3ZDXF

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
214
structure length
214
Chain Sequence
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPSRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2012-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zdxF02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zdxF01
1UH3A 5I1GH 2X10A 3NIDE 2JIXD 4NKDA 3MRFA 3L1OH 4N8CL 4JFZH 1SMAA 1E6JH 4Z7VE 2IQ9L 2PCPB 4LNRB 5CJ8A 1IC1A 1OHQA 1C16B 2KZWA 2X4OB 5KSBB 1FZOB 1HEZB 2GITA 1LWRA 2WANA 1AGBB 2BK8A 4P57A 5FA4A 1NLDH 1U6AH 4N1HB 1CGWA 3W2DH 5CUSH 2BRRL 3MLVL 3MRQB 2R2BA 3ZTJG 1Z9MA 4XXDA 5JXEC 3MUGB 4EOWH 3RDTA 1VCAA 1GGBH 2BVOB 3O0RL 3ARSA 1J1XL 5E24E 5E9DD 2I9LB 1OAKL 1TJIL 2VXTH 3HR5A 2X4UA 3VRLE 1EUUA 4ZFOB 5IM7B 2FYYA 3DTXB 4LL9A 2AS5M 2P5EE 5E1HB 4BM7A 4X8JB 1T20B 5FGBC 5T1LB 3VRIB 2IJ0C 1ND0B 3ILPA 4I48B 5T1LD 1MFAH 4EN3C 1N0XL 5FM4A 4GW1A 2Y36H 3HMXH 5IKCB 2EICA 3Q1SH 2Z93B 3MOAL 3RPIA 1F90H 1OTSD 4I8DA 5MI0B 4JFFB 5E6IA 1I1YB 5HGBB 1S9XA 4RDQF 1FL5A 5ISZE 1VFMA 4YFDB 1RZGB 3HE7C 4IRSD 1FJ1B 3D39D 3WSQL 5E2VH 3GKZA 3TWCH 3QUYD 2ADGB 1FDLL 5I1CL 4U3HA 1AGEB 3WIFB 4ODHH 4WEMB 1P9MC 3QQ9D 4PJAB 3S37X 1YMMA 1FZKA 1RZJC 1UA6H 5DGQA 4XCCH 4J4PD 2LV4A 2CD0A 3SKJL 4G6MH 4OZGF 1D5XB 4RMRA 5C9JB 1RIHL 5DQDL 3ULUC 5D70L 1H3WM 3KR3L 1IQWL 3VWKC 3TA3A 4RMQA 2ZOKA 1NKOA 4G8GA 4WU7B 2J88L 4KDVA 4XPAL 4UT6L 5F7EL 4MA8H 3UJTH 4OZ4A 4IM8A 4GG6F 2AGJH 3RWIA 5IVXE 4PJ9A 1A7RL 3EKCA 1XCQB 5D1XB 5HVGB 3WNNA 3H9SB 2DLTA 3HC4L 2AV7B 4N0UA 1W8OA 2YBRA 1F00I 3LQZA 4MJ5B 3UP1A 4OZHF 5JMOC 1WCQA 2XN9E 4DGVH 4JRXB 1LEGA 3VFUB 4L4VE 4YX2L 4HFWB 3SKNA 1TQCB 1G7LB 3F7QA 4YDVB 1RZJL 2BOCA 4QLRA 4F7PB 2JK5B 5BVJB 1A14H 2G75B 5FM8A 5EOCL 3CFBA 1W72B 1QLRB 3DO7A 3R06B 5E2UH 1A3RL 1TVBA 2AW2A 4LHUA 3RJQB 3QEGH 4LRNL 5HBBA 12E8L 4BFIA 3O8XC 1LEKB 1OAZL 5C0IA 3F58L 1S3KH 2ICWA 4KPHL 1M7DA 3ARPA 1JHLL 5I1AB 5LWYH 4XHJD 3MV7B 5C6PB 1N64L 1KB5H 1X4ZA 3PGDA 5IV2A 1KJ2B 3MRKA 4ZD3L 4JLRB 5C0FB 1KC5H 3A6BH 4YFLF 4GAFB 1Q94B 1GOGA 2V7NA 1N8ZB 4M6AA 2PW1A 5D2LA 3RWDA 4PJ7E 3D2UB 1SJXA 3GIVB 3MR9A 4Z7VB 3SDAD 4E42B 1OTSC 4UB0L 1OAUL 5DEFA 2O5ZH 3D2UD 3ZMRA 2XIDA 2VDPH 1LP9A 1L0XA 1YEEL 4NKMB 3G08B 3V5HB 1JPTH 3QIBB 5J12B 3CZFB 4JANB 1PEWA 1VDGA 3QIBD 3G5ZA 1EZVY 1KFAH 1AIFA 1ZEAL 3QUYC 5C9KA 4DKFH 2NR6C 1Y18A 1XR8A 3MCLL 1T7VA 4KI1A 3UO1H 4PREA 3QQ9C 4RX4A 2N56A 4P2QA 3CK0L 5E00A 5E08L 3L3IA 2MPAL 3LEVH 2HKHH 3BQUC 4UIMA 5EZOL 3T08A 3MJ8B 3CCHB 3H9HB 3MV01 5L6YH 5I18H 4U1KA 4E5XB 1NCUA 2OSLB 2OTUB 3BHBA 1R3KB 3MYJB 4TVPE 4WUKL 2P5EB 4PJGF 5E2TH 3ZE1F 3VA6A 2ENSA 1S7QA 1AKJA 3UBXI 1HHHB 4XH2A 3VGEA 2VUYA 4S1DD 1G6RL 2WLZA 4G9FA 3FRPG 1NC4A 5ISZB 3H42L 3IVKB 5ISZD 1SVCP 1SYVB 4KJYB 4Y4FC 4Z7WA 3HS0A 3QJHB 5DLMH 3IU3A 5T1KA 3KJ4B 4M93C 3OB8A 2C5DC 1Z0MA 3K7UA 5AZ2H 2FGZA 2O93L 3R8BB 2KZ1B 3L5HA 4FXGA 4POZC 3U6RA 3HE6D 4BYHA 2ZCHH 1HQ4B 2EH7H 4HEPG 1BECA 1BD2D 3NCYP 4DAGH 3VFWA 3O3EA 4EVNA 5A2KH 3IFLH 3MRRB 4MA3A 1L7TH 2GJ6A 1FLRH 3INUL 3ALPA 3CVIH 1DQTA 4ODWB 5IVXB 4Z7QF 1EAJA 4UNVA 2BSRB 3OKNB 5C71A 3D3VA 4FFZH 2X4RA 5LG1A 3IAGC 3EIFA 3SDAC 5JOEA 2XN9B 2NY4C 4ZUTB 1GPOH 1RIUH 1KCRL 4L4VB 1MI5E 4MXQC 1TTFA 4LFHG 5DRZB 1FP5A 4D9LL 1T83C 5D8JL 4BQBA 2CIKA 4R4ND 2WUCL 1FO0B 1BAFL 1MFEL 2XY2A 4ELKA 4PS4L 5CHNB 1XR9B 5I1IL 1SJVA 2DRUA 1YECH 2FIKA 3CH1A 3UAJC 4IDJL 1CR9L 3BP7B 1KGCD 5F89B 5KVFH 1KN2L 3MJ7A 1K6QL 1JF1A 1EEYA 3U4BL 1FFRA 3GMQA 3UPCA 3E0GA 5BRZA 4OCXH 4W6YB 4CN4A 3MRMA 4PRBA 4K94C 4NRXB 3OL2A 4CADB 1INEL 4LSSH 1FG2B 1QFOA 5I1EL 2IGFL 1FNHA 5DMIL 4N68A 5KVEL 4NKOB 4PJ7B 4M03A 