3X29A

Crystal structure of mouse claudin-19 in complex with c-terminal fragment of clostridium perfringens enterotoxin
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
182
structure length
166
Chain Sequence
SGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASGQVQCKLYDGHIQSARALMVVAVLLGFVAMVLSVVGMKNPTAKSRVAISGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAMLGGSFLAAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into tight junction disassembly by Clostridium perfringens enterotoxin
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Claudin-19
total genus 58
structure length 166
sequence length 182
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00822 PMP22_Claudin PMP-22/EMP/MP20/Claudin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.150 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 3x29A00
5GJWE 5GJVE 3X29A 4P79A
chains in the Genus database with same CATH superfamily
3MXLA 2E0AA 2XS1A 3TTBA 1X90A 2UXWA 3D1IA 2JBRA 2EBAA 1JM6A 4L1FA 2Q8HA 4MPEA 2YGWA 5B5VA 2PNRA 1RP3A 3R7KA 5B5WA 3MDDA 3LG1A 1EGCA 3D2RA 5GJVE 1K90A 2C0UA 1R3BA 1FS7A 2Z1QA 5GJWE 3VKHA 2BU5A 3TZ4A 3FO3A 5K3GA 4X28A 2CJ7A 2QR4A 2YYGA 4MP2A 1Y8OA 2A1TA 2ZDXA 1GKXA 1EGDA 2R05A 4L3ZA 1FS9A 4V26A 3CRLA 2PG0A 1IVHA 2BU8A 2F6LA 4WJYA 2OEXA 3II9A 2CJ4A 4XVXA 3D9GA 2PO4A 4FF1A 1X8ZA 4Q5CA 2IX6A 3Q24A 2OT4A 1RJ4A 2HJNA 4Q1OA 4V25A 3OIBA 3SXQA 3TZ2A 3D9DA 5J71A 2VF1A 3BNFA 5M4PA 3Q0AA 4HR3A 1Y0VA 3D6BA 2Q8IA 4DOYA 2XS8A 2WBIA 1XFWA 1U8VA 3D9FA 4HKRA 2R0NA 2CJ5A 4L3XA 3EOMA 3MDEA 4H81A 3C2PA 3SF6A 4H7QA 3Q22A 2CJ8A 3P4TA 4W9UA 4IV6A 1PI1A 3CE2A 2RFQA 3C3LA 5J6AA 2VIGA 5M4MA 2GBBA 1XG2B 4FZ4A 4AKGA 3SCEA 2AZEA 2D29A 1UKWA 4FF2A 4Q0TA 4LQQB 1XFZA 1XFXA 2YYJA 2E81A 4KS9A 3D9EA 3UU9A 2BU7A 2R0MA 4Q5BA 2IX5A 2EC5A 3VKGA 3AFFA 3OWMA 4KSAA 4MPNA 2YYIA 1RX0A 3LGQA 3TZ0A 2JBTA 3X29A 1R2JA 1K8TA 2OEVA 2ZAFA 1T9GA 2FONA 4IRNA 4X28C 3PFDA 4HKSA 4N5FA 4NXLA 2JIFA 4RM7A 2Q8GA 5BRKA 4U83A 3C46A 4FF3A 2BU6A 4Q4UA 4DZYA 3L1TA 4L3YA 4AKHA 4JIOA 1UDYA 4O5MA 2CJ6A 2R03A 1X91A 1XFVA 2E80A 3BNHA 4JIZA 3RKHA 5B6BA 5M4NA 2Q8FA 5K3JA 1XFYA 4Q17A 3MKHA 2FP2A 3MMOA 1SC5A 2YYMA 1FS8A 4H85A 3GQTA 1RJ1A 1IS2A 3SWOA 3F29A 4QICA 2EBHX 4L38A 1EGEA 2CX9A 2FP1A 4M9AA 3X0XA 4F0XA 4P79A 3Q23A 1WS9A 2XQRB 3GM6A 3BNGA 4G97A 