3WX9A

Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
404
structure length
404
Chain Sequence
b'SMLGDVERFFSKKALEMRASEVRELLKLVETSDIISLAGGLPNPKTFPKEIIRDILVEIMEKYADKALQYGTTKGFTPLRETLMKWLGKRYGISQDNDIMITSGSQQALDLIGRVFLNPGDIVVVEAPTYLAALQAFNFYEPQYIQIPLDDEGMKVEILEEKLKELKSQGKKVKVVYTVPTFQNPAGVTMNEDRRKYLLELASEYDFIVVEDDPYGELRYSGNPEKKIKALDNEGRVIYLGTFSKILAPGFRIGWMVGDPGIIRKMEIAKQSTDLCTNVFGQVVAWRYVDGGYLEKHIPEIRKFYKPRRDAMLEALEEFMPEGVKWTKPEGGMFIWVTLPDGIDSKKMLERAIKKGVAYVPGEAFYAHRDVKNTMRLNFTYVDEDKIMEGIKRLAETIKEELKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein PH0207
publication title Crystal structure of Pyrococcus horikoshii kynurenine aminotransferase in complex with PMP, GLA, 4AD, 2OG, GLU and KYA
rcsb
source organism Pyrococcus horikoshii ot3
molecule tags Transferase
total genus 148
structure length 404
sequence length 404
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3wx9A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3wx9A01
4WD2A 2JJGA 1ARIA 2FNIA 2GMUA 1GEYA 2HUIA 2QB2A 5EUDA 2ZSMA 2W7EA 4ZDOA 4BQ0A 3FTBA 3VP6A 4Q31A 1SZSA 3WLXA 5E4ZA 2VMXA 1JS3A 4UHNA 4AZKA 2VMTA 4K2MA 3LVLB 2AY7A 2R5CA 1PG8A 3AEOA 3LVKA 3RQ1A 4JF0A 2DGMA 2AY4A 2BKWA 3EIBA 1OATA 4TN4A 2HUFA 1VJOA 4JF1A 2Z9WA 1S07A 3LVJA 2VYCA 1OXPA 3NYSA 5HDMA 4Q6RA 2OGAA 2C44A 3DZZA 2BIGA 2W7GA 2FNUA 2ZJGA 3L8AA 1AHXA 2VGVA 1UU0A 5C6UA 4OT8A 4KXKA 3W1HA 3AEPA 3K28A 3KKIA 3OP7A 4UQVA 2YKVA 4PFFA 2GMSA 2AY6A 4Y0DA 1YNUA 4Q76A 1GBNA 3ZRPA 3G7QA 3KGXA 2JJHA 1M0NA 3GR9A 3E2YA 1J04A 1LC7A 2HP2A 2OKJA 4RJ0A 1BJNA 2W8VA 1X28A 2BI9A 2BYJA 1OHYA 1AKBA 2OQXA 2VMUA 2Z20A 3DXWA 1UU2A 2GB3A 3EZ1A 4Y0HA 4A00A 1MAPA 1C7GA 1WKHA 1CQ6A 2CY8A 3AATA 4IY7A 1DJEA 2BWNA 4RITA 1BJOB 1ASEA 1X0MA 2HORA 2JISA 4OC9A 3WZFA 1DGEA 3NTJA 4ZM4A 1ARHA 1AIBA 3G8MA 4FL0A 3MAFB 9AATA 1YAAA 2BWOA 2W8TA 4JE5A 4MGRA 1IX7A 2BI1A 2D65A 2BIEA 1ARSA 1BJ4A 1AY8A 2OKKA 3WGCA 4KAMA 1BT4A 1CZCA 2Z1YA 3QM2A 4W91A 3EUCA 4F5FA 3ASBA 3CBFA 2BI3A 2VMRA 4XQ2A 3H14A 3BC8A 2HOXA 3AV7A 3PD6A 3HBXA 1AIAA 1UU1A 3UE8A 3CQ4A 4WLHA 3TFUA 2VI9A 4CBSA 3HQTA 1CJ0A 5D5SA 5IWQA 3FKDA 2WK9A 4GE7A 1VEFA 1AMQA 1BQDA 1YIZA 3AEMC 4WYAA 3NYTA 4OCAA 2CJGA 1BQAA 5G4IA 2D5YA 4R8DA 4ATQA 4UHOA 3ZRQA 5DJ1A 1FC4A 3LY1A 5BJ4A 2AY2A 4IYOA 3A9YA 1BW0A 1I29A 2QBTA 4I8AA 3AEMA 4H51A 4P3MA 1SZUA 3E2ZB 4GE4A 2VMZA 3T32A 5FT4A 2OGEA 4LW4A 2JJEA 4XAUA 3GZDC 5F9SA 3MKJA 1IAXA 2CH2A 1AJSB 1IX6A 2NMPA 3M5UA 3N0LA 4ADBA 2C81A 4E1OA 3GJUA 2VGZA 3ELPA 4U2HA 5G2PA 5DJ9A 3FVXA 1AKAA 3GZDA 4GSAA 1IJIA 3L44A 3PJ0A 3ACZA 2EGYA 4K2BA 1C0NA 4ADEA 5M46A 1ASAA 3K40A 4FFCA 2DKJA 4DBCA 2HZPA 2CH1A 1LW4A 1MLZA 2W7FA 3BB8A 3CQ6A 5HHYA 4F5MA 1O61A 1OHWA 3NUIA 4GDYA 1KMKA 2AY3A 3B1EA 2FYFA 3B46A 4OYTA 3WX9A 3NX3A 1WYTB 1CQ7A 1W23A 3Q8NA 1ZOBA 4IXOA 3FRKA 4AH3A 1S06A 2CFBA 1QISA 1QZ9A 2O1BA 4IX8A 3ATHA 3RCHB 4WXFA 2ZUKA 2VIAA 1AKCA 4WYEA 4ZDLA 2VMSA 5EAAA 1TATA 2CSTA 1SPAA 1RVUA 2Z1ZA 4PFNA 4TMRA 2VMOA 3EI7A 5I92A 4WP0A 3WCNA 2YKYA 4MSOA 4A0HA 3BV0A 1AAMA 3NDNA 4AOAA 1M4NA 2AY1A 1RVYA 1B9IA 2QLRA 1GC2A 1AHYA 2VMWA 3VK3A 4JEXA 3FQ8A 1C4KA 3BWNC 4R5FA 1TOGA 4A0RA 3ISLA 1XI9A 2FM1A 4JEWA 4F4EA 2AY8A 3LVMA 3JZLA 2R5CB 1DKAA 4IXZA 4JEYA 4OBUA 1YOOA 2CB1A 3QI6A 2OATA 4TV7A 1DFOA 4UHMA 1D7SA 1N2TA 1TOKA 3BWNA 3NYUA 4M2KA 4WYDA 3PDBB 2EZ1A 4R2NA 1LC5A 5G4JA 4BHDA 4RAEA 4RJYA 2CJHA 1TASA 4MY5A 1CZEA 1DJUA 4WB0A 4AZJA 1N31A 1I41A 1JS6A 3VK2A 2W7KA 1SVVA 2V0YA 1P3WA 2VMVA 1ZODA 3BCXA 1QITA 2PB2A 3F9TA 3WKSA 1G7XA 1TOJA 1TPLA 1WYUA 3GZCA 3FZ6A 4R5ZA 4U1TA 5JAYA 2ZY2A 3FD0A 1X29A 2JGTA 2DOUA 1SZKA 2YRIA 2W7HA 1AMAA 2ZY3A 4W1VA 2EPJA 2VMPA 2Z9VA 2CANA 1WYVA 5EAVA 4A6TA 1TOIA 4F5JA 1TARA 1V2EA 2BIAA 2YKUA 3IF2A 3FSLA 3TFTA 2AEUA 1V2DA 2W7IA 1H1CA 3EI6A 4WYGA 1ASMA 2CINA 3FQAA 1ZC9A 1ASDA 4JE5D 2W8JA 3H7FA 2PB0A 1AHFA 3HMUA 3N75A 2DGKA 1BJWA 2CTZA 3FDDA 2V1PA 4XJLA 4JEVA 5D95A 4EU1A 2HOYA 1ASLA 1E5EA 2VGSA 2X3LA 1U08A 3AENA 3COGA 1IUGA 1AY4A 5G2QA 1FG7A 3UAKA 5M49A 4O6ZA 3A9XA 3DU4A 3QBOA 3WCOA 3DODA 1O4SA 2GSAA 1CL1A 1AX4A 3PD6B 3FZ8A 1EJIA 3TATA 1RV4A 4M2JA 4J5UA 2R2NA 5TF5A 4LNJA 5FT6A 1OXOA 3KGWA 1YJSA 2E54A 4F5LA 3E6GA 1ELQA 2BI2A 5DX5A 1ASBA 2ZY4A 2D64A 3EI9A 2F8JA 1W3UA 2YRRA 4OTLA 3KE3A 4M2MA 3ASAA 3R4TA 1MDOA 2VIBA 4RKDA 1FG3A 2ZY5A 4IYOB 4MQQA 4B98A 1G4VA 1S09A 4N0WA 3GETA 3FVSA 1YJYA 3A9ZA 3BS8A 5E3KA 1BS0A 4F5IA 1H0CA 4EMYA 1GC4A 4ZASA 5M4DA 1EQBA 1QIRA 5E5IA 2VMYA 4KYOA 3UWCA 3E9KA 4RKCA 4CBRA 1OHVA 2VGUA 1I48A 2VMNA 2Q7WA 1RV3A 1J32A 3I5TA 1ARGA 3HLMA 3FDBA 4K2IA 4BMKA 3FZ7A 1JG8A 2VGTA 3MC6C 3I16A 1MLYA 3ZRRA 2AATA 3D6KA 1PMMA 2WKAA 4GEBA 2C7TA 2HOZA 4F5GA 2W8WA 1AHEA 3PPLA 1WSTA 1M0PA 8AATA 3P6KA 1KKPA 4L0OA 2E7IA 5K8BA 1QGNA 2YCTA 3PAAA 5EIGA 5LHAA 4ZLVA 5DB5A 1B5PA 2YCNA 1IVRA 2ZYJA 2VMQA 3AELA 1ECXA 1QJ3A 4ZAHA 4GRXA 4ITGA 4PIWA 1CQ8A 1YIYA 1V2FA 2WK8A 2D7YA 1ARTA 1S0AA 4XEWA 3VOMA 1W7MA 4EB7A 4W5KA 4BA5A 1YJZA 2W7DA 1M0OA 3F0HA 3GBXA 4JEZA 5G0AA 1ASNA 3ECDA 1AICA 3NU8A 4A6UA 1ORDA 3NRAA 3QHXA 3A2BA 2R5EA 4IXSA 1AMSA 2D63A 4AO4A 3BCAA 1ELUA 2JJFA 2ZC0A 3MEBA 5F8VA 3LG0A 4HF8A 3RBFA 3VAXA 2W7MA 3AOWA 4LC3A 1AHGA 1GD9A 2FQ6A 3K7YA 3PDXA 1O69A 3E77A 4XJOA 1BKGA 1T3IA 2R0TA 3QGUA 3WY7A 3WKRA 3HT4A 4BA4A 1DTYA 4ISYA 1B4XA 1S08A 4OMAA 2QMAA 4WB0B 1GC3A 1D7RA 1GEWA 2BYLA 4IW7A 3ZZJA 1KKJA 1UKJA 3ZZKA 5BJ3A 4E3QA 4F5KA 7AATA 4ZSYA 1KL1A 4DGTA 4EB5A 3PDBA 2PO3A 1IBJA 1WYUB 3OKSA 1ASCA 1B5OA 1W7LA 3QPGA 4ZWMA 3TCMA 4J8LA 1MGVA 2TPLA 3GWPA 3JW9A 2FN6A 3W1IA 3B1DA 4GE9A 2VI8A 1W7NA 4ADDA 1M32A 4LNLA 4ZDPA 1M7YA 2AEVA 3E2FA 3G0TA 2C0RA 3B1CA 4ITXA 1WYVB 1C7NA 1G7WA 2VLFA 3JTXA 4WLJA 4ADCA 3NNKA 1GC0A 1PMOA 3R9AA 1KL2A 2GQNA 2Z67A 3EI8A 3PGYA 1SFFA 4A72A 4EFFA 2VLHA 2DKBA 1GCKA 2HP1A 1D7VA 4WXGA 1SF2A 3MAUA 1ASFA 1MAQA 2O0RA 3TQXA 5EUEA 3QN6A 1I43A 1DGDA 1BJOA 1WKGA 1PFFA 2BHXA 4XJPA 1AMRA 3EZSA 2AY5A 4W1XA 3PIUA 1CS1A 2BI5A 3MAFA 1XEYA 5FT8A 4XK1A 3RBLA 4CVQA 2JG2A 3AENB 1M6SA 3JU7A 3DC1A 