5KOVC 4S1DC 5TE7H 2HT2D 3UZEA 3LB6C 1LHZA 4IOIA 1QG3A 4M5YL 1WFTA 3FQRA 1FV1B 1FZJB 5E5MB 2VDKL 4PRAB 5TE6L 1VGEL 4MJ6B 4PJBA 2OQJB 5HYSA 1KLUB 4MQ7A 2PXYA 3LS4L 4XZUA 3MRHA 3KPSA 5FGCE 2JJSA 3C09B 1NEZB 5FA3A 2QSTA 4LP5A 5I1KL 3HE6C 4K94L 4ODUB 1EX0A 3GIZH 2VTFA 1I9JH 1DZBA 4P59L 3JWDH 2VE6A 4MCZB 2AEPL 4ZNCD 1NFDE 2Z92B 3W0WA 4P46C 1TENA 3V0WL 2A73B 4JJ5A 2F53E 1NGYB 2X4SB 3ZKMD 1ZHBB 3QG7H 1H0DB 2RFXB 2AJSL 3MBXL 2ZOLA 1MCOL 1QSVA 3VD3A 3OKMB 3VWJA 4YNYB 3P0YL 5DGRA 3EDKA 3QQ3B 1CFNB 4K7PL 3SE9L 1AQKH 1FGNL 2R56H 3C5ZB 3OPZH 4L8SC 3WHXB 1A9BB 1INDH 4XPTL 4M48H 3C5ZD 3QPXH 3V79C 1WISA 3TN0D 4NO2A 3O6FC 4NQSB 4ZS7H 2V2WA 3S98A 3CSYB 1AC6A 1UB6B 4GRWH 5EOTB 3BN3B 4N8PA 3HI1B 4KUZL 1I1CA 5K9OA 3PP3H 2BMKB 1ZS8A 1LO4L 4G8IB 4OKVA 5CILL 1A9EA 2XICA 4LPTA 1OSPL 4RQQB 3BEVA 1G0DA 3ZTNL 4JFOB 3DX8A 1ETZA 3MACH 2D9QB 1DVFA 2NZ9C 1KXQE 4O02L 3RWCA 4JJHA 5JIHA 3PDOB 5AUMA 1EO8H 4F7TA 4WFHE 4F58L 4HKZB 4PB0H 4S1QH 4FXKA 4XNUL 1SM3H 3P4OA 1FFNB 5FDYA 3WXWL 1INQA 5GRZA 2R0WL 3JXAA 4LCCB 1V3MA 3BPNC 1FNEA 5SV3A 2OTWA 4G6JL 1JWMA 4H0GA 4LKCB 1KJ3L 4H20H 4HUVB 1BQHA 4U0QB 3QDMB 3VFVA 1KYOK 3S88H 5GS0D 1MI5B 2P8LB 5D71H 3BX7C 2K7PA 5IJKC 1SVZA 4M9PA 4NN7C 3RWEA 1WT5A 1EO5A 3GMOA 5HHOE 4PRID 1EV2E 3MOBH 2XFXA 4F7EB 3MJ9L 4HW6A 1CCZA 5EBMA 3DI2B 4OZFA 4FTVE 3EO1B 4AEIH 1WGOA 4LCYA 4JPVH 2NTSP 5ESVB 3ETBF 2QR0B 2Z8WC 3GSRA 1R3HA 3B43A 5H37G 5EA0L 1BQUA 2W9LA 1P4IH 3L7FB 4UILL 1EDQA 4Y5YA 2BHYA 1S5IH 4F57L 2F8XC 4HWZA 3VFNB 3SGJC 3A6CH 1KEMH 1FVCA 2R9HD 3STZA 1V3KA 4ZDHA 3GSVA 4LP4A 5HYQA 3Q3GA 3TBTB 2ATPB 1OAXL 3QA3B 4RGOH 1H3PH 1FE8L 3TBSB 5IGXL 1TQBC 1C08A 3JV4A 3MLXL 3N9GH 3NCCB 1MCFA 3ZKMC 5FO9B 3FFDA 3ARVA 3EJYC 1Z5LB 3QZWB 3ARGB 1NCAL 4K3EL 4WO4B 1QR1A 4X6CF 3ARGD 1SYSB 1CN4A 4H8WC 1MWAA 1NUDA 2H6PB 1I4FB 2Y1VA 1B4JH 2XWBB 2ERJC 3PL6C 2IC2A 1FAIL 3VRJA 4S1RH 1JHKL 4OCLC 5J57B 5C0BA 1F4YH 1J5OL 3QFDA 1I75A 3QHZH 3HNTH 4GAGL 3AS3A 4KKLD 4PB9L 3O4OC 2VLLB 4F37K 2QSCH 2IANE 3K8LA 4LPWA 4O58L 1CK0H 3IKCB 4EBQH 4OD2B 3TO2A 1QSFA 4EQ3A 1NCWL 5FGCB 4UDUA 1IAOB 1XF5A 3DBXB 3H9YA 3HUJE 5ACLA 3HG1E 1L0YA 3MBEB 1KXTB 3VFTB 2EIZB 2VDOL 3MBED 4HUXB 2VZOA 1NFDB 4MWFB 4OFYD 3O2VH 3IETA 4AM0B 3BDXA 5IB3A 2QQLH 2IQAA 2IAMD 2F53B 3WNKA 4WHDA 4R2GB 2EKSB 4H8WL 2R0ZH 3QXDB 5C09A 1RZFH 2IBBA 4M6MH 5EZJB 2BDNH 3UTQA 3HZMA 2LTQB 5JNYB 4WNQA 3MV8A 4XPBL 3GNMH 4P5KB 2BRQA 1RJZA 3IAPA 3AUVA 4ZAKA 1CE1L 2X1WL 1CE6B 5GS0C 1CDIA 5E94B 4U6TA 3EYUH 2NX5E 5GGTL 5MP6H 5F7DB 3SY0A 1GZPB 3QG6B 3TO4C 1NGQL 1UXSA 1J1PH 1OP5K 3FQUB 2A77L 1QQDB 3S9DB 4H1LA 3GI8L 2I07B 1RZKL 2AK4D 5HHPA 5J4MA 4UTAL 4H0HB 4KFZC 3NA9H 1F45A 4R7DA 5I30L 3CFCL 2OS7A 1A1NA 2EDWA 2R4SH 2DMBA 1U8NA 4NZJA 2CIIA 4GXVH 2XQBL 1LE9B 3TZVB 1YYLH 5E8OA 4WFHD 3TZVD 2QEJA 5ID0A 4OGZA 4EUPB 1CD9B 2Q8AH 4OUUA 2B4CH 5KS9A 1U8KA 1CLYH 5HDBF 1OY3B 4QHLA 3DROA 3UYRH 3BP5B 2WNGA 4YXLH 3FB6A 3NIDF 3DJ9A 1MREH 4ORZC 4P3CH 3GBMH 3RBSA 4Z7VF 3LKOA 1HXYB 3C8KA 3Q5OA 1CG9A 4ELME 3KJ6H 3RAJH 4JDVB 1UKTA 2IG2H 1YJDL 4P2RD 2B39A 4NM4H 1QPXA 1EXUA 4GQPH 2UVEA 1B9ZA 2NXYD 5HHOB 2H45A 3N0PB 3GHBH 1XGRA 3BDBA 3E6FB 4J3UA 3KPPB 1U3YA 3UX9B 3MRBB 4JKLA 4KKLC 1LDSA 4FTVB 2NNAB 1KN4L 4X9BA 4FTVD 1S7XB 5GGRY 1FNSH 2AJ3A 1IGTA 1D5BA 4C59B 4HC1L 2V9RA 5F70A 3WCYA 2YN5A 3S4SG 3SCMA 2MTPA 4QRQA 3UPAA 4HUUA 3VRLF 3P9WB 5JIKA 4KXZH 2W0FB 4LU5L 1A3LL 4Y16A 3KVQA 4AG4L 3FT4A 4FQLH 4YO0A 4PJ8D 4OZFH 4O51B 2OTPA 4Q0XL 4MD5B 4XP6H 3BMWA 2FX8H 1XGPA 4LCWD 4KJPC 4OCWH 2AAVA 2XTLA 4UZGA 2BNRD 3STLA 4EXKA 4DEPC 1CLZL 2YMXH 3ALXA 5LGJA 4MYWB 2BX5A 3Q0HA 5MEOB 4K3JH 5D72L 4AIZA 