0AH 4NKIL 5E94B 3SDCA 1DEEA 2NYYD 5SX5K 3VJ6B 1ED3A 1P2CA 2HTLD 4AIZB 4GQPH 2V2XA 1PQZA 2VLME 4UT9L 4DVBB 3VXOA 1RZIB 2BVTA 5ESAA 1JV5A 4TYUA 4AH2A 4RX4A 1DUZB 5ICZA 3PJSA 1OGAD 5FUOH 1LO2L 5C71A 1D5MA 3MRCA 1Q94A 1X4XA 1BFOB 1B2WL 1XR9B 3M1BB 5B39A 1QACA 5EORH 3ORJA 4KZEH 4M7KL 3C09B 1HH6B 5CHNA 1ZA3B 4RA0C 3E6FB 1BWMA 1HK6A 2AQ3A 3TYGL 3OJDA 3C6SB 1YNTB 1CTNA 3RWGB 1C5DA 4ALAL 5DMGC 3RHWK 4NO5B 4F2MA 2JIXB 2YMXH 3CFKB 4WFHD 3RKDD 2I27N 2X4UB 1MF2L 1OAZH 1X5ZA 1WZMA 4OIAA 3NCJL 1CIDA 5ETUA 5D7LD 1IGML 1ZS8A 4BZ1H 2G75A 2A77L 4M6NH 1D5IH 3MJ8A 4HCRH 3W9EB 4Z0BH 4GW5A 4OCWH 2FO1A 2IFFL 3DGCR 4OJFH 5K93A 1I3RB 3KYKL 1HINH 3TWCH 3ZYZA 4DOHB 3MLVL 2WBJA 1UEYA 1ZT7A 3KVQA 4I5BB 3PHQA 5F1NA 4WW1A 5ESQB 2HFGH 4JGMA 2ZKHH 4P3CH 1ZGLM 2PW2B 4HEPG 1RZKC 3B6SA 3ES6A 4JRXB 3DRQA 3V5HA 3EJJX 3RY6C 4Y2OA 3U9UB 1W0YT 4Z7WF 1OHQA 3VFWB 3VFTA 1NEUA 1FJ1B 3S5LA 4DFHA 1I7ZB 4UDTB 4R6UA 5TQ0H 1H3WM 1NCAL 3U4BH 4OLYH 5BRZA 5FECA 3H9HB 2PW1B 2P8PA 2ZCHL 5KG9A 4LLAA 3D85B 1JYNA 4RFNB 1OQOA 3N1GC 5I30L 4NM8L 4BFIA 3S9DB 4RAHA 1ZV5A 4PJ7E 2X4OB 2R1YB 4PGEB 4MB3A 2BP3A 3OF6A 1NCDL 3H9SD 3U2SB 4X5XA 2C3VA 2NCMA 3MYJA 1IILE 2H2PD 4MA8H 2EXYD 5T3XD 3KXFD 3MREB 2DD8H 2VZSA 1HEZB 3BKJH 1LP9E 1J1XL 4RAUA 4NWTH 3OKLB 3KPSA 4MJIE 3ULUE 5DSCB 1CGTA 1WIUA 2XI9A 2D31A 1AP2A 4PJXA 3EKCA 1EFQA 3MODH 15C8L 3L95A 4OZ4A 4AZ8A 1UWEL 1H15B 4D0DB 5DR5L 5MP6H 1HHIA 5J4MA 1RU9L 3KPRB 4LIQE 1MFBH 4F58H 3BZ4B 5TPWL 4U05A 5DD6B 3HE6A 5BOZG 3GSVB 2DQFA 2R15A 5IB3B 2Z8SA 3P4OA 4K71B 3RZCA 2V5RA 2APFA 4O2FA 1CXLA 4RFOL 4GBXB 2GAZB 3MOQA 3TN0A 1G7MA 3UYRL 5IFJB 1AXSB 1GGUA 3MUHL 4D9QD 5GSRB 1KF9B 4JKPH 2LU7A 1CFSA 1G7HA 4JG1H 2P8MA 2VDQL 1LP9B 5CJ5A 4V1DA 5INCB 4MJIB 1ZTXL 4YHZH 3X3FH 4U1LB 1FBIH 1J8HA 4JRYB 2ICWA 3M8OH 4I9WD 1GIGL 3CSYB 1KIQB 4LP5A 2Z92B 3DMMC 4HKZA 1MVUA 3O6KH 4MD5A 3V6ZA 1IEBA 5GJTL 4MGXA 4EIZC 3CNKA 3DX7A 1JHKH 1II4E 2HRPL 5FYKL 4ZUTB 4F7CA 2CKBA 3MO1A 5KOVC 3VDCA 4PJ9C 4F3FA 3ZSTA 3I02B 2VDMH 5D1QB 5I9QB 1RZFL 2D0FA 4NQVA 1LEIA 4IRJB 5I18H 1JZ6A 4QRSA 3D2UA 1B4JL 5ID1B 4W4NA 4HUKB 4PRIE 1DBBH 4FN0A 5MI0B 4OZGF 3CCHB 3B9EA 4M1DH 1GSMA 3O8XA 3O45B 1CDJA 1AJ7H 4IOFC 1OTSC 3MACH 4NKDA 4QLRA 3K4AA 3KLAA 3PDOB 4LLDA 1FCGA 3RAJL 1I75A 5HDBF 3C08L 1LK2B 4OCLC 4LLMA 2F8VA 3T77A 4XCFL 9CGTA 3K7UA 4OGZA 4L5FL 1A64A 4PG9A 4PTTA 4OCXL 4RGNB 2Z8VC 1K4DB 1EJOH 5I8OH 2DQHL 2GCYB 3CSBA 1XF2A 1VFOA 1DTUA 4IMLA 1VACB 1GL4B 12E8L 4PRIB 2AXJA 4HIIA 4WW2A 3ARXA 5FIEA 2FECI 4XNZC 3WFEH 1DANT 2JKXA 2FEEI 4XX1G 3L6FA 4DN3H 1JFQL 4TSAL 1N3NA 2BSTA 5E6YA 3VG9C 3B2UC 2BX5A 5INDB 4IOFD 3TYFB 3PUCA 3BPLB 1M1SA 4R26L 4GSDL 2QQNL 4HEME 3BSZH 5HHQA 3QXDB 5IJKC 3BT2H 5E1HB 4IRSD 4XP6H 4HLZG 2CR3A 1BIIA 4K94C 5IOPA 3FN0H 4O51B 3HPJB 3SGKA 2QL1A 4RMWA 1M7DB 1MAKA 4G6AC 1CXHA 3R1GH 1D9KA 2GJ6B 1H5BB 3UYPA 5CBAB 3F7QA 1RHFA 5FF6B 4Z0XA 1HH9B 1EO5A 1EXUB 1CL7I 4P9ML 4JM2B 3FONA 1NDMB 3SGEI 2DTSA 1NFIB 1R5VB 2DLFL 3C09C 1YEHH 2CXGA 1OSZA 1Z9MA 4QRUA 4OF8A 2ICES 4JO1H 2PXYD 3N1PC 1U8MA 2L0DA 3SO5A 1QNZH 3B4NA 5DJCA 5KVDH 5JR1H 4PGBA 1FL5A 1OTUD 2VLJA 5FA4A 2EZ0D 1GGIH 2RFXB 4XH2A 4PJEE 4LGRB 1U92B 4X8JB 1P69B 4PJ5E 3F6IA 4OM1L 3LQAC 4K2UH 4WCYL 4KVCH 3SQOH 5E6IA 4UDUA 2VSCA 3P4NB 2AEPH 2CRZA 1OAYH 3NACH 1MRCH 1NLBH 1QSEE 2R2EA 2R69L 4G6FD 4PJCA 1I8LC 1YECL 4FQ1H 1EBPA 3MOBL 1PAMA 5C70A 3G5VB 1NGQH 1S9XA 4NRYB 3QBTB 4K3DL 2APWA 3CZFA 3DX9A 4GAJH 2BVPB 1R3KB 1T22B 1SYVA 5FV2A 1H3VA 4HPYL 4YJZL 4NZUH 1Q72H 1QLRA 4RFEB 5B22A 3KYNB 1AGBA 3BPCA 5D7JB 4QTHA 4NQEE 1G9ML 4OIIH 3WMSA 3I6GA 1KB5H 3OXSB 4PJEB 2AV1B 1MJJB 4PJ5B 4I2XE 1BEYH 3I3BA 3F5WA 3JVGA 5EZLA 2DI9A 2WM0A 5CEYB 4L4JA 2RHEA 4P2QE 1CFQB 3AMLA 1IAIH 3UPCA 2JIXD 2VLMD 1A14L 5HYQB 1QSEB 4UNTA 1D5BA 3H2WA 4QCIA 1OAKH 4G6ML 4RFNC 5D1XB 5IK3A 4BJLA 2K9UA 1DN0A 4XAKD 1UQSA 4KAQL 4X6CA 4Z95L 2EEBA 5DZOA 3HE7A 3MCKB 5LQBL 1DBJH 3O2VH 2QHRH 4Z7UA 3UTQA 4X99B 2J8UF 5JPNA 2Q76A 1A9BA 5DVMA 1OF2A 2EDXA 5JW5B 5F3HB 2UVFA 4NQEB 1LEKA 4EUPB 5KN5B 2XWBA 2DQGH 1LE9A 1IM9A 4Y8DC 3LVEA 4I2XB 3SE4C 1XGUB 1QEWA 3FB6B 2BZDA 1QOKA 1OD7A 2XQYG 3X3GH 2A1WH 1BVKB 2F5BH 3REWA 