3WS6A

Crystal structure of h-2d in complex with a mimotopic peptide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
275
structure length
273
Chain Sequence
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Compensatory mechanisms allow undersized anchor-deficient class I MHC ligands to mediate pathogenic autoreactive T cell responses
pubmed doi rcsb
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
molecule tags Immune system
source organism Mus musculus
total genus 72
structure length 273
sequence length 275
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ws6A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3ws6A01
4PRBA 3V6OC 4NZTL 5JW5A 2X42A 4L8DA 2DKSA 3HR6A 3MRBB 3MUGB 4O2EB 5IR1B 3D2UB 5FEBA 4KMLB 3HI6H 1WCQA 2XZZA 5D1QD 5GQBA 1A1MA 4S1DD 2B20A 1JL8A 4JCLA 3MNZB 4XAKE 3WSQL 4R4BB 4PJHA 3OKYA 1EDQA 1BREA 4IOIB 1FNGA 3TBVB 5TH2A 3AM8C 2EXWC 4KU1A 3RVVD 4PJDA 4F7CA 4JPIB 4XX1E 2J1KA 3MA9H 2YPKA 5T3ZD 3QEHA 1A2YB 4KVCH 3LV3B 4OCMC 3T4AA 3DX8A 5CP7B 2FSEB 1RU9L 1XGTA 1XH3B 1RJYA 2VDRL 5CJXA 4LLDB 1J0ZA 1D9KB 3DIFB 1IQWH 5IQ9B 3UX9B 4DVRH 2DWEA 1C08A 4DOHE 5EDXA 5IF0A 3ARYA 2E27L 3V6OE 4JN1H 4J3UA 3Q5YA 2FH6A 1OWWA 3CC5B 3VXSA 5E2TH 3DROA 4Y5VB 1KTKE 5DR5L 2M26A 1WCBA 1IAOA 4LNVA 3TCLB 4PJ5E 4HFWB 4L5FH 4JZNA 3UPCA 4IIQB 4ONGH 1CF8L 1W0VB 4BELD 5AYQA 5HHOA 4KZEL 4JKMA 1U95B 4H8WH 5ALBH 3RTQD 3ZL4H 4PRHA 4GQ9L 5D2LA 1TZHA 4DKEL 1A9BA 4ZPVA 1RUPL 1CL7H 3BIKA 5LCVH 4ELMB 2HTLC 3D87B 2YPLE 2X7LA 1F13A 4LSQL 1I9RH 2AXGB 1I8LA 2HT2C 5HGDB 4M1CD 3VFOA 3KYOA 3MLVH 2DBLH 4FRWA 5D5MB 3VJ6A 1JMXA 4YHPB 1X5HA 2R69L 2FECL 4UT7L 1VDGA 3GSWB 4K94L 4XRCA 5EU3B 5BJTB 5MEPB 2HLAA 4Y4FD 1EFQA 4LPYA 2AJ3B 3S35H 1NANH 3DMMC 1CXHA 1E4JA 2NXZD 4IOSD 1YUHA 4G9FD 3HE6B 4XHQA 1ZLVK 4CVUA 1RHHB 4FABL 2E6JA 5IB5B 1FFPA 1UJTA 4MVBD 1MLCB 4WUUE 3PV6A 1FLRL 3UTSA 1RZIB 3W11C 5IGXL 1A8JH 1DFBH 1Q38A 5JOFA 1S9WB 4YHOH 5HYSB 1KFAL 3FKUS 4YO0A 2L7JA 3HC4L 3JUZA 3U0PB 3BPNC 1EIBA 4L29A 1EV2E 5C0GA 1MCQA 2RCSH 3UTTA 5IP4A 5HDLA 4P46C 3CVHA 2ADJB 2CLZA 4LLYB 3RAJL 5I1CL 1R0AH 2YEZB 3NIDE 3AGVA 4XP6L 4RMWA 2R15A 2V2WB 5D1QB 4LLMA 3VI4E 4Y16D 3GSNB 3BI9X 1BVKA 4HWBA 1IGFL 3ROLB 3HZVB 1T1YB 1U8NB 1T80A 3HLAB 3IJHB 4K8RC 1FAIL 4IRSB 1LO2H 2D4DA 3AXLA 4X6FA 2ZCHH 5D2NB 2Z93A 2BNRD 1LD9B 1EGJL 3P0VL 1KCRH 3MV7D 2ZUQC 4JANA 5DMGC 4G8EB 4QHUB 2H1PL 1D5IL 1HE7A 3AVEA 2O5YL 4UIMA 2CMRH 3MCLL 4KVNL 1DQLH 4PJEF 1O7SA 2WV3A 1BBDH 4M9OA 4OT1L 3PV7A 1X5JA 4KROC 4XPHL 5SWQB 5DXWA 1CE1L 4UILL 4PJBA 2AJYH 1JPFA 4X5LA 2W9DL 1IC4L 4Z6AT 5IMKB 1ZKAA 3AREC 3WJLC 4Q74A 1JHKH 1ETZB 4WV1C 4D94A 3LEXA 4WJ5B 5FGBA 3D9AH 1MCWM 1EEYB 3ZE2E 5K9OA 1FL6A 3QEUA 3V0AC 4WFED 4K3DH 1Z0NA 4NO2A 1G9MH 3HI1A 3S3PA 3ZDZF 2NNAB 2NR6D 4P5TB 5EULV 4D0BB 5J56B 1ZVSB 2IBBA 2Q7YB 4XAWH 4XZUA 3MOBL 4NKMA 4FZ8H 4JAMB 4HFUH 3ARSA 2ENYA 3OAYK 4N5UA 2BDNH 4PLNC 2YZ1A 2ED9A 2P43B 4P57B 1NFIA 3CDGA 1BQUA 1AO7D 3BQUA 3HPJB 3KLAA 3SEPA 1OY3B 3QDJD 1DQDL 4JB9L 3QUYD 2X89D 4OUOA 1UM6L 4F8TA 3K8LA 2NCMA 4Z7QF 3IJSB 4KJWD 3RGHA 3VFRA 4ODSL 5EIIB 4JM2D 5GRYA 5E95B 3OKOA 1FH5H 3TJHD 3O4OC 4FQ2L 3ALWA 1Y6MR 3MNVA 3RIFF 3UDWA 1NFKA 3QBTB 1HILB 1MREL 3G6JB 4G9FB 4YDJB 2YD7A 4X9HA 3T4YB 1AR2A 1LO3H 6FABH 4HPOH 5TFSH 1IGJA 1AGFA 4YC2C 3QEGH 1YQVH 3ULUC 3X3FH 4M7LL 3MOAH 3QHFL 3V8CA 4X6EB 4JG1L 5KW9L 1ZLUH 1AHWC 1SEQH 2QQNL 1KTLA 4P2YA 1CT8B 3LKNB 2VDNL 3PGDA 3AMKA 3QDAA 4R26L 1P4LB 5IWLA 5F7KC 3AB0B 2F5AH 5K59E 1AY1H 5F6IC 2R4RH 1TVHB 3GRWL 5A2KH 2RFXA 1NGPL 4F9PC 4CMHB 3T2OA 1U42A 5GS0H 4P9HC 1Q9LA 2WWMC 4RRPA 1KPVB 1KACB 1FORH 1I7ZB 1XGYH 1JHTA 3TN0C 1VEOA 4Y16B 2ADIB 1FNFA 1HKLL 5SX5H 5DD1H 2YWZA 5FHBL 1F42A 3MRQA 4PGCB 4XB7A 4Q58C 1AI1L 3VH8G 3C5ZA 2I24N 5ACZB 4PRAB 4KI5E 3DTXA 3ZTJH 4AEIH 3B5GA 2VISA 1YEDB 2BNRB 1DLHA 5E6YA 3MV7B 1R24A 3B2UD 2BVYA 4J8RB 3F58L 4JGUA 4ALAH 3QWOA 4I0PA 4QYOA 3VFMB 3ZT6A 1NCWH 3B9KB 3BP4A 2PTTB 4HW6A 1ZEAL 4F58H 1S7WB 3Q6FA 5IHLB 3JWOL 3QIUD 1YNTA 3X11B 4PB9H 3RDTA 1HIML 5ID1A 2YHGA 2Z9TA 1INQA 1YDPA 5FDWB 3TYFB 2N56A 3BE1H 1ZT4A 5IK3B 3KPTA 4GFTB 5FUCE 5GGVH 2H9GB 3T0VA 5K93A 3MFFB 4NHCH 2NY0D 3BKML 3FRUA 1ZS8B 1A6AB 1FZJB 4ZO9A 1WZLA 2DBJA 3TO4A 5D8JH 3MJGX 4TSBL 4TN9A 1VFAB 1J8KA 1I4FB 2QQLL 3G6DL 3WE6B 2R39A 4G8GE 1S78C 3IU4L 3V5KB 5INCA 1PX4A 4F7MB 1NDGA 3ARGA 1MVFA 5GGRA 2C7UB 3NACL 4L4VA 4BSWB 3MV9D 4R4FL 4LLUB 2JIXA 4L8SB 4OGAC 1URLA 3FAXA 4UUJA 1XZ0A 1AO7B 3RPIB 5MHSE 4H5SB 3FB5A 4I3RH 3BX7C 1KGCE 1ADQL 3D25B 1NCTA 3QDJB 5GGTL 3QUYB 5I1LA 3SDXA 4U3HA 3DI2B 5GRUL 4Z7NE 5FYKH 5J1AA 4EOWL 1T4KA 3K7UA 2V9RA 1FN4A 3RZWA 1NGXA 3E6HB 4LIQH 5J11C 1U91B 2D7TH 3RHWF 2N1KA 4POZD 4Y2DD 4D3CH 4K7PY 1QSFD 1WJ3A 4MXWL 5DRNB 1CU4L 4PRIA 1P6FA 3QUMA 4J1UB 3TVMA 2PYED 1ZT7A 2X5PA 3IDYC 4U1LA 4X6CF 4HS6A 4NJAL 5EZJB 4D2NA 1U8HB 4MS8C 3PWUB 4APQD 1B88A 3OKLB 5DC0A 3H3BC 2PCPB 3LKPA 3RNKA 2NZIA 2FDBP 5BRZA 1KNOB 2VL5B 2APXA 1JZ8A 4HXAH 2J8OA 4X6DE 1L9MA 4Z7VB 1P5VA 4XGZB 3MLSH 1AFVL 4OZIE 1IKNA 2BVUA 4FQXB 4KAQH 5DZLA 4F15B 4Q6IC 2CUIA 4MCYB 3SKJL 2IQAB 3CMOH 4NFCA 1NUGA 3KXFD 4P2QE 4UIKL 