1T2XA 3UJJL 5DA0B 5HDLA 3FOLB 3PNWA 3DUSA 3E8UH 1ADQA 5EU5B 3UTOA 3QWRA 2IANB 1OF2A 4ZG1A 3GMLA 3LN9A 4PP2A 5F71A 1HHIB 3ZKXC 5B39B 5K9QG 5FECA 3HUJB 5EG6C 2M26A 2O5YL 3X13B 3QRGH 3HG1B 3BGFC 3TJEL 1MFCL 2GFBA 5ID1B 2PYEA 5T1DH 2EDYA 1JWSB 1U3HD 3UTTA 2PF6A 2ESVB 2P5WD 4KUCD 4PJEF 1K85A 4QRPE 1DN0B 1MCCA 1JGUL 4PUBH 3MRCB 1XGQB 4KH2A 4J3VA 5IVXF 1SBSH 1I1AC 2QADD 2Y7QA 3AS1A 4YFLI 3DMMD 3EZ8A 4V1DA 1CZ8H 2MKLC 3MPCA 4XVJH 5F93C 3BPOB 3V7AE 4G7VL 3TIDA 5CJXA 5JQHC 3UBXA 3WLBB 5L8LB 3TH2T 1RK0A 2NX5B 3A67L 1YDPB 1FYTD 2NX5D 4YHNB 1YQ2A 4NQXB 1M1SA 4KVCH 5AEAA 4YHIA 3ULVE 4M43H 1EUTA 3MLYH 1CDYA 4J7RA 3DV4B 4C56D 5EO9A 1IC5L 4U6XA 1NQBA 5BOPA 2DN7A 4UV4L 1MLBA 1CXKA 4G8FA 1K5NA 3BP6B 4NZRL 4OLYL 2XZZA 5C2UB 2OL3B 3U9PL 1RUPL 1Y6KR 5C0CA 5LGHL 3QEHA 3O3BA 1D9KD 1Y6NR 1F58H 3S35H 3L3DA 5JZ7D 2EXWC 4H1LH 3C87A 1S9WB 4Y5VB 4G3YL 3WFDL 1FL6A 4F15C 3ZSTA 1G7HB 5C6WH 4ZOBA 1KUMA 3LPGA 4M7JH 1P7KA 4G42B 3ARFA 5IQ7H 1AJ7L 3ZSSA 2PUQT 4JZNB 2AJZB 3OKEA 3SKOB 4JY5H 5E8DH 1KLGA 3IDIA 4OI9A 2ARJQ 4Q6IA 4LFHD 1WVZA 1RJLB 3RU8H 1HDMB 1WTLA 4KMTH 4PJFA 5F1IA 5HHNB 1HQRB 5TE4L 5F72S 4HIJB 4WW1B 5J11C 1JJUA 5KANI 5DVLA 3FFCA 4RAUA 4JHWH 1T7XA 4JZJC 3F12A 2WIMA 2ZUTA 3ARQA 3GSQB 2VDLL 4MB5A 2YN3A 2QADC 1CDGA 4LVHC 4NZUH 3O6ML 5FYLE 3VJ6A 4WI8A 1KELL 3NACH 4WHTA 1AP2B 5IW6A 3BUTA 3EYVA 4X4XB 2VXSL 3T65B 4PGBA 8FABA 1ZA6B 4EI5A 5DMKB 2VABB 1OQXA 2E5EA 3NZ8A 3G5XB 4XC3H 1CL7I 1OGAD 1IZJA 2FJHA 2CDEA 1F4WH 4HH9A 4U7SA 1M71B 5CGYC 3C08H 5MEND 1E4KA 2ZG3A 5BS0D 5ICYB 3O81A 4X6DF 1BWWA 4F7CB 4I0PC 4JKPL 4HUWA 5FHBL 4ORGB 3EYQC 1T21A 1DBJL 1KT2A 2YD1A 1F11B 2NW2B 2FDBP 3C5SB 2GHWB 4OJFH 1MAMH 4QRPB 2HJKB 2D0FA 4TUJA 5JOFA 3S34L 1XGTB 1RUQH 5JZ7C 3MA7B 1BF2A 5T5NG 4PGEB 3QJFA 5L2KD 1DLHA 2APFA 3G04A 1HNGA 5D6DC 4ZSOE 2NYYC 4MJIA 2A38A 1E4WL 3VXTB 5F9WB 3QT2A 1EVUA 1DBBL 1U8PA 4UTBL 3IXAB 4LKXA 1C1EH 4R4FH 5BXFB 5IROC 1Q72L 3PWJB 4WU5B 4L5FH 3RGVA 3NABL 1IM3B 2B1AH 2JJTA 1PKOA 2MQ3A 4KTEH 4L4TA 1UCBH 2CO7B 2XWTB 3QUKB 5KW9H 2WBJC 1WC7B 5JW3L 1T0MB 4WTWA 5DJ6B 2X4NA 1VGKA 3C60A 3OKOA 5E1AA 1G9MH 1P1ZA 4KJWC 5F9JB 4FG6D 4QRRE 1IC4H 4HKBB 1MRFH 2GAZA 4R9HA 4PBWD 4Y2DC 4ISVB 5I8EB 2ICWJ 2X70A 2VZSA 3BE1H 3AXLB 4APQC 2VDQL 2ICCA 2M1KA 3OR7A 4LSTH 2H1PH 4LLUB 5INDB 2X42A 1ONQA 3WHE1 4NRYA 2D7OA 3WE6A 3G5YA 4X9GA 3TVMB 5KSVB 3HC0A 2KPNA 4QXUL 5EOQL 2HMID 4P23D 3VXMA 4DKAA 2GCYA 4U1GC 3PQYD 5KSUA 1D5MB 2VZ3A 1MUJB 1Q9KB 3PABA 3PWNB 4F33B 3HC3L 3C8DA 1BM3L 4NO5A 4JREC 4ODVL 1BFTA 4OBRA 2RIKA 1BFOB 2MWCA 3KYOA 1QFWI 2IWGA 4HIEB 1JGDB 1SQ2N 5B21A 3CJJA 3WD5L 3WEXB 1OWWA 2CLVA 3NAAL 3HCVB 1EEZB 3QUXC 4JO2H 1YY9D 3P4NB 2V2TB 1F97A 3P9MA 2KQMA 2YD4A 4DTGH 3B83A 2PW2A 4OIBA 4KMQA 4ZTPH 4EEEA 3WHE0 2AQ1A 5L9DH 4DCQB 2NY5C 4HS6B 2IALA 4KK9D 5GISL 2VC2H 5FF6A 4TUOA 1NBYA 5FYLD 1QFWM 4NRZA 5CLTA 5E8PA 3P0VH 4WENB 5IG7A 2HFTA 4WVRA 3QCTH 3DO3A 5E4EC 3NN8B 4EN3B 3D87B 3CPLB 3BVNB 4YGAB 2W9DH 2IPTH 3GRWL 4HJGA 3KLAB 5GS1A 1MHEB 4NIKB 5SWZD 1JZ4A 1LEIB 3H0TA 5IB5B 4F2MB 1X6NA 1JUFB 4PGCA 4KRLB 1AO7A 4CNIB 2D7TL 1DLFL 4CDGC 2AERT 2HLFC 1YNLH 1WICA 3B2VL 3DPBA 5SX4I 5DVOA 3Q6GH 4U1IA 2ARWA 4U0RB 3QHTC 2YA0A 2ZCLH 1YEDB 3ARYA 4HS8H 3VWKB 1IGMH 4C83A 4LCIH 3QFJA 3GSUB 1NCCH 4Y5XB 3CX5J 3EYSL 5F88A 3MLSL 5E4IA 4M1DL 4ZSOB 4XCEB 5FO8B 3OKKA 5J9PA 4WEUD 2VLKA 4KV5F 4ONHB 4L3EE 2K1MA 4WW2F 5GGSY 1N6QL 5IFHH 3S5LG 3ARUA 2VLRA 3MO1A 1U91A 1JNHB 2DWEB 2G2RB 3KXFA 1XMWA 5C0ND 2CSPA 1L4IA 1LK2A 1UG9A 3BKML 3OAZK 2YPKA 1MCPL 5DD0H 3VFOB 3U2SB 4U1MB 4P23C 4NGHH 3S97C 3RWHA 3THML 32C2A 5B4MD 1N5YH 2GW5A 5HVFB 3GMMB 3FQNB 