3RI5K 4C54A 1QFHA 3MRGB 4PB0L 1CGSH 2I9TB 5B3NA 1UB6A 3C9NB 1QR4A 1XF3B 4L4TE 3FQTB 3QAZB 1RAMA 1ORSB 5C0NC 2NXZB 2W9LA 1I7UA 4K71C 1LQSR 3KG5A 2E8YA 2J6EA 3HPLA 4GBXC 3CIQA 3GUTB 2RQ8A 1UWGH 4WDIA 5FUOL 1L0QA 3VXUD 3U7AA 3Q5YA 1E4XH 3GSNA 3FMGL 1SEBA 4NJAH 4GXUN 4QXUL 3ULUC 2YS4A 4OCMC 2GT9A 3BZEA 4G7YH 4JFEE 4KZEL 1P5UA 1EH9A 5H37H 1SHMA 3MNZB 4Z7QF 4LHUG 3GO1L 1M7IA 2COQA 3EYFB 3VDAA 4J3SA 5IHUL 5F1IB 5HHNA 5JQHC 3O9WB 4G3YL 3MUJA 4L4TB 5C0DA 2YMXL 4YXHH 1OCWH 1A6WH 3LQZA 3HMWL 1U58B 4FFWC 3RWHB 3LEXA 1JPSH 1RZ8A 5D1QC 1XGTA 5I9QC 5DJ0A 4HUVB 3GMOB 4IRJC 3FOLB 3U9PL 3WUWB 1RMFH 4BZ1L 3C5SA 3FT4A 1D5IL 4K3JL 2R9HC 4M6NL 4HCRL 3MV9E 4P5TB 4UIKH 1MHEB 2Y9RT 4EQ2A 5IJVB 5MI0C 4OCWL 4MZ3A 4JJHA 4JFEB 5F7FA 3TBTB 2VC2H 3OXRB 3MMEB 4GBXD 4JY6A 2GKIA 1HINL 3C5ZB 4L3AA 2R4SH 2YPLB 5DEZA 5GS0C 2UZXB 5JIHA 5TFSH 3KPPB 4OFVA 2WUBL 2Y36L 5AZ2H 2VXVL 2UYLA 2Z9TA 5T5FH 5EU6A 2HFGL 4LSVH 2BJML 2ZKHL 4P3CL 3ULUD 2HKFH 1V5JA 1DFBH 1T7ZA 2R0WL 4RGNC 1OP5H 3VXUA 2GTWB 2FWOB 3GGWB 4QHUA 4CNIA 5MERA 5DVKA 2YEZA 1CGXA 2P5EE 3T4AB 3RWCA 1XIWB 5FB8A 2CUMA 5DD3H 4NRXB 2A2QT 3VRIA 1G0YR 1RUML 2A6JB 2QQLH 3MV9B 4C56B 2JLLA 5HVGB 2VXSL 3BPOB 3DXAA 3LS4L 5D5ME 2XN9D 3MRLB 2VDOH 3JV6A 1AXTL 3U0TA 3ELAT 1R5IA 5JXAH 4I18A 5HGDB 4WJ5B 1GGYA 1XF4B 4J1UA 2R9HD 4XBGA 2BDNL 5F44A 1RI8A 4MA8L 4M4PA 3SDAA 3BKJL 4U6YA 3BPLC 1OAUL 5CD3B 4XGZB 4Z78B 4MA1B 5I1GH 1AGEA 1FDLL 4X5WA 3LKQB 1HQ4B 2P5EB 4G42B 4YDJA 4RWHA 4LK4A 4UTAL 3GIVB 1I9RH 1KCSL 2HMIC 2DLTA 1H5BC 4JGUA 2VB5A 3CMGA 3VFNB 3WHXA 4HQQL 3HUJB 3K2MC 4Y5XB 2FBJL 1FFPA 3S88L 4KGLA 4JM2C 4IDLA 4IIQB 1JPTH 2IBGA 4Z9KB 4MQ7A 3D18A 4PV8A 1F3JA 4R4BB 3E3QC 4PRID 4R7DA 1K5NA 1V7NL 3RWDA 3PWJB 1CD1B 5CBEB 4ZPTB 1EFXB 4H8WC 4JKPL 4ZPVA 4LQFH 5FKAB 4JG1L 4F7PA 4I48A 5IVXE 3QEGL 2MOVA 4LQ1A 2XA8H 3C8HA 5HYSG 2VL5A 3NA4A 1FBIL 4ONFH 3QUXA 1KCRH 3L7EA 3RWJB 2XN9A 5GGSA 4D9LL 1NGZA 4CADA 1MFAH 5CGYC 2V7HB 4Y19A 1LNUA 3DYMA 4IBLT 5IBTH 1BZ7A 4LHUA 1H3GA 1P4IH 5J57B 3QEQE 3RA7L 5HDQH 2H1PH 2MSPA 1BAFH 3TO4B 3D39A 1WCBB 4XRCB 3ZT5A 5IVXB 1UXSB 5IROA 4JM2D 5I8EA 4EJ1C 4GMTL 5D7JC 4A6YB 2UUDH 3QFDA 4ZNEE 1GOFA 2Z35A 1A6TB 4ORGB 3MACL 3L3GA 3BDYH 4U1IA 1QBLL 4Q74A 3MGTB 1CD0A 2H26B 5DHVH 2O93L 4HGKC 4LPYA 4U3HA 1MFCH 1S8DA 4XP1H 5I6XB 3AC0A 5E5UB 1EBAA 3QEQB 2WIIA 5D1XC 4KKCC 3DVNA 1QA9B 1EJOL 3GMQB 2BFVL 3UP1A 2D7QA 4MDJB 2XZQL 1NLDH 3FB5A 4V2CB 2G60L 3QR2A 1A21A 2CLZA 3HC4H 1IQWH 1P2CB 1GAFL 1UG9A 32C2B 1NEZG 3VXOB 4JQVA 4G8EA 1S9VA 4PY7A 4AQOA 2NW3B 3GSRA 1JV5B 1C5BL 3V0VB 2WAHA 4AH2B 4DN3L 3V5DA 4NHCH 1J86A 3MA9H 5GXBB 4NC0B 4U1GB 2HLFC 3I6KA 1D6EA 1Q94B 3MRCB 5DC4B 5D2NA 3C60B 4K3EH 3TCLA 4M1CC 1JPST 2Z91B 4G9FE 3BSZL 3SDXF 3QAZC 3ALXA 3NVQA 2NXZC 5FCUL 1QD0A 3QO1A 4RNRA 2R0ZL 1OY3B 1QSED 4BSWB 3U79A 2FJFB 1CZ8L 3R1GL 5D1XD 4KKCD 1C5DB 4LCYB 3MNVA 2SEBB 4F2MB 4EN3D 1A0QH 5FUCC 1UKTA 4LRIC 3AFLA 3Q2CA 3DO3A 1G9EA 3F12A 4FFZH 1EDQA 5KSUA 4TSCH 4UNVA 1CR9L 5A16A 5DTFB 2DL2A 1ZS8B 3D0LA 4QYOB 3MGOB 3QCUL 4NQED 4I3GA 3BGFB 1BBJA 4U31A 5BRZE 2GYSA 3JTTA 2IALB 4GW5B 1S5HB 3ISWA 5D7IF 4CMMA 1XCQB 5EOTA 3O9WC 3HNSL 2HFFA 5DK2A 2VLKE 1A6VH 3HC0B 2IFGA 5C2BH 5DMKB 3KLHD 1UENA 5C0FB 3REVA 5GGUA 1OWRM 4P2QD 4OUOA 1ZT7B 3P30L 3SGDH 2HLFD 4OBSA 2B2XL 3IJHA 3TJEH 3ZSSA 5KAQG 2Q7YA 3F58H 3ZTNL 4KVCL 3OAZH 4M43L 3O3EB 3LH2H 1M6OA 3B6SB 4M1CD 4E0RA 4P5TC 2R2HB 3DRQB 3V5HB 1NLBL 2NXZD 3QG6A 1DEDA 1NDGA 2BHYA 3TP4A 4PJDF 4GW4B 1E4WL 3QXTA 3J7HA 3C5ZC 4RMRA 4J4PA 1JZ5A 1NGQL 4N8VA 2H32A 3BWUC 3FO9B 5BRZB 4KUZL 1QR1A 5HI3D 2P8PB 4WHDA 4GKZB 4NN7B 4YHOH 2DTML 4LGSB 3TIDA 1Q72L 3TBYA 2VLKB 2F8XC 2JTDA 4K23H 5IFHL 4MVBC 5B38B 2FZ3A 1KB5L 3NAAL 3IJYB 3IDUA 1XIWC 4WUKH 2ZNWA 4Z7OF 3O9WD 3TT1H 3QNXA 2LABA 3QULA 5A43C 3BPOC 1JWUA 4FHBD 4JE4B 4WU5A 1U8NB 2Y5TA 5F7WC 2G2RB 5ISZE 4PJXB 5C6TL 3K1DA 5F9OH 5F71A 1E4KC 1PZ5B 3L95B 3O2VL 1IKNC 1NMAH 3WS6A 4AEFA 3NOIA 3NCFB 4F15B 4K7PY 3MJGX 2IQ9H 4W4OA 5C0EB 1MEXL 3GI8L 5K9OA 1CCZA 2P46B 2VKWA 3O3BA 5IW1A 2WLZA 1F4WH 1QLFB 3HE6B 5DA0B 3ZHKA 2XG5A 2DQFB 2DQGL 2OX5A 4O2FB 4ZXBA 4MA1C 4QNPE 3ZE0F 1GXEA 1B0RA 3SDDA 