1OF2B 1MVUA 1IEBA 5LWYH 3IETB 1BOYA 3L7FA 1I8IB 3I6LD 5GSVB 3IFNL 4RMSA 4HUVA 5FYKD 4MD0B 1JZ2A 2FYYA 2OR9L 3N06B 4K55A 4C56A 3MTRA 5L7XH 1XF2A 2ITCB 5D7LD 4GSDH 5T1KA 2A74B 2VLME 2X70B 4OCWL 1RPQA 5D1XD 3MLRL 4GRLC 1OM3L 4ODVH 4FFZH 3GIVA 3SN6N 5DURB 3P11H 4JRYE 3L3HB 4G5ZH 2VR5A 4OFVA 4ZNEE 5DJAB 4GXVH 3DUUB 4M8QB 4N9OB 1HYSD 3DI3B 1EHNA 5KSBB 3SY0A 1EK3A 1JZ6A 1Q0YL 1JRHI 2AJZB 1JGLL 3EW3B 2NY0B 3F5WB 4PV9A 1F2QA 2YBRA 1EVUA 2VXQL 1MCJA 3RA7L 3B4NA 1GGBL 1PLGL 3DWTA 1J9CT 2ILLA 1ITBB 5ALCL 4OLWH 1AXTH 3EJZD 1QSEA 1Y6NR 2JCCE 4NQDB 3QNXA 3RVUC 2B7DT 2KL6A 1GPOL 3LEVH 2J12B 3DRTA 3CLEH 2BJML 4QRSB 1NGQH 3MV9B 2GI7A 1YEJH 5EUOA 5DVNA 1WFNA 4BUHA 4JFYA 1UZ6F 3GI8H 4A6YH 2JB6A 2AERT 1S7VA 4EDXA 4LSTL 9CGTA 2X05A 1GOFA 4N0CC 2ZOLB 3LAFA 3Q3GB 3FAWA 1TJHL 1NGWA 4OCXL 1CDBA 4WHCA 2C1OB 5I1AB 3UBXI 2XOTA 5FKAA 5JPNA 5DD3H 1JNLH 4CBPA 4P2OD 3S5LA 3ZSSA 1CQYA 3UP1A 1JPTH 4Y2DB 3K8MA 1QSFB 3K4DA 2YC1B 2R2BA 4DKDC 4K07A 5TF1L 3MRPA 4U2YA 4S1SL 3TFKC 2PYEB 3NGBB 5I74B 5ISZE 1N64L 4GT7A 5DRZB 3EYUH 3O11A 3WJJA 3SE4C 1ZVHA 4APQB 5L88L 1R3JB 3X14A 3OJ2C 1A7QH 5DMKB 2AK4A 4QOKE 4MA7L 3F12A 4EUPH 1I1FA 3IDNB 5TPWL 5BV7L 1MHPH 2GSGB 5HHVH 2EEAA 4N0YH 3TPUA 3ILPA 1ND0A 4H25A 1CDUA 4MD4B 5HVGB 1S9VA 2R2CA 5EOQH 3U9PL 4EN3A 5CHNA 1G7JA 1J12A 2B1AL 3KXFB 5HGGS 2HRPL 1KG0B 4YZFF 2JJSC 4XNZC 5FO7A 2PYFB 5DJ8A 2A6IA 5A3IC 4Q9QL 5ANME 1U6AH 1K6QH 3P30L 3RP1A 1KLGA 5IQ7L 3BKCH 3HS0B 1CLZH 2AJUH 3WKMH 5KVMC 1T20A 1ED3B 5D7LB 1ZA6B 3CU7A 4ORGB 1YN6A 3FT4A 7FABH 1CFVH 5D1XB 2F8OA 2ZG2A 4FMFA 2WNGA 3U0WH 5ADOL 1H3PL 3HTLX 3HNTL 4K2UL 4NCC1 2VDOL 4R7DB 5IV2A 1J87A 4L9LA 1RIVL 2O5XL 3NPSB 1IC5H 2BOCB 1V5JA 3NCJH 1G7HA 1FFNA 1FVDB 1J05A 4ZUTA 2AV7A 1D5ZB 1ZHNA 1PEWA 3TH2T 1TJGH 4H20L 2OL3A 3NCYS 5IMOA 5E8PB 1R5WB 1G7MA 3GBLA 2G2RB 3S37L 2E8YA 3OR6B 3WIIL 4UQ3A 2BSTB 2P4AB 1UVQB 3BDXA 3QWRA 3QUKA 5EN2B 2B0SL 3KG5A 4CN6A 1YY9C 2FHFA 4Y4HC 3K1KC 2P48B 1LEKB 3CK0H 4PJEE 4YXHL 4GAJL 4PJAA 4M1DL 4W70A 4S2SB 2NY4D 4ZFGH 1VKXA 4IHOA 2ZPKL 2RR3A 4M5YH 4WFHE 1RURH 3STLB 3GBMH 4G80A 1F4HA 5L9DH 2NTFB 4JFFA 3U36A 5HYEA 3PWPA 2O5ZL 1JYNA 1KENL 4ELMF 5FYLH 4MNQA 1F58L 4MAYD 4OLUH 2I5YL 1Z5LA 3VA2C 4LVHC 2JELL 4OJFH 4LKXA 3QCTH 5D5MF 1Y0LA 3KPOA 2HVJB 4P2OB 1KJ3H 2YD5A 3GHBH 4KJYA 2GITB 2EIBA 1OGAA 1PW3A 3U46B 1FNSH 4NKDB 1MLBB 3G5ZB 2GAZB 1CLCA 1TJIL 2IPUG 1YEFL 5IFHH 1UKQA 2WANA 3RUGF 1I85C 4X9IA 1KIRA 3MRCB 2JJWA 2WBJB 4WGWB 1KN4H 2FX7L 3IDXH 5DYOA 3S97C 4H1LA 1LP9E 4HJ0C 2DQGH 5F7EH 1DP0A 4WDIB 4HUNB 4M5ZH 4OM0L 5JHLH 2D7MA 3RX8A 4F8QA 2DL2A 2V7HA 1A6ZA 4I18C 2X4TA 3MCKB 1AXSB 3DX6B 3KPSA 5D9SB 1YMHA 3PHQA 5JPMA 2Y06H 3R1GL 5FYLD 5TQ0L 1IKFL 2VLLB 5DEFA 3S6CA 1N2RA 4JHWH 4H88L 4ZAKD 5JMOC 4PFEA 3SDXF 4RAUA 4P3CH 4XVTH 4X4ZA 2M1KA 5EU4B 5GGSB 1OARL 4QKXB 3P9MB 2Y7QA 3H9SA 3PWNB 4NJ9L 2FEDC 3B9EA 4QXGL 3CFKB 4O51B 3QO1B 3LPGA 4U1NB 4I77H 1MF2H 1R3LB 2EDQA 1VACA 1FC2D 1EBAA 1WQVT 1P2CB 2JB5H 3NZHH 3RVXC 2UY6A 3N9GH 3P73B 5T5NF 3BO8A 1MHCB 1NLBL 1QO3A 3BP6B 3TBTB 2HG5A 1HQRB 3QI9B 2R9HD 3T2NH 1UKTA 1A02N 3G04A 1KF9B 4H0IA 5D1ZA 1TZGH 1TCMA 3CVHH 1HXMB 1SMAA 2X4OB 4YDVB 3KPNA 4D9LL 3RWDA 1RAMA 3EGSB 5FA4A 4N90D 4UQ2B 4EDWH 4QRUA 1K9TA 4NZDA 5B38B 1T0MA 2Y5TA 1NGZA 2A6JB 4HWBH 1QHOA 1G9NC 2F58H 3LQMA 4QWWC 2XN9B 2W38A 3Q6GH 4E41B 3T3MF 5GS1B 4S0SD 4OZFB 1DBMH 1K3ZA 3T1WA 1C5BH 1XIWD 3BP7B 4NDMB 2HJLB 2DJSA 2NY4B 3MV11 1KT2B 3OKMB 1NEUA 2JK5B 1K4CA 5AEAA 5I75C 3TIDB 1TPXB 2FH8A 2LTQB 1CICC 1C7TA 2VE6A 3PJSA 4MAYB 1Q72H 3BXNA 3MR9B 1FJ1B 4XNMA 4OZHB 1RUKL 5GZOD 5ACMA 4QRPA 3F8UB 4WEBH 5C3LD 5C0AD 5FHAL 1SJVA 1WTLA 4PGBB 4HS3A 1NFDF 1T66D 2R0WH 4Z78A 1KB9K 1ZANH 4BKLA 3IDGB 4NNYA 4WHTA 4B7LA 4MZ3A 4HIEB 2R1XB 2G75B 4UINL 1PY4A 3UTTD 1EX0A 4QHKI 3V0VA 4WHYG 1YY8A 2XQBH 2HLFD 4AM0B 4NNPH 4PYHA 1NAML 4WW1A 1CLYL 1TETL 3VFNA 4IRZH 4PJHB 1FVEA 3KJ4C 2VQ1A 2UYLB 2DQEL 1FNGB 3NFNB 5TH2B 4DEPB 4PJDB 5HI3D 1X5GA 2W65B 3TWCL 5E0QA 1R5IA 5I1GH 4F7CB 4DN4L 1YYMH 1INEH 1RUML 5C0BA 5EBLA 1MIML 3RWJA 5GJSL 3QEHB 1PKOA 3T4AB 3LEYH 5CWSA 2RAMA 1F3JB 4LCCC 2F53E 4DVBA 3FN9A 3GJEB 4HT1L 1UWEL 3T0DA 1WEJL 2NMSA 5C1MB 3GM0A 1TITA 1OAUL 4R90H 1CR9H 4HH8A 5F89B 3KYKH 1NC2A 1A3LH 5D96B 2DWEB 1C08B 3TV3L 5IF0B 4KJPC 2O26U 5FCSH 4M6OL 3P4OB 3GKWH 3MV8D 1F6AB 4ZSOE 3VFPA 3VXNA 3ZTNL 1HNGA 4AJ0A 5F1IA 4N8VG 3DROB 3QXDA 2DAVA 4EI5D 1WCBB 3FONB 3UJTH 3QQNA 5T3XH 2XA8L 1S8DA 3ZKQD 2H6PA 3BZDA 4JZNB 4L4TD 4X4YA 1LHZA 5I30L 2VLJE 4Y8AA 4AG4H 5BMFL 3GK8L 3QZWG 1FZOB 2BOBA 4FQQA 3PXJA 3QISA 3S8WA 3GDBA 3IFOA 4PRHB 5CILL 5IOPA 3TBYB 1TZHB 1QBML 2XZAH 1T22B 3CVIH 2EE6A 5DJYB 2Z31D 4W6XB 4WY7L 3BAEL 1H8SA 4J6RL 4GG8A 4KKAC 2Z8RA 3DGCR 1YMMA 1OP5H 4LCIH 3TCXA 3LPFA 3VW3L 3O41A 1MFEL 5JNYB 4OCSL 3KYOB 3IF1B 4NP4H 1Z3GH 4BSVB 4QRTB 1UQSA 4HUWA 4LRNH 2PETA 4Z8FL 3QO0A 4LPWA 4P5MA 1XIWB 2HLAB 4P4KD 1FIGL 4CNIB 4JZJC 3CZFA 4KTEH 1GZPA 5DUPH 2RGSA 2D0HA 2OMBA 1FFPB 5DMJB 3PV6B 3T77B 5T3XD 5J6GB 4M7LT 4OTXL 2AV1B 4KTYA 3GNML 2B1HL 1KOAA 3KJ6H 5H94B 3ARPA 3JWDC 4JO1H 5GRZA 4YBLC 4RISH 4HWUA 1OLZA 1JYWA 3ES6B 1YJDH 5C09E 1CD8A 