3AOVA 3NU7A 1B9HA 5G09A 1B8GA 3ELEA 1E5FA 2QB3A 1D7UA 4NOGA 4MKJA 1DJ9A 2X8UA 3JWAA 4RM1A 4MQPA 3HL2A 2D61A 4P7YA 5AX8A 2QA3A 3BCBA 4N0BA 3USFA 5J8QA 3MBBA 2G6WA 3EIAA 2YOBA 2W7JA 4LNMA 2DR1A 2ZP7A 3IHJA 4B9BA 2YHKA 2E7UA 2DGLA 3DR4A 4A0FA 4E3RA 4ZWVA 1LKCA 1KMJA 2Z61A 1VP4A 3DR7A 4ZM3A 3DXVA 3NUBA 2W7LA 5EUNA 1GDEA 2E7JA 3EI5A 2Z9UA 3FQ7A 1M0QA 2VGWA 3A8UX 4MQRA 4PVFA 4W8IA 2BWPA 3LWSA 4XJMA 5EQCA 3JWBA 4F5HA 2RFVA 3RI6A 2X5FA 4OBVA 4DQ6A 2YKXA 3E2ZA 4LW2A 2YCPA 5M4BA 1O62A 3PA9A 3BWOA 1AY5A 5FT5A 4E77A 3II0A 4WYCA 3AEJC 2D66A 1AJSA 1EG5A 1Y4IA 2XH1A 4Q75A 4Y0IA 3N5MA 2XBNA 3FFHA 2ORDA 4UOYA 3RUYA 2W8UA 4W1WA 1AJRA 3I4JA 3LV2A 4ATPA 1D2FA 2AY9A 2EO5A 1N8PA 1TOEA 3BN1A 2EH6A 3CQ5A 3DRDA 1Z7DA 4WYFA 3AEJA 5EFSA 2EZ2A 4RLGA 3MC6A 4A6RA 3WGBA 3F6TA 1ASGA 1LS3A 1MDZA 1X2AA 5HXXA 5LH9A 2CJDA 1LK9A 1G4XA 3B8XA 3GSBA 4MKKA 1C9CA 1CL2A 1V72A 2Z9XA 4WXBA 5EIGB 2O7CA 3HVYA 4A0GA 1C7OA 3CAIA 1Z3ZA 2X5DA 1GEXA 2ZSLA 3P1TA 3HDOA 4AO9A 3FCRA 1MDXA 1LC8A 3VK4A 3MADA 1WYTA 4QGRA 1IX8A 4RIZA 2WK7A 3FFRA 3RCHA 1AAWA 1QJ5A 3FVUA 3DYDA 2D7ZA 4HVKA 1JF9A 1LW5A 2HUUA 3W1JA 4CXRA 1IAYA 4WBTA 4ZSWA 4CXQA
chains in the Genus database with same CATH superfamily
4WD2A 2JJGA 1ARIA 2FNIA 2GMUA 1GEYA 2HUIA 2QB2A 5EUDA 2ZSMA 2W7EA 4ZDOA 4BQ0A 3FTBA 3VP6A 4Q31A 1SZSA 3WLXA 5E4ZA 2VMXA 1JS3A 4UHNA 4AZKA 2VMTA 4K2MA 3LVLB 2AY7A 2R5CA 1PG8A 3AEOA 3LVKA 3RQ1A 4JF0A 2DGMA 2AY4A 2BKWA 3EIBA 1OATA 4TN4A 2HUFA 1VJOA 4JF1A 2Z9WA 1S07A 3LVJA 2VYCA 3N4RA 1OXPA 3NYSA 5HDMA 4Q6RA 2OGAA 2C44A 3DZZA 2BIGA 2W7GA 2FNUA 2ZJGA 3L8AA 1AHXA 2VGVA 1UU0A 5C6UA 4OT8A 4KXKA 3W1HA 3AEPA 3K28A 3KKIA 3OP7A 4UQVA 2YKVA 4PFFA 2GMSA 2AY6A 4Y0DA 1YNUA 4Q76A 1GBNA 3ZRPA 3G7QA 3KGXA 2JJHA 1M0NA 3GR9A 3E2YA 1J04A 1LC7A 2HP2A 2OKJA 4RJ0A 1BJNA 2W8VA 1X28A 2BI9A 2BYJA 1OHYA 1AKBA 2OQXA 2VMUA 2Z20A 3DXWA 1UU2A 2GB3A 3EZ1A 4Y0HA 4A00A 1MAPA 1C7GA 1WKHA 1CQ6A 2CY8A 3AATA 4IY7A 1DJEA 2BWNA 4RITA 1BJOB 1ASEA 1X0MA 2HORA 2JISA 4OC9A 3WZFA 1DGEA 3NTJA 4ZM4A 1ARHA 1AIBA 3G8MA 4FL0A 3MAFB 9AATA 1YAAA 2BWOA 2W8TA 4JE5A 4MGRA 1IX7A 2BI1A 2D65A 2BIEA 1ARSA 1BJ4A 1AY8A 2OKKA 3WGCA 4KAMA 1BT4A 1CZCA 2Z1YA 3QM2A 4W91A 3EUCA 4F5FA 3ASBA 3CBFA 2BI3A 2VMRA 4XQ2A 3H14A 3BC8A 2HOXA 3AV7A 3PD6A 3HBXA 1AIAA 1UU1A 3UE8A 3CQ4A 4WLHA 3TFUA 2VI9A 4CBSA 3HQTA 1CJ0A 5D5SA 5IWQA 3FKDA 2WK9A 4GE7A 1VEFA 1AMQA 1BQDA 1YIZA 3AEMC 4WYAA 3NYTA 4OCAA 2CJGA 1BQAA 5G4IA 2D5YA 4R8DA 4ATQA 4UHOA 3ZRQA 5DJ1A 1FC4A 3LY1A 5BJ4A 2AY2A 4IYOA 3A9YA 1BW0A 1I29A 2QBTA 4I8AA 3AEMA 4H51A 4P3MA 1SZUA 3E2ZB 4GE4A 2VMZA 3T32A 5FT4A 2OGEA 4LW4A 2JJEA 4XAUA 3GZDC 5F9SA 3MKJA 1IAXA 2CH2A 1AJSB 1IX6A 2NMPA 3M5UA 3N0LA 4ADBA 2C81A 4E1OA 3GJUA 2VGZA 3ELPA 4U2HA 5G2PA 5DJ9A 3FVXA 5KTBA 1AKAA 3GZDA 4GSAA 1IJIA 3L44A 3PJ0A 3ACZA 2EGYA 4K2BA 4H63Q 1C0NA 4ADEA 5M46A 1ASAA 3K40A 4FFCA 2DKJA 4DBCA 2HZPA 2CH1A 1LW4A 1MLZA 2W7FA 3BB8A 3CQ6A 5HHYA 4F5MA 1O61A 1OHWA 3NUIA 4GDYA 1KMKA 2AY3A 3B1EA 2FYFA 3B46A 4OYTA 3WX9A 3NX3A 1WYTB 1CQ7A 1W23A 3Q8NA 1ZOBA 4IXOA 3FRKA 4AH3A 1S06A 2CFBA 1QISA 1QZ9A 2O1BA 4IX8A 3ATHA 3RCHB 4WXFA 2ZUKA 2VIAA 1AKCA 4WYEA 4ZDLA 2VMSA 5EAAA 1TATA 2CSTA 1SPAA 1RVUA 2Z1ZA 4PFNA 4TMRA 2VMOA 3EI7A 5I92A 4WP0A 3WCNA 2YKYA 4MSOA 4A0HA 3BV0A 1AAMA 3NDNA 4AOAA 1M4NA 2AY1A 1RVYA 1B9IA 2QLRA 1GC2A 1AHYA 2VMWA 3VK3A 4JEXA 3FQ8A 1C4KA 3BWNC 4R5FA 1TOGA 4A0RA 3ISLA 1XI9A 2FM1A 4JEWA 4F4EA 2AY8A 3LVMA 3JZLA 2R5CB 1DKAA 4IXZA 4JEYA 4OBUA 1YOOA 2CB1A 4K05A 3QI6A 2OATA 4TV7A 1DFOA 4UHMA 1D7SA 1N2TA 1TOKA 3BWNA 3NYUA 4M2KA 4WYDA 3PDBB 2EZ1A 4R2NA 1LC5A 5G4JA 4BHDA 4RAEA 4RJYA 2CJHA 1TASA 4MY5A 1CZEA 1DJUA 4WB0A 4AZJA 1N31A 1I41A 1JS6A 3VK2A 2W7KA 1SVVA 2V0YA 1P3WA 2VMVA 1ZODA 3BCXA 1QITA 2PB2A 3F9TA 3WKSA 1G7XA 1TOJA 1TPLA 1WYUA 3GZCA 3FZ6A 4R5ZA 4U1TA 5JAYA 2ZY2A 3FD0A 1X29A 2JGTA 2DOUA 1SZKA 2YRIA 2W7HA 1AMAA 2ZY3A 4W1VA 2EPJA 2VMPA 2Z9VA 2CANA 1WYVA 5EAVA 4A6TA 1TOIA 4F5JA 1TARA 1V2EA 2BIAA 2YKUA 3IF2A 3FSLA 3TFTA 2AEUA 1V2DA 2W7IA 1H1CA 3EI6A 4WYGA 1ASMA 2CINA 3FQAA 1ZC9A 1ASDA 4JE5D 2W8JA 3H7FA 2PB0A 1AHFA 3HMUA 3N75A 2DGKA 1BJWA 2CTZA 3FDDA 2V1PA 4XJLA 4JEVA 5D95A 4EU1A 2HOYA 1ASLA 1E5EA 2VGSA 2X3LA 1U08A 3AENA 3COGA 1IUGA 1AY4A 5G2QA 1FG7A 3UAKA 5M49A 4O6ZA 3A9XA 3DU4A 3QBOA 3WCOA 3DODA 1O4SA 2GSAA 1CL1A 1AX4A 3PD6B 3FZ8A 1EJIA 3TATA 1RV4A 4M2JA 4J5UA 2R2NA 5TF5A 4LNJA 5FT6A 1OXOA 3KGWA 1YJSA 2E54A 4F5LA 3E6GA 3N4SA 1ELQA 2BI2A 5DX5A 1ASBA 2ZY4A 2D64A 3EI9A 2F8JA 1W3UA 2YRRA 4OTLA 3KE3A 4M2MA 3ASAA 3R4TA 1MDOA 2VIBA 4RKDA 1FG3A 2ZY5A 4IYOB 4MQQA 4B98A 1G4VA 1S09A 4N0WA 3GETA 3FVSA 1YJYA 3A9ZA 3BS8A 5E3KA 1BS0A 4F5IA 1H0CA 4EMYA 1GC4A 4ZASA 5M4DA 1EQBA 1QIRA 5E5IA 2VMYA 4KYOA 3UWCA 3E9KA 4RKCA 4CBRA 1OHVA 2VGUA 1I48A 2VMNA 2Q7WA 1RV3A 1J32A 3I5TA 1ARGA 3HLMA 3FDBA 4K2IA 4BMKA 3FZ7A 1JG8A 2VGTA 3MC6C 3I16A 1MLYA 3ZRRA 2AATA 3D6KA 1PMMA 2WKAA 4GEBA 2C7TA 2HOZA 4F5GA 2W8WA 1AHEA 3PPLA 1WSTA 1M0PA 8AATA 2KFPA 3P6KA 1KKPA 4L0OA 2E7IA 5K8BA 1QGNA 2YCTA 3PAAA 5EIGA 5LHAA 4ZLVA 5DB5A 1B5PA 2YCNA 1IVRA 2ZYJA 2VMQA 3AELA 1ECXA 1QJ3A 4ZAHA 4GRXA 4ITGA 4PIWA 1CQ8A 1YIYA 1V2FA 2WK8A 2D7YA 1ARTA 1S0AA 4XEWA 3VOMA 1W7MA 4EB7A 4W5KA 4BA5A 1YJZA 2W7DA 1M0OA 3F0HA 3GBXA 3H9XA 4JEZA 5G0AA 1ASNA 3ECDA 1AICA 3NU8A 4A6UA 1ORDA 3NRAA 3QHXA 3A2BA 2R5EA 4IXSA 1AMSA 2D63A 4AO4A 3BCAA 1ELUA 2JJFA 2ZC0A 3MEBA 5F8VA 3LG0A 4HF8A 3RBFA 3VAXA 2W7MA 3AOWA 4LC3A 1AHGA 1GD9A 2FQ6A 3K7YA 3PDXA 1O69A 3E77A 4XJOA 1BKGA 1T3IA 2R0TA 3QGUA 3WY7A 3WKRA 3HT4A 4BA4A 2FKIA 1DTYA 4ISYA 1B4XA 1S08A 4OMAA 2QMAA 4WB0B 1GC3A 1D7RA 1GEWA 2BYLA 4IW7A 3ZZJA 1KKJA 1KAFA 1UKJA 3ZZKA 5BJ3A 4E3QA 4F5KA 7AATA 4ZSYA 1KL1A 4DGTA 4EB5A 3PDBA 2PO3A 1IBJA 1WYUB 3OKSA 1ASCA 1B5OA 1W7LA 3QPGA 4ZWMA 3TCMA 4J8LA 1MGVA 2TPLA 3GWPA 3JW9A 2FN6A 3W1IA 3B1DA 4GE9A 2VI8A 1W7NA 4ADDA 1M32A 4LNLA 4ZDPA 1M7YA 2AEVA 3E2FA 3G0TA 2C0RA 3B1CA 4ITXA 1WYVB 1C7NA 1G7WA 2VLFA 3JTXA 4WLJA 4ADCA 3NNKA 1GC0A 1PMOA 3R9AA 1KL2A 2GQNA 2Z67A 3EI8A 