1NEZA 1MLCB 1PSKL 2UZYB 3ZE1F 4PJHA 1G7HB 3NCYP 2DI8A 2F5BL 1ADQH 4YHKL 1I3VA 3MLYH 5CD5C 4XTRD 5ISZB 3G5ZA 4Y5XC 4P4RB 1NGPH 1SJHA 2XY1A 2C1OA 2WP3O 4IIQC 3EJYD 5K9QI 4Q9QL 4CMHB 1UZ8A 3O3DB 4R3SA 4HKZB 4LDOB 3MV9D 4ELMF 5BMFH 1UWGL 4K07A 2ICWI 5JPMA 1NUGA 4NC1E 1I4FA 2DKUA 5DRZA 5CINH 4F7CB 3UBXI 4NJAL 7CGTA 4OCSL 1CLYH 1EEYA 4N5UA 1N2RA 1QBAA 2D4DA 5HVHB 4HUMB 1J12A 2EECA 4KI5E 3QQ3B 4YXLH 3A6OA 4QRSB 5JHDA 4PRDB 1N8ZA 5EDXA 4S1SH 5FUZH 4L9LB 3EYSH 4YO0A 3N1MC 5HVWA 2P5ED 2VLLB 5GGSY 1OCWL 4XWOC 5IT2L 4DAGH 3BPNB 3CJJA 3TO4C 3VFPA 1KUMA 5F7EH 2W59A 5T1KA 2YD8A 2CH8A 1FNSH 4PJAA 1OT1A 5I19H 3HCVA 3UTPE 4Z5RB 4LLUA 4X7SH 1B6DA 2B1HH 8CGTA 2R1XB 3FAXA 1XF2B 2VC2L 1XMWA 2B5IB 5J3HD 4EQ3A 5C0CE 2IG2H 2ADJA 4IMLB 1EFXD 4ZO8A 5TFSL 2H6PB 3WD5L 5C0AA 5I16B 4P2RE 4HIIB 3LKRA 2WK2A 3CDYA 5I6XC 4LSVL 5F7LB 3P9MB 3Q3GA 5CS7A 3V8OA 4R97B 4PP1D 1DFBL 1DQQB 5BVJB 4KXZH 3O0RL 3L6FB 4QOKA 5EO9A 5ENWA 1N3NB 3ARGB 2AEQL 1J18A 3UTOA 3DRTB 2PNDA 2GITA 3GBNL 4Y1AA 3BP5A 5HHPA 5E8NA 2QQLL 4BH8A 1CLZH 2E7LA 1W0WA 4XWOD 5JW3H 4JANB 2CDEA 3FN9A 4FQXA 2QV2A 2X89D 4RDQF 3TO4D 5BS0E 4G8IB 5GIRA 5C0CB 1BIIB 1I1YA 4ZFFA 1KBGL 3W5NA 2YZ8A 4WI2A 4OAWA 1Q0YH 5JXAL 5DT1H 4NFCA 5SWSD 4GKOA 1D9KB 3VI3F 4U1GC 2BVEA 1UVQA 4GAYB 3U4EA 3EZJB 1I1FA 3C60C 3FONB 1F42A 2X4NB 4X7DC 1JWMA 3HG1A 2F5AL 3PNWA 4WFFE 3IFNH 3FO1A 3DARA 1RZJL 1L7TH 4MNQA 4OFKA 3S4SG 1I3GH 3DV4B 1I9RL 3QEQD 1MHCA 3QISA 4FMFA 4TPRL 1Q0XL 2BRQA 3RVTC 1RUQH 5FA4B 5BS0B 5KSBA 3MJ9H 5KANI 1AKJB 4DZ8A 1JPTL 3LN9A 5IFAL 3LEYH 4L3EE 2W65A 3HB3D 3MLTB 3BD5A 4FP8L 4K7FB 1DQTA 2FSEA 3BGFC 2L7JA 4Z76A 1G7QA 2XA8L 3IFPB 5DEGB 1W8OA 1OP5K 4YHNB 3KR3H 1OM3H 5HSFA 1S9XB 5E9DE 4RGMB 3GMNB 3PP3K 3CDGA 2X89A 1KPRA 3DX9B 2YBRA 3NTCL 4WHYH 4Z7UE 4GRWE 1I8MA 3C60D 1HE7A 2IANE 1QLRB 25C8H 3TBWB 4H88H 5IBTL 1MFEH 1AHWA 5DJ8B 1DVFA 2CLVA 4JQXA 3FB8A 2J88H 2H1PL 2NW2A 1Y0LA 1GGTA 1JGDB 1P84K 4P46B 1FGVH 4X9GA 4L3EB 2DQJH 1YUHB 1AR2A 4HCRA 1WBZA 5LG1A 3LKOB 1OTTD 1KN4L 1J1PH 3S3JA 5EULV 1IC5L 4E42B 4NN7C 1DN0B 1BFVH 2CQVA 3HE7B 1N5AB 5E9DB 1FP5A 1ACZA 5C0BE 4NWUH 4Z8FH 3FTGA 4Z7UB 3V4VL 3UTQB 4B5EA 3U6RB 4GRWB 3D48R 3S34H 4HGMA 2PTTA 1YMHA 2IANB 3EJZD 1LE5A 2BY3A 1AY1H 1NC4A 1KTLA 4ZOBA 2OXGA 3U0WH 2X4RA 4G9FD 1F2XK 1LEKB 1WCQA 4WVRA 1LE9B 4JDZA 5JLZB 2E7CA 3UTZA 5JO5A 4QGTA 5E6ZA 2ATKA 4RAVA 1KEMH 2ATPA 2D0HA 2X4QA 3QO0B 1XH3A 1EMTH 4WWID 1FPTL 1L9NA 3O2DH 4ELKA 4F15C 3REWB 1NLDL 4NM4L 5GGVL 5A3IC 1K4CA 3MUY1 2JJUA 1IQWL 4PD4K 1FNGA 3QH3A 1X9QA 1Z9OA 3HE6C 3O4LE 2IMNA 2N1KA 1BD2A 5C0BB 3AB0B 3EAKA 3ETBF 1KCLA 1HSBB 1P5VA 3MA9L 5FO9A 4NUJA 1UM6H 1CDGA 3LSOA 4TNWF 5LCVH 4YHMH 1S7QA 5IMOB 1SEBB 3MBEA 2NNAB 2DQUH 3MXWH 3TNNA 1DLFL 4S0TD 5ANMA 3RUGF 2AXFA 4PJIF 4LCCA 2OI9C 3NH7H 3BJ91 3SKUD 3DNKA 4CMHC 4M62H 3T65A 3UEZA 2EO1A 5A40E 5JA9A 3OAUH 1SBSH 2NXYD 1UM5L 5DVNA 3BGAA 3O4LB 5C0DB 2OTUB 1FNHA 4LVNB 3ROOB 3S4SA 3LQZB 4J8RA 5IV2A 1OD9A 3LEXB 2IQAA 4FFZL 1MHHA 4NOBA 5DJ0B 4MB5A 5HVHC 4TSCL 3VXTB 2Q3ZA 4IRZH 3C5SB 1N6UA 4L9LC 1NCTA 3DXAE 3RIFF 3I75B 2OP4H 3ULVL 1A6VL 1T21A 3AY4C 1ZVSA 5L8KB 3BPNC 5IIEB 1Q8MA 3FO2B 3KWWB 1WWAX 2C7UA 5ISZD 3EO0A 1QP1A 1E27A 1IAKA 1SQ2N 5JMOC 3QDME 4HT1H 1A1MB 1AI1H 4XZUB 1ZEAH 4CNIB 1RULH 2B5IC 1NANI 4X7EC 4I3SL 3OGOE 2YEZB 1ND0B 3N85L 1NCBH 4KI5C 2R23A 1JRHI 3VRIB 3QXAB 4NQXA 4ZFZA 3UJTH 1C5CH 1TZGH 1BBDH 4S1DD 1Z9SA 4YHOL 5AEAA 3DXAB 4R97C 1YJDL 1KB9J 4R8WH 1R5IB 5JDSA 1YMME 3E8UH 3QJHA 4XPGH 4EI6A 5JORB 3BP7A 3VA2C 4LNVA 3ARGC 4JHWL 4J1UB 1MAMH 1GC1L 1H0DB 3S36H 3SDAB 2DDQH 4P23A 3DUUA 1D6VH 1YY8B 4JO2L 4O5LH 4OF6A 4L4VD 4WGVB 4B41A 2NMSA 4WFEE 1LO0L 2DYPA 3I9GL 1YDPB 2HJKA 5F9DC 5JUEH 5TH2A 1HQRA 5FYLL 4TULH 3SGKC 1FORH 4KV5F 5CZVH 1ZHNA 2IQ9L 1D9KC 2VDLH 5IMLA 4AY0A 3A0OA 5D8JH 4LSRH 1T66D 4GMSH 4HSQA 1F4WL 4KI5D 1YMMB 2VDPH 3D18B 4PV8B 1GGBH 2YSSA 3KPOA 1WGOA 3WFCH 1BFSA 3QPQC 4XNUL 1HI6A 1F97A 1EVTC 1CQYA 1G0XA 5CEZL 3QQ9C 2F8OA 3S35H 3OAZK 4ZPVB 1O0VA 8FABA 4F7PB 4I48B 5DK0A 5E2TH 3IDJB 2XQBH 3GSUB 3TPUA 4DGVL 2MHAB 3EHBC 3QUXB 1NGPL 2BOBA 3ARGD 2WWMC 3L7EB 2CIKA 2RIKA 2W92A 4XBPA 5GGSB 