1DBBL 5I71C 4I5BA 4JM2F 4K9EC 4K71C 3UTTB 2R2EB 3L9RA 1WC7A 4CW1A 3D3VA 1RMFL 3VGAC 4XT1C 2P5ED 5HDBF 4CAGA 3O6LL 2L0DA 4LLMB 4ZFOL 5KSVB 3CXDH 1FFQA 1DVFA 2FJGA 4LDEB 3TF7A 2BMKB 1UZ6E 2NLJB 1BVKB 2Y9RT 5E94A 2XI9A 5F97E 2ICCA 3UTQA 3AXLB 2AGJH 4X6FB 3OG6B 4PP1C 2FD6L 4HKJA 5EU6D 3OAZK 5E7BA 3DXAA 3QULB 5EU7C 5IMLB 2NX5D 1KUMA 3UJJL 1MQKL 1S5HA 4ZQKA 2PR4L 1IGIL 4YHIA 4UIMB 3LQAH 4M00A 4OF8A 2AK1H 4KK8C 4AYFA 1WT5C 3EOTH 2EDTA 5D70L 3QFDB 3O3DA 4GMSL 4NQED 5C2BL 1PY9A 5E24E 2Y07H 3VD7A 3C5SB 3HG1D 3KDMB 3RKDD 3MV8B 5KS9A 1U3HD 4LEXL 1NC4A 4R2GD 3QUMH 1SM3L 4Q97A 2GSIA 1N6QL 4EI5B 3BESR 4F2MB 1FL6B 5KTEH 1D9KC 1QR4A 2HT3C 5C07D 2Z0BA 2VLRE 4OGYH 3V9FA 2E7CA 5HHMA 1KC5H 4PRDA 1VESA 1FDLH 3DO7A 1F6FB 2CLRA 2V5RA 3SE3A 4QTIH 2IH3A 4BZ1H 4XZUB 4JFHE 4Y5VC 4YZFE 2HKFH 4XP9L 4J3XA 1JGEA 5JIIA 1QKZL 1HHGA 2Z31B 5IJKC 1QFPA 1U8OA 3SJVA 1NFIB 3EUUA 4XCNA 3CDGB 4IIQC 3VFUA 3L5XH 5J6HA 4FFVC 4N9GB 2PO6A 4HWEH 3R8QA 2VDQH 5D6CA 3FO9A 1EEQA 2V2TA 5JOPD 2HJFB 4K8RL 4JY4B 5HBBA 3LHPH 3ESUF 4HUMB 4IDJH 1FGVL 2CDGB 1BFVH 4KUCF 5A2JH 2BK8A 4P4KB 1LDPH 3OKOB 2HFFA 4O2CA 1QFWH 2OK0L 4CJ1A 2YD3A 1CGSH 2YSSB 5HYQA 4PRID 5E2UL 1K5NA 4KKCD 2OI9B 4ZS7L 1A6VL 3SCMD 3QR2A 2LAAA 4FFYL 1J86A 3CX2A 1XF4B 1S7TA 4TRPL 3TP4A 1KTLB 3OZ9L 3TA3D 1WICA 3QIWA 2A77L 1UWGL 3PGFL 5HI5C 2VKXA 3RZCD 3OL2A 1LK2A 1WAAA 1ORQA 3GMRB 2AQ1A 3EYVB 3B2VH 4HIHA 2WMPA 3FB8A 4KQ4L 5F3HB 1MPAL 4JDTH 5EU5B 1C12B 2X40A 4BH7A 2VABA 5EPMB 4ELME 1C5DA 1MRCH 3B5HA 3BP5A 2P8LA 4GH7B 3ZTJG 4ODXB 4XNYL 3MRJA 2VISB 5ILTH 3L5JA 1A6TA 5D5ME 5D1QC 3FHQA 5EU6B 3PHOA 5I1KL 1R24B 4G6ML 5E2VL 4GKSA 1MNUL 2F9BT 2E6QA 2NX5B 4QYOB 5F1KC 1P4BH 3JZ7A 3QDGA 4GS7B 2F8VA 1GJIA 5IIEB 2QQKH 3DV4B 1U8PB 1OPGH 3DO3A 3BP4B 4IRSC 3RVVC 3LH2L 4WFFE 1PZUB 3GJFB 3RUGE 5D2NC 4GG6B 3Q6FB 5HD8D 1DQJB 4NQEB 3GB7B 5ITBL 2LVCA 4OUUA 3V6ZA 1H5BB 4DKFH 1T2QH 3RDTB 4Z5RB 3LQZA 2GJJA 5HPMA 1INQB 1YDPB 3HG1B 5LAXA 2CLVA 3C60A 3GMOA 3V52H 1U3HB 2ERJB 2W0FA 1ZT4B 4MCZA 4R2GB 2OZ4A 4X0KB 3ULUL 3OAUH 4PG2C 2L7UA 5C9KA 1J1PH 5FKPB 2DTMH 3MACL 3FRUB 5C07B 2UZIL 5E03A 4JO3H 5CJBA 1QA9B 5JQ6L 3VGHA 2FHCA 3PP3H 2VZUA 1Z9LA 1QSED 5GGRB 5F3BA 4WI3A 4P9HL 3JWNC 1QRND 5F7DA 3REWA 2P45B 3MBXL 2ESVD 3TNNA 2JIXB 2MHAB 1I1AD 1XAUA 3EOBA 4ZOBA 1XZ0B 4LHUG 3ZE0E 3UYRL 1J8HA 3PL6A 4P5TC 3QG7L 2Y36H 4LHQB 1MFAH 3MCG1 2QR0B 1KLUA 2DLFL 2VSDA 3T0AA 3IU3A 5D2NE 5J1AB 3QPQC 1T4KB 1SY6H 3OV6A 2B39A 3I9GL 2APFA 4PG9A 5CFHA 5T3ZE 1ONQA 1ORSA 1O5DT 2NY2D 1CDCA 2XG5A 1BOGA 4M1CC 2YOCA 1PG7L 4QXUL 2DL9A 2Q76A 4PRIB 4NOFA 4R7NA 1TMCA 2M2DA 3QUMB 5EZOL 3OQ3B 3IDMB 1ZT7B 3MYJA 4W68A 4ZDHA 2NYYD 4HS6B 1JNHA 2IH1A 3CH8A 4AL8L 3GHEL 1T0NA 2FIKA 2Z8VC 4YE4L 4LARL 3PF2A 4ORZC 3PP4L 5CCKL 4OFKA 3TA3B 3RNKB 3RZCB 4YFLF 3ARBA 4MVBC 3BW9B 3D69B 2AABH 3GI9H 4PB0L 2GJ6A 1MCOH 4Q9RH 3H3PL 4NN7B 4LF3A 4JKKA 2IAND 5I19L 3B83A 2NTSP 1HWGB 1A1NA 5EC2B 1QHPA 5IW1A 4H8WC 1MVUB 1IEBB 3IGAA 3T65A 3VXTB 3AB0C 3L7FB 2OTUA 1B2WH 3I6GB 3HKFA 4UNVA 1I7TA 1JWSA 1XT5A 4I3SL 3S37X 4CMHC 3E3QC 2N4IA 2SEBA 4P99A 2R23A 1XF2B 1QUNA 4BQBA 1X4ZA 4I1NB 3O8XA 4Y16C 2DD8H 1NFDE 5T1KB 1ACYH 3VG0L 1FBIL 4FXGB 1AQKL 4HC1H 5E00A 4IS6B 1N7ML 1QNZL 1S3KL 5DHYB 1IGCL 3WIHH 3OJVC 3G6JE 4G9FE 1UM4L 3HB3C 4F7PA 3EYOA 3D0LA 4OSUH 3N85L 1NMAL 1XMWA 2RJMA 3B9KC 3FOLA 5FYJL 3HUJF 3RL2B 4PTUB 4Y4KA 1WISA 5E2WL 5IMMA 4PGDA 4TOYH 4PV9B 3LN9A 3G08A 3K74B 4OI7A 4O2FB 3BN9D 4MD5A 3QWRD 4WW2A 4NKQB 2I9LA 1QSEB 4LKCA 3QNXB 1N4XL 1LEIB 1CK0L 2PW2A 1D6EB 5GIRA 3DRTB 3E3QE 5FYKU 1QPPA 3TNMB 3VFGH 3UJIL 1QRNB 43C9B 2H32A 3ZHLA 2BHUA 2ESVB 4X7DC 2YWYA 4TPRH 5EUOB 1I1AB 5CSBA 4Y1AA 3KPLB 4GAFB 4U6XB 4O02L 3SGKC 4JFYB 2NR6C 1S9YA 2JB6B 4EDXB 1CE6A 1X9QA 2V2XA 3PWPD 2VLKD 4WNQA 1IT9L 1PKQE 1IEAA 2DQFA 5KG9A 5KN5B 3E0GA 3SPVA 2D2OA 2WUCL 2BNRE 4UNUA 4L8SC 3FB6A 5FKAB 4W4OC 3MV7E 4HXBH 1DQMH 3KPRA 5KVDH 2NY2B 4UDTA 3AS0A 4Y89A 5EZIH 1MCNA 1NDMA 3QUYC 1NMBL 3TBWB 3DX9A 3OR7A 4CVXB 1KEGL 4KHTH 4JPWH 1PJ9A 4NUGH 3FQNB 2ED7A 3EYQC 5KS9F 3O11B 3M07A 3O9WA 1FSKB 4LCWD 3LIZL 4XPAH 2NZ9D 1JTPA 3TJHC 3X17A 1ADQA 1GIGL 4WFGD 2VAJA 1ZE3C 5GGTA 4OZHF 4BUGA 1QYGL 3N0PB 1UCBL 3MJ9L 4EUPG 4WFEE 2XTLA 4HZAA 3ARDA 5AZEH 3V6FA 3TPKA 3TPUB 1WWWX 4YDIL 5B38G 3OHXA 1ND0B 5BZWB 1G9MC 2IAMD 2DF3A 2IANB 1G7JB 2EDLA 3K4ZA 1JMZA 1D5MB 2H8PA 2HFEA 4HS8L 2A6IB 1P1ZA 1G7IB 1AO7E 4FQXC 4F15C 1M7DA 1LK3L 3HRPA 5H35A 1YEGL 1PZ5B 3HE7D 2A83A 2OTPA 3QDJE 2WQRA 2EC9T 1T20B 3PIQB 1NCAH 3M8OL 4P59L 4POUB 5DK3A 3RY4A 1XR8A 2XWTB 1OTSD 4M7ZB 4NCDA 3FT4B 3U30B 2EDYA 4M62H 4DGYL 4GAGL 2V17L 2DQIL 3QNYB 3CLFH 1RUAL 3WFCH 4EJ1C 2EO9A 4L9LB 4JO4H 3FB7B 5HDBE 4CGTA 3TO2A 1FFNB 1J05B 2CDEA 2ADGA 3RRQA 2XKNA 4GW1A 2HKHL 2Y1VA 1M6OA 2P24A 5D72L 3TBSB 1MUJA 1AE6H 3P0YH 5GRJH 4R8WH 4OFYD 1WAAF 4Z7WA 4I0CC 4UQ3B 4ODWB 3MUHL 3ZYZA 1U9KA 5AZ2L 5GISH 4P48A 1AGCA 1JGUL 5E4EC 4L4JA 4XNUH 2NY0C 5HHNA 2FJFA 5ERWA 1T1XB 1CLOH 4ZOEA 3D0VA 3P4LA 1X5ZA 2CKBL 3GMNA 4F57H 4J7RA 4XBGA 1T6VN 3VXOB 3SOBH 5AYUH 2CRIA 4G80B 1LGVA 3MJ8B 1FZMB 3UYPA 3BUYB 4WU7A 3PWPB 1HZHL 2VLKB 5EO1A 3QJFA 3BWUC 5AD0B 