3PGYA 1SFFA 4A72A 4EFFA 2VLHA 2DKBA 1GCKA 2HP1A 1D7VA 4WXGA 1SF2A 3MAUA 1ASFA 1MAQA 2O0RA 3TQXA 5EUEA 3QN6A 2EYQA 1I43A 1DGDA 1BJOA 1WKGA 1PFFA 2BHXA 4XJPA 1AMRA 3EZSA 2AY5A 4W1XA 3PIUA 1CS1A 2BI5A 3MAFA 1XEYA 5FT8A 4XK1A 3RBLA 4CVQA 2JG2A 3AENB 1M6SA 3JU7A 3DC1A 3AOVA 3NU7A 1B9HA 5G09A 1B8GA 3ELEA 1E5FA 2QB3A 1D7UA 4NOGA 4MKJA 1DJ9A 2X8UA 3JWAA 4RM1A 4MQPA 3HL2A 2D61A 4P7YA 2WB6A 5AX8A 2QA3A 3BCBA 4N0BA 3USFA 5J8QA 3MBBA 2G6WA 3EIAA 2YOBA 2W7JA 4LNMA 2DR1A 2ZP7A 3IHJA 4B9BA 2YHKA 2E7UA 2DGLA 3DR4A 4A0FA 4E3RA 4ZWVA 1LKCA 1KMJA 2Z61A 1VP4A 3DR7A 4ZM3A 3DXVA 3NUBA 2W7LA 5EUNA 1GDEA 2E7JA 3EI5A 2Z9UA 3FQ7A 1M0QA 2VGWA 3A8UX 4MQRA 4PVFA 4W8IA 2A1VA 2BWPA 3LWSA 4XJMA 5EQCA 3JWBA 4F5HA 2RFVA 3RI6A 2X5FA 4OBVA 4DQ6A 2YKXA 3E2ZA 4LW2A 2YCPA 5M4BA 1O62A 3PA9A 3BWOA 2G7JA 1AY5A 5FT5A 4E77A 3II0A 4WYCA 3AEJC 2D66A 1AJSA 1EG5A 1Y4IA 2XH1A 4Q75A 4Y0IA 3N5MA 2XBNA 3FFHA 2ORDA 4UOYA 3RUYA 3N4XA 2W8UA 4W1WA 1AJRA 3I4JA 3LV2A 4ATPA 1D2FA 2AY9A 2EO5A 1N8PA 1TOEA 3BN1A 2EH6A 3CQ5A 3DRDA 2QSRA 1Z7DA 4WYFA 3AEJA 5EFSA 2EZ2A 4RLGA 3MC6A 4A6RA 3WGBA 3F6TA 1ASGA 1LS3A 1MDZA 1X2AA 5HXXA 5LH9A 2CJDA 1LK9A 1G4XA 3B8XA 3GSBA 4MKKA 1C9CA 1CL2A 1V72A 2Z9XA 4WXBA 5EIGB 2O7CA 3HVYA 4A0GA 1C7OA 3CAIA 1Z3ZA 2X5DA 1GEXA 2ZSLA 3P1TA 3HDOA 4AO9A 3FCRA 1MDXA 1LC8A 3VK4A 3MADA 1WYTA 4QGRA 1IX8A 4RIZA 2WK7A 3FFRA 3RCHA 1AAWA 1QJ5A 3FVUA 3N7NA 3DYDA 2D7ZA 4HVKA 1JF9A 1LW5A 2HUUA 3W1JA 4CXRA 1IAYA 4WBTA 4ZSWA 4CXQA
chains in the Genus database with same CATH topology
4WD2A 2JJGA 1ARIA 2FNIA 2GMUA 1GEYA 2HUIA 2QB2A 5EUDA 2ZSMA 2W7EA 4ZDOA 4BQ0A 3FTBA 3VP6A 4Q31A 1SZSA 3WLXA 5E4ZA 2VMXA 1JS3A 4UHNA 4AZKA 2VMTA 4K2MA 3LVLB 2AY7A 2R5CA 1PG8A 3AEOA 3LVKA 3RQ1A 4JF0A 2DGMA 2AY4A 2BKWA 3EIBA 1OATA 4TN4A 2HUFA 1VJOA 4JF1A 2Z9WA 1S07A 3LVJA 2VYCA 3N4RA 1OXPA 3NYSA 5HDMA 4Q6RA 2OGAA 2C44A 3DZZA 2BIGA 2W7GA 2FNUA 2ZJGA 3L8AA 1AHXA 2VGVA 1UU0A 5C6UA 4OT8A 4KXKA 3W1HA 3AEPA 3K28A 3KKIA 3OP7A 4UQVA 2YKVA 4PFFA 2GMSA 2AY6A 4Y0DA 1YNUA 4Q76A 1GBNA 3ZRPA 3G7QA 3KGXA 2JJHA 1M0NA 3GR9A 3E2YA 1J04A 1LC7A 2HP2A 2OKJA 4RJ0A 1BJNA 2W8VA 1X28A 2BI9A 2BYJA 1OHYA 1AKBA 2OQXA 2VMUA 2Z20A 3DXWA 1UU2A 2GB3A 3EZ1A 4Y0HA 4A00A 1MAPA 1C7GA 1WKHA 1CQ6A 2CY8A 3AATA 4IY7A 1DJEA 2BWNA 4RITA 1BJOB 1ASEA 1X0MA 2HORA 2JISA 4OC9A 3WZFA 1DGEA 3NTJA 4ZM4A 1ARHA 1AIBA 3G8MA 4FL0A 3MAFB 9AATA 1YAAA 2BWOA 2W8TA 4JE5A 4MGRA 1IX7A 2BI1A 2D65A 2BIEA 1ARSA 1BJ4A 1AY8A 2OKKA 3WGCA 4KAMA 1BT4A 1CZCA 2Z1YA 3QM2A 4W91A 3EUCA 4F5FA 3ASBA 3CBFA 2BI3A 2VMRA 4XQ2A 3H14A 3BC8A 2HOXA 3AV7A 3PD6A 3HBXA 1AIAA 1UU1A 3UE8A 3CQ4A 4WLHA 3TFUA 2VI9A 4CBSA 3HQTA 1CJ0A 5D5SA 5IWQA 3FKDA 2WK9A 4GE7A 1VEFA 1AMQA 1BQDA 1YIZA 3AEMC 4WYAA 3NYTA 4OCAA 2CJGA 1BQAA 5G4IA 2D5YA 4R8DA 4ATQA 4UHOA 3ZRQA 5DJ1A 1FC4A 3LY1A 5BJ4A 2AY2A 4IYOA 3A9YA 1BW0A 1I29A 2QBTA 4I8AA 3AEMA 4H51A 4P3MA 1SZUA 3E2ZB 4GE4A 2VMZA 3T32A 5FT4A 2OGEA 4LW4A 2JJEA 4XAUA 3GZDC 5F9SA 3MKJA 1IAXA 2CH2A 1AJSB 1IX6A 2NMPA 3M5UA 3N0LA 4ADBA 2C81A 4E1OA 3GJUA 2VGZA 3ELPA 4U2HA 5G2PA 5DJ9A 3FVXA 5KTBA 1AKAA 3GZDA 4GSAA 1IJIA 3L44A 3PJ0A 3ACZA 2EGYA 4K2BA 4H63Q 1C0NA 4ADEA 5M46A 1ASAA 3K40A 4FFCA 2DKJA 4DBCA 2HZPA 2CH1A 1LW4A 1MLZA 2W7FA 3BB8A 3CQ6A 5HHYA 4F5MA 1O61A 1OHWA 3NUIA 4GDYA 1KMKA 2AY3A 3B1EA 2FYFA 3B46A 4OYTA 3WX9A 3NX3A 1WYTB 1CQ7A 1W23A 3Q8NA 1ZOBA 4IXOA 3FRKA 4AH3A 1S06A 2CFBA 1QISA 1QZ9A 2O1BA 4IX8A 3ATHA 3RCHB 4WXFA 2ZUKA 2VIAA 1AKCA 4WYEA 4ZDLA 2VMSA 5EAAA 1TATA 2CSTA 1SPAA 1RVUA 2Z1ZA 4PFNA 4TMRA 2VMOA 3EI7A 5I92A 4WP0A 3WCNA 2YKYA 4MSOA 4A0HA 3BV0A 1AAMA 3NDNA 4AOAA 1M4NA 2AY1A 1RVYA 1B9IA 2QLRA 1GC2A 1AHYA 2VMWA 3VK3A 4JEXA 3FQ8A 1C4KA 3BWNC 4R5FA 1TOGA 4A0RA 3ISLA 1XI9A 2FM1A 4JEWA 4F4EA 2AY8A 3LVMA 3JZLA 2R5CB 1DKAA 4IXZA 4JEYA 4OBUA 1YOOA 2CB1A 4K05A 3QI6A 2OATA 4TV7A 1DFOA 4UHMA 1D7SA 1N2TA 1TOKA 3BWNA 3NYUA 4M2KA 4WYDA 3PDBB 2EZ1A 4R2NA 1LC5A 5G4JA 4BHDA 4RAEA 4RJYA 2CJHA 1TASA 4MY5A 1CZEA 1DJUA 4WB0A 4AZJA 1N31A 1I41A 1JS6A 3VK2A 2W7KA 1SVVA 2V0YA 1P3WA 2VMVA 1ZODA 3BCXA 1QITA 2PB2A 3F9TA 3WKSA 1G7XA 1TOJA 1TPLA 1WYUA 3GZCA 3FZ6A 4R5ZA 4U1TA 5JAYA 2ZY2A 3FD0A 1X29A 2JGTA 2DOUA 1SZKA 2YRIA 2W7HA 1AMAA 2ZY3A 4W1VA 2EPJA 2VMPA 2Z9VA 2CANA 1WYVA 5EAVA 4A6TA 1TOIA 4F5JA 1TARA 1V2EA 2BIAA 2YKUA 3IF2A 3FSLA 3TFTA 2AEUA 1V2DA 2W7IA 1H1CA 3EI6A 4WYGA 1ASMA 2CINA 3FQAA 1ZC9A 1ASDA 4JE5D 2W8JA 3H7FA 2PB0A 1AHFA 3HMUA 3N75A 2DGKA 1BJWA 2CTZA 3FDDA 2V1PA 4XJLA 4JEVA 5D95A 4EU1A 2HOYA 1ASLA 1E5EA 2VGSA 2X3LA 1U08A 3AENA 3COGA 1IUGA 1AY4A 5G2QA 1FG7A 3UAKA 5M49A 4O6ZA 3A9XA 3DU4A 3QBOA 3WCOA 3DODA 1O4SA 2GSAA 1CL1A 1AX4A 3PD6B 3FZ8A 1EJIA 3TATA 1RV4A 4M2JA 4J5UA 2R2NA 5TF5A 4LNJA 5FT6A 1OXOA 3KGWA 1YJSA 2E54A 4F5LA 3E6GA 3N4SA 1ELQA 2BI2A 5DX5A 1ASBA 2ZY4A 2D64A 3EI9A 2F8JA 1W3UA 2YRRA 4OTLA 3KE3A 4M2MA 3ASAA 3R4TA 1MDOA 2VIBA 4RKDA 1FG3A 2ZY5A 4IYOB 4MQQA 4B98A 1G4VA 1S09A 4N0WA 3GETA 3FVSA 1YJYA 3A9ZA 3BS8A 5E3KA 1BS0A 4F5IA 1H0CA 4EMYA 1GC4A 4ZASA 5M4DA 1EQBA 1QIRA 5E5IA 2VMYA 4KYOA 3UWCA 3E9KA 4RKCA 4CBRA 1OHVA 2VGUA 1I48A 2VMNA 2Q7WA 1RV3A 1J32A 3I5TA 1ARGA 3HLMA 3FDBA 4K2IA 4BMKA 3FZ7A 1JG8A 2VGTA 3MC6C 3I16A 1MLYA 3ZRRA 2AATA 3D6KA 1PMMA 2WKAA 4GEBA 2C7TA 2HOZA 4F5GA 2W8WA 1AHEA 3PPLA 1WSTA 1M0PA 8AATA 2KFPA 3P6KA 1KKPA 4L0OA 2E7IA 5K8BA 1QGNA 2YCTA 3PAAA 5EIGA 5LHAA 4ZLVA 5DB5A 1B5PA 2YCNA 1IVRA 2ZYJA 2VMQA 3AELA 1ECXA 1QJ3A 4ZAHA 4GRXA 4ITGA 4PIWA 1CQ8A 1YIYA 1V2FA 2WK8A 2D7YA 1ARTA 1S0AA 4XEWA 3VOMA 1W7MA 4EB7A 4W5KA 4BA5A 1YJZA 2W7DA 1M0OA 3F0HA 3GBXA 3H9XA 4JEZA 5G0AA 1ASNA 3ECDA 1AICA 3NU8A 4A6UA 1ORDA 3NRAA 3QHXA 3A2BA 2R5EA 4IXSA 1AMSA 2D63A 4AO4A 3BCAA 1ELUA 2JJFA 2ZC0A 3MEBA 5F8VA 3LG0A 4HF8A 3RBFA 3VAXA 2W7MA 3AOWA 4LC3A 1AHGA 1GD9A 2FQ6A 3K7YA 3PDXA 1O69A 3E77A 4XJOA 1BKGA 1T3IA 2R0TA 3QGUA 3WY7A 3WKRA 3HT4A 4BA4A 2FKIA 1DTYA 4ISYA 1B4XA 1S08A 4OMAA 2QMAA 4WB0B 1GC3A 1D7RA 1GEWA 2BYLA 4IW7A 3ZZJA 1KKJA 1UKJA 3ZZKA 5BJ3A 4E3QA 4F5KA 7AATA 4ZSYA 1KL1A 4DGTA 4EB5A 