4MB4A 5B8CB 2YK1L 3SDCD 1KPVA 2W07A 4X98A 4NJ9H 4DFIA 4J3SA 1SEBB 4G6FB 4AT6A 4YHML 2H26A 2AJYH 5DUPL 1UZ6E 1ES0A 2YSSA 4Q74A 4Y4KA 3D85D 3I6GB 4QRRB 3LKQA 3E6HA 4YHKL 4XPGL 3O8XB 4QRRD 3MRDA 1A6TA 3V6OC 4WDIA 5DI8B 3UEZA 2DKMA 5D7JD 1P84J 2A9NH 3WIIL 4JFPB 3MNVA 4MNHA 2PR4H 3CDCA 2VJXA 4Z77A 5C0RH 3IDJA 5DWUH 5TF1H 2EXYD 1W0VA 4BZ2L 2VIRA 1BX2B 2EE9A 4UINL 2C3XA 3QNYB 3L7EA 4OF7A 2XTJC 2R1YB 1QEWA 1HE7A 3BH8B 1F42A 2ZPKL 1Q1JH 4E41E 3HRZA 1HZHH 1G6RB 1MHPL 3DYPA 5JORA 3KLHD 1B0GA 4I18B 4ENEC 2BCKA 4YJZL 3HUJF 3GSOA 3MLRH 3LZFH 1MCWM 2VDRL 3ZLQC 4IRJB 4NSKB 1IEAB 4KUCF 3BZ4A 4DZ8A 4OZGA 2Z8RA 3BQUB 3S4SB 2R1XA 4NQCD 4QWWD 3MLWH 5TH2B 4FQXB 4IOFD 3KPQA 3I3DA 1JMXA 4QOKD 3BMVA 3K81A 2X2YA 3LEXB 4N0FB 4DZBB 5DJ2A 1ZT1B 1IKFH 3MGTA 3K80A 5EO1A 1R5VA 2B8OT 3LH2H 1BZ7A 1HHJA 4HWNA 1XF2B 5JOPE 1XF3B 3F7VA 4YIQA 1HSBB 1YNKL 2LAGB 5I1GL 1T80A 4NWTH 1S9VB 3L1OL 3SDDC 3PE9A 4OZHA 1T5WA 1E6JL 4GBXA 4GT7A 2UWEA 5CMAA 4Y4FB 3O11A 3EBAA 1RZ7H 1FG9C 1F3DH 2GUOB 4GLRH 5JDSA 4M93B 3TCLB 5A1AA 4PRPD 5EU4A 1PVHA 2BY0A 5I1JL 1NLDL 4KRPD 4HKJA 3W2DL 5CUSL 5GIRB 1QRNE 3SDCC 4MAYA 3W39A 4YHYB 4EOWL 3RKDD 3NCFB 3BKJH 1GGBL 4LLWA 3OXRA 1EO7A 4YC2C 2HVKA 5F1NA 1BMGA 3HFMH 4LLDB 3IS0X 5I1DB 2VXTL 3RVUC 5D7LE 3ROOB 1QA9B 2P8MB 5D7JC 1ZE3C 5LCVL 3ZE2F 2APWA 3L6FA 3WDHA 2K7QA 1XIWB 4ELMF 4O9HH 1EFXB 2EYSB 3GMNA 4L3EB 4R97C 1MFAL 3PHQA 1GHFH 3S3SA 1ZHLB 2Y36L 3HMXL 5CGTA 3U30C 3Q1SL 3LKRA 4X9HA 5C07A 4F9LC 4L9LB 5MHSD 3KS0H 4HGWA 1IZKA 1BBJB 4PRNB 1MVUA 2NY4B 2PTUA 5GHWL 4OV6F 4P4KA 4UAOC 5E2VL 3KLHC 3KPOA 2B5IC 3TWCL 1JPSH 4JPIB 5I2IA 3OB0H 4WI7A 3KHOA 2PO6B 3O9WC 3ZDXE 3IJSB 4B7IA 3RVVD 5DTFA 2MJWA 4ODHL 1I7RB 3FAXA 4MAUL 4QTIL 1UA6L 2Z35A 2H3NB 4GKNB 1MCQA 4LF3A 1E4XI 1J8KA 3EO0A 1UJ3C 3G5VA 4LRIC 2CDFA 1T7WA 5E6ID 4JAMA 1WZLA 5FEBA 3GO1L 3QIUB 4PJGA 1EJ6A 4MA8L 2XYCA 1AH1A 3QIUD 1G7QA 3W9EA 4H26B 1QHPA 5D1ZA 2V6HA 2AGJL 2GK0A 1QUNA 1TJHH 4IMKA 5D96C 3TESA 4WJ5B 4YHPB 4DGVL 1T1YB 4E41B 1LO3H 1LE5B 5JIPA 2AJUL 5E6ZA 4TULH 5DJCA 4RRPA 5IVOA 2ATKA 1MFDH 4OCNC 1JPGB 3OGCA 5FCSH 4ODXA 3TA3D 3QQ4A 1A14L 1HYSC 1BJ8A 5HI3D 3K2MC 4KRPC 1CU4H 1XEDA 4LLQB 3PXJA 1VENA 4XBPA 4D0BA 3AAZA 3AY4C 5E2UL 5DJYA 4PJ9D 2ZUVA 3MUY1 3QEGL 2WAHA 1BJ1H 3FONB 3REVA 1ZWIA 1Z0NA 1S3KL 2NPLX 4P46B 1DCLA 3RY4A 4RZCB 2FX7H 3T77A 2Z31B 1KSRA 4QHNA 1S8DA 5IHUH 1KB5L 2R69L 1U8OA 1TVHA 1KC5L 3C9NB 4N1CA 2E7LA 4KKCD 1BVLA 1KJVB 4O2CB 3X12B 2UUDH 1QPPA 5IW1B 5IP4A 2O5ZL 1TCRB 3RDTC 1JNLH 2VDPL 1KPUA 2L7UA 4HF5H 1ZKAA 3VXUA 4POUB 3D0LA 3T0BA 1H3UA 1JPTL 1PKQB 3O6FB 4ZTOL 4WHYH 3C2SA 5IB1A 2FATL 3EO9H 1M7IB 2CK2A 1FNLA 1FVEB 1BBDH 1KFAL 4FQJH 4KRNA 3BGMB 1DQQA 1QRNB 4DKFL 1I3GL 1UWEH 1ODAA 3RUGE 1JZ6A 1X6LA 4EQ2A 3UO1L 4LSRL 1JYNA 4GXUM 4A6YL 4JRYE 1EEUA 1MHHB 3CIQA 3LEVL 1KENH 1HIMH 3CVHH 2ZUSA 2AJVH 5L6YL 5I18L 4OGAC 3DVNB 4HK0A 3FQTB 1TZHA 4G8EA 1J8HD 5D7LB 3QXUA 2FSEA 5D7LD 1IM9A 3ZKQD 4PY7B 3QPQD 5E2TL 5LBSH 5J6HB 1UEMA 3DVGB 2W65B 3FT2B 5E8EB 2BSTA 5FFLA 4GKZA 4XMKH 5F9AC 3MREB 1CGVA 3W5NA 1F13A 2D7MA 3TFKD 2E8YA 1WIPA 4RX4D 1PSKH 4P2QD 1U36A 1LO5A 4NUGH 1B0RA 1L7IH 1AXSB 2GTWA 3BESR 4NN7B 2B2XH 3PWUA 5DLML 5E5UB 1WV7T 1X5HA 2VQ1B 4FQCH 2DMKA 4XRCB 5E56A 2X1QA 3K1KC 5CSBA 2NY6C 1GGCH 5J1AB 1QTYT 4JFEE 1JN6B 15C8H 4KKAD 1GZQA 4Y1AA 3MGOA 2BVPB 3UBXG 4DN3H 3T0AA 3OX8A 2G5BA 1AKJD 4FA8A 1NANI 2ZCHL 4PJ9C 5C2BH 2EH7L 3GBLA 5EN2B 3TYFB 1KF9B 1M7XA 3CFDB 1CICA 4DAGL 3PWVA 4G9FD 1IEBA 1H5BA 5CBEA 1Q9WA 3IFLL 3TPUB 3BW9A 5EU7C 1L7TL 4HAFA 1D5IH 1FLRL 3L5WB 3M17B 4WI4A 1Q9LB 2AEIT 2CMRH 3MRPA 5T1KD 5IT2L 4OF6A 5BV7H 2FECL 