1NGZB 4CADB 3UTPD 3DO7A 4LPCA 5BMFL 4FRWA 2CXKA 1ETZB 1LNUB 2EIZB 2Y1VA 4LHUB 1R24A 3IDXH 1FL3B 1KPVB 2WQ8A 2GQHA 3P3YA 5C0CD 3BRGC 3SPVB 5J6GA 1X5HA 2WANA 5LGKA 4R7NA 2WWKT 4LLVA 4P2RD 4KKLC 4RGMC 2OCFD 2DWEA 1IEHA 4YXLL 1DUYA 2I5YH 2VXTH 4F7TA 3AAZA 4X0KA 3QFDB 2GTZA 3BYTA 3QPQD 2Z35B 4B7IA 2OK0L 3L3GB 1YEIH 3JVGC 1BJ8A 3QQ9D 4O9HH 1FCCA 4P46C 4AEIL 4GG6A 3NZHH 4XVUC 4HFUH 4HZAA 4ZMAT 4OZIE 3C2AH 4PTUB 3VFSB 1FNSL 1JZ7A 3EHBD 4KK6C 3PQYA 2WWMD 5I19L 2AJVH 2B1HL 3HE7C 3TLRA 2R56H 1Z3GL 1X5KA 4JRWA 2IG2L 1FC1A 4ZFOL 5SX4H 4YH6A 2J1KA 1PFCA 4LAQL 4X6DE 5E8DH 1KB5A 5JMRA 2XZAH 4KKLD 1NAMH 3MJ7B 4UT6H 2X42A 3SKJH 4YEFA 4G5ZH 5CUSL 5D9SA 3V5DB 2V9RA 3WDHA 4OZIB 3SGEH 4HMDA 4XI5C 1TVHA 3VXSA 3I6KB 4TSBL 4WFGE 3FFCD 3PL6A 4P48A 1BLNA 3EFDH 3CX5K 5ITFA 4POZC 2R29H 2Q86A 4HWEH 1K8IB 4LNRA 5JW3L 1AE6H 3WBDA 2VQTA 1CTOA 3AB0C 2FATL 3QO1B 3GSQA 3WXVH 5GRVK 1QHOA 1Q0YL 2ICCA 2YK1H 2LVCA 5GS2D 3GJEB 3MNVB 4X6DB 3QUMH 5FYKE 5F93C 3T8XB 2AXGA 1J0HA 1J7VR 5E9DD 1CIUA 2EYTA 4X80L 3F12B 4XPAL 2APXA 4ZTOH 2IAND 3DOSA 2X5PA 5LGJA 4DGIH 3FQWB 2CDFA 2XRAL 1BBJB 1ZMYA 3JTTB 1DLHA 3FQUB 2E7BA 3W2DH 5EOTB 2HFFB 5DK2B 1S9YA 1LO4H 5EC1A 4LVNC 5GGUB 3T0AA 2EKSA 4KK8C 4G8GA 1AFVH 4LCWA 4XI5D 1KCVH 4XPHL 3IJHB 3HZYB 4OCYH 5HYSB 4Z77A 3P4MA 4FQ2H 4POZD 5FGBA 5HDLA 2DIJA 2BCKA 2OZ4L 3QG6B 1R3IH 1K6QH 1NDGB 3G5XA 2WZPD 3KR3L 4O02H 4ZODA 4AIXA 1MJ7H 4A2MA 3CSPA 1VADB 4ZS7H 4PPTA 3OKMB 1FZKB 5CSBA 4HS8H 5GGQH 3PG2A 1Q1JL 1YNLH 2P1YA 1QRKA 2P45B 2P48B 4QRPA 3TIDB 5CGMA 25C8L 3EOTH 1UFUA 4H88L 4EVNB 4PY8J 2EYSA 2FZ3B 1A4JA 1IGYA 2VDKH 2AJ3B 2X6MA 4XHJC 2PYFA 4MA3B 3EW3B 3T1WA 2EE2A 3TIEA 2DQJL 4JDVA 4X9HA 5FM8A 3BMVA 4CVZB 1MCPH 3O4LD 4QRTB 3WNMA 3QNXB 3QULB 3CFDA 1OPGH 1JWUB 1RK1A 2ZOLA 2ARWA 3OPZH 5EIQA 1U42A 4PRBB 2BERA 3V4UL 1MELA 1WWWX 4Z8FL 3TH4T 3OKNB 1OQXA 1AY1L 3SDAC 4NP4H 3U0WL 4U7MA 3IETB 2FO4A 1MCBA 2XKNB 3D69A 2J2ZA 4O2EA 4P9HC 3WS3A 1BQHA 4O4YL 1UYWH 4M48H 1B0RB 3SDDB 1NEZB 4HWZA 3X13A 3O2DL 5JHDE 3L3IA 4B50A 2RCSH 1NUNB 5FXCH 5KTEH 5I2IB 4J23A 2IPKA 4IS6A 3P0VH 1OAXH 1CU4L 4HUWA 1IAOA 4M1GH 4XVSL 3ZHLA 4JFXB 4HW6A 1UZ8B 4R3SB 3N9GL 3U48A 1EJ6A 3UTTE 4Y2DB 1UM6L 1I4FB 5EB9A 3BP6B 2ICEA 1R6VA 5C07A 5FFLA 4XMKH 2FH8A 3IDGB 3JWOH 3MFFA 1EEYB 1XGQA 5EUKB 1N2RB 3QUXC 4G6JH 1BGXH 1KEGH 2AVGA 5DD5L 5JHDB 3AS0A 3IRPX 4FFYH 3ARED 4M62L 3QDMD 4NT6B 3SOBH 1T1XB 3RGVB 4ZQKA 1OOAA 1MUJA 1FN4A 2IH3A 3OAUL 5H2BB 4PRPE 5IB1B 2BSSB 5K9KA 1MHPL 1YQVL 1XGPA 5IR1B 3P73A 4LEXL 3UTTB 4MCZA 3V2AR 4DUWA 4PJAB 3NCEB 2ZPKH 4IRZL 2FIKB 3HCVB 1YMMD 3NN8B 2AXHA 2HVKB 4Q58C 1A6UH 4I0PD 2OP4L 2VDNL 4TTGA 3N0PB 4LPTA 2ADJB 1G9NH 2I25N 5C0AB 3CDFA 1ZHLA 4HS6A 2X1WL 4PRPB 5HI5C 4W6YB 4G43A 4KTEL 4XPBL 4HT1L 1HHKB 3WKNA 4DGYH 5D1ZA 3CVIL 3LN5A 3HS0A 5DJXB 1ZEAL 3DSFL 3CUPA 1F3DH 1RULL 5AUMA 3BZFA 2MPAH 1NCBL 3IKCA 1PX4A 2GITB 3ZYIA 3BP5B 3TT3L 3WYRA 4Y7MA 3UJTL 1DL7H 4BH8B 1C5CL 3GM0A 1TZGL 1BBDL 2HAZA 3BH9A 4G9DA 4OLUH 2E9IA 4M6ML 4Z7VE 4FQXB 1MNUL 4RMUA 5F3BB 4JZJA 4JQVC 4N8CH 5GIRB 4Q2ZB 1I1YB 4HC1L 4PJ7F 5DHVA 5IHZB 1GGCH 3E8UL 4XPGL 2ZCLL 3BOVA 3DUHA 3GZKA 2OXHA 1E28A 1ZKAA 4M9PA 4NNPH 2P4AB 2R2CA 4QRRE 1MAML 3U4EB 5I0DA 4XVTH 3ZDYE 1NUDA 3S36L 2DDQL 1I1FB 1D6VL 3RL2A 1J88A 1LP9F 3QIBB 4J6RH 4AJ0A 4G7VL 3ULUF 1JWMB 2C4FU 2ADGA 1VFAA 4MAUH 3VGEA 3RVVC 1XR8B 4MNHA 3S36X 4MNQB 2HN7B 5FA3A 4OCRH 5HI5D 1A7QL 1KLUA 5CP7A 4E5XB 3DV6B 2VDLL 4ONGH 4Z7VB 4CW1B 4WWKB 4LSRL 4I4WB 5C9JA 4KDTC 4LAJH 1FIGH 4HHAA 1GGBL 2JCCE 3WFCL 5DLMH 4QRRB 3TA3D 2AI0L 3G9AB 2P44B 1ZT1B 4P2CG 4HIEA 1GZPA 4JFQB 3S35L 1MCSA 3HI5L 5T3ZH 2CRMA 3LRSA 1G7QB 2W9DH 5I1CH 5TF0A 5GHWL 5H94A 3CXHJ 1GOGA 4NRZA 2ZG2A 3O41A 1NBZB 3S35X 1KPRB 2YBRB 1A9EA 5C09E 3U83A 1TIUA 3LKSB 3C6LA 1WBYB 1DVFB 3RVVD 4LBEA 2DMCA 2NW2B 2JCCB 3MFGB 4QRQA 1EK3A 5GRJH 4FXKA 3L3HA 3PHOA 3VI4F 4TNVF 5CEXA 2A73B 1UCTA 1FNEB 2B7DT 1TQCB 1F5WA 2I5YL 1R3HB 2VXTL 1SM3L 2V2WB 1P1ZA 4FQCH 4N0YL 4U1HA 4HGWB 4JFDA 4PUBL 1CBVH 3U1SH 1YPZE 3FTGB 3DGGB 2FECL 1I9EA 3GMLA 4WFGD 4O9HL 1YMHB 1N4XL 2MQ0A 1LE5B 2I07B 1KTLB 4C59B 4DQOL 2FEEL 2X4RB 1Z6JT 3TA3A 4M7LH 4JDZB 