3PDBA 2PO3A 1IBJA 1WYUB 3OKSA 1ASCA 1B5OA 1W7LA 3QPGA 4ZWMA 3TCMA 4J8LA 1MGVA 2TPLA 3GWPA 3JW9A 2FN6A 3W1IA 3B1DA 4GE9A 2VI8A 1W7NA 4ADDA 1M32A 4LNLA 4ZDPA 1M7YA 2AEVA 3E2FA 3G0TA 2C0RA 3B1CA 4ITXA 1WYVB 1C7NA 1G7WA 2VLFA 3JTXA 4WLJA 4ADCA 3NNKA 1GC0A 1PMOA 3R9AA 1KL2A 2GQNA 2Z67A 3EI8A 3PGYA 1SFFA 4A72A 4EFFA 2VLHA 2DKBA 1GCKA 2HP1A 1D7VA 4WXGA 1SF2A 3MAUA 1ASFA 1MAQA 2O0RA 3TQXA 5EUEA 3QN6A 2EYQA 1I43A 1DGDA 1BJOA 1WKGA 1PFFA 2BHXA 4XJPA 1AMRA 3EZSA 2AY5A 4W1XA 3PIUA 1CS1A 2BI5A 3MAFA 1XEYA 5FT8A 4XK1A 3RBLA 4CVQA 2JG2A 3AENB 1M6SA 3JU7A 3DC1A 3AOVA 3NU7A 1B9HA 5G09A 1B8GA 3ELEA 1E5FA 2QB3A 1D7UA 4NOGA 4MKJA 1DJ9A 2X8UA 3JWAA 4RM1A 4MQPA 3HL2A 2D61A 4P7YA 2WB6A 5AX8A 2QA3A 3BCBA 4N0BA 3USFA 5J8QA 3MBBA 2G6WA 3EIAA 2YOBA 2W7JA 4LNMA 2DR1A 2ZP7A 3IHJA 4B9BA 2YHKA 2E7UA 2DGLA 3DR4A 4A0FA 4E3RA 4ZWVA 1LKCA 1KMJA 2Z61A 1VP4A 3DR7A 4ZM3A 3DXVA 3NUBA 2W7LA 5EUNA 1GDEA 2E7JA 3EI5A 2Z9UA 3FQ7A 1M0QA 2VGWA 3A8UX 4MQRA 4PVFA 4W8IA 2A1VA 2BWPA 3LWSA 4XJMA 5EQCA 3JWBA 4F5HA 2RFVA 3RI6A 2X5FA 4OBVA 4DQ6A 2YKXA 3E2ZA 4LW2A 2YCPA 5M4BA 1O62A 3PA9A 3BWOA 2G7JA 1AY5A 5FT5A 4E77A 3II0A 4WYCA 3AEJC 2D66A 1AJSA 1EG5A 1Y4IA 2XH1A 4Q75A 4Y0IA 3N5MA 2XBNA 3FFHA 2ORDA 4UOYA 3RUYA 3N4XA 2W8UA 4W1WA 1AJRA 3I4JA 3LV2A 4ATPA 1D2FA 2AY9A 2EO5A 1N8PA 1TOEA 3BN1A 2EH6A 3CQ5A 3DRDA 2QSRA 1Z7DA 4WYFA 3AEJA 5EFSA 2EZ2A 4RLGA 3MC6A 4A6RA 3WGBA 3F6TA 1ASGA 1LS3A 1MDZA 1X2AA 5HXXA 5LH9A 2CJDA 1LK9A 1G4XA 3B8XA 3GSBA 4MKKA 1C9CA 1CL2A 1V72A 2Z9XA 4WXBA 5EIGB 2O7CA 3HVYA 4A0GA 1C7OA 3CAIA 1Z3ZA 2X5DA 1GEXA 2ZSLA 3P1TA 3HDOA 4AO9A 3FCRA 1MDXA 1LC8A 3VK4A 3MADA 1WYTA 4QGRA 1IX8A 4RIZA 2WK7A 3FFRA 3RCHA 1AAWA 1QJ5A 3FVUA 3N7NA 3DYDA 2D7ZA 4HVKA 1JF9A 1LW5A 2HUUA 3W1JA 4CXRA 1IAYA 4WBTA 4ZSWA 4CXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WD2 A;  2JJG A;  1ARI A;  2FNI A;  2GMU A;  1GEY A;  2HUI A;  2QB2 A;  5EUD A;  2ZSM A;  2W7E A;  4ZDO A;  4BQ0 A;  3FTB A;  3VP6 A;  4Q31 A;  1SZS A;  3WLX A;  5E4Z A;  2VMX A;  1JS3 A;  4UHN A;  4AZK A;  2VMT A;  4K2M A;  3LVL B;  2AY7 A;  2R5C A;  1PG8 A;  3AEO A;  3LVK A;  3RQ1 A;  4JF0 A;  2DGM A;  2AY4 A;  2BKW A;  3EIB A;  1OAT A;  4TN4 A;  2HUF A;  1VJO A;  4JF1 A;  2Z9W A;  1S07 A;  3LVJ A;  2VYC A;  1OXP A;  3NYS A;  5HDM A;  4Q6R A;  2OGA A;  2C44 A;  3DZZ A;  2BIG A;  2W7G A;  2FNU A;  2ZJG A;  3L8A A;  1AHX A;  2VGV A;  1UU0 A;  5C6U A;  4OT8 A;  4KXK A;  3W1H A;  3AEP A;  3K28 A;  3KKI A;  3OP7 A;  4UQV A;  2YKV A;  4PFF A;  2GMS A;  2AY6 A;  4Y0D A;  1YNU A;  4Q76 A;  1GBN A;  3ZRP A;  3G7Q A;  3KGX A;  2JJH A;  1M0N A;  3GR9 A;  3E2Y A;  1J04 A;  1LC7 A;  2HP2 A;  2OKJ A;  4RJ0 A;  1BJN A;  2W8V A;  1X28 A;  2BI9 A;  2BYJ A;  1OHY A;  1AKB A;  2OQX A;  2VMU A;  2Z20 A;  3DXW A;  1UU2 A;  2GB3 A;  3EZ1 A;  4Y0H A;  4A00 A;  1MAP A;  1C7G A;  1WKH A;  1CQ6 A;  2CY8 A;  3AAT A;  4IY7 A;  1DJE A;  2BWN A;  4RIT A;  1BJO B;  1ASE A;  1X0M A;  2HOR A;  2JIS A;  4OC9 A;  3WZF A;  1DGE A;  3NTJ A;  4ZM4 A;  1ARH A;  1AIB A;  3G8M A;  4FL0 A;  3MAF B;  9AAT A;  1YAA A;  2BWO A;  2W8T A;  4JE5 A;  4MGR A;  1IX7 A;  2BI1 A;  2D65 A;  2BIE A;  1ARS A;  1BJ4 A;  1AY8 A;  2OKK A;  3WGC A;  4KAM A;  1BT4 A;  1CZC A;  2Z1Y A;  3QM2 A;  4W91 A;  3EUC A;  4F5F A;  3ASB A;  3CBF A;  2BI3 A;  2VMR A;  4XQ2 A;  3H14 A;  3BC8 A;  2HOX A;  3AV7 A;  3PD6 A;  3HBX A;  1AIA A;  1UU1 A;  3UE8 A;  3CQ4 A;  4WLH A;  3TFU A;  2VI9 A;  4CBS A;  3HQT A;  1CJ0 A;  5D5S A;  5IWQ A;  3FKD A;  2WK9 A;  4GE7 A;  1VEF A;  1AMQ A;  1BQD A;  1YIZ A;  3AEM C;  4WYA A;  3NYT A;  4OCA A;  2CJG A;  1BQA A;  5G4I A;  2D5Y A;  4R8D A;  4ATQ A;  4UHO A;  3ZRQ A;  5DJ1 A;  1FC4 A;  3LY1 A;  5BJ4 A;  2AY2 A;  4IYO A;  3A9Y A;  1BW0 A;  1I29 A;  2QBT A;  4I8A A;  3AEM A;  4H51 A;  4P3M A;  1SZU A;  3E2Z B;  4GE4 A;  2VMZ A;  3T32 A;  5FT4 A;  2OGE A;  4LW4 A;  2JJE A;  4XAU A;  3GZD C;  5F9S A;  3MKJ A;  1IAX A;  2CH2 A;  1AJS B;  1IX6 A;  2NMP A;  3M5U A;  3N0L A;  4ADB A;  2C81 A;  4E1O A;  3GJU A;  2VGZ A;  3ELP A;  4U2H A;  5G2P A;  5DJ9 A;  3FVX A;  1AKA A;  3GZD A;  4GSA A;  1IJI A;  3L44 A;  3PJ0 A;  3ACZ A;  2EGY A;  4K2B A;  1C0N A;  4ADE A;  5M46 A;  1ASA A;  3K40 A;  4FFC A;  2DKJ A;  4DBC A;  2HZP A;  2CH1 A;  1LW4 A;  1MLZ A;  2W7F A;  3BB8 A;  3CQ6 A;  5HHY A;  4F5M A;  1O61 A;  1OHW A;  3NUI A;  4GDY A;  1KMK A;  2AY3 A;  3B1E A;  2FYF A;  3B46 A;  4OYT A;  3WX9 A;  3NX3 A;  1WYT B;  1CQ7 A;  1W23 A;  3Q8N A;  1ZOB A;  4IXO A;  3FRK A;  4AH3 A;  1S06 A;  2CFB A;  1QIS A;  1QZ9 A;  2O1B A;  4IX8 A;  3ATH A;  3RCH B;  4WXF A;  2ZUK A;  2VIA A;  1AKC A;  4WYE A;  4ZDL A;  2VMS A;  5EAA A;  1TAT A;  2CST A;  1SPA A;  1RVU A;  2Z1Z A;  4PFN A;  4TMR A;  2VMO A;  3EI7 A;  5I92 A;  4WP0 A;  3WCN A;  2YKY A;  4MSO A;  4A0H A;  3BV0 A;  1AAM A;  3NDN A;  4AOA A;  1M4N A;  2AY1 A;  1RVY A;  1B9I A;  2QLR A;  1GC2 A;  1AHY A;  2VMW A;  3VK3 A;  4JEX A;  3FQ8 A;  1C4K A;  3BWN C;  4R5F A;  1TOG A;  4A0R A;  3ISL A;  1XI9 A;  2FM1 A;  4JEW A;  4F4E A;  2AY8 A;  3LVM A;  3JZL A;  2R5C B;  1DKA A;  4IXZ A;  4JEY A;  4OBU A;  1YOO A;  2CB1 A;  3QI6 A;  2OAT A;  4TV7 A;  1DFO A;  4UHM A;  1D7S A;  1N2T A;  1TOK A;  3BWN A;  3NYU A;  4M2K A;  4WYD A;  3PDB B;  2EZ1 A;  4R2N A;  1LC5 A;  5G4J A;  4BHD A;  4RAE A;  4RJY A;  2CJH A;  1TAS A;  4MY5 A;  1CZE A;  1DJU A;  4WB0 A;  4AZJ A;  1N31 A;  1I41 A;  1JS6 A;  3VK2 A;  2W7K A;  1SVV A;  2V0Y A;  1P3W A;  2VMV A;  1ZOD A;  3BCX A;  1QIT A;  2PB2 A;  3F9T A;  3WKS A;  1G7X A;  1TOJ A;  1TPL A;  1WYU A;  3GZC A;  3FZ6 A;  4R5Z A;  4U1T A;  5JAY A;  2ZY2 A;  3FD0 A;  1X29 A;  2JGT A;  2DOU A;  1SZK A;  2YRI A;  2W7H A;  1AMA A;  2ZY3 A;  4W1V A;  2EPJ A;  2VMP A;  2Z9V A;  2CAN A;  1WYV A;  5EAV A;  4A6T A;  1TOI A;  4F5J A;  1TAR A;  1V2E A;  2BIA A;  2YKU A;  3IF2 A;  3FSL A;  3TFT A;  2AEU A;  1V2D A;  2W7I A;  1H1C A;  3EI6 