5D7JD 3I50L 4K3HA 4QXTA 1NAKL 4LKXB 5E9DA 3GUTA 3KPOB 3U7AA 1CVRA 2Y5EA 1MIEH 5DMIL 4CVWA 2HVKA 1U8KB 4KJYB 4Q2ZA 3U2SA 3WXVH 1DUZA 1HKFA 4KKLC 5HVHB 1MJUL 1IJ9A 3Q48A 3QFJD 4ZUSA 1V05A 1YNKH 2FLRT 1WV7T 2O61B 2RIKA 3JVGA 2YK1L 1KIRB 2OP4L 3ETBF 4MXQC 2CR3A 4DUXA 4LCWB 3SKNA 5BO1H 4MNGB 3NAAH 4Y2DC 3MLUH 5DYOB 4K7FA 4PJIF 4KDWA 4G7VH 3NGBC 4OLYH 5I74C 1W0WA 4QCIB 1TQCB 3FJTA 2X4TB 4EIZC 4APQC 1FYTD 4V1DA 4FA8A 5FO8B 4G59A 1XF5B 1QBLL 3PHQB 5JPMB 3VRIB 4EI6A 1G1YA 3MV9E 2E8ZA 3TH4T 3BKYL 4ZTPH 5CEYB 3OXRA 2NY7L 5LGKA 4FQ1H 4HG4J 1N2RB 3V7AE 2IGFH 4M48L 2IWGA 4RAUB 1ZT1A 4XNQA 1IRAY 1IAMA 1OT2A 3HE7B 1U8LB 2OJEB 2Y7QB 3BGMB 4ZUUB 2IBZX 5J9PA 4PP8C 2ICWB 3PDOA 1IM9D 1UYWL 3RU8H 4WCYL 4AEEA 3V4PH 1AR1C 1MCPH 1NBZB 4UB0H 1FO0L 1QSFE 5ESQA 3BO8B 3ZYIA 1CQKA 3V5DA 5HDQH 1PYWA 5FAAA 4OZ4A 3JV0A 4BFGA 4PP2B 4L8CA 3T3PF 3RIFK 2PYEE 5D1ZB 5D1XC 4Y19A 4HDIB 1A22B 1RK1B 5F7HA 1NCCH 4GW5B 3RWDB 4CU6A 4NQUA 2ZNXA 4MMXC 1T0MB 1IAII 4LAQL 1ZLWK 2Q6WA 1RJZB 2ZSVB 3NPSC 1G6VK 5C08A 1OAYH 2E9WA 5DJZA 4QNPF 1HYSC 4HGKC 5LQBH 4GRMA 4J23A 2X4QA 1QACA 4GW4A 2Y6SD 2ENSA 1JF6A 2G5BA 2APTA 1A5FL 3KXFE 2FJHA 3CPLB 1BIIB 1LO0L 3L5HA 3WYRA 3RIAF 1E4XH 3I6LE 2I60H 5SV4A 2DDQH 5FYKE 3EJZC 2VE6B 3F7VA 3P4MB 1K4DB 4LIQE 5D7JB 2AEPH 4J2XA 4QRPB 2GTWB 4AMKH 1CDIA 5JA9A 1FL5B 5D7LE 4DQOH 4WO4A 3ZDYE 4XC1L 1D5BB 1MCFA 3FT2A 1Q1JH 4Z78B 1L6XA 4M1GL 4DGVH 2C3VA 5IHZB 3ISWA 4FQCH 1RIUL 4NNYB 2IPKA 5FOBB 3QFJB 1JI1A 3HNVL 3V0VB 1RJLB 3A67L 1XGPB 3ESVF 2VXTL 1MAML 2F54D 3FQRA 4RA3A 2IC2A 5TDNA 3HR5B 4P2OC 2ZUWA 4AIZA 5IBUG 4NN6B 5D71L 1LNUA 1SYVA 2J88L 3DX7A 2VQ1B 1EEZB 3ROOB 1WFOA 5DLMH 2FRGP 4PREB 5IB1A 4XXDA 1P7QD 1UM5L 5IT2H 5MP6L 5EBLB 2PW1B 5T33L 3RWJB 1G9NL 3V5HA 3LRSA 5DJ0A 1FYTB 3SHSA 4K23H 5DQ9A 3QHZH 1OGTA 1P7KB 2K1MA 5CWSB 4DVBB 3V0WL 4NUJB 1BZ9A 1T21B 1WGOA 2APWA 3BRFA 1Z9SA 2J3SA 1KB9J 2ZKHH 3O4LD 3CH1A 4FG6C 5ESVB 1IEHA 2HJKA 3R4DA 1A7PL 5IHUL 3VXNB 3VFPB 4OCYL 3O2WL 2HFTA 4RAVB 5F1IB 4OLEA 1CYGA 1RUPH 4NRYA 5L6YL 1IM9B 3UBXA 4X4XA 3B6SB 2DQCH 1AGBA 5C0RL 4LSQH 4X80L 2H6PB 1CZ8L 4X4YB 4LVOB 3O0RH 5HHMD 3RHWK 3BPCB 3VXUA 1ZLVH 2BOBB 2H26A 3MRFA 4KROD 4JFPB 1OAKL 4WTWA 3MREA 4GG6F 3B9VA 3LKOB 4NSKB 1K85A 1GGCL 1FPTH 1JNNH 4DTGH 3C6SB 3BKJL 4RRPG 3MFGB 5CD3B 1KIPB 4JM4H 4HIJA 1W72L 3QUZD 2NY5H 1F4XH 5A16A 4CN1A 4LMQE 2FO4A 3O2DA 1JWUA 3QG6B 4HUWB 5EWIL 4X5XA 2CGRL 3W9EB 3S36X 3IDJA 3OB8A 2BFVL 5EA0H 3QO0B 1UH2A 2X4UB 2H3NB 4XPFH 3CUPA 5C0EA 3QUXA 4KK6D 5DJDA 2AEQL 4MQ7B 3VWJA 3JV4A 1F11A 4E5XA 5I9QB 3JTSA 4JR9L 5GS1C 1GGIH 2EDHA 4HIXH 4F7EA 3HCVA 2EE3A 4HCRL 2NY4C 3BDYL 4WWKD 1S7SA 1Q9OA 1TPXC 2I07A 1DLFH 4YPGA 5F7YC 4TUKL 2LTQC 1X5IA 2OZ4H 4LVNB 5C6TL 4I5BB 4MAYC 1A6PA 5IM7A 5LG1A 5JR1L 4L3EA 1MCWW 3ABZA 4OLZL 1BJ1H 2F54B 1RUQH 3EJYD 1QG3A 1GVIA 5FK9A 1CD9B 3ULUD 3D39D 1C5CL 5IG7B 4CUCA 3AS1A 2LE9A 5E94B 3CSBA 3K2UL 43CAB 4OAWA 4OT1H 1KIQB 3H0TA 2G60L 3CDFA 4NBYB 4MAUL 5F21B 4F37F 1A9EA 1P7QB 1VA9A 4UILH 4LSVH 4ZD3L 4HBCH 4XPBL 3V4UH 2VC2L 3MLWH 3NA9L 2VAAA 3Q2CA 5HHXL 1KCLA 1S5HB 4YHIB 1ACZA 1UACL 2QHRH 1Z9OA 2V9TA 5TE6L 4LPXA 4DEPC 2NW3B 3SDAA 3O3DB 1IM3A 2AJSL 4NQVB 1WBXB 3O4LB 3VGEA 4FTVA 3RWHA 3RWEA 4U6VL 5DVLA 4OZHE 4OIBA 2BCKB 2GSIB 3MLTB 4RMRA 5CJXC 3O2VH 4KHXH 4BFBD 1QVOA 4HIIB 2J6EA 2RQ8A 3CFEA 5D96C 5HHMB 1IC7H 4YXLL 1BZ7A 3DO7B 3GO1L 4K9EL 3TH3T 4ERSH 5B39G 2WK2A 2IH3B 3QIBD 4ONFL 2GK0A 4P23A 5DQJB 3RY6C 3C8KB 3MBEA 3QT2A 5DD6B 4LFHD 5F7WC 35C8H 3NZ8A 3E8UL 1QR1A 1OT1A 1JPGB 4X7TB 2BY2A 2PO6B 3FTGB 1BX2A 2GT9B 2XWJA 4PIRF 5JDSB 4MA8L 3C9NA 4PS4H 3VU2A 2WBKA 1FNEA 2YKLL 1GGTA 4M7LH 3QHFH 1CFSB 2J8UA 4I8DA 3FO2A 1J1OL 3T0XA 3MXVL 1AD0B 5KW9H 4H0HB 3L3OA 5C0FA 3K8KA 1YA5A 1I8LC 4WEUD 2HFFB 4O2CB 1IGYA 4R26H 4LASH 5FYLE 5HYQB 5I1EL 5CJQL 1A3RH 4PJ5A 4XMPL 1MHHB 3HAEA 4C54A 2A6KB 3SE8H 1XIWC 4NRXB 3BOVA 3CDCA 3JUYA 1DL7L 4YHZH 1DQQB 5IFAL 2V9QA 1ZV5A 3AM8A 3BH8B 12E8L 1AI1H 1LK2B 1E4WL 4YX2L 3BHBA 5HJ3A 1DEEB 2FZ3B 4YHNA 3QB7C 2VOTA 2YPLA 2FX8L 3FB8B 5H8DA 1N8ZB 1NMCB 5MI0B 1T66C 4TVPH 5E99H 4G6JL 5GS2D 4M6NH 4UI2A 2YS4A 2CRMA 2OR8A 4OZGB 5FYJD 4BH7B 2VABB 3D39B 4FQHB 1QLFA 5IVZA 1MSPA 2CUHA 4HQQL 1ZEAH 3SO5A 4ZS6D 4N90E 2FGWL 4NC1C 4R3SB 2HLFC 2KPNA 1NEZA 1ES0A 2OLDA 3MRJB 3OTTA 4G3YH 1A6TB 4QHMA 1M4KA 4F80A 5MEND 3PHOB 4NFDA 4QRQB 2ZUVA 4TUOA 5I15L 4GXUM 1I3GH 4KPHH 4W81A 3RGVD 1BBJB 5K9KA 4WUUA 4J3VA 4HPYH 3BKMH 2IALB 1K8DA 5HI3C 2X4RA 2OTWA 3BFOA 3S5LG 5LGHL 1FCGA 1P53A 3EDDA 5C0DA 4U1IA 5KVFL 3EJJX 1XGRB 4TNWF 1A7RL 4NBZB 1J5OL 2GFBA 1UC6A 3GMOB 2BSRA 1OAQL 4MCZB 1ZHBA 1U8MA 1CGYA 1FE8L 5DK2B 5EC1A 2UWEB 3F6IA 3PWVA 2WLZA 4HAFA 5C0AE 2UZXB 3VD3A 2Z35B 3O6FD 4PJIE 5E6ZA 1SBSL 2WW8A 2FNBA 5T5FH 3GMMA 1T2XA 2Z4QA 3VXMD 2KUTA 2VO5A 4U1MA 3MC0A 4M61A 3BVNB 3UTTE 3QIBB 1RZ7H 4Z7UA 4ETQA 5F3BB 3KPMB 4EI5C 3D6GA 4PJ8A 2BSED 1FCCA 3DMMA 3H7BA 4LSUH 1E6JL 3W2DH 5DSCB 5CINL 3LKQA 3DURA 1U36A 1QPXA 5I8OH 5DJCA 4IMLA 4LLQB 1KLUB 4NM4L 4PUBH 2CSPA 4G8IA 4HKBB 1YNLL 5DHVH 3IU3B 3NIFF 4ZTOH 2OJZH 4U6HB 5LJYH 2Z31C 3HFMH 4PG9B 1N0XL 3MRNA 5JUEL 5IESL 3BZ4A 3LB6D 3MA7B 