3WTKA

Crystal structure of lymnaea stagnalis acetylcholine-binding protein q55r mutant complexed with thiacloprid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
208
structure length
208
Chain Sequence
b'AADRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQRTTWSDRTLAWDSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title Studies on an acetylcholine binding protein identify a basic residue in loop G on the beta 1 strand as a new structural determinant of neonicotinoid actions
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Signaling protein
total genus 44
structure length 208
sequence length 208
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3wtkA00
5AFMB 2WNCA 3UU8A 3PEOA 5KZUA 4HFBA 3UQ4A 5AFHA 4HFDA 2BJ0A 1UW6A 2XQ5A 4AFHA 2W8GA 2XNTA 4ZRUA 3P4WA 3TLVA 1UX2A 5AINA 4Z90A 3UQ7A 2BG9A 2WZYA 5TVCA 3U8KA 4A97A 3TLSA 4QAAA 5L4EA 2Y7YA 3WIPA 5LG3A 3WTMA 2YN6A 5L4HA 4LMLA 3WTIA 3WTNA 4BQTA 3U8LA 3P50A 4IL4A 3C79A 5HEGA 3SIOA 4DBMA 5BP0A 3EI0A 2BYPA 2X00A 2PH9A 2XQ4A 4COFA 4EZ1A 5J5FA 3RHWA 4TNWA 3RIAA 3C84A 4UY2A 5KE4A 2VL0A 3RI5A 5JMEA 4B5DA 4TWHA 3UUBA 1UV6A 4UM3P 5AFJA 2XZ5A 4LMKA 4ILBA 3TLUA 3SQ9A 3U8JA 3WTJA 3JAFA 2WN9A 2Y58A 3UU6A 2YMDA 4BFQA 2BG9E 4IL9A 4UXUA 3WTOA 2XQ6A 3PMZA 4NPPA 5HEHA 4XK9A 5J5HA 5BW2A 5L47A 2BYNA 4XHEA 2YKSA 2C9TA 3RIFA 4ZZBA 4ZZCA 3TLTA 4ILAA 3WTHA 4ZJTA 5AFNA 5AFMA 2XNVA 3WTKA 3ZKRA 4HFHA 2Y57A 4HFIA 5IUXA 3UU3A 4AFGA 5LXBA 5AFLA 4HQPA 3UU4A 5HEJA 4UM1A 2XQ3A 4ZJSA 4QABA 3UU5A 2UZ6A 2BG9B 5HEOA 4AFTA 4QH4A 2WNJA 3JADA 4FRRA 2XQ7A 3U8NA 3LSVA 4ZR6A 2BR8A 4Z91A 4HFCA 2YOEA 3SH1A 4F8HA 4PIRA 4UM3S 2PGZA 4HFEA 4TWFA 2BR7A 5AFKA 5BRXA 2Y54A 2BYQA 4QH1A 4ALXA 4ZK4A 4TWDA 4TNVA 5HCMA 3EAMA 4QACA 5J0ZA 3U8MA 2XZ6A 4QH5A 4LMJA 3TLWA 4ILCA 1I9BA 2ZJUA 4IREA 3RQUA 4WV9A 2BYRA 2BYSA 2WNLA 2X00D 4D01A 5HCJA 2Y56A 3JAEA 3SQ6A 2QC1B 5HEUA 5CFBA 3IGQA 2W8FA 5SYOA 3T4MA 5CO5A 2YMEA 3ZDGA 3EHZA 4A98A 2XQAA 3RQWA 4ZK1A 2ZJVA 2XQ8A 5FJVA 2XNUA 3WTLA 5J5IA 5J5GA 2BG9C 3ZDHA 3GUAA 2XYSA 2XQ9A 4UM3A 4X5TA 2XYTA 4NZBA
chains in the Genus database with same CATH superfamily