A;  4WYG A;  1ASM A;  2CIN A;  3FQA A;  1ZC9 A;  1ASD A;  4JE5 D;  2W8J A;  3H7F A;  2PB0 A;  1AHF A;  3HMU A;  3N75 A;  2DGK A;  1BJW A;  2CTZ A;  3FDD A;  2V1P A;  4XJL A;  4JEV A;  5D95 A;  4EU1 A;  2HOY A;  1ASL A;  1E5E A;  2VGS A;  2X3L A;  1U08 A;  3AEN A;  3COG A;  1IUG A;  1AY4 A;  5G2Q A;  1FG7 A;  3UAK A;  5M49 A;  4O6Z A;  3A9X A;  3DU4 A;  3QBO A;  3WCO A;  3DOD A;  1O4S A;  2GSA A;  1CL1 A;  1AX4 A;  3PD6 B;  3FZ8 A;  1EJI A;  3TAT A;  1RV4 A;  4M2J A;  4J5U A;  2R2N A;  5TF5 A;  4LNJ A;  5FT6 A;  1OXO A;  3KGW A;  1YJS A;  2E54 A;  4F5L A;  3E6G A;  1ELQ A;  2BI2 A;  5DX5 A;  1ASB A;  2ZY4 A;  2D64 A;  3EI9 A;  2F8J A;  1W3U A;  2YRR A;  4OTL A;  3KE3 A;  4M2M A;  3ASA A;  3R4T A;  1MDO A;  2VIB A;  4RKD A;  1FG3 A;  2ZY5 A;  4IYO B;  4MQQ A;  4B98 A;  1G4V A;  1S09 A;  4N0W A;  3GET A;  3FVS A;  1YJY A;  3A9Z A;  3BS8 A;  5E3K A;  1BS0 A;  4F5I A;  1H0C A;  4EMY A;  1GC4 A;  4ZAS A;  5M4D A;  1EQB A;  1QIR A;  5E5I A;  2VMY A;  4KYO A;  3UWC A;  3E9K A;  4RKC A;  4CBR A;  1OHV A;  2VGU A;  1I48 A;  2VMN A;  2Q7W A;  1RV3 A;  1J32 A;  3I5T A;  1ARG A;  3HLM A;  3FDB A;  4K2I A;  4BMK A;  3FZ7 A;  1JG8 A;  2VGT A;  3MC6 C;  3I16 A;  1MLY A;  3ZRR A;  2AAT A;  3D6K A;  1PMM A;  2WKA A;  4GEB A;  2C7T A;  2HOZ A;  4F5G A;  2W8W A;  1AHE A;  3PPL A;  1WST A;  1M0P A;  8AAT A;  3P6K A;  1KKP A;  4L0O A;  2E7I A;  5K8B A;  1QGN A;  2YCT A;  3PAA A;  5EIG A;  5LHA A;  4ZLV A;  5DB5 A;  1B5P A;  2YCN A;  1IVR A;  2ZYJ A;  2VMQ A;  3AEL A;  1ECX A;  1QJ3 A;  4ZAH A;  4GRX A;  4ITG A;  4PIW A;  1CQ8 A;  1YIY A;  1V2F A;  2WK8 A;  2D7Y A;  1ART A;  1S0A A;  4XEW A;  3VOM A;  1W7M A;  4EB7 A;  4W5K A;  4BA5 A;  1YJZ A;  2W7D A;  1M0O A;  3F0H A;  3GBX A;  4JEZ A;  5G0A A;  1ASN A;  3ECD A;  1AIC A;  3NU8 A;  4A6U A;  1ORD A;  3NRA A;  3QHX A;  3A2B A;  2R5E A;  4IXS A;  1AMS A;  2D63 A;  4AO4 A;  3BCA A;  1ELU A;  2JJF A;  2ZC0 A;  3MEB A;  5F8V A;  3LG0 A;  4HF8 A;  3RBF A;  3VAX A;  2W7M A;  3AOW A;  4LC3 A;  1AHG A;  1GD9 A;  2FQ6 A;  3K7Y A;  3PDX A;  1O69 A;  3E77 A;  4XJO A;  1BKG A;  1T3I A;  2R0T A;  3QGU A;  3WY7 A;  3WKR A;  3HT4 A;  4BA4 A;  1DTY A;  4ISY A;  1B4X A;  1S08 A;  4OMA A;  2QMA A;  4WB0 B;  1GC3 A;  1D7R A;  1GEW A;  2BYL A;  4IW7 A;  3ZZJ A;  1KKJ A;  1UKJ A;  3ZZK A;  5BJ3 A;  4E3Q A;  4F5K A;  7AAT A;  4ZSY A;  1KL1 A;  4DGT A;  4EB5 A;  3PDB A;  2PO3 A;  1IBJ A;  1WYU B;  3OKS A;  1ASC A;  1B5O A;  1W7L A;  3QPG A;  4ZWM A;  3TCM A;  4J8L A;  1MGV A;  2TPL A;  3GWP A;  3JW9 A;  2FN6 A;  3W1I A;  3B1D A;  4GE9 A;  2VI8 A;  1W7N A;  4ADD A;  1M32 A;  4LNL A;  4ZDP A;  1M7Y A;  2AEV A;  3E2F A;  3G0T A;  2C0R A;  3B1C A;  4ITX A;  1WYV B;  1C7N A;  1G7W A;  2VLF A;  3JTX A;  4WLJ A;  4ADC A;  3NNK A;  1GC0 A;  1PMO A;  3R9A A;  1KL2 A;  2GQN A;  2Z67 A;  3EI8 A;  3PGY A;  1SFF A;  4A72 A;  4EFF A;  2VLH A;  2DKB A;  1GCK A;  2HP1 A;  1D7V A;  4WXG A;  1SF2 A;  3MAU A;  1ASF A;  1MAQ A;  2O0R A;  3TQX A;  5EUE A;  3QN6 A;  1I43 A;  1DGD A;  1BJO A;  1WKG A;  1PFF A;  2BHX A;  4XJP A;  1AMR A;  3EZS A;  2AY5 A;  4W1X A;  3PIU A;  1CS1 A;  2BI5 A;  3MAF A;  1XEY A;  5FT8 A;  4XK1 A;  3RBL A;  4CVQ A;  2JG2 A;  3AEN B;  1M6S A;  3JU7 A;  3DC1 A;  3AOV A;  3NU7 A;  1B9H A;  5G09 A;  1B8G A;  3ELE A;  1E5F A;  2QB3 A;  1D7U A;  4NOG A;  4MKJ A;  1DJ9 A;  2X8U A;  3JWA A;  4RM1 A;  4MQP A;  3HL2 A;  2D61 A;  4P7Y A;  5AX8 A;  2QA3 A;  3BCB A;  4N0B A;  3USF A;  5J8Q A;  3MBB A;  2G6W A;  3EIA A;  2YOB A;  2W7J A;  4LNM A;  2DR1 A;  2ZP7 A;  3IHJ A;  4B9B A;  2YHK A;  2E7U A;  2DGL A;  3DR4 A;  4A0F A;  4E3R A;  4ZWV A;  1LKC A;  1KMJ A;  2Z61 A;  1VP4 A;  3DR7 A;  4ZM3 A;  3DXV A;  3NUB A;  2W7L A;  5EUN A;  1GDE A;  2E7J A;  3EI5 A;  2Z9U A;  3FQ7 A;  1M0Q A;  2VGW A;  3A8U X;  4MQR A;  4PVF A;  4W8I A;  2BWP A;  3LWS A;  4XJM A;  5EQC A;  3JWB A;  4F5H A;  2RFV A;  3RI6 A;  2X5F A;  4OBV A;  4DQ6 A;  2YKX A;  3E2Z A;  4LW2 A;  2YCP A;  5M4B A;  1O62 A;  3PA9 A;  3BWO A;  1AY5 A;  5FT5 A;  4E77 A;  3II0 A;  4WYC A;  3AEJ C;  2D66 A;  1AJS A;  1EG5 A;  1Y4I A;  2XH1 A;  4Q75 A;  4Y0I A;  3N5M A;  2XBN A;  3FFH A;  2ORD A;  4UOY A;  3RUY A;  2W8U A;  4W1W A;  1AJR A;  3I4J A;  3LV2 A;  4ATP A;  1D2F A;  2AY9 A;  2EO5 A;  1N8P A;  1TOE A;  3BN1 A;  2EH6 A;  3CQ5 A;  3DRD A;  1Z7D A;  4WYF A;  3AEJ A;  5EFS A;  2EZ2 A;  4RLG A;  3MC6 A;  4A6R A;  3WGB A;  3F6T A;  1ASG A;  1LS3 A;  1MDZ A;  1X2A A;  5HXX A;  5LH9 A;  2CJD A;  1LK9 A;  1G4X A;  3B8X A;  3GSB A;  4MKK A;  1C9C A;  1CL2 A;  1V72 A;  2Z9X A;  4WXB A;  5EIG B;  2O7C A;  3HVY A;  4A0G A;  1C7O A;  3CAI A;  1Z3Z A;  2X5D A;  1GEX A;  2ZSL A;  3P1T A;  3HDO A;  4AO9 A;  3FCR A;  1MDX A;  1LC8 A;  3VK4 A;  3MAD A;  1WYT A;  4QGR A;  1IX8 A;  4RIZ A;  2WK7 A;  3FFR A;  3RCH A;  1AAW A;  1QJ5 A;  3FVU A;  3DYD A;  2D7Z A;  4HVK A;  1JF9 A;  1LW5 A;  2HUU A;  3W1J A;  4CXR A;  1IAY A;  4WBT A;  4ZSW A;  4CXQ A; 
#chains in the Genus database with same CATH topology
