3X1LF

Crystal structure of the crispr-cas rna silencing cmr complex bound to a target analog
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
149
structure length
146
Chain Sequence
IREIEQERASFAFKVVSDIKDKYSQNKKVQGKYSSYAEKAPTIILNNGLGATLAFFLSKLIDDVDYKSINPESFGNAENIAYAFLYKHLSTWLAEGNGKDSAFSGLTNGEDPLKYIMEKTAIDVAISTEEALSILNWIKKFAKAML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the CRISPR-Cas RNA Silencing Cmr Complex Bound to a Target Analog
pubmed doi rcsb
molecule keywords CRISPR system Cmr subunit Cmr2
molecule tags Rna binding protein/rna/dna
source organism Pyrococcus furiosus dsm 3638
total genus 55
structure length 146
sequence length 149
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF09701 Cas_Cmr5 CRISPR-associated protein (Cas_Cmr5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.520.30 Mainly Alpha Orthogonal Bundle Peroxidase; domain 1 AF1862-like domain 3x1lF00
2OEBA 3X1LF 2ZOPA 4GKFA
chains in the Genus database with same CATH superfamily
1GWUA 1YZRA 2EUQA 2GHDX 4JM6A 4ATJA 4BLLA 5KQ6A 5KQ0A 1DCCA 3UW8A 2B10A 4CVJA 5FNEA 3FKGA 6CCPA 1GWOA 4JQKA 3M2FA 1LY8A 1AEKA 4A78A 1AEQA 1H5KA 2WSSS 2X07A 2ZOPA 1CCIA 2WD4A 4NVLA 4JM8A 5JQRA 4A6ZA 5H9EB 5SX0B 4NVKB 2X08A 5SYVA 5SW5A 1ARPA 1H5AA 1C8IA 2Y6AA 1H55A 1A2GA 4BLZA 1B82A 3M2DA 2RBZX 5CIEA 3VLHA 4JQJA 4JMZA 1KOKA 4BLNA 3M26A 4CZQA 5SYWA 1B80A 2CYPA 5JHZA 2CCAA 1MKQA 1ZBYA 1QO4A 4JZAA 5SYHA 1A2FA 5L05A 5SYYA 5ABQA 2XJ6A 1LGAA 2XI6A 1AEBA 3X1LF 1BEJA 1U75A 2GB8A 5KQHA 1APXA 1DSEA 3ZCYA 1OAFA 4C50A 1ARVA 5KSKA 1QGJA 4NVGB 5L02A 3VLIA 3M2GA 3E2NA 4BLKA 1AEDA 1U2KA 2RC2X 2GHEX 1DSGA 1AEEA 2VCFX 5L86A 2AS2A 3VLJA 1CCGA 1H5FA 5D6MA 1H5DA 1W4YA 4BM4A 4FCNA 1ML2A 1BGPA 2GHKX 1CCBA 4OQ7A 5CIBA 6ATJA 2EUSA 4NVCA 4JMTA 5CIHA 1SBMA 3FM6A 5SYJA 5JPRA 3FM4A 4CCXA 2V2EA 4NVIB 4NVDA 4CZRA 4XV5A 3Q3UA 3VLMA 2RBVX 3M8MA 4FCSA 5SYLA 5SXTA 1KXMA 4JQNA 3WA8A 1KRJA 5KSFA 4BLXA 5KQIA 2RBWX 1H5IA 4XV8A 4JPUA 4NVJB 5SXWA 3M29A 1AEUA 3FMUA 1GZAA 5JHYA 2AS1A 3RIWA 1FHFA 1AC8A 3RIVA 2VO2X 5AL9A 5EJTA 4G05A 4JMAA 2IA8A 2B11A 4BM3A 