4BQBA 2YD7A 4QWWC 2AJVL 1F6LL 3LV3A 4Z7WA 5C6WH 2ATKB 1HCFX 4GRLA 4MSWA 3OKOA 2R56L 4LEOA 3IU4H 5K9JL 1PW3A 1NC2B 4ELKB 2NY5H 4W4OC 5D71L 4OD3H 1K4CB 1KPUB 3WO3B 1FNGB 3ZDXE 4ONHB 3QH3B 4KMTH 5IVNA 4QF1A 5C0IA 3V7AG 4H0HB 4UT6L 3VXQB 1YPZB 4JM2F 1T2QL 2MCPH 1WF5A 1KENL 4R4FL 4QXGH 1ZANH 2OQJB 1UWXH 1FFOA 3SDDC 1CL7L 4NUJB 5DRXA 4Q97A 3BQUA 3KLDA 2YD2A 2UZIH 5I76A 4ODWB 4MHHG 2XTLA 3HZVA 4P2OA 2R29L 5CAYB 4HWEL 4LCIH 5IB4B 3I3DA 5ANMB 5GSVA 3TZVB 4LCCB 3QI9A 3MYZA 5EU7C 2OM5A 3G04A 3VXMA 1ZAGA 5ADOH 4Y2DC 1G7LB 3Q6GH 2GJZA 4QWWD 2O61B 5E5MA 1ZT4A 2V5YA 1L0YA 2EE6A 4QHKI 3S4SB 3T04D 2DBLH 2F54E 3M17A 1J5OH 2IQAB 4OQ1A 1MHHB 5A2FA 4JFPA 1T0NA 1AQKL 3EO9H 1Z0NA 1UC6A 1ADQA 1MVFA 3QIWA 1G6VK 4IMKC 4JDTH 3R8QA 4Y4FA 5J1AA 3RGVC 4NO2B 4XPFL 1JF5A 3W2DL 1J05B 2BC4B 1X5YA 2KUTA 4M61B 3FOMB 1LO4L 3QUYB 1G6RL 4PJEF 3W11D 1AFVL 4YBHA 4G8FA 5AAWA 2R0LH 5T1DH 4FQ2L 1T3FB 3NFSL 4UV4L 4IM8A 4YNYA 1TZHA 2F54B 3MV7D 2ED7A 4QHMA 1JNHA 1R3IL 2QR0B 1U8IB 3MRBB 4Y2DD 3IAGC 2OL3H 4OKVB 2AP2A 4D0BB 2J8HA 5T5NF 1IGIH 1G9MC 4OZGA 3UAJC 1BZ9B 4HS8L 4YZFF 5LAXA 1YNLL 2FL5B 4RISH 3HMXH 4YDIL 2MJWA 5JDSB 5EU5B 2QSVA 1INEH 1A2YA 3QJHB 4EI6B 3BP7B 1J0IA 2DQIL 2VDKL 4I77H 4KJYA 3V6OA 2Q8AH 1KLGB 3RGVD 2E6PA 3BH8A 2WWKO 1WZLA 5J6HA 1H3UA 1MCPL 1MI5D 2W38A 5E4IA 2E7LC 1OPGL 3L3DB 3RTQA 1ZHKA 1BQSA 3KDMA 4FQXC 3VXNA 3LN4A 3OPZL 4U0RB 3UTTD 2PTUA 1B0GB 5GJSH 1NCCL 4X98A 3GFUA 3JBG7 1A5FH 1VENA 2Y4SA 1OSPH 4JN2A 1IT9L 2HJLA 1ZHNB 2NZ9C 2FHBA 1CFNA 2YRLA 1Q38A 1S7TB 5DD0H 2HLAB 1A6ZB 3X14B 3LHPL 4NP4L 1I7TA 3QIBC 3GDBA 2EKJA 4AM0A 2YSSB 3RWFB 4TVPL 1RD6A 5D70H 4DCQB 4P2YA 4DTGH 2YWYA 2QTEA 5DHYA 1YEEL 4M48L 4ZDHA 1AIFA 5DRNA 2HG5A 2NTFA 3BUYB 4PRPD 8FABB 1X6LA 4KHXL 5BZWA 4M3JA 4HV8A 4WWKC 5T3XH 3VMPA 5HYFA 5KSVB 1EUUA 1FAKT 2CIKB 1CN4A 2YPKA 4M1GL 2VNCA 3F65A 5E00A 2R39A 3WN5B 3ET9F 2YPVH 4JG0L 1P4BH 3QRGH 1RZKH 4XXCA 3VXPA 5FK9A 3VMNA 5J6GB 4CJ0A 1T7XA 5I8KH 2PR4H 1QSVA 4R7NB 1MI5A 4M6AA 3O6LH 4S11A 2NZ9D 4ORZC 1JN6A 1N59A 1KEGL 4NCDA 2BNRE 4JJ5B 3I6LE 5JW4M 4M7LT 5DDHA 5I1LA 3QIBD 2NY0D 3SOBL 3OR7B 1RJZA 1FQ9C 3AAZB 3MJ9A 3BDBA 1SEQH 1DVFC 3OV6A 4JQXC 4XC1H 4DZBA 5I8CA 2WMPA 5IVZA 4D0CA 4IEFB 1N0LA 4GG6B 3BFOA 3MCLH 4HPOH 43C9B 4MLIA 4WWKD 2ZPKL 4QXWA 2APTA 1KYOJ 3B3IB 1TQCC 2VQ1B 1FLTX 3T0EE 4MYWB 3VRLE 4QRRD 3IXAA 1A6UL 5HJ3A 1IFHH 1S7RA 4YUEH 3WNNA 4YDVA 2BNRB 1G9NL 1PGRB 1MCHA 3KPQB 5CIPH 3TBSA 1H3PL 3E1F1 5HGAA 3MROB 5FOBA 5TE7H 2NX5E 5ILTH 1DE4A 1FZJA 5IB5A 1CICA 5C08D 1KB5B 1KIPA 4APQD 2VITA 4AQ1B 4R90L 1SVZA 5EOCL 3Q5OA 1TZIA 3ZMRA 2AS5M 3GKZA 5JNYB 4FXGA 2HRLA 4YBQC 4U1MA 3D25B 4MD4B 2IGFH 4OLXL 5EIIA 2ESVE 3VXSB 5ICYB 3SJVD 3PP4L 2YUWA 4I0CC 4JKLA 1B9ZA 1BLNB 5BV7L 4DK3A 2Q86B 3T0EB 5D5MF 3BP4A 2J8UA 5CJQL 5DJZA 4S0SD 4OM0L 1CDBA 1RV6X 3S96B 4D8PA 3CVHH 2EDYA 4TQEH 2Y06H 2Z31A 2JELH 5C09D 3LB6C 1BJ1J 4JB9H 3O2DA 1FFQA 3TZVC 4LCCC 2ESVB 3TJHC 1RIHH 2LE9A 4OCRL 4HKXB 2Z4QB 3ZTJH 3GMPA 5CJ8A 5TDOB 1S9YB 4PRHE 2OJEA 3R0MA 3HAEG 5E8OB 3QNYB 4F7MA 3O6FA 1NC2D 1VHPA 3JSSA 3BE1H 4Z77B 4OI9A 5DLML 4TUOB 3EYQC 1MJUL 4HXAH 3LDBB 4HX1A 4LARL 1AGDA 2C5DC 3EO1A 3CGTA 1CK0H 5I1CL 3SJVA 1E4XI 2ED9A 1AC6A 3U82B 2NY1D 3QUYC 1T83C 2C1PA 1U95B 1I85C 3DURB 4EIGB 2YD4A 1LGVA 3IFLL 4ZO9A 1JHTA 3NIGE 4OQTL 2R1WB 1TCMA 4PRHB 3LB6D 3RBSA 2XACC 3R8BB 3TZVD 1IGYB 4OLZH 3QJFB 1PG7H 4YIQA 3TJHD 1UCBH 5CJXA 4NNYA 4U1NB 1ZHBB 1MLBA 2KDGA 3DHJA 3MRMA 5DQ9A 1Z5LB 5E70A 2JJVA 3ULSB 3INUH 1WV7T 1XF1A 3CFDB 2ZOKA 2EDBA 3CFBA 1CFTB 3D9AH 4X6EA 5EC2A 3V6FA 1RK1B 1XFPA 2BVOB 4HF5H 4KRMB 4AG4H 1U41A 4FQCL 4U49A 4XNMB 4K94H 3RU8H 4FABL 1JZ2A 2JJSC 4XP9H 2ZJSH 2DQTH 2GIYA 1DBKL 3SBWC 2FO4B 4K8RL 3T3ME 3QUYD 2X1PA 4PYHA 3RDTA 1C16A 3WS3B 1CXKA 5DJAA 5F7DA 4V2BA 4U0RC 3PABB 4RWYH 1XF5A 3ARTA 3MLZL 3L3IB 2ED8A 2FDBP 4NYLA 3F7VA 3SDYH 4YWGH 4LPXA 4JFHD 3O6ML 4QKXB 4DW2H 4HC1A 2V7NA 1U8HB 2G9HB 1LEGA 1JK8A 5FO8B 2EO9A 2BVQA 1W72H 1TDQA 4NFDA 3A67H 2CMRH 1FZOA 5D6CA 2AK4A 3KNBA 4N9GA 4S1QL 1MWAB 3LQAH 4P4KB 1H9VA 2XT1B 2DI7A 2NLJB 2UZIL 3QA3B 5C07B 3H7BA 5JOFB 1K9TA 2VXUH 1VESA 1XGQB 4JO3L 4OD1L 3EOAA 