 4WD2 A;  2JJG A;  1ARI A;  2FNI A;  2GMU A;  1GEY A;  2HUI A;  2QB2 A;  5EUD A;  2ZSM A;  2W7E A;  4ZDO A;  4BQ0 A;  3FTB A;  3VP6 A;  4Q31 A;  1SZS A;  3WLX A;  5E4Z A;  2VMX A;  1JS3 A;  4UHN A;  4AZK A;  2VMT A;  4K2M A;  3LVL B;  2AY7 A;  2R5C A;  1PG8 A;  3AEO A;  3LVK A;  3RQ1 A;  4JF0 A;  2DGM A;  2AY4 A;  2BKW A;  3EIB A;  1OAT A;  4TN4 A;  2HUF A;  1VJO A;  4JF1 A;  2Z9W A;  1S07 A;  3LVJ A;  2VYC A;  3N4R A;  1OXP A;  3NYS A;  5HDM A;  4Q6R A;  2OGA A;  2C44 A;  3DZZ A;  2BIG A;  2W7G A;  2FNU A;  2ZJG A;  3L8A A;  1AHX A;  2VGV A;  1UU0 A;  5C6U A;  4OT8 A;  4KXK A;  3W1H A;  3AEP A;  3K28 A;  3KKI A;  3OP7 A;  4UQV A;  2YKV A;  4PFF A;  2GMS A;  2AY6 A;  4Y0D A;  1YNU A;  4Q76 A;  1GBN A;  3ZRP A;  3G7Q A;  3KGX A;  2JJH A;  1M0N A;  3GR9 A;  3E2Y A;  1J04 A;  1LC7 A;  2HP2 A;  2OKJ A;  4RJ0 A;  1BJN A;  2W8V A;  1X28 A;  2BI9 A;  2BYJ A;  1OHY A;  1AKB A;  2OQX A;  2VMU A;  2Z20 A;  3DXW A;  1UU2 A;  2GB3 A;  3EZ1 A;  4Y0H A;  4A00 A;  1MAP A;  1C7G A;  1WKH A;  1CQ6 A;  2CY8 A;  3AAT A;  4IY7 A;  1DJE A;  2BWN A;  4RIT A;  1BJO B;  1ASE A;  1X0M A;  2HOR A;  2JIS A;  4OC9 A;  3WZF A;  1DGE A;  3NTJ A;  4ZM4 A;  1ARH A;  1AIB A;  3G8M A;  4FL0 A;  3MAF B;  9AAT A;  1YAA A;  2BWO A;  2W8T A;  4JE5 A;  4MGR A;  1IX7 A;  2BI1 A;  2D65 A;  2BIE A;  1ARS A;  1BJ4 A;  1AY8 A;  2OKK A;  3WGC A;  4KAM A;  1BT4 A;  1CZC A;  2Z1Y A;  3QM2 A;  4W91 A;  3EUC A;  4F5F A;  3ASB A;  3CBF A;  2BI3 A;  2VMR A;  4XQ2 A;  3H14 A;  3BC8 A;  2HOX A;  3AV7 A;  3PD6 A;  3HBX A;  1AIA A;  1UU1 A;  3UE8 A;  3CQ4 A;  4WLH A;  3TFU A;  2VI9 A;  4CBS A;  3HQT A;  1CJ0 A;  5D5S A;  5IWQ A;  3FKD A;  2WK9 A;  4GE7 A;  1VEF A;  1AMQ A;  1BQD A;  1YIZ A;  3AEM C;  4WYA A;  3NYT A;  4OCA A;  2CJG A;  1BQA A;  5G4I A;  2D5Y A;  4R8D A;  4ATQ A;  4UHO A;  3ZRQ A;  5DJ1 A;  1FC4 A;  3LY1 A;  5BJ4 A;  2AY2 A;  4IYO A;  3A9Y A;  1BW0 A;  1I29 A;  2QBT A;  4I8A A;  3AEM A;  4H51 A;  4P3M A;  1SZU A;  3E2Z B;  4GE4 A;  2VMZ A;  3T32 A;  5FT4 A;  2OGE A;  4LW4 A;  2JJE A;  4XAU A;  3GZD C;  5F9S A;  3MKJ A;  1IAX A;  2CH2 A;  1AJS B;  1IX6 A;  2NMP A;  3M5U A;  3N0L A;  4ADB A;  2C81 A;  4E1O A;  3GJU A;  2VGZ A;  3ELP A;  4U2H A;  5G2P A;  5DJ9 A;  3FVX A;  5KTB A;  1AKA A;  3GZD A;  4GSA A;  1IJI A;  3L44 A;  3PJ0 A;  3ACZ A;  2EGY A;  4K2B A;  4H63 Q;  1C0N A;  4ADE A;  5M46 A;  1ASA A;  3K40 A;  4FFC A;  2DKJ A;  4DBC A;  2HZP A;  2CH1 A;  1LW4 A;  1MLZ A;  2W7F A;  3BB8 A;  3CQ6 A;  5HHY A;  4F5M A;  1O61 A;  1OHW A;  3NUI A;  4GDY A;  1KMK A;  2AY3 A;  3B1E A;  2FYF A;  3B46 A;  4OYT A;  3WX9 A;  3NX3 A;  1WYT B;  1CQ7 A;  1W23 A;  3Q8N A;  1ZOB A;  4IXO A;  3FRK A;  4AH3 A;  1S06 A;  2CFB A;  1QIS A;  1QZ9 A;  2O1B A;  4IX8 A;  3ATH A;  3RCH B;  4WXF A;  2ZUK A;  2VIA A;  1AKC A;  4WYE A;  4ZDL A;  2VMS A;  5EAA A;  1TAT A;  2CST A;  1SPA A;  1RVU A;  2Z1Z A;  4PFN A;  4TMR A;  2VMO A;  3EI7 A;  5I92 A;  4WP0 A;  3WCN A;  2YKY A;  4MSO A;  4A0H A;  3BV0 A;  1AAM A;  3NDN A;  4AOA A;  1M4N A;  2AY1 A;  1RVY A;  1B9I A;  2QLR A;  1GC2 A;  1AHY A;  2VMW A;  3VK3 A;  4JEX A;  3FQ8 A;  1C4K A;  3BWN C;  4R5F A;  1TOG A;  4A0R A;  3ISL A;  1XI9 A;  2FM1 A;  4JEW A;  4F4E A;  2AY8 A;  3LVM A;  3JZL A;  2R5C B;  1DKA A;  4IXZ A;  4JEY A;  4OBU A;  1YOO A;  2CB1 A;  4K05 A;  3QI6 A;  2OAT A;  4TV7 A;  1DFO A;  4UHM A;  1D7S A;  1N2T A;  1TOK A;  3BWN A;  3NYU A;  4M2K A;  4WYD A;  3PDB B;  2EZ1 A;  4R2N A;  1LC5 A;  5G4J A;  4BHD A;  4RAE A;  4RJY A;  2CJH A;  1TAS A;  4MY5 A;  1CZE A;  1DJU A;  4WB0 A;  4AZJ A;  1N31 A;  1I41 A;  1JS6 A;  3VK2 A;  2W7K A;  1SVV A;  2V0Y A;  1P3W A;  2VMV A;  1ZOD A;  3BCX A;  1QIT A;  2PB2 A;  3F9T A;  3WKS A;  1G7X A;  1TOJ A;  1TPL A;  1WYU A;  3GZC A;  3FZ6 A;  4R5Z A;  4U1T A;  5JAY A;  2ZY2 A;  3FD0 A;  1X29 A;  2JGT A;  2DOU A;  1SZK A;  2YRI A;  2W7H A;  1AMA A;  2ZY3 A;  4W1V A;  2EPJ A;  2VMP A;  2Z9V A;  2CAN A;  1WYV A;  5EAV A;  4A6T A;  1TOI A;  4F5J A;  1TAR A;  1V2E A;  2BIA A;  2YKU A;  3IF2 A;  3FSL A;  3TFT A;  2AEU A;  1V2D A;  2W7I A;  1H1C A;  3EI6 A;  4WYG A;  1ASM A;  2CIN A;  3FQA A;  1ZC9 A;  1ASD A;  4JE5 D;  2W8J A;  3H7F A;  2PB0 A;  1AHF A;  3HMU A;  3N75 A;  2DGK A;  1BJW A;  2CTZ A;  3FDD A;  2V1P A;  4XJL A;  4JEV A;  5D95 A;  4EU1 A;  2HOY A;  1ASL A;  1E5E A;  2VGS A;  2X3L A;  1U08 A;  3AEN A;  3COG A;  1IUG A;  1AY4 A;  5G2Q A;  1FG7 A;  3UAK A;  5M49 A;  4O6Z A;  3A9X A;  3DU4 A;  3QBO A;  3WCO A;  3DOD A;  1O4S A;  2GSA A;  1CL1 A;  1AX4 A;  3PD6 B;  3FZ8 A;  1EJI A;  3TAT A;  1RV4 A;  4M2J A;  4J5U A;  2R2N A;  5TF5 A;  4LNJ A;  5FT6 A;  1OXO A;  3KGW A;  1YJS A;  2E54 A;  4F5L A;  3E6G A;  3N4S A;  1ELQ A;  2BI2 A;  5DX5 A;  1ASB A;  2ZY4 A;  2D64 A;  3EI9 A;  2F8J A;  1W3U A;  2YRR A;  4OTL A;  3KE3 A;  4M2M A;  3ASA A;  3R4T A;  1MDO A;  2VIB A;  4RKD A;  1FG3 A;  2ZY5 A;  4IYO B;  4MQQ A;  4B98 A;  1G4V A;  1S09 A;  4N0W A;  3GET A;  3FVS A;  1YJY A;  3A9Z A;  3BS8 A;  5E3K A;  1BS0 A;  4F5I A;  1H0C A;  4EMY A;  1GC4 A;  4ZAS A;  5M4D A;  1EQB A;  1QIR A;  5E5I A;  2VMY A;  4KYO A;  3UWC A;  3E9K A;  4RKC A;  4CBR A;  1OHV A;  2VGU A;  1I48 A;  2VMN A;  2Q7W A;  1RV3 A;  1J32 A;  3I5T A;  1ARG A;  3HLM A;  3FDB A;  4K2I A;  4BMK A;  3FZ7 A;  1JG8 A;  2VGT A;  3MC6 C;  3I16 A;  1MLY A;  3ZRR A;  2AAT A;  3D6K A;  1PMM A;  2WKA A;  4GEB A;  2C7T A;  2HOZ A;  4F5G A;  2W8W A;  1AHE A;  3PPL A;  1WST A;  1M0P A;  8AAT A;  2KFP A;  3P6K A;  1KKP A;  4L0O A;  2E7I A;  5K8B A;  1QGN A;  2YCT A;  3PAA A;  5EIG A;  5LHA A;  4ZLV A;  5DB5 A;  1B5P A;  2YCN A;  1IVR A;  2ZYJ A;  2VMQ A;  3AEL A;  1ECX A;  1QJ3 A;  4ZAH A;  4GRX A;  4ITG A;  4PIW A;  1CQ8 A;  1YIY A;  1V2F A;  2WK8 A;  2D7Y A;  1ART A;  1S0A A;  4XEW A;  3VOM A;  1W7M A;  4EB7 A;  4W5K A;  4BA5 A;  1YJZ A;  2W7D A;  1M0O A;  3F0H A;  3GBX A;  3H9X A;  4JEZ A;  5G0A A;  1ASN A;  3ECD A;  1AIC A;  3NU8 A;  4A6U A;  1ORD A;  3NRA A;  3QHX A;  3A2B A;  2R5E A;  4IXS A;  1AMS A;  2D63 A;  4AO4 A;  3BCA A;  1ELU A;  2JJF A;  2ZC0 A;  3MEB A;  5F8V A;  3LG0 A;  4HF8 A;  3RBF A;  3VAX A;  2W7M A;  3AOW A;  4LC3 A;  1AHG A;  1GD9 A;  2FQ6 A;  3K7Y A;  3PDX A;  1O69 A;  3E77 A;  4XJO A;  1BKG A;  1T3I A;  2R0T A;  3QGU A;  3WY7 A;  3WKR A;  3HT4 A;  4BA4 A;  2FKI A;  1DTY A;  4ISY A;  1B4X A;  1S08 A;  4OMA A;  2QMA A;  4WB0 B;  1GC3 A;  1D7R A;  1GEW A;  2BYL A;  4IW7 A;  3ZZJ A;  1KKJ A;  1KAF A;  1UKJ A;  3ZZK A;  5BJ3 A;  4E3Q A;  4F5K A;  7AAT A;  4ZSY A;  1KL1 A;  4DGT A;  4EB5 A;  3PDB A;  2PO3 A;  1IBJ A;  1WYU B;  3OKS A;  1ASC A;  1B5O A;  1W7L A;  3QPG A;  4ZWM A;  3TCM A;  4J8L A;  1MGV A;  2TPL A;  3GWP A;  3JW9 A;  2FN6 A;  3W1I A;  