4LOUC 4CVXB 4HX1A 1W2KT 2ZNWA 4HMCA 5F9OL 3W9DA 5ITFB 4Q58C 4KKCC 4FFZL 3PL6B 1JTTA 1DUYA 1QHOA 3LRSB 1GPOL 3BISA 1ZLUH 1RIUL 2E27H 1FL3B 1RU9H 5IB4A 4CMHC 5C8JB 5DT1H 5TDOA 5AD0B 4JHBA 3BP4B 1MCWW 3EJJX 3MV9A 1T7YA 5HYJD 2YXMA 4CRPA 4PLJD 3JTTA 2AEQL 2Q7NA 5DDHB 4KDTA 3K8KA 3GMPA 2CRZA 4B0MM 5ICZB 5GS2D 2GJ6D 1UGNA 1KIPA 1U3ZA 2AJXH 4KHTH 1YECL 2EO1A 4YBQC 4LSQH 5KVFL 2P49B 4EZMA 5FYJD 4D0DA 4NQDE 1R3LA 3O3UN 3OMZA 4R26H 4OCXL 3BXNA 1AE6H 5DD1H 1S9KC 1CTOA 2I9TB 2J4WL 2LABA 5GGRA 2HH0H 3I2CL 3AM8A 4Z95H 3JWDC 1YN7B 4NOBA 1I3RA 2JIXA 4LSSL 2J7LA 4QT5B 3BRDA 3FTGA 2D31B 5A16B 4NYLB 1DSFH 2PCPA 4LNRA 1C16A 5TE7L 5KSBA 1FZOA 5GZOC 2OI9B 1HEZA 3UTZB 4FQIH 4FQHB 3O2DH 1AGBA 2E9IA 2Q7YB 4B53A 2VAJA 3TO4B 3QEQE 2VZVA 4L29A 4HH8A 2KH2B 3MRQA 5BRZD 4BELD 3RUGB 3MUGA 1T6WA 2BVOA 4JRYB 1GCFA 1O0VA 1CGYA 4XP5H 3X14B 4Q97A 2WQRA 1AHWB 3BPCB 1OW0C 2I9LA 4LASH 3GB7B 1DFBH 4Y19E 3GIZL 4HIHB 4ZFOA 1I9JL 4GRLB 5IM7A 3ORJA 2EDQA 2ITCB 3BPLB 3DTXA 1WSST 3JWDL 4GRLD 4JO1H 5T3XD 4PTUB 5BZDA 4X8JA 1T20A 5T1LA 3VRIA 1ND0A 4I48A 1NFKA 1KXVC 4PJIE 4HLZG 2E9JA 3QG7L 5IKCA 1TZGH 2Z93A 1QFUH 4X6CA 3S3JA 4JFFA 2LVEA 3CNKA 3WFBH 1I1YA 2PXYD 4ZQKB 4QHMA 2Z8VC 3UTPD 5HGBA 5J13C 5HVHB 5LQBH 1U8HB 1RZGA 2K9UA 1AGCB 4Y4HB 1FJ1A 1AQKL 4UDTB 5GSVB 3S5LB 2R56L 3AREC 3OPZL 3MXVL 4GKSB 4OGYL 5I73C 4M48L 4YR6B 3QPXL 5ERWB 2ADGA 5DD5H 1AGEA 4RBPH 4ZS7L 3DV6B 4KI5D 1SEQH 3TJHD 1Q0XH 3WIFA 4QHUB 1FSKC 2DQFB 3KPNB 4JFEB 1D5XA 4JM4H 5C9JA 2X9WA 3QWOB 4ONFH 1RV6X 4MNQE 3S36H 4TQEH 3CMGA 4WU7A 5CBAA 3SOBH 1A4JA 2F9BT 4OCRH 3VWJD 5IEKB 4PB0L 3DI3B 1YYMH 4S1QL 3QXTA 1ACYH 1U42A 1MEXH 1OP3H 3LDBC 1SM3L 1XCQA 5D1XA 3H9SA 3QUZB 2D7QA 2UYLB 4JG0H 4PJXE 4NBYB 1K4DB 4MJ5A 3MLTB 4OSUH 3RA7H 3Q5YA 4H20L 2E7HA 4XP9L 4JRXA 4DGIH 5GSRB 3S88L 3VFUA 2VSDA 4L8CB 5DD3H 4HFWA 1G7LA 5IHBA 4UT7H 4F7PA 2JK5A 1DVFD 5BVJA 1FH5H 2G75A 4PJDE 1GGIH 2XPGA 3MOBL 4OFPA 5D1QC 2F8VA 4CJ1A 3DSFH 1W72A 1QLRA 1U8LB 1MLCB 3R06A 4LVEA 4JPVL 2CQVA 3TBYA 5C0JA 2JCCE 4HUMB 2DLEA 1HHGB 5C7XH 2CKBL 1NBZB 2YC1B 1P4IL 4NQDB 4HCRA 4RAVB 1S5IL 2AXJA 1M6OB 3A6CL 5I1AA 3VGDA 2HWZH 4U6HB 1H3PL 1P2CA 1I1AB 4LDOB 1KJ2A 2EDRA 4JLRA 5C0FA 4D9RD 3BWUC 1PJ9A 2Q86B 4H5SA 4MDJB 1Q94A 2VDNH 5EUOB 1N8ZA 2MCG1 4IOSD 3D2UA 3GIVA 4Z7VA 3QULB 3PV6A 1IJ9A 4E42A 4HIIB 2VMFA 4EKXA 3GK8L 1E27A 1XFPA 2KKQA 4KJQD 3G08A 3V5HA 3QIBA 4S1RL 5JA8B 5L7XH 2JJSC 3CZFA 4JANA 3UPRB 1F4YL 4FQ2H 3QEQB 3HNTL 1YEFH 4KK6C 4L1DA 1NAKH 3DVFA 3I9GH 1EZVX 3TJHC 2QSCL 5GZND 3P9LA 4EBQL 1A7OH 2WBWB 1EGJH 5SV4A 5I0ZA 3DURB 2DKSA 3MJ8A 3CCHA 3H9HA 4R4BB 1AXTH 2BJMH 2JB6B 2YPLD 4E5XA 2E8ZA 5C0AE 2OTUA 3FO2B 4LQ1A 4Y19B 5IMOB 4WWKB 5H2BB 1L6XA 3NOIA 2N7AA 1WUNT 3L3GB 3MYJA 3CH8A 5JW4R 1C5DB 2P5EA 3O2VL 2ZJSH 5EU6E 4L8DB 5C0BD 2R8SH 4PJIB 2FHCA 3RL2B 1RZFL 4LGPB 1HHHA 4M6ML 2BDNL 4XNZC 2D7NA 2O61B 2B4CC 3GNML 5ISZA 4JE4B 1QSFD 3IVKA 3RVTD 4CKVX 4F15B 1SYVA 3JZ7A 4KJYA 2Y06L 5J89A 3HAEH 3QJHA 2GEEA 2ARJB 3EYUL 3KYKL 5MP6L 1IQDB 4B50A 1DVFC 2ZSVB 2A6DB 5DVMA 1UEYA 3QCVL 3TPKA 3WKMH 2LU7A 1MQKH 2NLJB 4MDIB 5F6HI 4Z8FH 1HQ4A 5BVPH 3IJHB 2V2XB 3NA9L 4MNQB 3RWGB 2H2PD 3WLWC 1WZMA 3MV8D 3FB5B 2R4SL 5J11B 2J5LB 3VI3F 3MRRA 2EDBA 4GXVL 1D5ZB 4ZAKD 1YYLL 4P9HH 1J86A 4JZJB 4ODWA 1MJ8H 5JHDE 2Q8AL 5IVXA 1WT5C 1CLYL 1A0QL 3OKNA 4PJXB 4PJCE 4NQEE 3UYRL 4LVHB 3BFOA 2I60L 1MREL 3LIZH 3O2WL 3GBML 1S9YA 2XN9A 4KROD 4ZUTA 2NCMA 4I13B 4L4VA 4GW4B 2RR3A 3KJ6L 5F7KC 3RAJL 3HZYB 2IG2L 1RK1A 1TFHA 4NM4L 4NHCH 5DRZA 3GHBL 4PJDB 4Y5YC 5DSCB 3LKPB 4AEEA 4XVTH 3C2AH 1FO0A 3SDXF 5CHNA 1XR9A 5GZNC 1FC2D 1T1WA 1IGCH 1FNSL 