1T5WA 3GSNL 3RVUD 5CEZH 4TQEH 1MFDL 4S1QL 4PRPD 1FGNH 1BOGB 2HH0L 4OIIH 5C8JA 4Y5XA 2VZOA 3L3IA 4WI5A 2AJXL 4P46A 1FVCB 1QOKA 3WO4B 4ZPTA 1TMCB 4G6AD 3T3PE 4FP8L 5DS8A 3P9LA 2DQHL 2BNQA 1EHLL 2XFXA 5T3ZL 1MHEA 2F74A 4XMLL 4P4KC 3G5VA 4BQCA 1T0NB 2FIKB 3MV8E 5JXEA 2EKSA 1S7UB 3FQTA 2GHWB 1HQ4B 5DQDH 3TZVA 2YZ8A 4G7YL 3PABB 5F96H 2OI9C 4IRJA 4L4TE 5L8KB 4IOFD 1I1CA 1EJOL 2GJ6B 2ZUSA 4OLVH 3I02B 4JJ5B 5CSZA 2X9YA 3LOWA 5ID0A 5IW1B 5IWLC 1HH9A 3MOQA 4LQFH 2QADB 2ZG1A 1JWSB 3HI6L 2AJVH 4KRPD 5CJ5A 3SDDD 5CEZD 4N8VA 1XCTA 4DWHA 2PXYD 3AREA 3STBA 3O8XB 5DD5H 3G5XA 2DJ4A 1GC1H 2MTPA 4IDLA 4PJ7B 5IVXB 1H15A 1JGLH 4Q6YA 4BFEA 3RGVB 2W0KA 2B5IB 4RWHA 3QZWA 4S0TD 3MA9L 4XCYB 3RA7H 4KVCL 3WLBB 4RX4A 5ALCH 3EYOB 3R0NA 4AT6A 2P44B 2K3TA 4GS7C 5T3XE 2BY1A 4NYLA 3VXQA 1PSKH 3VFWA 1IQWL 1M7IA 2DLEA 4PJ9D 4DVRL 4PRNA 3KGRA 3O6FB 3FO1A 3MMEA 2D31A 5L0QB 1H5BC 3LSOA 3RDTC 1BD2D 4H1LG 1N3NB 4ZYKB 3VXMB 3RKDC 4WW2B 5JQHC 1YJDC 1U3HC 2ERJC 3GMPB 4JVWA 4R2GC 2WUBL 3IVKB 1X5LA 4L5FL 2P5EE 3U1SH 4N0UB 1CDHA 1NUFA 3A6BH 4ONGL 3B9DA 5DRXB 4ETYA 4R4ND 4TULH 4LSSL 5BW7C 4H8WL 5ALBL 1S9YB 1QBAA 1E6OL 1CG9A 4NGHH 5IW6A 3L3DA 4UTBH 1CL7L 2I9TA 5LCVL 5D93B 2DQFB 3O3UN 3F7RA 1C16B 2IEPA 3AS3A 1AHWA 1I9RL 5FUOH 1WBZA 4Y0GA 5J13B 5EU6E 3LDBB 1X4YA 3UPAA 3MLVL 4Y5YB 2DBLL 2NX5E 4UDTB 1J0HA 3AMLA 3OKDA 1BFTA 3QQ4A 4F9PA 3OR7B 5TPWH 4GG6E 3LQAC 4DW2H 4NQEE 1LMKA 3ZHKA 3VGBA 5F9JB 4KY1H 4XCCH 3TN0A 5EO0A 1NGYA 4YBQD 3S35L 1EUTA 3HG1E 4U6YA 3T1FA 3S88H 4G8GA 2A9NH 3L1OH 1HHKA 2DM2A 2P8MA 3CFCH 4LOUD 4UTAH 1CD1B 1DBKL 1G7LB 1RIHL 4LNRA 1OTUD 2ICEA 5C07E 3NTCH 1V7NH 4KKCC 3WLWD 4OQTA 1HH6B 5CBAB 5F1OB 4F7TA 5BZDB 1LEGB 5DUMH 5EOTB 8FABA 3TA3C 4RWYH 2RCSL 5SWSD 3RZCC 5ADOH 2JTDA 1MCHA 5DHVB 1P1ZB 2Q20A 5BVJB 1NPUA 4ZUVB 4XP5H 1FV1B 1IKNC 4KRPB 5E8NA 5I17B 3SDDB 1M7DB 5I2IA 4PY7A 1JK8A 2O5XH 4NN7C 2A83B 2PXYB 5JOPE 3SE9H 1S7XA 3MXWL 3QQ9D 1OW0C 4O4YH 5IEKA 3HI5H 5IB3B 1KPUA 1CGVA 2ZCHL 2IFFL 5F71A 3PDDA 2BZDA 4K7PX 1KCRL 2EC9U 4LBEB 3WIIH 1A3QA 3L6FB 3OF6D 1P6AB 3C8HA 4PRIE 4RGOH 3WL9A 4NKOA 1SJHA 4HKZB 2B0SH 4PJGF 1DQLL 5DRWA 3AY4C 4X6DA 2XKNB 4GW1B 4X99A 5I16B 1TCRB 2A38A 3WD5H 2Q7NA 4FMKA 4OZIA 4PJ9B 1M6OB 2P24B 1CFQA 2ZCLL 2AJYL 2ZPKH 5HD8C 4QEGA 1CGUA 5C08D 4P2QA 1BD2B 1NKRA 1JHKL 1JRHH 4UBDC 4F3FA 5C0NC 4LEOB 1F00I 3D9AL 1AGDB 1VGKA 4JFDD 3T08A 1IVLA 1AGCB 4K3DL 1G9ML 5HHNB 5ERWB 5E70A 2W9EH 3QRGH 3MO1A 2CIIB 2YUXA 3LMJH 3MUJA 1MJ7L 3VD4A 5F7UA 1DSFH 3MNWB 4WU7B 4HUUB 2DYPD 5EO1B 4FZ8L 4GRWF 4HFUL 2BDNL 5C0CD 4YHLH 3EKCA 3MLPA 3WBDA 1HSBB 5DTFA 4B41A 4JKPH 4JRYA 3FO0H 4QXTB 4ZNEA 3QA3A 1I1AC 1MEXH 1ZA3A 3C6LD 3GUTB 4AY0A 1EMTH 1V3MA 3NCBB 2ADFH 4MX7B 4Q2ZB 3U2SB 4HLZG 4UAOB 1UB5B 3P40A 1VADB 1DUZB 1ZHKA 3GSQB 4AIXA 5BV7C 4NQCA 3PWJA 4NQSB 3MROB 4IMKC 4OM0H 1EZVY 3NN8A 4Q6IA 2RHEA 4LP4A 2COQA 5C0JA 3UXFA 1FH5L 3SKNB 2KKQA 4RSVA 4EXPX 2NY2C 1PG7W 2D4FA 3O6MH 3PQYA 5DJ2B 4K7FB 3R1GH 3VH8B 2JCCA 4NC0B 1LO3L 6FABL 5GRXG 2M8XA 5TFSL 3BGFB 3T0WA 2AXHA 4S0UC 2WBWB 3CSYB 3QEGL 1YQVL 3X3FL 4GUPA 4X9GA 3MOAL 2CJUL 1FO0B 1T04A 1CDJA 3U6RA 3WJJC 2NYYC 1SEQL 1FSKC 3C2AH 4Z77B 5I76A 1OARH 4KDTC 2IBZY 2X44D 1QSEE 4GRLA 3HZMB 5EG6C 1AY1L 3O2DH 1QRNE 2R4RL 4JFOB 2ESVE 2NY1B 4JY5H 5HYJD 1D5XA 5GS0L 4YFLI 1MAJA 1FORL 1XGYL 4UT6L 3QDMD 1NBVL 5DD1L 3H7LA 2YN3A 1F02I 3GGWA 5J9PB 4GOSA 3EO1A 1CGWA 3U7WH 2W60A 4O58H 3MJ9A 3TYGH 3W0WD 3CNKA 1Y6KR 4HZLB 4D9LH 4EVNA 4LQ1A 5ISZA 3P2TA 4AEIL 1B0RA 1BWMA 1L7TH 3SKMA 3DUSB 4ZFFA 1NCDH 5HY9A 4JFZH 2YD9A 3V5DB 4ALAL 1EEUA 1PYWB 2WP3O 4MDIB 4PDCE 4OZ4B 3L3KA 1PQZA 2ZSWA 4M7ZC 2XKUA 1NCWL 4QOKA 3U30C 5B4MD 4YGVA 2ZOKA 4J3WA 1TLKA 2BVOA 3MYZA 4LHUA 4F58L 2V5YA 4BA8A 4HAGA 4E42B 4HWNA 2EH8L 2WIIA 4PB9L 5FDYA 4OKVA 5EBWA 4L9LC 3WNNA 4N0CA 5I66A 5C08B 3UPRA 1G7PA 3X3GH 4TUJA 2ZP0T 3F7YB 5GGVL 3OKEA 4NHCL 3N1MC 4GRMB 4JFDB 2X4QB 1WBYA 5D8JL 2IANE 2V7NA 15C8H 2XKSA 3DGGA 3QCUH 1UA6H 2JE8A 3QUXD 3BN9C 4HV8A 3ILQD 1X5FA 4FXLA 4ELKA 3DNKA 3TFKA 5I0ZA 2DYPB 5F1NA 3SE4A 5C0CB 1KCGC 5LXGH 1DN2A 4I3RL 3C6LB 3K2MC 3OX8B 4LRIA 3GSUA 1CLYH 2Y25A 3VDAA 4PJXB 3WFZA 5FO9A 4OIAA 3ZKND 2I27N 5FYKL 5EO9B 5E8OA 1IILE 2VYRE 2UZYB 2OX5A 2UY7A 4LIQL 2D7TL 4J4PD 4RDQG 4DN4H 2J6EH 5L8LB 1TTUA 3KLSA 2CKBA 3MGTB 3WDHA 5BXFA 3RWGA 3Q0HA 4AIZB 4CADA 1KCVH 1HOCA 2JJSA 1LNUB 4PGJA 2K7QA 1SYVB 1T6WA 5HVHC 2D7QA 1X5KA 4PY8J 3U83A 4LLVA 4JEGB 2WP3T 4PJEA 2C1PB 1RZGB 1OAUH 1ZK9A 5FF6B 5IB1B 2BC4A 4UNTA 3TV3H 3WIFA 1I7RB 3MRIA 3QH3A 4LPUA 4X8JA 2NZ9C 1JUFA 5IJVB 3L95A 1MY7A 3MODH 5DQ9B 4MJID 3IXTB 3HC0A 4ISVA 1YPZB 5HDOA 3JV5A 1BZ9B 4GKOA 5ICYB 5HYJB 4U1GB 4KAQL 2VWEC 4OLXH 3SDAD 2MKWA 5I30H 3CMOL 2R1YB 3ULUF 5BMFH 4OZGF 1TQCC 3QDMB 3IS1X 4C57C 3PWPE 2VLKE 1HYRC 5EOCH 2K7PA 5LWYL 1X4XA 5HVWA 3JV6A 1A14H 3BH9A 3ME0A 4DZBA 4MJ4A 4ZG1A 3EFFA 4P9MH 3W0WB 32C2A 3UBXB 1GH7A 3HAEH 3MZGB 2HWZH 5L7XL 1AGBB 2DM4A 4D0DA 5ITFB 3H9YA 1L6ZA 3VW3H 4GSDL 3HE7C 1C8PA 2A2QT 3SGDI 2ATKB 3VXUB 4GBXD 1H8OA 1UCTA 2H26B 3MRFB 4Y4HA 4UOW0 3MREB 4ODVL 3WFBH 4XP1H 4FFZL 5F6HI 3MRGA 1AIFA 2EXYC 4G5ZL 1JF1B 4LCWE 5I1IH 