3B1D A;  4GE9 A;  2VI8 A;  1W7N A;  4ADD A;  1M32 A;  4LNL A;  4ZDP A;  1M7Y A;  2AEV A;  3E2F A;  3G0T A;  2C0R A;  3B1C A;  4ITX A;  1WYV B;  1C7N A;  1G7W A;  2VLF A;  3JTX A;  4WLJ A;  4ADC A;  3NNK A;  1GC0 A;  1PMO A;  3R9A A;  1KL2 A;  2GQN A;  2Z67 A;  3EI8 A;  3PGY A;  1SFF A;  4A72 A;  4EFF A;  2VLH A;  2DKB A;  1GCK A;  2HP1 A;  1D7V A;  4WXG A;  1SF2 A;  3MAU A;  1ASF A;  1MAQ A;  2O0R A;  3TQX A;  5EUE A;  3QN6 A;  2EYQ A;  1I43 A;  1DGD A;  1BJO A;  1WKG A;  1PFF A;  2BHX A;  4XJP A;  1AMR A;  3EZS A;  2AY5 A;  4W1X A;  3PIU A;  1CS1 A;  2BI5 A;  3MAF A;  1XEY A;  5FT8 A;  4XK1 A;  3RBL A;  4CVQ A;  2JG2 A;  3AEN B;  1M6S A;  3JU7 A;  3DC1 A;  3AOV A;  3NU7 A;  1B9H A;  5G09 A;  1B8G A;  3ELE A;  1E5F A;  2QB3 A;  1D7U A;  4NOG A;  4MKJ A;  1DJ9 A;  2X8U A;  3JWA A;  4RM1 A;  4MQP A;  3HL2 A;  2D61 A;  4P7Y A;  2WB6 A;  5AX8 A;  2QA3 A;  3BCB A;  4N0B A;  3USF A;  5J8Q A;  3MBB A;  2G6W A;  3EIA A;  2YOB A;  2W7J A;  4LNM A;  2DR1 A;  2ZP7 A;  3IHJ A;  4B9B A;  2YHK A;  2E7U A;  2DGL A;  3DR4 A;  4A0F A;  4E3R A;  4ZWV A;  1LKC A;  1KMJ A;  2Z61 A;  1VP4 A;  3DR7 A;  4ZM3 A;  3DXV A;  3NUB A;  2W7L A;  5EUN A;  1GDE A;  2E7J A;  3EI5 A;  2Z9U A;  3FQ7 A;  1M0Q A;  2VGW A;  3A8U X;  4MQR A;  4PVF A;  4W8I A;  2A1V A;  2BWP A;  3LWS A;  4XJM A;  5EQC A;  3JWB A;  4F5H A;  2RFV A;  3RI6 A;  2X5F A;  4OBV A;  4DQ6 A;  2YKX A;  3E2Z A;  4LW2 A;  2YCP A;  5M4B A;  1O62 A;  3PA9 A;  3BWO A;  2G7J A;  1AY5 A;  5FT5 A;  4E77 A;  3II0 A;  4WYC A;  3AEJ C;  2D66 A;  1AJS A;  1EG5 A;  1Y4I A;  2XH1 A;  4Q75 A;  4Y0I A;  3N5M A;  2XBN A;  3FFH A;  2ORD A;  4UOY A;  3RUY A;  3N4X A;  2W8U A;  4W1W A;  1AJR A;  3I4J A;  3LV2 A;  4ATP A;  1D2F A;  2AY9 A;  2EO5 A;  1N8P A;  1TOE A;  3BN1 A;  2EH6 A;  3CQ5 A;  3DRD A;  2QSR A;  1Z7D A;  4WYF A;  3AEJ A;  5EFS A;  2EZ2 A;  4RLG A;  3MC6 A;  4A6R A;  3WGB A;  3F6T A;  1ASG A;  1LS3 A;  1MDZ A;  1X2A A;  5HXX A;  5LH9 A;  2CJD A;  1LK9 A;  1G4X A;  3B8X A;  3GSB A;  4MKK A;  1C9C A;  1CL2 A;  1V72 A;  2Z9X A;  4WXB A;  5EIG B;  2O7C A;  3HVY A;  4A0G A;  1C7O A;  3CAI A;  1Z3Z A;  2X5D A;  1GEX A;  2ZSL A;  3P1T A;  3HDO A;  4AO9 A;  3FCR A;  1MDX A;  1LC8 A;  3VK4 A;  3MAD A;  1WYT A;  4QGR A;  1IX8 A;  4RIZ A;  2WK7 A;  3FFR A;  3RCH A;  1AAW A;  1QJ5 A;  3FVU A;  3N7N A;  3DYD A;  2D7Z A;  4HVK A;  1JF9 A;  1LW5 A;  2HUU A;  3W1J A;  4CXR A;  1IAY A;  4WBT A;  4ZSW A;  4CXQ A; 
#chains in the Genus database with same CATH homology
 4WD2 A;  2JJG A;  1ARI A;  2FNI A;  2GMU A;  1GEY A;  2HUI A;  2QB2 A;  5EUD A;  2ZSM A;  2W7E A;  4ZDO A;  4BQ0 A;  3FTB A;  3VP6 A;  4Q31 A;  1SZS A;  3WLX A;  5E4Z A;  2VMX A;  1JS3 A;  4UHN A;  4AZK A;  2VMT A;  4K2M A;  3LVL B;  2AY7 A;  2R5C A;  1PG8 A;  3AEO A;  3LVK A;  3RQ1 A;  4JF0 A;  2DGM A;  2AY4 A;  2BKW A;  3EIB A;  1OAT A;  4TN4 A;  2HUF A;  1VJO A;  4JF1 A;  2Z9W A;  1S07 A;  3LVJ A;  2VYC A;  3N4R A;  1OXP A;  3NYS A;  5HDM A;  4Q6R A;  2OGA A;  2C44 A;  3DZZ A;  2BIG A;  2W7G A;  2FNU A;  2ZJG A;  3L8A A;  1AHX A;  2VGV A;  1UU0 A;  5C6U A;  4OT8 A;  4KXK A;  3W1H A;  3AEP A;  3K28 A;  3KKI A;  3OP7 A;  4UQV A;  2YKV A;  4PFF A;  2GMS A;  2AY6 A;  4Y0D A;  1YNU A;  4Q76 A;  1GBN A;  3ZRP A;  3G7Q A;  3KGX A;  2JJH A;  1M0N A;  3GR9 A;  3E2Y A;  1J04 A;  1LC7 A;  2HP2 A;  2OKJ A;  4RJ0 A;  1BJN A;  2W8V A;  1X28 A;  2BI9 A;  2BYJ A;  1OHY A;  1AKB A;  2OQX A;  2VMU A;  2Z20 A;  3DXW A;  1UU2 A;  2GB3 A;  3EZ1 A;  4Y0H A;  4A00 A;  1MAP A;  1C7G A;  1WKH A;  1CQ6 A;  2CY8 A;  3AAT A;  4IY7 A;  1DJE A;  2BWN A;  4RIT A;  1BJO B;  1ASE A;  1X0M A;  2HOR A;  2JIS A;  4OC9 A;  3WZF A;  1DGE A;  3NTJ A;  4ZM4 A;  1ARH A;  1AIB A;  3G8M A;  4FL0 A;  3MAF B;  9AAT A;  1YAA A;  2BWO A;  2W8T A;  4JE5 A;  4MGR A;  1IX7 A;  2BI1 A;  2D65 A;  2BIE A;  1ARS A;  1BJ4 A;  1AY8 A;  2OKK A;  3WGC A;  4KAM A;  1BT4 A;  1CZC A;  2Z1Y A;  3QM2 A;  4W91 A;  3EUC A;  4F5F A;  3ASB A;  3CBF A;  2BI3 A;  2VMR A;  4XQ2 A;  3H14 A;  3BC8 A;  2HOX A;  3AV7 A;  3PD6 A;  3HBX A;  1AIA A;  1UU1 A;  3UE8 A;  3CQ4 A;  4WLH A;  3TFU A;  2VI9 A;  4CBS A;  3HQT A;  1CJ0 A;  5D5S A;  5IWQ A;  3FKD A;  2WK9 A;  4GE7 A;  1VEF A;  1AMQ A;  1BQD A;  1YIZ A;  3AEM C;  4WYA A;  3NYT A;  4OCA A;  2CJG A;  1BQA A;  5G4I A;  2D5Y A;  4R8D A;  4ATQ A;  4UHO A;  3ZRQ A;  5DJ1 A;  1FC4 A;  3LY1 A;  5BJ4 A;  2AY2 A;  4IYO A;  3A9Y A;  1BW0 A;  1I29 A;  2QBT A;  4I8A A;  3AEM A;  4H51 A;  4P3M A;  1SZU A;  3E2Z B;  4GE4 A;  2VMZ A;  3T32 A;  5FT4 A;  2OGE A;  4LW4 A;  2JJE A;  4XAU A;  3GZD C;  5F9S A;  3MKJ A;  1IAX A;  2CH2 A;  1AJS B;  1IX6 A;  2NMP A;  3M5U A;  3N0L A;  4ADB A;  2C81 A;  4E1O A;  3GJU A;  2VGZ A;  3ELP A;  4U2H A;  5G2P A;  5DJ9 A;  3FVX A;  5KTB A;  1AKA A;  3GZD A;  4GSA A;  1IJI A;  3L44 A;  3PJ0 A;  3ACZ A;  2EGY A;  4K2B A;  4H63 Q;  1C0N A;  4ADE A;  5M46 A;  1ASA A;  3K40 A;  4FFC A;  2DKJ A;  4DBC A;  2HZP A;  2CH1 A;  1LW4 A;  1MLZ A;  2W7F A;  3BB8 A;  3CQ6 A;  5HHY A;  4F5M A;  1O61 A;  1OHW A;  3NUI A;  4GDY A;  1KMK A;  2AY3 A;  3B1E A;  2FYF A;  3B46 A;  4OYT A;  3WX9 A;  3NX3 A;  1WYT B;  1CQ7 A;  1W23 A;  3Q8N A;  1ZOB A;  4IXO A;  3FRK A;  4AH3 A;  1S06 A;  2CFB A;  1QIS A;  1QZ9 A;  2O1B A;  4IX8 A;  3ATH A;  3RCH B;  4WXF A;  2ZUK A;  2VIA A;  1AKC A;  4WYE A;  4ZDL A;  2VMS A;  5EAA A;  1TAT A;  2CST A;  1SPA A;  1RVU A;  2Z1Z A;  4PFN A;  4TMR A;  2VMO A;  3EI7 A;  5I92 A;  4WP0 A;  3WCN A;  2YKY A;  4MSO A;  4A0H A;  3BV0 A;  1AAM A;  3NDN A;  4AOA A;  1M4N A;  2AY1 A;  1RVY A;  1B9I A;  2QLR A;  1GC2 A;  1AHY A;  2VMW A;  3VK3 A;  4JEX A;  3FQ8 A;  1C4K A;  3BWN C;  4R5F A;  1TOG A;  4A0R A;  3ISL A;  1XI9 A;  2FM1 A;  4JEW A;  4F4E A;  2AY8 A;  3LVM A;  3JZL A;  2R5C B;  1DKA A;  4IXZ A;  4JEY A;  4OBU A;  1YOO A;  2CB1 A;  4K05 A;  3QI6 A;  2OAT A;  