5AFMB 2WNCA 3UU8A 3PEOA 5KZUA 4HFBA 3UQ4A 5AFHA 4HFDA 2BJ0A 1UW6A 2XQ5A 4AFHA 2W8GA 2XNTA 4ZRUA 3P4WA 3TLVA 1UX2A 5AINA 4Z90A 3UQ7A 2BG9A 2WZYA 5TVCA 3U8KA 4A97A 3TLSA 4QAAA 5L4EA 2Y7YA 3WIPA 5LG3A 3WTMA 2YN6A 5L4HA 4LMLA 3WTIA 3WTNA 4BQTA 3U8LA 3P50A 4IL4A 3C79A 5HEGA 3SIOA 4DBMA 5BP0A 3EI0A 2BYPA 2X00A 2PH9A 2XQ4A 4COFA 4EZ1A 5J5FA 3RHWA 4TNWA 3RIAA 3C84A 4UY2A 5KE4A 2VL0A 3RI5A 5JMEA 4B5DA 4TWHA 3UUBA 1UV6A 4UM3P 5AFJA 2XZ5A 4LMKA 4ILBA 3TLUA 3SQ9A 3U8JA 3WTJA 3JAFA 2WN9A 2Y58A 3UU6A 2YMDA 4BFQA 2BG9E 4IL9A 4UXUA 3WTOA 2XQ6A 3PMZA 4NPPA 5HEHA 4XK9A 5J5HA 5BW2A 5L47A 2BYNA 4XHEA 2YKSA 2C9TA 3RIFA 4ZZBA 4ZZCA 3TLTA 4ILAA 3WTHA 4ZJTA 5AFNA 5AFMA 2XNVA 3WTKA 3ZKRA 4HFHA 2Y57A 4HFIA 5IUXA 3UU3A 4AFGA 5LXBA 5AFLA 4HQPA 3UU4A 5HEJA 4UM1A 2XQ3A 4ZJSA 4QABA 3UU5A 2UZ6A 2BG9B 5HEOA 4AFTA 4QH4A 2WNJA 3JADA 4FRRA 2XQ7A 3U8NA 3LSVA 4ZR6A 2BR8A 4Z91A 4HFCA 2YOEA 3SH1A 4F8HA 4PIRA 4UM3S 2PGZA 4HFEA 4TWFA 2BR7A 5AFKA 5BRXA 2Y54A 2BYQA 4QH1A 4ALXA 4ZK4A 4TWDA 4TNVA 5HCMA 3EAMA 4QACA 5J0ZA 3U8MA 2XZ6A 4QH5A 4LMJA 3TLWA 4ILCA 1I9BA 2ZJUA 4IREA 3RQUA 4WV9A 2BYRA 2BYSA 2WNLA 2X00D 4D01A 5HCJA 2Y56A 3JAEA 3SQ6A 2QC1B 5HEUA 5CFBA 3IGQA 2W8FA 5SYOA 3T4MA 5CO5A 2YMEA 3ZDGA 3EHZA 4A98A 2XQAA 3RQWA 4ZK1A 2ZJVA 2XQ8A 5FJVA 2XNUA 3WTLA 5J5IA 5J5GA 2BG9C 3ZDHA 3GUAA 2XYSA 2XQ9A 4UM3A 4X5TA 2XYTA 4NZBA
chains in the Genus database with same CATH topology
5AFMB 2WNCA 3UU8A 3PEOA 5KZUA 4HFBA 3UQ4A 5AFHA 4HFDA 2BJ0A 1UW6A 2XQ5A 4AFHA 2W8GA 2XNTA 4ZRUA 3P4WA 3TLVA 1UX2A 5AINA 4Z90A 3UQ7A 2BG9A 2WZYA 5TVCA 3U8KA 4A97A 3TLSA 4QAAA 5L4EA 2Y7YA 3WIPA 5LG3A 3WTMA 2YN6A 5L4HA 4LMLA 3WTIA 3WTNA 4BQTA 3U8LA 3P50A 4IL4A 3C79A 5HEGA 3SIOA 4DBMA 5BP0A 3EI0A 2BYPA 2X00A 2PH9A 2XQ4A 4COFA 4EZ1A 5J5FA 3RHWA 4TNWA 3RIAA 3C84A 4UY2A 5KE4A 2VL0A 3RI5A 5JMEA 4B5DA 4TWHA 3UUBA 1UV6A 4UM3P 5AFJA 2XZ5A 4LMKA 4ILBA 3TLUA 3SQ9A 3U8JA 3WTJA 3JAFA 2WN9A 2Y58A 3UU6A 2YMDA 4BFQA 2BG9E 4IL9A 4UXUA 3WTOA 2XQ6A 3PMZA 4NPPA 5HEHA 4XK9A 5J5HA 5BW2A 5L47A 2BYNA 4XHEA 2YKSA 2C9TA 3RIFA 4ZZBA 4ZZCA 3TLTA 4ILAA 3WTHA 4ZJTA 5AFNA 5AFMA 2XNVA 3WTKA 3ZKRA 4HFHA 2Y57A 4HFIA 5IUXA 3UU3A 4AFGA 5LXBA 5AFLA 4HQPA 3UU4A 5HEJA 4UM1A 2XQ3A 4ZJSA 4QABA 3UU5A 2UZ6A 2BG9B 5HEOA 4AFTA 4QH4A 2WNJA 3JADA 4FRRA 2XQ7A 3U8NA 3LSVA 4ZR6A 2BR8A 4Z91A 4HFCA 2YOEA 3SH1A 4F8HA 4PIRA 4UM3S 2PGZA 4HFEA 