4BLYA 1MN2A 1AEJA 1DJ1A 5ABOA 2GGNX 3M2IA 2W23A 2VCNA 4A5GA 1KZMA 1LY9A 1IYNA 1ZBZA 1Z53A 3FJWA 2BO5A 4BM0A 5CCPA 1ATJA 1CPEA 2PCCA 4CVIA 1CPDA 1LLPA 2E3AA 2AS6A 2N18A 1ARUA 2A7UB 4NVEA 1HCHA 3M27A 2E39A 3M25A 1SDQA 2VCSA 5SX6A 1U2JA 4JB4A 4NVHB 2V23A 2PCBA 3ATJA 1H58A 3RRWA 1AEVA 1CCPA 1SJ2A 3M2CA 1AESA 3FM1A 1YZPA 1CPFA 5AOGA 3ZCHA 5CICA 3X16A 4A7MA 2XJ8A 4XV4A 2BOQA 4JM5A 4CUOA 1CCJA 1H5GA 5EJXA 4JMSA 5SXXA 2AQDA 2EUOA 4PAEA 4JMVA 4GKFA 1AENA 4XVAA 5SXQA 4CCPA 4JMWA 2E3BA 1S6VA 5SX7A 1BESA 1MKRA 1H5CA 4NVAA 1OAGA 2Y6BA 4XV7A 1H5MA 2BCNA 2VNZX 1GW2A 1JCIA 5CIFA 1CPGA 1CK6A 1YYGA 2VKAA 5CJHA 1U74A 5SYKA 1BEMA 1BEKA 2RBUX 5SX3A 2AS4A 1DJ5A 1LYKA 1DS4A 2YCGA 4A71A 1BEPA 1BVAA 1H5LA 5SW6A 2YLJA 4C51A 4NVNB 4JPTA 4NVMB 1MN1A 4JM9A 1UB2A 5JHXA 4JN0A 1H57A 4H7AA 2XIHA 2EUTA 1DSOA 4QYZB 5SX0A 4CZPA 1CCAA 1AA4A 4P4QA 5SXSA 2CEPA 1V0HX 4JMBA 2RBTX 2RBXX 1ARWA 1AEOA 3M2BA 1ABVA 5CIGA 5KQ2A 1AEHA 1U2LA 1YYDA 1H5JA 2RC1X 1LYCA 2CL4X 4BM2A 1CCCA 2B12A 5CD4J 1GX2A 7ATJA 5SW4A 5SYIA 1AEMA 1CYFA 1HSRA 3WXOA 3M23A 2JMXA 4JPLA 2CCPA 1EBEA 1MNPA 4NVBA 5SX2A 1BJ9A 2ANZA 1CMPA 3E2OA 2XILA 3CCXA 5FNBA 1AETA 2OEBA 3R99A 3M2AA 2EURA 2XIFA 3M28A 2AS3A 1CMQA 4JQMA 1H5HA 2ZCAA 2EUPA 2B0ZA 1BEQA 1AEGA 5SXRA 1GWTA 2GHCX 2XJ5A 4CZOA 5KQ3A 5CIDA 3WNUA 1S73A 2Y5AA 1H3JA 4U7UB 1H5EA 3ZCGA 1ARYA 7CCPA 5SYXA 1ITKA 1PA2A 4FDQA 1CCKA 5SX1A 1CCEA 1B85A 2EUUA 1W4WA 3VLLA 1KXNA 4BM1A 1SOGA 3M2EA 3M5QA 2ICVA 3CCPA 3UT2A 1CMTA 2RC0X 1CMUA 3HDLA 5AMMA 1ARXA 2GHHX 1MK8A 2VNXX 4H79A 4USCA 5SYUA 4CZNA 4GEDA 4XV6A 2ATJA 1AEFA 5ABNA 1DSPA 5ALAA 1JDRA 1CCLA 1STQA 5KQKA 1GZBA 2CCDA 3EXBA 2EUNA 4NVFA 4NFGA 1RYCA 2RBYX 1AC4A 3VLKA 5H9FB 4FEFA 1QPAA 2JTIA 3R98A 4NVOB 1SCHA 3M2HA
chains in the Genus database with same CATH topology
2OEBA 3X1LF 2ZOPA 4GKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OEB A;  3X1L F;  2ZOP A;  4GKF A; 
#chains in the Genus database with same CATH topology