3LPWA 3EDEA 4MNGE 4GXVL 2VSCA 2X4PB 3R06A 4WFGE 3LN5B 4HIJB 4KZDH 1KELL 4MDJB 2UWEF 2BHZA 4YEFA 5A16B 2VWEE 5D1ZC 4OTXH 1UXSA 1DR9A 2B1HH 4CN4A 4UU9B 1N59A 1U8IA 3GMQA 3NFPB 3QHTC 4QGYA 3S4SA 2F5BL 3CUPB 2MOVA 3CZJA 3QUXB 1AXTL 3DHMA 4PLKD 2FECI 4QHNB 3QRFM 5CEXB 2GQHA 1I85A 2BNUA 3CLEL 5EBMA 4EQ3A 4NBXB 1NGQL 2EDXA 1KB5B 3UC0L 3JTSB 2R29H 1YEJL 3U0TA 3LS5H 4GAYA 1QFUH 2VZVA 3HCVB 4OV5B 1OSZA 1I9IH 3OAZH 1U8JB 3GI8L 2E7MA 4A6YL 4ESKA 4PYGA 5C9JA 4N1HB 4PGEA 3JSSA 2EZ0D 3O3AB 2YPVH 4YPGB 2QSQA 1ZSDA 5GPRA 4QLRA 2EDKA 3MRMB 5D7JC 1R3HB 4I18A 5DD3L 2CDFA 2FD6H 1RVFH 3BZEB 3CIQA 1B4JH 1QLEH 2EE2A 5FK9B 3UJJH 5E8EA 1TTFA 5KOMC 1IGIH 4TNVF 4B5EA 2XZCH 1IL1B 3CX5K 1XCQA 5F44A 3H0TB 3EYUL 3PGCA 2E5EA 4H26A 1F8TH 4JFED 4AQOA 1BM3H 3HE6D 5C2BH 1A9EB 4K3JH 5M7QA 4BYHA 3CFDA 3GMLA 3KYNA 1A7QL 3CFIC 4NN6C 25C8H 2VAAB 4WI6A 1FFOB 4MJIB 4NQTA 1MHPL 3B9AA 3O3EA 5HHVL 3KWWA 4XI5D 1Y18A 4HF5H 4N0YL 3VRJB 2BRRH 3WNKA 2EYRA 3VFVA 4ZXBD 2F19H 3P9WB 2DKMA 3SDAB 4OCRH 5EOQL 1P5UA 5IW3A 2ATPA 4UOJA 3W39A 2MPAL 3RWEB 4WHYH 4ZODA 4YFEA 4QF1B 1U6AL 1K6QL 1WIUA 3BJLA 2R1WA 3BKCL 3ELAT 4Y2OA 4C4KO 2AJUL 3T04D 3WKML 3SDCD 3CMGA 1T5XA 2NY6D 5IVXF 2ARJA 3L3JB 4IRSD 4YHKL 4GBXB 2EH7H 2HN7A 3BEVA 3QFJE 1CFVL 7FABL 1LO5A 2BY3A 3GZKA 3KNBB 1B3JA 4NQXA 3U0WL 3EO9H 5BS0D 3ECBA 3DBXA 3QCVH 1EHAA 5MEOB 1SJEA 1VSCA 1QFWM 4YFDB 5JXAL 1B9ZA 3SBWC 2JCCF 1T2JA 5H2BA 3SQOH 5CBEB 3ARVA 2D03H 4LVOC 4U1SB 1IC5L 3G6AB 5C0IB 1QR1B 3NCJL 3ULSB 1CICA 2MSPA 2OK0H 4OD1H 2J7LA 3QEQD 1BX2B 1S9XA 2DTSA 2XWJB 1DN0B 4BJLA 3KS0H 3WUWA 4B7IA 2F53A 1TJGL 3H9HA 3E2HB 3KVQA 1KJMB 4X6BA 2J8UB 4YBHA 3H8NA 1MCKA 4I2XB 3B8SA 1FNAA 4X6CA 1FYTE 4DOHB 5FB8A 5C0FB 1FL3A 4NZUL 1NQBA 3DVNA 1OB1A 1IGYB 1UWGH 2CIKA 4WRLA 4NO3A 5DFWH 4S1RH 4XBPA 5ETUA 4PJGE 3CK0L 4R96B 4P5TD 3AU1A 4OI8A 2H45A 2EC8A 4ONHB 1FC1A 4WI4A 2BNQD 3V79C 4ZFGL 3HAEB 5CAYB 4M5YL 2VLJA 2Y6SC 3Q1SL 4XPGH 1MPAH 1U58B 2X1PA 3GBML 3S36H 4EQ2A 5L9DL 3QPQD 1W72A 4JJHA 5J89A 3DRQA 2VDLL 5FYLL 5ICZA 2XT1B 2QKIB 1U2HA 4OLUL 2D0GA 4UV4H 4U7KA 4D9QD 5I9QC 1CN4A 4IRJD 4OJFL 3BHBB 5HJ3B 3QCTL 3KYMA 4BZ2H 3KPQA 5FECB 1ERNA 1KJ3L 3GHBL 1UJ3A 1VFBB 2R4SH 5DT1H 5ENWA 1EAPA 4OFPA 1FNSL 1IAKA 3PDGA 4KRLB 4XVJH 4C4KT 3RJQB 3I3BA 5DJ6A 3KR3L 5IFHL 4LVNC 1GZQB 4FQJH 4GRWE 5CGMA 4JRWA 5GSRB 1KN4L 5JO5A 5FCUH 1SEBA 1FHGA 3FQXA 1FZKA 5ITBH 4JFEB 2B4CH 4WEMB 1R5VA 1T3FB 4RMUA 1YN7A 3IDXL 1A47A 3RWCA 2DQGL 5F7EL 5LVEA 3TF7C 1BQLH 1RSFA 3NCCB 1AP2B 4GKNB 1Q9WB 4M5ZL 4AENA 5JHLL 1F4YH 1Q9KA 5K9KB 3C08H 2EDDA 4EKXA 3VI3E 4D0CB 3MACH 4ZXBB 4JN2A 1YYLH 1M71B 2DQJH 4LU5H 4PR5A 4QTHA 2GUOA 4RNRB 4Z0BL 4NO0A 2X9WA 3VXPB 1EFXA 2Y06L 5FGCB 5C09A 1UXWB 1A0QH 3MRLB 1OAZH 5B8CB 1CCZA 5D6DC 2DQUL 4UDUA 2BSRB 4PTTA 4U7MA 5IUSA 4KTDH 5KVGH 4JHWL 1R3KA 3M1BA 4P3DA 4X9FA 3GSOB 4XVTL 3LN4A 1MWAA 4FQIH 4P49A 2HMID 3SDCB 5JW3L 5IFJA 2NY6B 4QRRD 3GMMB 5HGAB 5I18H 5JORA 5FYJU 3DV6A 1MF2L 4MSWA 1N26A 5BS0B 4Z7UB 2EYSA 3ORJA 3QXUA 4RBPK 3T0BA 2WSKA 3HB3D 4PJ8B 4OQTH 2F54E 2JB5L 3NZHL 1MRFL 1VPOL 2UUDH 3N9GL 4GJTB 4JZJA 4AIOA 3VD9A 3W9DA 4HH9A 3B9KD 3LKQB 1L8JA 3T2NL 5BVPH 3QEQB 1TZGL 3MRDA 3P77A 2ORBH 3CVHL 3IKCA 1G7QA 4JZOA 3P3YA 1UZ8B 4EDWL 3MRNB 3ZT7A 2VZ3A 1HXYA 3UTZB 1KXTB 4HWBL 5E08H 5IEHA 1JN6A 3HZYB 3RJDA 2Q3ZA 5IB2A 3FRPA 3Q6GL 3QUZC 4JE4B 4Y5XB 5C8JB 3L3IB 2EKJA 4P46B 4Z95L 5EIQA 4MNHA 1P7HL 1C5BL 3I85A 3HZKA 3O4LE 2BNQB 3L5WA 2VLRA 3V4VH 4O00A 1HI6A 2F74B 4U1KA 4WI2A 5GJTH 5L8JB 4KK6C 1IGML 3FQTB 3TZVB 3MRBA 3MUGA 4O2EA 3L7EB 3UYOD 3D2UA 3LKSA 5IR1A 1LP9F 4IRJB 4WEBL 5HHME 1L0QA 4OGXH 2R0WL 3MNZA 2R8SH 4R4BA 4QY8B 2FEEL 5IBTH 1ZANL 4IOIA 3EYQD 4WWKC 3VG0H 1U41A 1QFHA 5ID0B 1WT5A 4HJGA 1HH9B 2DI8A 4JPIA 5KSAD 1ZTXH 3FZUD 3CDYA 2BSSA 2P8PA 2P47B 4NNPL 4Y88A 1A2YA 3D85D 5JHDD 2A73A 1DE4B 4N8VB 1XCTB 1CTNA 1RZKH 3EJYC 4IRZL 1NMCC 5CP7A 2FSEA 5EZLA 1YEHH 1XH3A 3H42H 3BSZH 4LLDA 4YWGH 5SWZD 1D9KA 3DIFA 1H15B 3ET9F 2FATH 5IQ9A 2D7NA 3VFTB 5I1GL 1A1OB 1YYML 1INEL 3QZWB 4DN3H 3V2AR 3CC5A 3OGOE 3LEYL 1WLHA 4FQXD 5JMRA 1CK0H 3RIAK 2D0FA 2R0ZH 2DQDL 4NYLB 5HHPA 3VFWB 1INDH 4IIQA 4R90L 4TSAL 2DJUA 3KYKL 5I8CB 4PRNB 1U95A 3FO1B 3MMEB 2VJXA 3GKWL 4GLRI 4QRRB 3LSOB 1JWMA 5E7FA 3UJTL 1B4RA 4ELMA 5T3XL 4N68A 3GSVA 3OJDB 3HN3A 3BEWA 3FQWB 2AXGA 4L1DA 3SDYH 4BH8B 5HGDA 4AG4L 3GSXA 3U9UB 3I6KB 4WU5B 5D5MA 4XH2B 4M8VA 4YHPA 4OZGE 3ULUE 5I8EA 3D39E 1F4WH 3ARFA 5DURD 1J1XH 3M17B 3QNZB 4HHAA 3R8BB 1TNMA 5CZKA 2XZAL 3CVIL 3L3DB 5EU3A 4R0LB 5IW6B 3QIBC 5BJTA 5MEPA 1JGVH 5JW4N 4P2RD 4U05A 5AUMA 2QSCH 5FV2A 3RUGA 2AJ3A 1WBZB 4MQXD 2ZCKH 4LCIL 5JIPA 3MRKB 3ZHDA 1MI5A 4F33B 2APBA 1YEIH 4NP4L 1MLCA 1XFPA 3OKDB 1Z3GL 3MJ9H 3QQ4B 4MWFB 5GS0D 4NQCD 5CJOH 1QQDB 1S9WA 1X6NA 5C6WH 5HYSA 1CDGA 5L2KD 1G6RH 4NQDD 4URTB 1NGYB 4KTEL 4G8GB 5DUPL 1CBVH 3UO1H 3PQYD 2P8MB 3VE0B 4X5WA 2CPCA 5JZ7D 1K8IB 1RZJH 3B43A 3WO4C 2ADJA 2JJUA 2UWEE 4LLYA 2EIDA 3KJ6L 1B90A 1JYXA 5D1QA 4JO1L 2E9IA 4PJXF 3GSNA 4KKLD 5F7MC 4CRPA 4F7TB 1BWWA 2E7LA 2ICES 1EXUA 4FHBD 5E8DH 1YJDL 2FWOA 1T1YA 1U8NA 4HKXA 5FA3B 4MXQD 5F72S 5F88A 3BGAA 1A7OH 4PJCB 