4TV7 A;  1DFO A;  4UHM A;  1D7S A;  1N2T A;  1TOK A;  3BWN A;  3NYU A;  4M2K A;  4WYD A;  3PDB B;  2EZ1 A;  4R2N A;  1LC5 A;  5G4J A;  4BHD A;  4RAE A;  4RJY A;  2CJH A;  1TAS A;  4MY5 A;  1CZE A;  1DJU A;  4WB0 A;  4AZJ A;  1N31 A;  1I41 A;  1JS6 A;  3VK2 A;  2W7K A;  1SVV A;  2V0Y A;  1P3W A;  2VMV A;  1ZOD A;  3BCX A;  1QIT A;  2PB2 A;  3F9T A;  3WKS A;  1G7X A;  1TOJ A;  1TPL A;  1WYU A;  3GZC A;  3FZ6 A;  4R5Z A;  4U1T A;  5JAY A;  2ZY2 A;  3FD0 A;  1X29 A;  2JGT A;  2DOU A;  1SZK A;  2YRI A;  2W7H A;  1AMA A;  2ZY3 A;  4W1V A;  2EPJ A;  2VMP A;  2Z9V A;  2CAN A;  1WYV A;  5EAV A;  4A6T A;  1TOI A;  4F5J A;  1TAR A;  1V2E A;  2BIA A;  2YKU A;  3IF2 A;  3FSL A;  3TFT A;  2AEU A;  1V2D A;  2W7I A;  1H1C A;  3EI6 A;  4WYG A;  1ASM A;  2CIN A;  3FQA A;  1ZC9 A;  1ASD A;  4JE5 D;  2W8J A;  3H7F A;  2PB0 A;  1AHF A;  3HMU A;  3N75 A;  2DGK A;  1BJW A;  2CTZ A;  3FDD A;  2V1P A;  4XJL A;  4JEV A;  5D95 A;  4EU1 A;  2HOY A;  1ASL A;  1E5E A;  2VGS A;  2X3L A;  1U08 A;  3AEN A;  3COG A;  1IUG A;  1AY4 A;  5G2Q A;  1FG7 A;  3UAK A;  5M49 A;  4O6Z A;  3A9X A;  3DU4 A;  3QBO A;  3WCO A;  3DOD A;  1O4S A;  2GSA A;  1CL1 A;  1AX4 A;  3PD6 B;  3FZ8 A;  1EJI A;  3TAT A;  1RV4 A;  4M2J A;  4J5U A;  2R2N A;  5TF5 A;  4LNJ A;  5FT6 A;  1OXO A;  3KGW A;  1YJS A;  2E54 A;  4F5L A;  3E6G A;  3N4S A;  1ELQ A;  2BI2 A;  5DX5 A;  1ASB A;  2ZY4 A;  2D64 A;  3EI9 A;  2F8J A;  1W3U A;  2YRR A;  4OTL A;  3KE3 A;  4M2M A;  3ASA A;  3R4T A;  1MDO A;  2VIB A;  4RKD A;  1FG3 A;  2ZY5 A;  4IYO B;  4MQQ A;  4B98 A;  1G4V A;  1S09 A;  4N0W A;  3GET A;  3FVS A;  1YJY A;  3A9Z A;  3BS8 A;  5E3K A;  1BS0 A;  4F5I A;  1H0C A;  4EMY A;  1GC4 A;  4ZAS A;  5M4D A;  1EQB A;  1QIR A;  5E5I A;  2VMY A;  4KYO A;  3UWC A;  3E9K A;  4RKC A;  4CBR A;  1OHV A;  2VGU A;  1I48 A;  2VMN A;  2Q7W A;  1RV3 A;  1J32 A;  3I5T A;  1ARG A;  3HLM A;  3FDB A;  4K2I A;  4BMK A;  3FZ7 A;  1JG8 A;  2VGT A;  3MC6 C;  3I16 A;  1MLY A;  3ZRR A;  2AAT A;  3D6K A;  1PMM A;  2WKA A;  4GEB A;  2C7T A;  2HOZ A;  4F5G A;  2W8W A;  1AHE A;  3PPL A;  1WST A;  1M0P A;  8AAT A;  2KFP A;  3P6K A;  1KKP A;  4L0O A;  2E7I A;  5K8B A;  1QGN A;  2YCT A;  3PAA A;  5EIG A;  5LHA A;  4ZLV A;  5DB5 A;  1B5P A;  2YCN A;  1IVR A;  2ZYJ A;  2VMQ A;  3AEL A;  1ECX A;  1QJ3 A;  4ZAH A;  4GRX A;  4ITG A;  4PIW A;  1CQ8 A;  1YIY A;  1V2F A;  2WK8 A;  2D7Y A;  1ART A;  1S0A A;  4XEW A;  3VOM A;  1W7M A;  4EB7 A;  4W5K A;  4BA5 A;  1YJZ A;  2W7D A;  1M0O A;  3F0H A;  3GBX A;  3H9X A;  4JEZ A;  5G0A A;  1ASN A;  3ECD A;  1AIC A;  3NU8 A;  4A6U A;  1ORD A;  3NRA A;  3QHX A;  3A2B A;  2R5E A;  4IXS A;  1AMS A;  2D63 A;  4AO4 A;  3BCA A;  1ELU A;  2JJF A;  2ZC0 A;  3MEB A;  5F8V A;  3LG0 A;  4HF8 A;  3RBF A;  3VAX A;  2W7M A;  3AOW A;  4LC3 A;  1AHG A;  1GD9 A;  2FQ6 A;  3K7Y A;  3PDX A;  1O69 A;  3E77 A;  4XJO A;  1BKG A;  1T3I A;  2R0T A;  3QGU A;  3WY7 A;  3WKR A;  3HT4 A;  4BA4 A;  2FKI A;  1DTY A;  4ISY A;  1B4X A;  1S08 A;  4OMA A;  2QMA A;  4WB0 B;  1GC3 A;  1D7R A;  1GEW A;  2BYL A;  4IW7 A;  3ZZJ A;  1KKJ A;  1UKJ A;  3ZZK A;  5BJ3 A;  4E3Q A;  4F5K A;  7AAT A;  4ZSY A;  1KL1 A;  4DGT A;  4EB5 A;  3PDB A;  2PO3 A;  1IBJ A;  1WYU B;  3OKS A;  1ASC A;  1B5O A;  1W7L A;  3QPG A;  4ZWM A;  3TCM A;  4J8L A;  1MGV A;  2TPL A;  3GWP A;  3JW9 A;  2FN6 A;  3W1I A;  3B1D A;  4GE9 A;  2VI8 A;  1W7N A;  4ADD A;  1M32 A;  4LNL A;  4ZDP A;  1M7Y A;  2AEV A;  3E2F A;  3G0T A;  2C0R A;  3B1C A;  4ITX A;  1WYV B;  1C7N A;  1G7W A;  2VLF A;  3JTX A;  4WLJ A;  4ADC A;  3NNK A;  1GC0 A;  1PMO A;  3R9A A;  1KL2 A;  2GQN A;  2Z67 A;  3EI8 A;  3PGY A;  1SFF A;  4A72 A;  4EFF A;  2VLH A;  2DKB A;  1GCK A;  2HP1 A;  1D7V A;  4WXG A;  1SF2 A;  3MAU A;  1ASF A;  1MAQ A;  2O0R A;  3TQX A;  5EUE A;  3QN6 A;  2EYQ A;  1I43 A;  1DGD A;  1BJO A;  1WKG A;  1PFF A;  2BHX A;  4XJP A;  1AMR A;  3EZS A;  2AY5 A;  4W1X A;  3PIU A;  1CS1 A;  2BI5 A;  3MAF A;  1XEY A;  5FT8 A;  4XK1 A;  3RBL A;  4CVQ A;  2JG2 A;  3AEN B;  1M6S A;  3JU7 A;  3DC1 A;  3AOV A;  3NU7 A;  1B9H A;  5G09 A;  1B8G A;  3ELE A;  1E5F A;  2QB3 A;  1D7U A;  4NOG A;  4MKJ A;  1DJ9 A;  2X8U A;  3JWA A;  4RM1 A;  4MQP A;  3HL2 A;  2D61 A;  4P7Y A;  2WB6 A;  5AX8 A;  2QA3 A;  3BCB A;  4N0B A;  3USF A;  5J8Q A;  3MBB A;  2G6W A;  3EIA A;  2YOB A;  2W7J A;  4LNM A;  2DR1 A;  2ZP7 A;  3IHJ A;  4B9B A;  2YHK A;  2E7U A;  2DGL A;  3DR4 A;  4A0F A;  4E3R A;  4ZWV A;  1LKC A;  1KMJ A;  2Z61 A;  1VP4 A;  3DR7 A;  4ZM3 A;  3DXV A;  3NUB A;  2W7L A;  5EUN A;  1GDE A;  2E7J A;  3EI5 A;  2Z9U A;  3FQ7 A;  1M0Q A;  2VGW A;  3A8U X;  4MQR A;  4PVF A;  4W8I A;  2A1V A;  2BWP A;  3LWS A;  4XJM A;  5EQC A;  3JWB A;  4F5H A;  2RFV A;  3RI6 A;  2X5F A;  4OBV A;  4DQ6 A;  2YKX A;  3E2Z A;  4LW2 A;  2YCP A;  5M4B A;  1O62 A;  3PA9 A;  3BWO A;  2G7J A;  1AY5 A;  5FT5 A;  4E77 A;  3II0 A;  4WYC A;  3AEJ C;  2D66 A;  1AJS A;  1EG5 A;  1Y4I A;  2XH1 A;  4Q75 A;  4Y0I A;  3N5M A;  2XBN A;  3FFH A;  2ORD A;  4UOY A;  3RUY A;  3N4X A;  2W8U A;  4W1W A;  1AJR A;  3I4J A;  3LV2 A;  4ATP A;  1D2F A;  2AY9 A;  2EO5 A;  1N8P A;  1TOE A;  3BN1 A;  2EH6 A;  3CQ5 A;  3DRD A;  2QSR A;  1Z7D A;  4WYF A;  3AEJ A;  5EFS A;  2EZ2 A;  4RLG A;  3MC6 A;  4A6R A;  3WGB A;  3F6T A;  1ASG A;  1LS3 A;  1MDZ A;  1X2A A;  5HXX A;  5LH9 A;  2CJD A;  1LK9 A;  1G4X A;  3B8X A;  3GSB A;  4MKK A;  1C9C A;  1CL2 A;  1V72 A;  2Z9X A;  4WXB A;  5EIG B;  2O7C A;  3HVY A;  4A0G A;  1C7O A;  3CAI A;  1Z3Z A;  2X5D A;  1GEX A;  2ZSL A;  3P1T A;  3HDO A;  4AO9 A;  3FCR A;  1MDX A;  1LC8 A;  3VK4 A;  3MAD A;  1WYT A;  4QGR A;  1IX8 A;  4RIZ A;  2WK7 A;  3FFR A;  3RCH A;  1AAW A;  1QJ5 A;  3FVU A;  3N7N A;  3DYD A;  2D7Z A;  4HVK A;  1JF9 A;  1LW5 A;  2HUU A;  3W1J A;  4CXR A;  1IAY A;  4WBT A;  4ZSW A;  4CXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...