4TWFA 2BR7A 5AFKA 5BRXA 2Y54A 2BYQA 4QH1A 4ALXA 4ZK4A 4TWDA 4TNVA 5HCMA 3EAMA 4QACA 5J0ZA 3U8MA 2XZ6A 4QH5A 4LMJA 3TLWA 4ILCA 1I9BA 2ZJUA 4IREA 3RQUA 4WV9A 2BYRA 2BYSA 2WNLA 2X00D 4D01A 5HCJA 2Y56A 3JAEA 3SQ6A 2QC1B 5HEUA 5CFBA 3IGQA 2W8FA 5SYOA 3T4MA 5CO5A 2YMEA 3ZDGA 3EHZA 4A98A 2XQAA 3RQWA 4ZK1A 2ZJVA 2XQ8A 5FJVA 2XNUA 3WTLA 5J5IA 5J5GA 2BG9C 3ZDHA 3GUAA 2XYSA 2XQ9A 4UM3A 4X5TA 2XYTA 4NZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFM B;  2WNC A;  3UU8 A;  3PEO A;  5KZU A;  4HFB A;  3UQ4 A;  5AFH A;  4HFD A;  2BJ0 A;  1UW6 A;  2XQ5 A;  4AFH A;  2W8G A;  2XNT A;  4ZRU A;  3P4W A;  3TLV A;  1UX2 A;  5AIN A;  4Z90 A;  3UQ7 A;  2BG9 A;  2WZY A;  5TVC A;  3U8K A;  4A97 A;  3TLS A;  4QAA A;  5L4E A;  2Y7Y A;  3WIP A;  5LG3 A;  3WTM A;  2YN6 A;  5L4H A;  4LML A;  3WTI A;  3WTN A;  4BQT A;  3U8L A;  3P50 A;  4IL4 A;  3C79 A;  5HEG A;  3SIO A;  4DBM A;  5BP0 A;  3EI0 A;  2BYP A;  2X00 A;  2PH9 A;  2XQ4 A;  4COF A;  4EZ1 A;  5J5F A;  3RHW A;  4TNW A;  3RIA A;  3C84 A;  4UY2 A;  5KE4 A;  2VL0 A;  3RI5 A;  5JME A;  4B5D A;  4TWH A;  3UUB A;  1UV6 A;  4UM3 P;  5AFJ A;  2XZ5 A;  4LMK A;  4ILB A;  3TLU A;  3SQ9 A;  3U8J A;  3WTJ A;  3JAF A;  2WN9 A;  2Y58 A;  3UU6 A;  2YMD A;  4BFQ A;  2BG9 E;  4IL9 A;  4UXU A;  3WTO A;  2XQ6 A;  3PMZ A;  4NPP A;  5HEH A;  4XK9 A;  5J5H A;  5BW2 A;  5L47 A;  2BYN A;  4XHE A;  2YKS A;  2C9T A;  3RIF A;  4ZZB A;  4ZZC A;  3TLT A;  4ILA A;  3WTH A;  4ZJT A;  5AFN A;  5AFM A;  2XNV A;  3WTK A;  3ZKR A;  4HFH A;  2Y57 A;  4HFI A;  5IUX A;  3UU3 A;  4AFG A;  5LXB A;  5AFL A;  4HQP A;  3UU4 A;  5HEJ A;  4UM1 A;  2XQ3 A;  4ZJS A;  4QAB A;  3UU5 A;  2UZ6 A;  2BG9 B;  5HEO A;  4AFT A;  4QH4 A;  2WNJ A;  3JAD A;  4FRR A;  2XQ7 A;  3U8N A;  3LSV A;  4ZR6 A;  2BR8 A;  4Z91 A;  4HFC A;  2YOE A;  3SH1 A;  4F8H A;  4PIR A;  4UM3 S;  2PGZ A;  4HFE A;  4TWF A;  2BR7 A;  5AFK A;  5BRX A;  2Y54 A;  2BYQ A;  4QH1 A;  4ALX A;  4ZK4 A;  4TWD A;  4TNV A;  5HCM A;  3EAM A;  4QAC A;  5J0Z A;  3U8M A;  2XZ6 A;  4QH5 A;  4LMJ A;  3TLW A;  4ILC A;  1I9B A;  2ZJU A;  4IRE A;  3RQU A;  4WV9 A;  2BYR A;  2BYS A;  2WNL A;  2X00 D;  4D01 A;  5HCJ A;  2Y56 A;  3JAE A;  3SQ6 A;  2QC1 B;  5HEU A;  5CFB A;  3IGQ A;  2W8F A;  5SYO A;  3T4M A;  5CO5 A;  2YME A;  3ZDG A;  3EHZ A;  4A98 A;  2XQA A;  3RQW A;  4ZK1 A;  2ZJV A;  2XQ8 A;  5FJV A;  2XNU A;  3WTL A;  5J5I A;  5J5G A;  2BG9 C;  3ZDH A;  3GUA A;  2XYS A;  2XQ9 A;  4UM3 A;  4X5T A;  2XYT A;  4NZB A; 