5D2NA 4GAGH 3GJFK 5KSAB 2VXUH 3D85B 2A1WH 5I2IB 1JK8B 3CXDL 5JHDB 2EDRA 1AQDB 4Y8DC 3WFEH 2CQVA 4PJFF 3DYOA 5TE7H 5F9DC 5FUZH 5GGQH 5SWZB 5SWQA 2QADC 4LSRH 5DEGA 4ZS6C 1UT9A 3QQ3B 3LKRB 5B39A 2P5WD 1BEYH 3S34H 4WJ5A 1BLNB 4KK9C 1EEYA 1MJ8H 3LQAL 3DVFA 1JE6A 5DRWB 2AK1L 4NT6A 3RGVC 3EOTL 1KJ2A 4X6DB 5I6XB 2NNAA 3WN5A 2FL5B 5HPOA 4XMKH 2Y07L 2ZUTA 3RTQA 1I7UB 1ZVSA 2Q7YA 5ABDE 1HHIB 1NSNH 4YH6A 1AR1D 1RK0B 5I73B 3QUML 4JAMA 4F3FB 3OMZA 1DDHA 1VGKB 2J5LB 1IQDA 3I50H 5KTEL 1UH4A 4Z76B 3HPJA 4OGYL 1NAKH 4XCEA 3O6FC 1KC5L 1FDLL 5L0QC 3BPOB 1H0DA 4QTIL 1NFDA 4M4RA 5FYJE 4BZ1L 1A7NH 3FFDB 3IJSA 1V7MH 2A6DB 1EERB 4WW2C 2DM7A 4X7EC 3X12A 1OOAA 1KJVA 4P2RB 2ARWA 4Y4FA 5INDA 3L5XL 1ZGLA 2OQJB 1ZAGA 4M7KL 3QA3B 1RULH 1ZA3B 4HWEL 2MQCA 4F37K 5MENE 2VDQL 5D7IF 3OXSA 1WZKA 4G9FA 4PJ7E 5IVXE 1BQHG 1MJJB 1U0QA 3LHPL 4OD2B 4HWZB 3BMWA 4E0RA 4NQCB 4IDJL 3UBXG 2Y23A 5CP3A 3NN8B 5EUKB 2QJDA 1LDPL 5C0JB 1CT8A 3LKNA 5J13C 5L2KB 3LB6C 3LDBC 1QFWL 4Y5YC 3PQYB 4LCYB 4EXKA 4DCQA 2FBJH 2WZPD 1P4IH 2DQTH 4G6AC 3E3QA 4JQVC 2Y72A 5DFTA 5F9WB 2E6PA 1I7ZA 1T04B 2DMKA 2VXSH 2X09A 1HINL 2ADIA 1E4KC 4JRXD 4Y16A 2VQUA 2P49B 2VTFA 3VXME 4OQ1A 1UH3A 4FXKA 1EJ6A 4U49A 1QLRA 1PKQA 5C86A 5DUBB 5ACZA 4PRAA 1KTRL 4N0UE 4RZCB 1D5XB 3STZA 2Z91B 2BNRA 3B2VL 4JPVH 3RY5A 4IOFC 1OWRM 4JDTL 4J8RA 3RKPA 2QLVB 3VFMA 2WBJD 3EO1B 4ZUWA 2Z8SA 1NJ9A 1S7WA 4KGLA 4MLSA 4ZOCA 4KUZH 3OKKA 1PEZA 3X11A 5ILTL 4KRPC 4PRPE 5DC4B 3SKMB 4LCUA 3SDDC 5FDWA 3TYFA 5HY9B 1G6RB 2PXYC 5IK3A 2P5WB 1P4BL 1L9NA 2CRYA 2ZSWB 3MFFA 4FG6D 4Y7MA 2GTZA 2IG2H 2QQKL 1OPGL 4YGVB 1A6AA 1FZJA 3I3DA 3LRHA 2DWDA 4LHUB 1KTDB 4NWUH 3K0WA 3SGKA 1I4FA 4N5ED 1JPST 3CCHB 3V5KA 4DKFL 1T2QL 3WEXB 4E9LA 5EBWB 4K7PH 4F7MA 5I1DA 3V52L 1BGXH 3CFJB 2C7UA 3FN3A 4BSWA 4TUJB 3OAUL 3BPLC 1XF3B 2CK2A 2DTML 5A43C 1AO7A 4HD9A 4NHUB 4H5SA 4PJ9C 5J3HD 2V7NB 3QDJA 4JO3L 3REVB 3QUYA 3HPLB 1N5YH 5HGHA 4ELKB 5KANG 3A6OA 3H6JA 1KEMH 4NCC2 1U91A 1MCDA 4JM2A 2IFGA 4RIRB 3A67H 1XGUA 4AH2B 4JGJA 3IAGC 5ADPL 1MAMH 3QI9D 5CEZE 3P0GB 1NCNA 1K3IA 5DRNA 3F7PC 3N1PC 2X4NB 2Y36L 4R4NC 1KSRA 3GSUB 1MFAL 2XXCB 4MB3A 5CKAA 1SY6L 2XQYK 1FFRA 5EZJA 2WQ8A 5C2UB 2AVGA 3I3EA 1BJ8A 5T33H 1SHMA 2XN9D 3OKLA 2X10A 4E41D 2PCPA 3LS4H 4YIQA 1QBBA 4CADB 5KANI 1HOCB 2VL5A 3NPZB 4UAOC 4TNWK 2BY0A 4XGZA 1AGEA 3I75B 1D3CA 1CXKA 3GKZA 2EYTB 4LLVB 1VFUA 4NZRH 5KVEL 1H3VA 2IQAA 4XX1G 1BFOB 5T1LD 2R0LL 4JRXB 1BD2E 4YBQC 1OAXH 1A7PH 1OF2A 1I8IA 1JUFB 4YUEH 3L95B 4LOUC 1A64A 1I3RB 4MD0A 4ISVB 3FFCA 3BGFC 1OTUC 2AABL 3GI9L 4HG4K 4UOW1 5E6ID 1MCOL 5C0RH 4X80H 4D8PB 2QTEA 3WLWC 5IROA 4HMEA 1WIPA 2A74A 4ENED 1RZ8B 1TVBA 1MH5B 2FB4H 1OAKH 4POYA 2OXGA 3AUVA 4UT9H 3N1GC 2D7PA 3L3HA 2Z92B 2NY1C 1FG2B 4J12A 4U3XA 3HAEG 4F9LA 3QIUA 5A2FA 5DD0H 1HEZA 2QBWA 4M8QA 3SGEH 5CZXD 5F7NC 2AJZA 3EZJB 3ZYJA 3QQ9C 3INUH 2XPGA 3L3GB 3B3IB 4HC1L 3MRGB 3UZQA 1Q0XL 4A6YB 1M05A 5F1SA 4KXZI 4X7SH 3WIHL 3RWIA 3U7YH 3R06B 4MYWB 4OSUL 5MERA 4O5LH 3MV9A 3ZE0F 4NRZB 2EDEA 2W92A 4TOYL 1JGDB 1T1WA 4MZ2A 1IAIH 1NEZG 4YQXH 1U8IB 3GIZH 3VXSD 2EEDA 3KPPB 3DSFH 4JVPA 1I1RA 2H2SD 4HGWA 2VITB 3WXWH 3MX0A 3NCYP 2VUOA 2ZOLA 3Q3GA 5SWSE 3ULVH 1ODAA 5EBMB 2C1OA 3VFGL 4M03A 3U82B 5HHOD 3C8DA 4TPRL 3D18B 3DLQR 3HRZB 5T1DH 4PRHD 4Y2DA 1QSFA 2WIMA 1K2DB 3LRGA 3IFLH 3WNPA 1P84K 4ZO7A 1G0YR 4PGEB 4EUPB 2X4SB 5T1MB 2BVQB 3ARXA 1ZSDB 1PD6A 2C3HA 1Q94A 1MWAH 4HXBL 5SX4I 4APQA 2CDFB 1X5XA 5E5RB 5KAQG 1DQML 4XPBH 5KVDL 1JTOA 3C6LC 5J8OA 1IBGH 1QRKA 1F45A 5DMKA 1X7QB 3NA9H 5IKCB 5EZIL 3IDNA 5E8EB 5TGBB 1IFHH 4KHTL 4JPWL 4NUGL 4MA3B 2QEJA 1YECH 3ZKMD 3IXAB 3MQIA 3PGCB 2AJSH 4H26B 4Q7DA 5E5MA 2DLHA 4YEEA 4XPAL 5T1LB 3SGJC 3KLDA 5C08E 5TQ2H 3KXFA 3CFDB 1NL0H 1HNFA 1S7RB 4RMQA 4LHJB 1KG0A 3UTSD 3K80A 1HSAA 2YD1A 4XNXH 3ULVD 1BAFH 4KQ3L 4LGPB 4JFDE 5HGBA 2R2HA 3IRPX 1YEEH 3FCTB 3JTTB 3JWDH 5AZEL 3HS0A 3KWWB 2JJTC 1Y18B 5E6IB 5H37G 5DWUH 1IGTB 1ED3A 4PRBB 1ZA6A 1HCFX 4ORGA 4G43A 4RMTA 1MFNA 2GYSA 5JW5B 4G42A 4L8DB 1KCSH 5D1XA 1IZJA 2IJ0C 4XC3H 5C0CE 1JNJA 3G6JF 2IQ9H 2XRAL 1A1MB 4U1GC 4R7DA 4DK3A 1OVZA 3ZYOA 4XHJD 2BOCA 3E8UH 4N8PA 1FVDA 1NCAL 3EOAA 3NFSH 4PJXE 1D5ZA 3I2CH 2ARJB 4HUKB 3NIGE 3CX5J 1LO5B 4M62L 1T83A 3CLFL 3DBXB 5E8PA 1R5WA 3WFCL 2YPKB 2G2RA 4I3GA 1MCEA 5H2BB 4LSPL 5CUSH 2BSTA 4JO4L 1UVQA 3DX8B 4OI9A 1XF1A 1D7FA 5EN2A 1XGTB 1H3WM 4HMCA 1RJYB 3BIBX 3VCLA 5TE4H 3NH7H 1PX3A 4PJFE 2F53B 5CJQH 5A40E 1SBBA 1JZ7A 4XMPH 1MCBA 3H9HB 5B4MC 2EE9A 1AE6L 5GRJL 1VFOA 4R8WL 3STLA 3VXSB 4M3KB 4X6CB 5AWNH 1FL3B 5IFAH 1IAOB 3KHOA 1OB1B 1YPZE 4KK5D 4U7SA 5GISL 5HYJE 5ETUB 4XNUL 4HULB 5HHOB 2P42B 2HVJA 2ZZUT 1CLOL 4P2OA 3QDME 4F57L 5JTWA 2GITA 3SOBL 5D2LB 4NKDA 1A9BB 4ZPVB 3BYTA 4YDLB 1ZVYA 2GAZA 3BIKB 3QUXC 1HHJA 4M6MH 5DA0B 2XICA 3W0WE 5J06A 3ILQC 2X7LB 3MRCA 3BQUD 1AJ7H 3VFOB 1A21A 1JFMA 1MIEL 3VJ6B 1UJ3B 3ZZ1A 2IPTH 3WXVL 1IAKB 2D9QB 4WDIA 4XRCB 3UTOA 1ZHLA 5I15H 3FMGH 1YNKL 3ZKNC 5DEZA 8CGTA 4N8CH 3MRHA 4WTXA 1OSPH 1RZFH 4J4PC 3TJEH 3MCKA 5LGHH 1AXSA 3DX6A 1YUHB 3WFDH 5BO1L 1R5VB 5KVFH 3NAAL 2HFGH 3RWCB 4YPJA 5D7IE 3UTSB 1CI5A 3PHSA 3TT1L 3VMOA 