2ZKJA 4KSFA 1LVCA 1OAHA 2DVLA 4E02A 1PK0A 1QDBA 1XFUA 1Y8PA 3NF4A 2C12A 2DDHA 1JQIA 2BU2A 2OR0A 3FCJA 4J1VA 2VR0A 3BNJA 2JBSA 3OWAA 2YYLA 4AKIA 1S26A 1GJVA 3GNCA 3VADA 4KTOA 1K93A 2EBFX 4LQSB 4KCFA 1SK6A 2LFWA 3S7WA 4FF4A 4E00A 4ZYJA 3EONA 3TORA 3UBRA 2RDZA 3MPIA 3B96A 5K3IA 4MP7A 2AO2A 2ZDYA 2ZO5A 4ZXVA 4G5EA 2RF7A 5BRMA 1GKZA 2R02A 2REHA 3KMLA 1GU6A 2J7AA 2YYKA 5K3HA 4MPCA 3AFEA 2OJQA 5M4KA 4E01A 3M9VA 3MPJA 1W07A 3TZ5A 3N0RA 3CRKA 4JEKA 4OO2A 1SIQA 1SIRA 4AI6A 1BUCA 2BTZA 3X0YA 3HWCA 1Y8NA 4P13A
chains in the Genus database with same CATH topology
4HKRA 4HKSA 3C46A 4FF3A 4AKHA 3Q22A 4AKIA 1S26A 2YGWA 1RP3A 1XFVA 1K93A 2EBFX 3CE2A 3C3LA 1SK6A 2LFWA 4FF4A 2GBBA 4FZ4A 4AKGA 1XFYA 5GJVE 1K90A 2AZEA 5GJWE 4FF2A 2AO2A 2FP2A 1XFZA 1SC5A 1XFXA 2QR4A 4KS9A 3KMLA 4QICA 2EBHX 2EC5A 2FP1A 4F0XA 2F6LA 4P79A 3VKHA 3Q23A 2PO4A 4FF1A 3N0RA 3Q24A 4KSFA 4G97A 4KSAA 1LVCA 3C2PA 3Q0AA 3VKGA 2VF1A 1PK0A 3X29A 1K8TA 1XFUA 4AI6A 1Y0VA 1XFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GJW E;  5GJV E;  3X29 A;  4P79 A; 
#chains in the Genus database with same CATH topology
 3MXL A;  2E0A A;  2XS1 A;  3TTB A;  1X90 A;  2UXW A;  3D1I A;  2JBR A;  2EBA A;  1JM6 A;  4L1F A;  2Q8H A;  4MPE A;  2YGW A;  5B5V A;  2PNR A;  1RP3 A;  3R7K A;  5B5W A;  3MDD A;  3LG1 A;  1EGC A;  3D2R A;  5GJV E;  1K90 A;  2C0U A;  1R3B A;  1FS7 A;  2Z1Q A;  5GJW E;  3VKH A;  2BU5 A;  3TZ4 A;  3FO3 A;  5K3G A;  4X28 A;  2CJ7 A;  2QR4 A;  2YYG A;  4MP2 A;  1Y8O A;  2A1T A;  2ZDX A;  1GKX A;  1EGD A;  2R05 A;  4L3Z A;  1FS9 A;  4V26 A;  3CRL A;  2PG0 A;  1IVH A;  2BU8 A;  2F6L A;  4WJY A;  2OEX A;  3II9 A;  2CJ4 A;  4XVX A;  3D9G A;  2PO4 A;  4FF1 A;  1X8Z A;  4Q5C A;  2IX6 A;  3Q24 A;  2OT4 A;  1RJ4 A;  2HJN A;  4Q1O A;  4V25 A;  3OIB A;  3SXQ A;  3TZ2 A;  3D9D A;  5J71 A;  2VF1 A;  3BNF A;  5M4P A;  3Q0A A;  4HR3 A;  1Y0V A;  3D6B A;  2Q8I A;  4DOY A;  2XS8 A;  2WBI A;  1XFW A;  1U8V A;  3D9F A;  4HKR A;  2R0N A;  2CJ5 A;  4L3X A;  3EOM A;  3MDE A;  4H81 A;  3C2P A;  3SF6 A;  4H7Q A;  3Q22 A;  2CJ8 A;  3P4T A;  4W9U A;  4IV6 A;  1PI1 A;  3CE2 A;  2RFQ A;  3C3L A;  5J6A A;  2VIG A;  5M4M A;  2GBB A;  1XG2 B;  4FZ4 A;  4AKG A;  3SCE A;  2AZE A;  2D29 A;  1UKW A;  4FF2 A;  4Q0T A;  4LQQ B;  1XFZ A;  1XFX A;  2YYJ A;  2E81 A;  4KS9 