#chains in the Genus database with same CATH topology
 5AFM B;  2WNC A;  3UU8 A;  3PEO A;  5KZU A;  4HFB A;  3UQ4 A;  5AFH A;  4HFD A;  2BJ0 A;  1UW6 A;  2XQ5 A;  4AFH A;  2W8G A;  2XNT A;  4ZRU A;  3P4W A;  3TLV A;  1UX2 A;  5AIN A;  4Z90 A;  3UQ7 A;  2BG9 A;  2WZY A;  5TVC A;  3U8K A;  4A97 A;  3TLS A;  4QAA A;  5L4E A;  2Y7Y A;  3WIP A;  5LG3 A;  3WTM A;  2YN6 A;  5L4H A;  4LML A;  3WTI A;  3WTN A;  4BQT A;  3U8L A;  3P50 A;  4IL4 A;  3C79 A;  5HEG A;  3SIO A;  4DBM A;  5BP0 A;  3EI0 A;  2BYP A;  2X00 A;  2PH9 A;  2XQ4 A;  4COF A;  4EZ1 A;  5J5F A;  3RHW A;  4TNW A;  3RIA A;  3C84 A;  4UY2 A;  5KE4 A;  2VL0 A;  3RI5 A;  5JME A;  4B5D A;  4TWH A;  3UUB A;  1UV6 A;  4UM3 P;  5AFJ A;  2XZ5 A;  4LMK A;  4ILB A;  3TLU A;  3SQ9 A;  3U8J A;  3WTJ A;  3JAF A;  2WN9 A;  2Y58 A;  3UU6 A;  2YMD A;  4BFQ A;  2BG9 E;  4IL9 A;  4UXU A;  3WTO A;  2XQ6 A;  3PMZ A;  4NPP A;  5HEH A;  4XK9 A;  5J5H A;  5BW2 A;  5L47 A;  2BYN A;  4XHE A;  2YKS A;  2C9T A;  3RIF A;  4ZZB A;  4ZZC A;  3TLT A;  4ILA A;  3WTH A;  4ZJT A;  5AFN A;  5AFM A;  2XNV A;  3WTK A;  3ZKR A;  4HFH A;  2Y57 A;  4HFI A;  5IUX A;  3UU3 A;  4AFG A;  5LXB A;  5AFL A;  4HQP A;  3UU4 A;  5HEJ A;  4UM1 A;  2XQ3 A;  4ZJS A;  4QAB A;  3UU5 A;  2UZ6 A;  2BG9 B;  5HEO A;  4AFT A;  4QH4 A;  2WNJ A;  3JAD A;  4FRR A;  2XQ7 A;  3U8N A;  3LSV A;  4ZR6 A;  2BR8 A;  4Z91 A;  4HFC A;  2YOE A;  3SH1 A;  4F8H A;  4PIR A;  4UM3 S;  2PGZ A;  4HFE A;  4TWF A;  2BR7 A;  5AFK A;  5BRX A;  2Y54 A;  2BYQ A;  4QH1 A;  4ALX A;  4ZK4 A;  4TWD A;  4TNV A;  5HCM A;  3EAM A;  4QAC A;  5J0Z A;  3U8M A;  2XZ6 A;  4QH5 A;  4LMJ A;  3TLW A;  4ILC A;  1I9B A;  2ZJU A;  4IRE A;  3RQU A;  4WV9 A;  2BYR A;  2BYS A;  2WNL A;  2X00 D;  4D01 A;  5HCJ A;  2Y56 A;  3JAE A;  3SQ6 A;  2QC1 B;  5HEU A;  5CFB A;  3IGQ A;  2W8F A;  5SYO A;  3T4M A;  5CO5 A;  2YME A;  3ZDG A;  3EHZ A;  4A98 A;  2XQA A;  3RQW A;  4ZK1 A;  2ZJV A;  2XQ8 A;  5FJV A;  2XNU A;  3WTL A;  5J5I A;  5J5G A;  2BG9 C;  3ZDH A;  3GUA A;  2XYS A;  2XQ9 A;  4UM3 A;  4X5T A;  2XYT A;  4NZB A; 