2Q7NA 3SCMA 4W70A 5I1HH 2LTQB 3ARSA 1DBMH 1S7XA 3L3KA 2D03H 3W9DA 3OKYA 1FVDB 4U1KB 1NAKH 4ZUUA 4TUKH 1X3DA 5F88A 4ZQKB 1FN4B 2YUXA 3GBMH 4G6KH 5CMAB 3W0WE 2VKXA 3WN5C 1KC5L 3VD3A 5DEFB 4U33A 3FJTA 5ADPH 4AMKH 3BN9C 3RQ3A 5IBLD 3HRZB 1KCUH 5F89B 4F33B 5K9KB 5BXFA 5T33H 4F9LA 4JCMA 2YD6A 1G7IB 3P73B 2FX8H 1F6AA 1V7MH 5BQ7A 5DD1L 3A6BH 1BOGA 2QQKL 4N90E 1NANH 1A47A 1JNLH 2CK2A 5EN2B 4NC2B 4OZHE 1JRHH 3PWUA 4C55A 3ARBA 2LAAA 4HIJB 5CWSB 4YPGB 4KK5C 5E8PB 3DROA 4JFYB 3SE9L 1LD9B 1JGVH 5HYJA 4JY4B 4MA7L 5I74B 2NY3D 2PTVA 4UU9B 1ZHLB 2H41A 1FGNH 2R0LL 4HS6B 4R0LB 5T1DL 5HHVL 1C08A 3LPFA 3G6AB 4G43B 4YHYB 3HZKA 3JWDH 3VFVA 1WIPA 3ARWA 3WIFA 2GFBB 3HS0B 3CUPB 5EBWB 3WJLA 3BZFB 4PGDB 4NO0A 1UWXK 2EDFA 1DQJA 2GI7A 3BN9D 1A7PL 4ONOA 3O2WL 2AK1H 4TNWK 2DKMA 3WSQL 1ZGLB 2VR9A 5FDYA 1YA5A 1MSPA 5D7SH 1HNGA 1EVUA 5ESVA 4RISL 3CFJA 3U7WH 4JFFE 1YEGH 2X70B 4I77L 1E28B 1P7QA 2E27H 4U6HA 2C4FT 1QLEL 1ZLSH 2Q8AL 1MCIA 2F53E 5M7QA 3F7YA 4S2SA 1C7TA 4GOSA 3VWJB 4W81A 5DJDB 4ZFGL 4KK5D 4JY5H 2GK2A 3T0EC 2FEDC 2ADGB 3UTSA 3ULUH 1DQLH 2IAMD 3RVXC 2XXCB 2LFGA 4MNHB 3DETD 1T2XA 3MRQA 4JQIH 1UXWA 5KVMC 1A5FL 1A7NH 4WY7L 4M7JH 4YHLH 1OSPL 5CP7B 2EDHA 4PLNC 4KH2A 4J3WA 3MRFB 1KJ2H 1A7OH 4LIQH 1NAMA 3DTXA 4M8QA 1QFUH 4PR5A 5C9JB 1KIRA 1CE1H 3RIFK 3NZ8A 2CO6B 1RJCA 1TITA 1MQKL 3FKUS 4N0RA 2BNRD 3I6LD 1N5YH 1WISA 5JZ7C 4X4ME 4DTGL 4WV1B 4DKEH 4J3VA 3AGVA 2F53B 4GQ9H 2BNUA 1DQMH 3DI2B 2H9GA 3FQRA 4ODHL 2O5YL 3ULVE 3H0TB 3SDXA 2DWDA 4N8PA 5T3XL 1PYWB 3Q5TA 2HKHH 1JGLH 4NRZB 2CKBL 3PWVA 3BKYH 4EI5D 3W39B 4KRPB 2B4CL 3IT8D 5BVPH 3T0ED 4PREA 2OJZL 1HHJA 4PRNB 5I75B 1MPAL 2X9WA 3AUVA 3LDBC 3MUZ1 3OKKA 3QRGL 4LBEB 1SJXA 1TFHA 1UKSA 4KY1H 1GYAA 2PR4L 3ALPA 3H3PH 4RGOL 2NX5D 1KNOB 2EDLA 3O6LL 5HHME 4FXKB 1D5ZB 4KI5F 3DECA 5CEXB 3ARFA 2DQDH 2IAMA 5D7IA 5ECJE 2AV7A 4Y4HA 4NZRH 4C57C 4HS3A 1YYMH 2PO6D 2ITCA 2X4SA 1P1ZB 3FT2A 3RPIA 1MRDH 1SEQL 4JFDB 3QIUD 1HN1A 4LRNH 3NIFE 5C0RH 4NQCA 4D3CH 2LV4A 3GMLB 1A4KB 1NBVL 3ZKNC 1YEKH 3LS5H 5ITBL 3PWPE 1X5GA 4QHNB 4AT6B 3VCLA 3MCLL 4LKXB 3V4PL 5C7XH 1EO7A 3LV3B 4PJDA 1UJ3A 3O3AB 4GRLB 4F57H 5FYLE 3OKOB 4LEOB 5HHMB 3MLXH 5IEKA 4KQ3L 3UDWA 3Q1SH 3OGCB 1JPFA 3GIZH 4HG4J 3QUZB 3ME0A 1WBXA 5GRYA 5TE7L 4WI9A 4L9DA 1VCAA 4Y4KD 4NN5B 3B9KB 5DJ6A 4U6XA 2X40A 5TJWK 3V0AC 4ODXA 2HYMA 3RX8A 3UMTA 5HGHA 1RUPH 3VFRA 5KZCB 1HHGA 1KJ3H 4UAOB 5CEZE 4CN4A 3PWPB 4PJGF 1K2DA 5IBUG 3BQUB 3BVNA 2X2YA 3BMWA 4IOIB 4X9IA 4H8WH 3L5XH 4XCCH 2Y7QB 6FABH 2YXMA 3O4OB 5ALCH 3MZGB 2PO6A 5GSVB 1FRGL 3ZKND 2ARJA 4CAGA 3G04B 4AENB 2IH1A 5IQ7L 1VGKA 2XPGB 3QIUA 4P4KC 1T89A 2C26A 2GJZB 1FE8H 1Y6KR 1ZT4B 2VH5L 1DSFH 2FB4H 2ZNXA 1FLRH 4KTDL 5SWZA 1RZJC 3C8KA 3M17B 3CVHL 1L0XA 4MAYA 2YRZA 1CD9B 1TVBB 4EBQL 5AZEL 1ZWIB 2LTQC 4JB9L 5L7XH 1T0NB 5C0GA 3ARUA 4KJQD 1IAMA 2AABL 1RIHL 4P57A 4RQQA 5LBSH 3QIWB 4OZGE 2KKQA 4MNGA 1NL0H 5I17B 5MENA 2QHLA 3U46B 2IF7A 5J06A 5HHOA 4Y4KA 4X6BB 5JA8B 2I60L 2AJSL 3BKMH 4ELMA 3EOYG 1QQDA 4D94A 3BN3B 5HPOA 3KYAA 2GSIA 2ZCKH 1CQKA 4GO6B 4K3HA 1F4AA 3HC3L 4QHMB 1CK0L 2ZWLT 4HK3J 2XWTA 1KTRL 4CU8A 1OARH 3BXNB 4P4KD 4EDWH 2BNQD 4ODSL 4EZMA 4PLKC 3LIZL 1I1AB 5I74C 3QUKB 4KKAD 4OZGB 4HJ0D 4R0LC 3K81A 4Y5YA 2FD6H 5D6DC 5J13B 5GGRA 4YHYC 5HD8D 1IAIM 5EO1A 4IHOA 4EUPH 3GRWL 1PG7L 3HHRB 4XB7A 1OLZA 3D87B 4BA8A 4PJFE 3V7AE 3GK8H 1P4LB 3CH1A 3FB7A 3QHFH 5FDWA 1PG7X 1JGUL 1FVCA 3MLRL 1ZHKB 5AG8A 4PJ8B 1JTOA 3I3EA 4ZFOB 3BHBA 4X98B 2HH0H 5CCKH 3BIKB 4LFHG 3U0PB 1FFNA 4JKWA 2HJLB 3ARDA 3NGBB 3G9VA 1OL0A 1LDPH 1C1EH 2X10A 3PWLA 4Y5VB 4HJGB 5E2WH 5CJOL 3VWJC 3IDIA 4NBXB 1I7TB 5DUMH 4UIMA 4XVJH 4OV5B 2VLRA 4AM0B 1UZ6E 2P8LA 4IDJH 4XMPH 5B39G 5T3ZD 1RURL 1I1RA 5FHAL 4RWYL 3O11B 2BY2A 3W0WD 2H2SD 4KXZI 4ZDHB 4PJFB 5DRNB 2HG5B 1J0JA 3ECBA 5LGHH 1EAPA 1M7XA 3PGCB 4YLQT 1AGFB 3CC5A 4HV8B 3TM6A 3I2CL 3WXWL 4FA8A 2Q87A 2E5EA 1W72L 3A67L 4N90D 5EPMB 5C0JB 1U8LB 1Y18B 1MCOL 4WV1C 1U3HB 3V0WL 4A2LA 1VPOH 3C2SA 3QHZH 1NKRA 5EZJB 3TVMA 2LU3A 1N0XL 4U1SA 3VXPB 5FYJU 1NBQA 3FHQA 4NZJA 3BGMB 4TRPH 2W60A 3W82A 1JN6B 5HDOA 5F7YC 3S8WA 3HI1B 1T1ZA 4QXTA 4FS0A 3LMJL 2VUYA 5I1LB 1NAKL 