A;  3D9E A;  3UU9 A;  2BU7 A;  2R0M A;  4Q5B A;  2IX5 A;  2EC5 A;  3VKG A;  3AFF A;  3OWM A;  4KSA A;  4MPN A;  2YYI A;  1RX0 A;  3LGQ A;  3TZ0 A;  2JBT A;  3X29 A;  1R2J A;  1K8T A;  2OEV A;  2ZAF A;  1T9G A;  2FON A;  4IRN A;  4X28 C;  3PFD A;  4HKS A;  4N5F A;  4NXL A;  2JIF A;  4RM7 A;  2Q8G A;  5BRK A;  4U83 A;  3C46 A;  4FF3 A;  2BU6 A;  4Q4U A;  4DZY A;  3L1T A;  4L3Y A;  4AKH A;  4JIO A;  1UDY A;  4O5M A;  2CJ6 A;  2R03 A;  1X91 A;  1XFV A;  2E80 A;  3BNH A;  4JIZ A;  3RKH A;  5B6B A;  5M4N A;  2Q8F A;  5K3J A;  1XFY A;  4Q17 A;  3MKH A;  2FP2 A;  3MMO A;  1SC5 A;  2YYM A;  1FS8 A;  4H85 A;  3GQT A;  1RJ1 A;  1IS2 A;  3SWO A;  3F29 A;  4QIC A;  2EBH X;  4L38 A;  1EGE A;  2CX9 A;  2FP1 A;  4M9A A;  3X0X A;  4F0X A;  4P79 A;  3Q23 A;  1WS9 A;  2XQR B;  3GM6 A;  3BNG A;  4G97 A;  2ZKJ A;  4KSF A;  1LVC A;  1OAH A;  2DVL A;  4E02 A;  1PK0 A;  1QDB A;  1XFU A;  1Y8P A;  3NF4 A;  2C12 A;  2DDH A;  1JQI A;  2BU2 A;  2OR0 A;  3FCJ A;  4J1V A;  2VR0 A;  3BNJ A;  2JBS A;  3OWA A;  2YYL A;  4AKI A;  1S26 A;  1GJV A;  3GNC A;  3VAD A;  4KTO A;  1K93 A;  2EBF X;  4LQS B;  4KCF A;  1SK6 A;  2LFW A;  3S7W A;  4FF4 A;  4E00 A;  4ZYJ A;  3EON A;  3TOR A;  3UBR A;  2RDZ A;  3MPI A;  3B96 A;  5K3I A;  4MP7 A;  2AO2 A;  2ZDY A;  2ZO5 A;  4ZXV A;  4G5E A;  2RF7 A;  5BRM A;  1GKZ A;  2R02 A;  2REH A;  3KML A;  1GU6 A;  2J7A A;  2YYK A;  5K3H A;  4MPC A;  3AFE A;  2OJQ A;  5M4K A;  4E01 A;  3M9V A;  3MPJ A;  1W07 A;  3TZ5 A;  3N0R A;  3CRK A;  4JEK A;  4OO2 A;  1SIQ A;  1SIR A;  4AI6 A;  1BUC A;  2BTZ A;  3X0Y A;  3HWC A;  1Y8N A;  4P13 A; 
#chains in the Genus database with same CATH homology
 4HKR A;  4HKS A;  3C46 A;  4FF3 A;  4AKH A;  3Q22 A;  4AKI A;  1S26 A;  2YGW A;  1RP3 A;  1XFV A;  1K93 A;  2EBF X;  3CE2 A;  3C3L A;  1SK6 A;  2LFW A;  4FF4 A;  2GBB A;  4FZ4 A;  4AKG A;  1XFY A;  5GJV E;  1K90 A;  2AZE A;  5GJW E;  4FF2 A;  2AO2 A;  2FP2 A;  1XFZ A;  1SC5 A;  1XFX A;  2QR4 A;  4KS9 A;  3KML A;  4QIC A;  2EBH X;  2EC5 A;  2FP1 A;  4F0X A;  2F6L A;  4P79 A;  3VKH A;  3Q23 A;  2PO4 A;  4FF1 A;  3N0R A;  3Q24 A;  4KSF A;  4G97 A;  4KSA A;  1LVC A;  3C2P A;  3Q0A A;  3VKG A;  2VF1 A;  1PK0 A;  3X29 A;  1K8T A;  1XFU A;  4AI6 A;  1Y0V A;  1XFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...