#chains in the Genus database with same CATH homology
 5AFM B;  2WNC A;  3UU8 A;  3PEO A;  5KZU A;  4HFB A;  3UQ4 A;  5AFH A;  4HFD A;  2BJ0 A;  1UW6 A;  2XQ5 A;  4AFH A;  2W8G A;  2XNT A;  4ZRU A;  3P4W A;  3TLV A;  1UX2 A;  5AIN A;  4Z90 A;  3UQ7 A;  2BG9 A;  2WZY A;  5TVC A;  3U8K A;  4A97 A;  3TLS A;  4QAA A;  5L4E A;  2Y7Y A;  3WIP A;  5LG3 A;  3WTM A;  2YN6 A;  5L4H A;  4LML A;  3WTI A;  3WTN A;  4BQT A;  3U8L A;  3P50 A;  4IL4 A;  3C79 A;  5HEG A;  3SIO A;  4DBM A;  5BP0 A;  3EI0 A;  2BYP A;  2X00 A;  2PH9 A;  2XQ4 A;  4COF A;  4EZ1 A;  5J5F A;  3RHW A;  4TNW A;  3RIA A;  3C84 A;  4UY2 A;  5KE4 A;  2VL0 A;  3RI5 A;  5JME A;  4B5D A;  4TWH A;  3UUB A;  1UV6 A;  4UM3 P;  5AFJ A;  2XZ5 A;  4LMK A;  4ILB A;  3TLU A;  3SQ9 A;  3U8J A;  3WTJ A;  3JAF A;  2WN9 A;  2Y58 A;  3UU6 A;  2YMD A;  4BFQ A;  2BG9 E;  4IL9 A;  4UXU A;  3WTO A;  2XQ6 A;  3PMZ A;  4NPP A;  5HEH A;  4XK9 A;  5J5H A;  5BW2 A;  5L47 A;  2BYN A;  4XHE A;  2YKS A;  2C9T A;  3RIF A;  4ZZB A;  4ZZC A;  3TLT A;  4ILA A;  3WTH A;  4ZJT A;  5AFN A;  5AFM A;  2XNV A;  3WTK A;  3ZKR A;  4HFH A;  2Y57 A;  4HFI A;  5IUX A;  3UU3 A;  4AFG A;  5LXB A;  5AFL A;  4HQP A;  3UU4 A;  5HEJ A;  4UM1 A;  2XQ3 A;  4ZJS A;  4QAB A;  3UU5 A;  2UZ6 A;  2BG9 B;  5HEO A;  4AFT A;  4QH4 A;  2WNJ A;  3JAD A;  4FRR A;  2XQ7 A;  3U8N A;  3LSV A;  4ZR6 A;  2BR8 A;  4Z91 A;  4HFC A;  2YOE A;  3SH1 A;  4F8H A;  4PIR A;  4UM3 S;  2PGZ A;  4HFE A;  4TWF A;  2BR7 A;  5AFK A;  5BRX A;  2Y54 A;  2BYQ A;  4QH1 A;  4ALX A;  4ZK4 A;  4TWD A;  4TNV A;  5HCM A;  3EAM A;  4QAC A;  5J0Z A;  3U8M A;  2XZ6 A;  4QH5 A;  4LMJ A;  3TLW A;  4ILC A;  1I9B A;  2ZJU A;  4IRE A;  3RQU A;  4WV9 A;  2BYR A;  2BYS A;  2WNL A;  2X00 D;  4D01 A;  5HCJ A;  2Y56 A;  3JAE A;  3SQ6 A;  2QC1 B;  5HEU A;  5CFB A;  3IGQ A;  2W8F A;  5SYO A;  3T4M A;  5CO5 A;  2YME A;  3ZDG A;  3EHZ A;  4A98 A;  2XQA A;  3RQW A;  4ZK1 A;  2ZJV A;  2XQ8 A;  5FJV A;  2XNU A;  3WTL A;  5J5I A;  5J5G A;  2BG9 C;  3ZDH A;  3GUA A;  2XYS A;  2XQ9 A;  4UM3 A;  4X5T A;  2XYT A;  4NZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...