1RJZB 3GBML 5I75C 5I1DB 1G7PB 1EHLH 3EDDA 3IFOB 1UA6H 1QVOB 2P24B 1OGTA 4JZNA 4DZBB 5LJYH 4CL7A 2EEAA 2BRRH 4ZSOA 3TPKA 1RJLA 1R3JB 3A6BL 3S5LG 3G08A 5E2VL 2E6JA 4NGHL 2D7TL 3ULVC 4JFFD 1T5XA 5HGBA 3X17A 1JRHL 3UPRA 4NQUA 3MA7A 1CF8L 2OMNA 4MQXC 3H9ZA 4UOW1 4X7FC 3KYMA 2J8UE 5HGAB 3BEVA 5ALBL 4OQTA 5FOBB 5FGSA 5I1IL 1FZJB 1KG0A 2I24N 1FGNL 1CICB 2VR5A 1KIPB 3RJDA 4OFYA 3JWDL 3QDJA 1TZIB 1E6JH 1FZMA 3EYVA 2XICA 4FXGB 4GRLC 3RRQA 1X5LA 2DIBA 4I0KA 4U1MB 2FGWH 4FNLL 4PJBF 1A6AA 3PHSA 2AW2A 5B8CA 1S7UA 2XG4A 3IJSA 3QUZC 1YJDC 2O5XL 1IL1A 5L88H 2HFTA 4N0UA 4NN5C 4OD2A 3E6HA 3B9KC 3QQ4A 3QXVA 5IW6A 5ID0A 5J8OA 5JQ6H 2J8UB 3U7WL 4UAOC 1GC1C 5D72H 4FFVC 3WFHB 4P59H 2E27L 1XZ0A 2YZ1A 3ULVD 3BQUC 3HR5A 3MUGA 3DSNA 3V5KA 4WHCA 4GRMA 4WTXA 4LSPH 3FAWA 1GZQA 1X5JA 3QEHB 4J3TA 4ZS6D 1LK3H 4JLRB 4M6OH 4LMQE 1F3RB 1T80A 3CLEL 2IWGA 5K9QG 3O4OC 2KZWA 3JV4A 4L3CA 1MFDH 3JXAA 3ULUL 1BWWA 3EDKA 4NQDD 4D2NA 2P5WE 1IBGH 5MEPA 2HT3D 2YKLL 2OTWB 3QDAA 1RVFH 1V3JA 3D3VA 1IC7H 1X7QA 3UBXG 2AJXH 4BSVB 4L8DB 1KJ2L 1A7OL 5HHXH 1AO7A 3C5JA 2C3HA 4NBZB 4WENB 3GHEL 4NO3A 5HHMD 3HZMA 4KFZC 3M07A 4DOHE 2X1OA 5F6HJ 3MNWA 3QWQB 1SYSB 4JHAL 1VA9A 3QUZD 4DKEL 1E6OH 1EEZB 3AS3A 3UJJH 2VAAA 1UM4L 2MTPA 1JWSB 1S7VB 3B9KD 3QIWC 4JRXE 4XP5H 2OR8A 1AGDB 3EO1B 1XGRA 5KZCD 1QSFE 1DBAL 4NNXB 1U8OA 3RUGA 4PJIA 4A6YH 3PWPD 4PS4H 2WBKA 4MDIB 4UV7L 2P5WB 5JXEC 3MPCA 2X4PB 1NGWB 2A6IA 5KSAA 3QDGE 3RL1A 5EA0H 1TNNA 1LO3H 3RBGA 5BVPL 5C8JB 2BSRA 5IW3A 5IQ9B 3MV8A 3A6CH 3EFFB 2XZCH 1C8PA 4YIQB 3MRIA 1T5WA 1Q9WB 4HWBH 4BM7A 5CZXC 4BUHA 3H3PL 5SWQA 3GKWH 4L8CA 5DQ9B 5IHBA 3NFPA 3B5HA 1I1AC 1P9MC 2DQDL 2VUOA 4QT5A 2ZOKB 4NQDA 1OGAA 3V6FB 3CPLA 3EUUA 3IGAB 1QSFB 1RK0B 5DWUH 2HJFB 5J13C 5CEZD 3GJFB 5DUBA 5KVGH 4MX7B 4PBVC 4CVUA 4CVXB 3VXRD 4BUGA 1VFBA 1WAAE 2AK4E 3QDGB 1MQ8A 4GT7A 4X7TB 5DMGD 2AJUL 1VGEL 3MRDA 3KPRE 3LS5L 4OZIF 1FSKB 5GGRY 2D4FA 2Q6WA 5F97E 3RWIB 3KYOB 4ACPA 1KJMB 2UV3A 4GXUM 1NGXB 1XEDA 1E0OB 3RDTB 1Q9LA 5JXED 4CN6A 1WQVT 4PJ8C 5DJAB 2OR9H 5L6YL 2OL3A 1RJYA 2P42B 4R2GB 4EOWL 3MLXL 3UXFA 2BMKB 4QHLA 3WL9A 2P7TA 3NGBC 2O5ZH 5D7LA 1TLKA 3HMXA 4WUUE 3TF7C 4Y5VC 1JTTA 2VERN 4X6DF 1I8KA 3STLA 3U36B 4JRYE 4C83A 3P4LA 4RBPH 4GKNA 2F58L 3LOWA 1PG7W 2AK4B 4K55A 1I1AD 3NABH 1KJ3L 3VG0H 1ZLVH 1FVEB 4LLQA 5D96B 2IPUG 4KROB 1BVZA 3CK0H 5KANG 5F21B 3L5XL 4YHIB 3WFDL 2VE6A 4OT1L 4KC3B 4WRLA 3KPMA 5T1MA 1IARB 1S7XB 3P9LB 1A3LL 3WE6B 4LOUC 3U7YL 1T1WB 5I1KL 4NIKB 4ZUUB 3J8F7 1IC4H 3WNKA 3IS1X 4TNVK 1U3HC 4FQQB 3FQNA 3IRZA 3L5WB 4WUUB 4P5MB 3VXRA 4FQLL 2GEEA 1CXFA 4PJ8D 4OGYL 1FE8L 5IEHA 3WUZA 5JIPA 3KJ6L 2FB4L 4YHPB 3ZTJG 5BXFB 1FLRL 5DFVC 5EWIH 2VR4A 4AL8L 4WU7A 2V2TA 1JPGA 5DFWH 3UBXA 1IE5A 1F6AB 1Q9KB 4H20H 1IGTB 2VISB 5TE6L 4HKBA 4XMLH 2R4RH 3ZKSD 4Q0XH 3HAEB 3H9SA 4DVRH 1QZ1A 4RRPG 2NQCA 4QY8B 1BQLL 3KXFA 3MXVH 5FCSH 1NL0L 4RGNE 5BO1H 3TO2A 3IXTA 1S9WB 1DQDH 4X9BA 1YYLH 2F74B 5DJ2A 1U91A 5HYJB 5F7UA 5F9JA 5D7KE 5EH1A 5H35A 1U8QA 3DUSB 2EDDA 3QQNA 3WKMH 3ZKQD 1PDKA 1AQDA 4LASH 3PV6A 1MIML 3HZKB 3VFVB 2CGRH 4MCYA 4LOUD 3HFMH 4LSSH 5E7BA 3KPNA 3L5JA 4WHTA 1U3HD 4NO0B 4X7CC 4EDWL 1HKLH 2WUCL 3ZL4L 2XTJB 1KELH 1CDUA 5E7FA 5BW7A 1FG9C 1BVLB 1CICC 1NFDE 2JJTA 3K1KC 5DFVD 4NKOB 2FD6L 4JPIA 4QTIL 1YN6A 2NZIA 5E99H 2XFXA 4MZ2A 3CFJB 3DMMD 2JB5H 4WNQA 1UB5A 2B0SL 3P77A 1QBBA 2OMBA 1UH4A 4YX2H 4LF3A 4R96A 2QSTA 3QCVH 2JB6A 1TCRA 2GJ6E 3ALWA 3IF1A 1T2JA 5TF1H 2WP3T 4S2SB 4PJ9D 5J0BA 3KPLA 3EGSB 3QHFL 3T08A 2APBA 2X7LB 1KT2A 3GMMA 3MRHA 3SDXE 3UTSB 4CN1A 4X4YA 2FJHA 1PKQE 3E3QE 1ONQB 4WO4B 5CIPA 4PD4J 1LWRA 1OTSD 3RWEA 4MB4A 3MOAL 2F19L 1NFDB 1F11A 1LDPL 3DTXB 1C1EL 1A8JH 4M8QB 5SX4I 4PR5B 3S3PA 4BZ2H 5EOQL 3NZ8B 4I13B 4XVJL 1T04A 4NZTL 3B2VH 2X9XA 3H3BC 3S37H 1EERB 1HSAA 5L2KE 1HWGB 2UVEA 3UJIH 5MEQB 1QFWH 2WSKA 4XCNB 5LGHL 3VD9A 3CFEA 2Y07H 4H26A 5EO0A 5JW4R 5DQJA 1A7RH 3SDXB 2DWDB 4OIBA 2VZ3A 4O58L 1NQBA 3JTSA 3UZQA 1PKQB 1S9KC 1JGEA 3I50L 5E1AA 3DIFA 4OB5H 5MEOA 5EBGA 1VPOL 3CU7A 4JKKA 3DVGB 3CVHA 4FQHA 4NKMA 4I3RL 2DOCA 2LU4A 2RBLA 4UBDC 4OGAC 2BXZA 2Y6SC 4FTVE 4GH7B 4PJDE 3X12A 5GRZA 3B2UD 