2JCCB 3BP7A 2HN7B 2GI7A 4HDIB 3IDGA 3F6IA 4I0PB 5F89A 2GT9B 3OV6A 4I0KA 4X8XA 5EB9A 4N0CC 2NY7H 1UYWH 3ESUF 1OAQL 1CVRA 4C4KT 4NRXA 3TIEA 1W72H 2DLIA 4FQLL 1OAYH 4TSCL 1GOHA 4CADA 1FG2A 1HKLH 3QNXB 5TFSH 4LEOB 1RHHA 2VDMH 5T5NF 4XP6L 2FX8L 2JELH 4NKOA 1JGVH 4OCWL 3PWPE 4PJ7A 1MCNA 5HVWA 4LBEB 3I6LD 1CBVH 2YMXL 2GY5A 1WQVT 3RVTC 4WEBH 4LLYA 3IU4H 3IDUA 1FZJA 2YEZB 5E5MA 2BXZA 1BWMA 4MJ6A 2MOVA 1NC2B 4ZFZB 4OFKA 2OQJA 5C3LD 1KLUA 3E8UL 3ZDXF 1KJ2H 1H15B 2IMNA 4LNVA 3P30H 3WNOA 1L0QA 1NEZA 3FZUD 1OD7A 2FD6L 3QRGL 5C0AB 1KB9K 4ODUA 2WBJB 4MCZA 1FFOB 3V6ZB 3IXTA 5T1DL 2HJLB 2Z92A 3IDXH 3BIKB 4Z7WF 2A73A 4DVRH 5EU6B 4ZAKC 3BAEH 1NGYA 2X4SA 5EU6D 3V6OE 1DQLH 1ZHBA 4PUBL 4Y2DB 1SBSL 1H0DA 4LPUA 2P45B 1AD9B 2RFXA 3FN9A 1X7QB 5DO2C 4APQB 3OKMA 1CZ8L 1MCHA 4YNYA 3PDDA 4K7FA 1S7UB 1CFNA 2HRPH 3IGAB 4KROC 1URLA 3C5ZA 5DRNB 3WHXA 1A9BA 3TN0A 1QVOB 3MRGB 2KL6A 5FUCC 4NQSA 3KYMB 4W70A 1VKXA 1JF5A 2MHAB 3CSYA 3B9KB 4JO3H 5D6CA 5EOTA 2XTJE 5I71C 4BSVA 2PYED 3B9KD 3SDYH 3HI1A 1GC1H 2WUBH 3BKYL 4M43L 3MLYL 1T5XB 1QSEE 4G80B 2BMKA 3CX5K 4G8IA 2BC4B 1VADB 5CD5D 4RQQA 2Z0BA 4JFOA 4X6DA 2DIAA 3NH7H 2VISB 4BKLB 5KSAB 3MCKB 5KSAD 3LVEA 5J6GB 4OZIE 4HWBL 1YC7A 4MS8C 3PDOA 3HA0A 4CDHA 3B9DA 3QUXB 1KPRB 3MGAA 3C8HA 3IJYB 5FUZH 3MRNB 1JK8A 4K7PY 1FFNA 4K23L 5JHDB 4P2OD 1F58L 3BWAB 4LCCA 3S35L 4PJCB 1VACB 3P73B 4NQEB 4Q9CA 4XNXL 4XX1G 4KTDL 4HUVA 1NL0L 4Z9KB 4YDIH 2FL5B 2Z91B 5E4EB 1MI5A 2P8LA 4CVWA 5DURB 1DBAH 1A2YA 4M7JL 3RI5K 3SCMC 1JZ5A 4S0TD 4F7EA 5IQ7L 1J7VR 1EEQA 3RUGF 3MNZB 5KG9A 3NA4A 5L8KB 5ESVA 4JY5L 5E8DL 2F5AH 1X5ZA 4Y16C 4XNMB 4XHQA 5J56B 1PQZB 4BQ8A 4RCAA 3RU8L 3FZUC 5CEYB 3L7FA 3DETC 1O7VA 2HTKD 4LPXA 3VFNA 3UDWA 2XQYK 1H3GA 2APTA 3TBTA 2ATPA 2EIDA 3QA3A 4LGSB 3TBSA 4RRPG 4JHWL 5FO9A 2QL1A 3PP4H 1T04B 4P48A 2Y5EA 1Z5LA 3QZWA 3ARGA 4KAQH 3PWPB 4WO4A 4LPYA 1C12B 4NZUL 1SYSA 5L0QC 4JM2B 4LAQH 2CLRB 2H6PA 1I4FA 3IDYC 3LSOB 3NACL 2XWBA 2VR4A 2EDXA 5C0DA 5EPMA 1TMCB 4L1HA 1AFVH 5A2IH 4KI5F 1FNGB 1Q0YH 5IFAH 1KBGL 2JKXA 2APVA 2VLLA 3WIHA 3DUUA 3IKCA 4XC3L 4OD2A 1HSAB 3JWOH 5E03A 1KV3A 4RISH 4PGZA 2A2QT 1MHCB 1IAOA 3CLEH 4M4PA 4Z7OE 5TDNB 3LRHA 3NFSH 5K9KB 3MBEA 4OLUH 5BJTB 3VFTA 5DC0A 1TDQA 4HUXA 5DK0A 1NFDA 4MWFA 1NMCB 4AM0A 3O4LE 2F53A 5DRWA 5CJXC 2EKSA 3RTQD 2Q8BH 1WBZA 2AXFB 4EI5D 5EZJA 3SE4C 1MQ8A 5JNYA 2AVGA 1G9MC 3GUTB 2P8PB 2X4PB 1KCSH 4R8WH 4P5KA 1WWAX 2FCBA 3QDJE 3ARRA 4RGMB 1CE6A 5ICXB 4JB9H 5E94A 5IMKB 4PLOB 1WEJH 1XH3B 5GRYA 1PG7L 2M2DA 5F7DA 1GZPA 3QG6A 3HN3A 1MAJA 2XTJB 1PX4A 1ITBB 1C1EL 4R4FL 3FQUA 1NMAH 1QSEB 1DUZB 1OARH 1QQDA 2AK4A 2VXUH 2I07A 4Z7UE 4L5FL 4J1UA 5D2NC 4GUPB 2B1AL 2W9EH 4KTEL 1H9VA 1UCBL 5DJ8B 4IIQC 4OZIB 1KOAA 1A6WL 3KWWB 5KW9L 1RHFA 1LE9A 3RVXD 2NY2B 3TZVA 3EDEA 4MJID 5I8OL 1QKZH 4OCMC 1G9ML 4EUPA 4OT1H 1IC4L 4NPYA 2NY3D 1MRFL 3W11D 4RMWA 4UV7H 4V2CB 3LHPL 3ARFC 2J8HA 1S7SB 3EDFA 3ZDZE 1ZAGA 1ZA3B 1H3XA 4DWHA 2X9XA 4WI2A 4LSTL 2H1PL 4PP1C 4JDVA 2FX9H 4WW2A 4Q6IC 4D3CH 5EBGA 3QYCA 5FB8A 5HHOA 5FKPB 3SDDB 2RCSL 3E6FA 1IT9H 1NANH 5DK3A 1CT8A 3MRBA 1SBBA 4FTVA 5F8RC 2NNAA 3O6KH 1S7XA 4RGNC 3RFZC 1OLZA 5GS0H 4FN0A 5IBUB 3ARDB 2BY2A 4MZ3A 4G6AD 2IBZY 2W0FA 5ESAB 5DJDB 5FDWB 4ODSL 1UJTA 2UZXB 5LAXB 5BO1L 4PJIF 4MD5A 4DTGL 4ZTPL 3B5TA 4EI5C 2MCPL 1R3IH 2BNRA 1T2QL 2GIYA 5J06A 1GSMA 2PYFB 4MCYB 3CU7A 2VC2L 43CAA 1U93A 1P7QB 3SKMB 2XNAA 4JKMA 1KACB 3QCTL 5MEOA 1E4KC 4K3GA 1Z2KA 3U30B 3FOLA 3D69B 2IPTL 3VG0H 2BVEA 5EU5A 3NPZB 3WBDA 4WHCA 2JLLA 3WFZA 1SY6H 2QQNH 2IANA 2ZNXA 1G7IA 1TNNA 1QBMH 1KTDB 5FUOL 5B39A 3G6AB 1LK3H 2B5IB 5K9QI 1G7JB 1K2DB 3HUJA 