5LBSL 2QHLA 1DBAH 5JOFB 3W81A 5KJRH 5ESAA 1TIUA 3HUJA 4Z18A 5EU4A 4YO0B 5GGSA 4JN2B 1RV6X 1F90H 1FG9C 4L29B 4UMGA 1VEPA 5F6HJ 5C0GB 4PJCF 4QT5A 1CXIA 3CFKA 1ULVA 4O51A 5C09B 4U1NA 1R3LA 3CVHB 2CLZB 4ZTPL 4UDUB 4FQ1L 4PTTB 3DPBA 5FM4A 1P2CA 4TYUA 1L7IH 2IGFL 4P3DB 1MWAB 3SDAC 4TSCH 3BP6A 3TBTA 2GY5A 1HQRA 5IFJB 1KCKA 1AC6A 3ZKXB 2FCBA 5GGUA 4AEFA 4WVRA 1J0IA 3C5ZD 5J7CC 1HXMA 3O6KH 4DK6A 4YDVA 1FAKT 2Z93B 4D9RD 5J57B 3T0EA 2EYSB 3V4PL 4UQ2A 1MCPL 3UTPD 1J88A 4JANB 4DAGH 5HHQA 4UB0L 2AI0L 3GSNH 4I0PD 4Z7VF 4DZ8A 2A6JA 5HDQL 3AROA 5AAMA 4LSDA 3G5YA 2AJXH 4GBXC 1S9KC 5GS1A 4OZFA 1MQ8A 3MRDB 1WSST 1NCCL 2PNDA 3IKCB 1JFQH 2YMXH 4JZOB 3RDTD 3BP7A 4PJBB 1HDMA 4NDMA 1JPFB 2X2YA 3OGCA 3OKMA 2JK5A 3TIDA 1EO8H 1OAYL 3LEXB 3VXRA 1WZ1H 1MI5D 5K9OB 4MJIE 3QEUB 4MAYA 3MR9A 1FJ1A 2FIRT 4OZHA 3TO4D 2P46B 4NO2B 1HK6A 3HI1B 4MNHB 4JQXC 3E2HC 3ARUA 3HZKB 2XTJD 5IBUB 4PGBA 3L5WB 1E0OB 5BQ7A 3CSGA 4BK5A 3ARGD 3BT2H 4U1KB 3IDGA 4NKMB 4L4VD 3NCEB 1QZ1A 3THMH 1E4XL 1LWRA 2I60L 4ACPA 1QEWA 1RD6A 3OB0K 1HHHA 4HIEA 3KLHD 4DFHA 2R1XA 2G75A 2DDQL 4JLRA 4PLKC 2JIXD 1HN1A 4YDKH 2W07A 1KJ2H 3J8F7 3LKSB 2AEPL 5EU7E 4AM0A 5KSBF 3BQUB 3KLAB 1N6UA 1KV3A 4AMKL 3CAFA 2ITDA 4DQOL 1OD7A 1KIUA 1MCIA 1Q1JL 4M6AA 1L0XA 4DGVL 1KCUL 5HVFB 2UYLA 5F7FA 2EZ0C 4FQCL 4DFIA 3NFNA 3VFRB 2ED8A 3HC3L 3GSRA 4HJGB 4JG0H 1T03H 2W65A 1A6WL 1U8QA 3NBNA 2BSSB 3MNVB 2D3VA 2P8PB 5FIEA 2A73B 4U6TA 4JHBA 4LPVA 1F3JA 3TVMD 1DJSA 5EZLB 2YRLA 3GJEA 1IGJB 1AGFB 4KV5F 3RX7A 5DLML 4ZAKA 2C4FT 2J8UE 5F89A 4I2XE 5IT2L 3PGDB 3HE6C 3MLZH 4MA1B 3P4OA 1F6AA 5BRZD 4K23L 3QHZL 4OB5L 2VN7A 3RY6A 4ZNCD 3SO3B 2RFXB 2MMXA 3FONA 2VDPL 2WUBH 1Q9LB 4G9DA 5CP3H 5HHPB 1JHTB 2ZKHL 4XI5C 1CFBA 3QYCA 5BCAA 4ZXBC 1LO4H 4UV7H 1FZOA 4LSSH 2W59A 4HJJH 2GY7B 4WTZA 3MRQB 3TIEA 3U79A 5GRWA 1E6OH 1ZLSH 4O9HH 3TBYA 1NBYA 3EBAA 5DJXA 3C5ZB 1T22A 5DJYA 1JWMB 4C56D 5B8CC 3DTXB 1BVLA 2EDWA 1GAFL 3AAZA 2DQCL 1DLHB 3GSVB 4OF6A 3BEWB 3UZVB 3O0RL 5T1KD 3GSXB 3QWOB 4I0PB 2MCG1 5JNYA 3SDCC 3IF1A 4ZO8A 4QHLA 2NY6C 3QXTA 5K33A 5I8EB 3ARFB 4BSVA 4HHAB 4QRTA 4C59B 1MCRA 3HMWH 1FPTL 1RQ5A 2BVTA 4YJZL 1JNNL 4KGJA 4DTGL 1YNTB 4JFEE 1XIWA 5AUMB 5ID1B 1J18A 4PJ8C 3RUGB 4UBDD 4JM4L 5C0ND 4CNIA 3QDHA 5SV3A 3GBNL 2NY5L 5IBLC 4U0RB 1F4XL 1MI5B 3DARA 1DBKH 1TENA 2NY3D 2V6HA 1RIHH 5CZVH 3T77A 3ZDYF 1JP5A 4HUXA 5J6GA 3A6CH 2AV1A 3TO4B 1F4AA 3ALPA 2H2PD 1W8NA 1EGJA 5H94A 3C5JA 5C0AA 5EA0L 3MRRA 2XTJB 4PJIA 5CIPA 5INCB 3ZKSD 1KN2L 3NABH 4XPFL 3ES6A 3NOIA 2LAGB 1NDGB 3ARGB 5FGCE 4L4VB 4BFIA 4X5WB 4Y5XC 5DDHA 4L9DA 2DS4A 2R2EA 4OD3L 1GGIL 4NWTH 4UUJB 1S5IH 1F5WA 1UGNA 4HIXL 3FB5B 5DC9B 5KSVA 3OJMB 5GGVY 5I1LB 1FNLA 4NPYA 4PBWD 2BMKA 3SDXB 2NLJA 1EXUB 2VXVL 2FWOB 3MXWH 1DLFL 4WHDA 2OZ4L 1FN4B 5JXEC 4HKXB 5BS0E 1NGXB 4FQLH 4Z7UE 2VH5H 4NKIH 4RFEA 5F88B 4NNXA 3TZVC 4XTRD 2VDKH 2IFFH 2DI7A 1O0VA 1OCWH 4IRJC 4CU8A 1RUQL 4ODHH 3LD8B 3QULA 5IMLA 3QEQE 5HTSA 3WFHA 3KAAA 3TVMB 1MFBH 4U1LB 2UVEA 3WNOA 3QFDA 3Q5OA 3T09A 5DVKA 4HX1A 5DEGB 4LSVL 2ZCLH 4HBCL 3V4UL 3LKPB 3C5SA 3QPXH 4JVUA 2AK4D 3OPZH 3VFSA 1RFDH 5B39B 3MLWL 3KDMA 3MV8A 3BD3A 5BRZB 3HNSH 3FT3A 2OL3H 4NN5B 1TXKA 4GMTH 4EI5A 4F2MA 5K9JH 1C1EH 2QHRL 5BOZG 4NT6B 1NLDH 2BNQE 1KJ2B 3DOSA 4L3CA 1VHPA 1XR9A 3NA4A 3PE9A 4L4TA 4EN3D 1FNHA 3WN5B 1QSZA 3U4BH 2YUVA 1GHFH 2B2XL 3BUTA 5HI4D 3RTQB 1MJ7H 7CGTA 1YEKH 3T8XA 3S3SA 4HUVB 4WI9A 1JZ4A 2FYYB 4D9QE 4C56B 2VDMH 2Z31A 1DDHB 4MB5A 4EBQH 3O2VL 4KHXL 4C58B 1IQDB 1J0KA 1A6UH 4XCEB 4N9GA 5DO2D 4N0RA 1IC7L 4XVSH 2HMIC 3WS6C 2OMNA 4ERSL 2HJFA 3EO0A 1H0DB 4JY4A 4J3SA 1NFDB 3GRWA 3GIVB 2OR7A 3UZEA 1MRDH 3G9VA 4LAJH 4TNVK 2CDGA 1CXLA 4I9WD 3X12B 4R6UA 4M43H 4P4KA 5I8KH 1KJVB 35C8L 4Y4FB 5INDB 4KI5C 1ZGLB 2YD4A 3SY0B 4XWGH 2NXZB 4CJ0A 2B4CC 2YSSA 2R0KH 3OXSB 1WITA 4DGIH 4WI7A 1UWXK 4JQIH 2EIEA 4PS4L 2NY3B 2OI9A 4R0LC 4E0RB 2YBRB 2CJUH 4XPTH 1TQBB 4H1LH 4MJ6A 1XF4A 5C3TA 2MFNA 4XCFH 4R97B 1WZMA 4WUKH 3BRDA 5JDJA 1GRWA 4LASL 4JHAL 2HRLA 1OD9A 1A3RL 4DCQB 1WFUA 3GMRA 5FUCC 1X6LA 2FR4A 3EYVA 1NCUA 1S7VB 2P5EA 3SE8L 4JFFD 4JDVA 5F3HA 1EA9C 4UT6H 2OXHA 5EU5A 1NBVH 4QRRE 1C12A 5GHWH 4MNQD 1ZWIA 4ODBD 4YHZL 5LGJA 1LVEA 5EPMA 1NGWB 2X9XA 4FXKB 1CS6A 1QLRB 1YC7A 1PKQB 5JPNB 2JLLA 3FFCD 3S5LB 4ODTH 3VD5A 4ODXA 3STZB 1OGAD 1YQ2A 2R2BB 5EU6A 3S4SG 2HP4A 4AEHH 3TC9A 3RVWD 3MRPB 3VDBA 4TVPL 5E99L 2GW5A 2NX5A 4IJ3B 4M6NL 1WWBX 5IIEA 3DV4A 1U8PA 1V3KA 4ZUWB 5JLZA 3GJFA 4GG6A 1NJ9B 4M7JH 3WDJA 1DQJA 4NQEA 3GB7A 5KSAC 1JTTA 2VR9A 3FZUC 3OKKB 4JFXA 2EH8H 1H5BA 3X14B 1U2CA 4Z5RA 5C92A 4G3YL 3VMPA 3O3BA 4LCUB 3ZSTA 2AK4B 3BWAA 3HG1A 5F93C 3J7HA 4YK4B 4OCLC 3TT3H 3F12B 1U3HA 3WHXA 1I1FB 4X0KA 1I3GL 4KPHL 3F6LA 5GGSY 2GTZB 4HPYL 3ILPB 4H25B 3IYLW 5FKPA 1S9VB 5C07A 4EN3B 2DWDB 3KPSD 5CHNB 5BW7A 2E3VA 1QA9A 4YGAB 4KUCD 5FO7B 5DJ8B 1KPRA 5I1DB 1KLGB 2DICA 2J4WH 2KDGA 4L8BA 4PY8I 4PJHF 5C70A 2MHAA 5I6XC 4CU7A 3H9SD 4FNLH 5E4IA 4HGMA 2ZUYA 4PJDF 1B6DA 5T5FL 1YN6B 4JO2L 2FX9H 3VG9B 2QR0A 2EXYD 1ZGLP 4PJCE 5I73C 1RZ7L 5HGHB 5I1JH 1CXFA 2J5LC 1T89C 3NVQA 4JM2B 5IV2B 3FN0H 1R3IH 1XGUB 2R56H 4LSUL 5JHDE 1G7HB 2BHYA