 1GWU A;  1YZR A;  2EUQ A;  2GHD X;  4JM6 A;  4ATJ A;  4BLL A;  5KQ6 A;  5KQ0 A;  1DCC A;  3UW8 A;  2B10 A;  4CVJ A;  5FNE A;  3FKG A;  6CCP A;  1GWO A;  4JQK A;  3M2F A;  1LY8 A;  1AEK A;  4A78 A;  1AEQ A;  1H5K A;  2WSS S;  2X07 A;  2ZOP A;  1CCI A;  2WD4 A;  4NVL A;  4JM8 A;  5JQR A;  4A6Z A;  5H9E B;  5SX0 B;  4NVK B;  2X08 A;  5SYV A;  5SW5 A;  1ARP A;  1H5A A;  1C8I A;  2Y6A A;  1H55 A;  1A2G A;  4BLZ A;  1B82 A;  3M2D A;  2RBZ X;  5CIE A;  3VLH A;  4JQJ A;  4JMZ A;  1KOK A;  4BLN A;  3M26 A;  4CZQ A;  5SYW A;  1B80 A;  2CYP A;  5JHZ A;  2CCA A;  1MKQ A;  1ZBY A;  1QO4 A;  4JZA A;  5SYH A;  1A2F A;  5L05 A;  5SYY A;  5ABQ A;  2XJ6 A;  1LGA A;  2XI6 A;  1AEB A;  3X1L F;  1BEJ A;  1U75 A;  2GB8 A;  5KQH A;  1APX A;  1DSE A;  3ZCY A;  1OAF A;  4C50 A;  1ARV A;  5KSK A;  1QGJ A;  4NVG B;  5L02 A;  3VLI A;  3M2G A;  3E2N A;  4BLK A;  1AED A;  1U2K A;  2RC2 X;  2GHE X;  1DSG A;  1AEE A;  2VCF X;  5L86 A;  2AS2 A;  3VLJ A;  1CCG A;  1H5F A;  5D6M A;  1H5D A;  1W4Y A;  4BM4 A;  4FCN A;  1ML2 A;  1BGP A;  2GHK X;  1CCB A;  4OQ7 A;  5CIB A;  6ATJ A;  2EUS A;  4NVC A;  4JMT A;  5CIH A;  1SBM A;  3FM6 A;  5SYJ A;  5JPR A;  3FM4 A;  4CCX A;  2V2E A;  4NVI B;  4NVD A;  4CZR A;  4XV5 A;  3Q3U A;  3VLM A;  2RBV X;  3M8M A;  4FCS A;  5SYL A;  5SXT A;  1KXM A;  4JQN A;  3WA8 A;  1KRJ A;  5KSF A;  4BLX A;  5KQI A;  2RBW X;  1H5I A;  4XV8 A;  4JPU A;  4NVJ B;  5SXW A;  3M29 A;  1AEU A;  3FMU A;  1GZA A;  5JHY A;  2AS1 A;  3RIW A;  1FHF A;  1AC8 A;  3RIV A;  2VO2 X;  5AL9 A;  5EJT A;  4G05 A;  4JMA A;  2IA8 A;  2B11 A;  4BM3 A;  4BLY A;  1MN2 A;  1AEJ A;  1DJ1 A;  5ABO A;  2GGN X;  3M2I A;  2W23 A;  2VCN A;  4A5G A;  1KZM A;  1LY9 A;  1IYN A;  1ZBZ A;  1Z53 A;  3FJW A;  2BO5 A;  4BM0 A;  5CCP A;  1ATJ A;  1CPE A;  2PCC A;  4CVI A;  1CPD A;  1LLP A;  2E3A A;  2AS6 A;  2N18 A;  1ARU A;  2A7U B;  4NVE A;  1HCH A;  3M27 A;  2E39 A;  3M25 A;  1SDQ A;  2VCS A;  5SX6 A;  1U2J A;  4JB4 A;  4NVH B;  2V23 A;  2PCB A;  3ATJ A;  1H58 A;  3RRW A;  1AEV A;  1CCP A;  1SJ2 A;  3M2C A;  1AES A;  3FM1 A;  1YZP A;  1CPF A;  5AOG A;  3ZCH A;  5CIC A;  3X16 A;  4A7M A;  2XJ8 A;  4XV4 A;  2BOQ A;  4JM5 A;  4CUO A;  1CCJ A;  1H5G A;  5EJX A;  4JMS A;  