4XVUD 3RNQB 3X13A 1NGZA 3O9WB 1ZK9A 1ZMYA 3HG1A 5DZLA 3NPSC 3G6JE 3EOTH 1JWSA 1UC6A 3Q6GL 3O4LB 1DN0A 5J1TC 5FYKD 1DQDH 2WWKO 5I74C 1U9KA 3MRCA 2GSIB 1UJ3B 1PGRB 4JCLA 4U1NB 4HS8L 2HT3C 1G0YR 3GJEB 3W11C 4N0UE 1NCCL 4Q2ZB 4P5TD 5KTEH 1EMTH 4G9DB 5EU7E 1O7SA 1K8IB 3QDJB 1CGXA 3CFIC 3AB0B 1A47A 4PJ5E 3WLBA 3CFEB 3RGVC 4BH8B 1AO7D 1PY9A 4D9QD 2NX5A 5C08E 2JJTC 1YDPA 4X7CC 5IFHL 2BFVH 4YHNA 4WFFD 4PJDF 5D96B 5AYQA 4NT6B 4P4RB 3K4ZA 2ZUQC 3DV4A 3VXQA 5CJQH 3V5KB 1UZ8B 5DD0L 2H9GB 3C60C 4Z7UB 3T3PE 4NGHL 1UKSA 1JGEB 1N5YL 1ORQB 2JCCF 2B7DT 4GFTB 3HHRB 4J3WA 4YQXL 3BP6A 5DFTA 1PLGL 3QFJD 2YWZA 2FO4B 1TTUA 4W4NA 2OL3A 3BO8B 4G7YH 1FFPB 1Q8MA 4NJ9L 5JO5B 4MVBD 5BW7C 1D9KA 1ZHKB 2AJYL 3ZYIA 4UT9H 2VLKD 3LKNA 4A6YB 2VLRD 4P3DB 3SJVE 2VXQL 2YUZA 3MRFB 2MSPA 3ES6A 4MQXC 1OCWH 4H88H 4TVSa 1S9WA 2A9NL 4Y5VA 2C1PB 5D93C 1HILA 1RUAH 4ELMA 2PR4L 3U4AA 5C0RL 1NH6A 1G7HA 3QXAA 5DWUL 3KYAA 4P57B 5TF1L 3QBTB 2YD6A 3F5WA 4G42A 3EFDH 1NUFA 1DE4B 3VFGL 4HLJA 4JZNA 4BK4A 3WJLC 4ZXBC 4JDZB 3RDTB 3SBWA 3AVEA 3SKOA 4Y4KD 5DQJB 2COQA 2R39A 2RGSA 1HZHL 1H8SA 1EH9A 2FEDD 5EULV 2A6JB 4X80L 3U46B 1F4HA 1RJLA 3H3BC 3ZO0A 1HDMA 3MLRL 4XVUC 5H94B 2DICA 2X4UB 5HHNA 1HQRA 4FRWA 2P47B 4B41A 3VW3L 4HIJA 3EYOB 2OZ4A 5DHVH 4WW1A 3OAZH 1AGFA 3ROLB 1QLEH 1L9NA 4LVOC 3ILPB 5E99H 4XT1C 2JJVA 2N4IA 4MB3A 3MLWL 4V2BA 3VXNB 2J6EA 3GSQA 4GW1B 1MFNA 4YGVB 2VNCA 3OJ2C 4DW2H 3UC0H 3P40A 3T0XA 1AP2A 1NGXB 3S37H 4X4XA 3MJGX 3T65A 1IKFL 2H8PB 4XXCA 3VFMB 1ZA6A 4WI9A 4HT1L 3LQAH 5DMKA 1C5CH 2VABA 2W60B 4NWTL 2ZKHL 3FB7B 1LQSR 1HK6A 5MENA 2YPVH 5DVNA 3C5JB 4Z76B 1M71A 4TPRL 1NCBH 1RZ7L 1KCVH 1A22B 5ICYA 3VXPB 1ZT4A 3KPRE 4WI6A 4F7CA 3EDDA 1U58B 4ORGA 2J8OA 2F54E 2D03H 5INCB 2NY6B 3G6JB 1DBKH 2X9YA 5F44A 1F11A 2NW2A 3BKJL 3C5SA 4QRPA 2HJKA 1DL7H 3WL9B 3GKWH 3RWIB 5KZCB 5I1HH 4JGMA 3WMSA 3Q6FB 2ZCKH 3D25B 1RPQA 1XGTA 2VQTA 4NJAH 4N0UB 2YBRB 4OAWB 3MA7A 2NZIA 4PGEA 3GJFA 2ORBH 3AROA 5FOBB 2VITB 2ED8A 1T6VN 2UZYB 5EZIL 1MY5A 4PJ5B 2IEPA 2F74A 1EHLH 5C08B 2BOCB 3VD5A 4QCIB 1GHFL 4MAYD 3QIWB 1YN6B 2GTZA 3X3GH 2P43B 5BXFA 4HPOH 5IWLA 3PWJA 4WU5A 2NY1B 4LHUB 4CN6A 4NN6C 1OM3L 1PG7X 2NY1D 4BFIB 2FEDC 1JPSL 1DQJB 4M8QA 2XWTA 4XBEH 1TVDA 1WC7A 1T0MA 5DJ6A 3ME0A 4K55A 1OVZA 2GJZB 5F9JA 5IR1B 4ZFGH 5KVDL 2DI9A 3MRKB 2NXZD 4HKBA 1JGLH 4JVPA 4WY7H 4RFNB 3DNKA 2D0HA 4ISVA 5C07D 3SJVB 2DM7A 3OQ3B 2Q3ZA 4ZMAT 3SJVD 5T3ZE 4JCMA 5ALCH 3AXLA 4JM2F 4P4KD 4TNWF 4LLUA 5INDA 4DJMA 2DDQH 5HYFA 5DFWH 3VXSE 3G5ZB 5A40E 2VAAB 3D6GA 3QDGE 3TVMA 5KSVA 3RKPA 1S7RB 1TJHL 1S78D 1Y18B 2Y6SD 4TNWK 2C7UB 1ZV5A 3KPLA 3I02B 1JWUB 4L8BB 1BQLH 3BH9B 1LO3L 1D5MA 1VSCA 1MUJA 1Q9KA 3PWNA 4F33A 4TULL 1ED3A 2MQ0A 3OKLB 1MFDL 1N4XL 3ZHDA 1BFOA 3BHBB 5JXEA 5I9QC 4HIEA 1JGDA 3HCVA 1EEZA 2XY1A 3P4NA 4H25B 4XPHH 2K3TA 4M5ZH 1S7QB 4RSVA 1IBGH 3WN5B 2WM0A 4CAGA 2MNUA 4Y88A 4DCQA 3VD4A 3SO3B 2XV6B 1QSZA 5F8QC 2NY0C 2CRYA 5EORH 4GBXC 4K9EC 5F7WC 1N59A 2LU4A 2FBJH 1QFPA 3HS0B 4PG9B 4GO6B 5IHUL 3CPLA 3BVNA 2E7MA 3TBWB 1MHEA 2PNDA 1ZVHA 1FPTH 5SWZA 4DOHE 1LEIA 4F2MA 5IB5A 1JNLL 1JUFA 3AREB 3ZL4H 1IGJB 4X6EB 1WZ1H 1T22B 1WBXA 3CSBA 3KPRB 4TSBH 4CNIA 3EO9L 2WINB 6CGTA 4PJHE 1HHKB 1P9MA 2F54B 4FQJL 4EVNB 1IGIH 1JZ2A 1NSNH 4OQTL 1UWEL 3WNLA 2EC8A 4KK5D 5CINH 4TTGA 4YFEA 3BIBX 1CF8L 5FGRA 5HY9A 1OSZB 5DMJB 1IAIH 1YEDA 1KENL 4HPYH 2OR7A 3CVHL 3VWKA 2NXZC 4XAKE 2H2SC 2AJVL 1IAKB 1JPST 5IB2B 5HI4C 4Y5XA 2XG4A 2VL4A 3CLFH 3S6CA 2CKBB 3RPKA 4XC1H 1BGXH 5LBSL 3VXUD 5FO8A 4AEHH 1HINH 5CJ5A 4N8VG 2HFFA 4ONHA 4XMKL 1C5BH 3T0ED 1J1OH 2DYPB 5LKNA 1YEKH 1JNHA 5JR1H 4IMLB 2DI8A 2EDFA 