4TRPL 4W6XB 5GS1A 5L2KB 3X11A 2EIBA 5IG7A 4DFIA 4LCUA 2B1AL 2AV7B 4Y4HB 1HOCA 4NPYA 2A74A 4H0IA 1G6RB 2ZSWA 2ITCB 4XC3L 2PCPA 4HIHB 4AEHH 2H3NA 4G6AD 2YUVA 4RRPA 1EHLL 2VZOA 4ETQA 2XNAB 4IRSA 4ODUB 3ZZ1A 4F7EA 4JGJA 2BRRL 4JZOA 3OKDB 3VCLB 1DDHA 1RIUH 3BKCH 2KPNA 1WWCA 1JMXA 4UQ2A 1IKFH 4Y16B 3GB7A 4FTVB 4PJDB 1UJ3B 1MH5A 4XNQB 4ZTPL 1IQDA 2EYRB 4XCEA 1EX0A 5KVFL 1KB9K 4MJ5A 3VDBA 1TTUA 1JPFB 3LKPA 2W9EH 1FO0B 3WLBA 5DMJB 5D2LE 4UBDD 1KN2L 1ZOXA 4J3XA 1FSKC 4GW1A 4XCYA 4S1RH 2PXYA 3GRWA 4ODXB 4TVPE 3RDTC 3THMH 3C8DA 2P5WD 5HGHB 1TJGL 5SWZE 5IMMB 3VFRB 4OSUH 2OSLA 3DX8A 4PRAB 4R2GC 4ZUWA 4MMXC 3L7FB 5ERWB 2VABA 4LVEA 5DRWB 4FQJH 5IESL 2JK5B 2QSCH 5EUOE 1JUFB 4OTXL 5FUCE 3HNTL 4AIZA 5E03A 4M93B 4Z7VF 5L88L 3VFMB 5IJKA 2UWEE 4DVBA 4LU5L 3MRJA 4OUUB 1RZIA 2XXMB 5FYKU 3RY4A 1J1OH 1IM3B 1NMBH 2NY7H 4UTBL 1TETL 5FHBH 3GI9L 4JRXD 2QKIA 5D2LB 1FYTE 1R0AL 5D96C 3RZWA 4JR9H 1T1YB 4KROC 3ZDYF 2PYEE 2V6HA 1QBMH 4LL9A 3M1BA 5TE4H 3QNZB 1U3JA 4LSPL 5SWZB 3VFGH 4ZUVB 4IJ3B 2CRYA 3OX8B 1HH6A 4POYA 1HXMB 5IUSA 5C3TA 1OP3H 3E6FA 3D85D 4HMEA 3PGDB 4NQSA 4P57B 4RQQB 5EUOB 3BYYA 2D7NA 3B9VA 4E41E 2XV6B 3C6SA 1YNTA 4MNGB 1O5DT 3RWGA 5KOMC 3EDEA 2AJZB 1CFVH 4JAMA 1M71B 5EORL 4NO5A 1D7FA 1W72A 2CRIA 2JIXA 5HHXL 2UWEB 1SJEB 3CFKA 4FZEH 2X4UA 1MIEH 4F9LC 2IEPA 2YPLE 2CPCA 3SHSA 5E24E 3UZEA 5DS8B 3RGHA 3CMOH 1FYTB 2JCCF 3VRJB 1EGJH 1Q9OA 4JVWA 4NSKA 1E6OL 2GSIB 4NKQB 4BZYA 2PYEB 4UT7H 5AAMA 2FLRT 1I8LA 1I3RA 5GS2H 2W0LA 1OAZL 3KPRD 3LPGA 4PS4L 3BO8B 2R2BB 4I5BA 5TDNB 4KROD 1TJIH 4FZ8H 1WEJH 3V8CA 4WEBH 5ESQA 2I9LB 5IM7B 3CAFA 5EA0L 4GRWH 2PW2A 4Z0BL 3PV7A 4C56E 5C0ND 1LO3L 3G6JE 4ISVB 4H25A 4JPVH 1BPVA 4OJFL 3PIQB 1A3RH 3TWCL 2BHUA 2VLRE 4IHOB 1MY7A 3AU1B 3U9UA 3VFWA 3VWKB 3QXWA 3P2TA 4WUUD 1I7ZA 4MJID 2X4TB 2XTJC 3RX5A 5CSZB 1CG9B 5D4QA 3VGBA 4JRYD 3H9HA 2PW1A 5CP3H 3D85A 3FN3A 4LLYA 4JFZH 5J9PA 3L3JB 5DWUL 2X4OA 2R1YA 4PGEA 4ZO7A 1RFDH 1YPZF 4PG2C 2HVJB 2FYYB 1NFKA 1CGWA 3ARDB 1OW0C 5TQ0L 3U4BL 4OLYL 5E2UH 3MREA 4YK4B 3G6JB 1HEZA 3TH2T 3IDIB 4MJ6B 3HUJE 4FFWD 5IB2B 1OB1B 4UIMB 1TJHH 5D1QD 3FT3B 2N4IA 1HIMH 2J5LB 2VLRB 2VQUA 4IRJD 2P8LB 5DSCA 3SE4A 2OR9L 1SVCP 4OZFB 2R8SH 4X4XB 4WO4C 2P49B 3BEWB 2ORBH 5EU3A 5BV7B 4PBWD 1H15A 2YC1B 2DD8L 4KJWC 3QFJE 3CC5B 1I8IB 2GK0B 3BZ4A 4NWTL 5GS0D 2ZZUT 3ZDXF 3L3OA 5DD6A 5IBUB 4PJ7A 3HLAA 5IB3A 3MODL 3HNVH 3LRHA 1S7WB 4YGVA 3CZJA 4GBXA 2GAZA 4JPWH 5IFJA 2A6DB 5MP6L 4RGND 4OGXH 1MFBL 4F58L 1LP9A 4J2XA 5KS9E 3TVMB 3P11H 3FQXB 3QWOB 1INQB 3GNMH 3DBXA 4U1LA 4L8SB 4ZAKB 5D7KD 4PFEA 2W60B 3MBXH 3V9FA 3KLSA 1GVIA 3D0VA 4JO4H 1URLA 5HI4C 2Z92A 1P7KB 2M8XA 1KJ2A 3QFJB 3OG4B 1WWBX 4YEEA 4KRNA 3BISA 4YHZL 3ZT7A 3X3FL 3MTRA 1QRNE 4ZUTA 3T3PE 3M8OL 2OTPA 3QDJE 4WO4D 3I02A 2ZG1A 1SMOA 2MKWA 3O6KL 1RJLB 4XMLL 2NTSP 5ID1A 3ZYJA 1XAUA 3P9WB 1JHKL 2P43B 4Y4HC 5KS9B 3DPBA 4N8VG 3CCHA 5HGBB 4K7PH 4N0UE 2A9MH 4PIRF 2BXYA 3FZUC 3O45A 2DM4A 2HMID 1MFNA 1BZQK 2VDML 2GJ6D 3PDOA 5I18L 3L1OH 5ACMA 1V3KA 1H3XA 1LK2A 3V79C 4U2YA 1DBBL 3WKML 1U8PA 4YXKH 1NSNH 1RHHB 3NCYS 1QRNB 4M1DL 2ZSVB 3QDJB 4Y16C 1AJ7L 1FZMB 3EYVB 1K4DA 1UJ3C 2HT4C 5HI4D 1L6XA 2GCYA 3QWRD 3HFML 4P9HH 4RBPK 3UO1H 1CXEA 1XCTA 5EZOH 1PEZA 1ZLVK 4NKIH 4CBPA 4DKAA 5BJTB 4PRIA 3IJSB 4J12A 4N0UB 2VMFA 3NPSB 3QQ4B 5T1LB 5I8OL 5ID0B 5CGYD 3H6JA 5L2KD 4L8BA 2K7QA 2H8PB 5E08H 1LO2H 4BKLA 4DJMA 1XZ0B 4YX2L 3SDCB 1DEEB 1DANU 1KACB 3MUGB 3F62A 1ED3B 4GRMB 5INDA 3FZUD 2V2XB 3NFNA 1PQZB 2BK8A 3WFEL 2XZZA 3EOBA 4M7KH 4U6TA 1VEPA 4M93C 4YGAB 1WZKA 5ESAB 3QRFM 2CLRA 5ICZB 2XOTA 3PJSB 1D5MB 3S7GA 5D7JD 3SGJA 4MXWH 1M7DA 3LRGA 3D3VB 3R0NA 5B39B 4Y16D 1HYRC 4FTVD 5CBAA 2HT4D 4PJ5D 5FF6A 3BD3A 1HH9A 1EXUA 4JM2A 3BT2L 1NDMA 4BZ2L 4XP6L 1INDH 1MF2H 5CHNB 1NFIA 1R5VA 3MNWB 4IJ3C 3FN0L 3NCJH 4BK4A 1JJUA 1IGMH 3OJDB 3S37L 2A77H 2VAAB 3UJIL 2ADFH 4OF5A 1ZLWH 6CGTA 2IFFH 2Y07L 3KYKH 3S37X 2RFXA 1YEHL 1U92A 5ETUB 4X8JA 3S98A 2G75B 3RIAF 4JO1L 3MJ8B 4OB5L 1VFUA 1QNZL 5KVDL 5M95B 5JR1L 3MV8B 4JHZA 4DUXA 2WBJB 1GGIL 1WIOA 3MZTA 5F72S 4DKDC 3PHQB 4K2UL 4WFHE 5F1NB 4NRYA 4WW1B 1MCEA 3SQOL 2E8ZA 1NCAH 2BVPA 1R3KA </