5SXX A;  2AQD A;  2EUO A;  4PAE A;  4JMV A;  4GKF A;  1AEN A;  4XVA A;  5SXQ A;  4CCP A;  4JMW A;  2E3B A;  1S6V A;  5SX7 A;  1BES A;  1MKR A;  1H5C A;  4NVA A;  1OAG A;  2Y6B A;  4XV7 A;  1H5M A;  2BCN A;  2VNZ X;  1GW2 A;  1JCI A;  5CIF A;  1CPG A;  1CK6 A;  1YYG A;  2VKA A;  5CJH A;  1U74 A;  5SYK A;  1BEM A;  1BEK A;  2RBU X;  5SX3 A;  2AS4 A;  1DJ5 A;  1LYK A;  1DS4 A;  2YCG A;  4A71 A;  1BEP A;  1BVA A;  1H5L A;  5SW6 A;  2YLJ A;  4C51 A;  4NVN B;  4JPT A;  4NVM B;  1MN1 A;  4JM9 A;  1UB2 A;  5JHX A;  4JN0 A;  1H57 A;  4H7A A;  2XIH A;  2EUT A;  1DSO A;  4QYZ B;  5SX0 A;  4CZP A;  1CCA A;  1AA4 A;  4P4Q A;  5SXS A;  2CEP A;  1V0H X;  4JMB A;  2RBT X;  2RBX X;  1ARW A;  1AEO A;  3M2B A;  1ABV A;  5CIG A;  5KQ2 A;  1AEH A;  1U2L A;  1YYD A;  1H5J A;  2RC1 X;  1LYC A;  2CL4 X;  4BM2 A;  1CCC A;  2B12 A;  5CD4 J;  1GX2 A;  7ATJ A;  5SW4 A;  5SYI A;  1AEM A;  1CYF A;  1HSR A;  3WXO A;  3M23 A;  2JMX A;  4JPL A;  2CCP A;  1EBE A;  1MNP A;  4NVB A;  5SX2 A;  1BJ9 A;  2ANZ A;  1CMP A;  3E2O A;  2XIL A;  3CCX A;  5FNB A;  1AET A;  2OEB A;  3R99 A;  3M2A A;  2EUR A;  2XIF A;  3M28 A;  2AS3 A;  1CMQ A;  4JQM A;  1H5H A;  2ZCA A;  2EUP A;  2B0Z A;  1BEQ A;  1AEG A;  5SXR A;  1GWT A;  2GHC X;  2XJ5 A;  4CZO A;  5KQ3 A;  5CID A;  3WNU A;  1S73 A;  2Y5A A;  1H3J A;  4U7U B;  1H5E A;  3ZCG A;  1ARY A;  7CCP A;  5SYX A;  1ITK A;  1PA2 A;  4FDQ A;  1CCK A;  5SX1 A;  1CCE A;  1B85 A;  2EUU A;  1W4W A;  3VLL A;  1KXN A;  4BM1 A;  1SOG A;  3M2E A;  3M5Q A;  2ICV A;  3CCP A;  3UT2 A;  1CMT A;  2RC0 X;  1CMU A;  3HDL A;  5AMM A;  1ARX A;  2GHH X;  1MK8 A;  2VNX X;  4H79 A;  4USC A;  5SYU A;  4CZN A;  4GED A;  4XV6 A;  2ATJ A;  1AEF A;  5ABN A;  1DSP A;  5ALA A;  1JDR A;  1CCL A;  1STQ A;  5KQK A;  1GZB A;  2CCD A;  3EXB A;  2EUN A;  4NVF A;  4NFG A;  1RYC A;  2RBY X;  1AC4 A;  3VLK A;  5H9F B;  4FEF A;  1QPA A;  2JTI A;  3R98 A;  4NVO B;  1SCH A;  3M2H A; 
#chains in the Genus database with same CATH homology
 2OEB A;  3X1L F;  2ZOP A;  4GKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...