2DWEA 1S78C 2G2RA 2NY5H 5HSFA 1PSKL 2DLHA 5D7KE 3VFOA 5BV7C 3U2SA 4M1CD 4GW5B 4HXAH 4U1MA 2FNBA 1GVIA 4NUGL 3ZHKA 3OF6A 1L7IL 3DIFB 3GJFH 2B2XL 3L3OA 5KJRH 3GMMA 4NBXB 5HI5C 3FQNA 3UTSD 5D1QB 5DEGB 5B8CA 4XAWH 4LQFH 3GMQB 3T1FB 3LMJH 5DR5H 1F6LL 1SEBA 1IM9D 1GGCL 3A0OA 5HD8D 3VMPA 4JFHD 4OLWH 3I6GA 4LVNC 15C8L 3SPVB 4QRRA 4DN3L 5D1ZC 4U4BA 5DI8A 4YPGB 3U4EB 1CXFA 1T0PB 4JY4B 2P46B 3UROR 1P69B 3VE0A 3DLQR 4IMKC 4J12A 5T3ZD 1N2RB 4C54A 1BEYH 1RURH 3R1GH 3FHQA 2EDJA 3GFUA 2CMRL 3HKFA 4I3SH 2OXGA 3VXSB 1DR9A 4HZAA 4WUUE 3QDGB 5BV7L 2IH3A 2BRRH 1BX2A 5C6TH 1FN4B 5DFVD 3MXWH 2D3VA 3QNYA 1P4LA 2R1YA 2BNUA 5CKAA 4JHZA 3BH8A 3MRHB 1J0YA 4Y1AD 2PTTB 5EIIB 1G6RA 3M07A 2E27L 1RU9L 4I18A 3P3YA 5DT1L 4JR9H 4Z7OF 5IMLB 3H6JA 1CICD 5ABDE 5L88H 4IRJA 4NSKA 1XGUA 3MRJA 3PF2A 1IEAA 2XWJB 1OGTB 1UACH 2EE2A 4KHTL 3S4SA 1F3JB 3I75B 5TH2A 4LSQL 3FMGL 4FQXA 4QXWA 5HJ3B 2A83A 5IIEA 3HLAB 4JEGB 4MXVE 2E7LC 4DZBA 4WFEE 1AE6L 5DD1L 1ZT1A 4F80A 4KGLA 5IMMA 1OLLA 1WFNA 1XF2A 2BP3A 1XF3A 4Z95L 1F6AB 5I1CH 1HSBA 1VFAB 5K59E 2FO1A 3TNMB 1S9VA 3R0NA 1DSFL 2CR6A 5E5RB 4DOHB 2WP3O 4UBDC 4UQ2B 1A9EB 3ZYOA 4Z7UF 5FYLH 2E6PA 5D70H 4UIKH 1BFVH 4FQIL 5FIEA 2GUOA 3O2DL 1IQWH 3H3KA 4R6UA 3TCLA 4PJHB 4UT6H 5GIRA 3VGHA 1OTUD 2OJZH 5H8DA 4W6XB 3VD7A 4XP5L 1I85A 3F7YB 3STBA 4LLDA 3VU2A 3EFFA 4LASL 2OTWB 2VN4A 3EOBB 3ROOA 3VGGA 1QA9A 2P8MA 4FMKA 5I6XC 3WS6A 2YD7A 4Q9RH 2DQIH 4JO1L 1FAKT 1XIWA 1U92B 2WWMD 4Y8DC 3Q5TA 4J23A 2EYSA 4L3EA 5IJVB 5ITBH 4PR5B 1ZHLA 1SJHA 2DJSA 4F7MB 1TZGL 2XFXB 3RX5A 4L9LA 1QFUL 5EBMB 1BBJA 1FCCA 4OZFB 4PRNA 5DFVC 5SX5K 1UM4H 4WCYH 4NO3B 5LQBL 5J7CC 1VEOA 2BY3A 1T83A 4JPIA 4HXBH 1VB9A 5DD5L 5CEZL 3CXDH 2PO6A 4KPHH 2EZ0C 4XB8A 1JHLH 1Q0XL 1FVCB 3QISA 4NNYB 1H5BC 2D7PA 1T1XA 3O3AB 5HHXH 5J1SC 2H3NA 1AR2A 5F96H 4ZD3H 1C08B 3JV4B 3IF1B 3S36L 2EYTB 4TQEL 4JFFD 5TPWH 3SOBL 2RAMA 1UWXH 3QIUA 4ERSH 3K74B 4ZNEE 1YYML 4H26A 1T3FB 5DHYB 1ACYL 5JQ6H 3MZGB 4S11A 3B9AA 3Q2CA 3HZVB 3N85L 2B0SH 3BN9D 4U2ZA 1ZEAH 4WUUB 1XF1A 2WQ8A 1IC7H 2W0PA 4OSUL 2YD8A 2XG5A 5I0DA 4RMVA 1NUNB 1UQSA 5C86A 3V95A 2ZSWA 4WJ5A 4YHPA 1T1YA 4DGIL 4E41A 1LE5A 5EZOH 4EUPG 4YWGH 3SO5A 1JPGA 4UT7L 1KIUA 5CKGA 1FH5L 1OL0A 1GGIL 2OYPA 1R0AH 3DSFL 3O3DB 1JFQH 1I3UA 2CLZB 2R29H 2R2HA 5EUKB 3P77A 2ZG1A 3H3PH 5D1XD 2GSGB 3H9SD 2BNQE 1REIA 5C7XL 3FONA 3VH8B 3V52L 1G6RH 3CXHK 3DX9B 2UWEF 2CK0H 4GXUN 1QRKA 5DJ0B 4JRXD 4AZ8A 1RJZB 3EYFB 3I6KA 4RZCA 1A21A 2Z31A 2HWZL 3O6LL 1UT9A 4WRLA 3DXAE 2WWMC 1S7WB 4MLIA 1S7TB 4YPJA 4ZPTB 3IS1X 3SY0B 3C9NA 3ULUL 2VDNL 2QTEA 3R4DA 1KJVA 1UXSB 2D4FA 4O2CA 5IW1A 4H1LB 3LAFA 1DDHB 3T3PF 3PJSB 1QBLH 5L7XL 3BRFA 4WIQA 4OFDA 4FQ2L 5I71B 1YEFL 4RIRB 1U8NB 1QRNA 1NAKL 2CIIB 3I9GL 5C0CE 3SDXA 4K2UH 3GI9L 1JRHH 5GGVH 3MV7D 3OHXB 5GRWA 3ULSB 3WS3A 4QRSA 3MJ9A 1A7OL 3QAZB 4NO0B 5D2NE 1MHHA 1EGJL 1KTRL 4UQ3B 3F7RA 1NGPH 5A43C 4QHLB 1MF2H 4J8RB 1AXTL 2BJML 1J8HA 3LN5B 3DVNA 3FB6B 1YEJL 3IFNL 5D7LA 3OAUH 5MI0C 1I8MB 2VKXA 1IAMA 4IRSC 4PY7A 2MMXA 1XT5A 3DVGA 2W65A 2ZJSL 5B39G 3FT2A 5E8EA 5A3ID 1G9NC 1I7ZB 2R8SL 2YRPA 1XGRB 5HDQH 3BN9C 3MREA 1GGTA 4ZO6A 4P9HC 1BAFH 5AAMA 5GRJL 4GMTL 5AYUH 1B6UA 4U6YB 4J4PC 1B88A 5IJKA 1CR9H 5HDOA 1HI6B 1AXSA 3ZE0E 4MJ4A 2EO9A 1J12A 3FRUB 5SWSE 2VQ1A 1G7MB 1GRWA 3Q48A 4LIQH 4XRCA 1ORSB 4HJ0D 1JL8A 2VLME 2X09A 3WKML 3TEUA 4OLZH 5GQBA 2P5ED 1QNZH 1U41A 4I5BB 1MQKL 1I1RA 4R96B 2EYRB 4WHYG 2R0LH 4Y16B 5J1AA 1JN6A 5DVKA 4FOMA 4RGNE 2BVPA 4Z8FL 5I1EH 2IADB 4OGXH 2IGFH 1J0HA 1CXEA 3DUHA 3FQXB 5D1XC 5BVPL 5KVEH 5EN2A 3TYFA 4YXKH 2Z8SA 4QO1A 5ANME 1CIDA 3TPUA 4PPTA 3HI5H 5IBLD 1MCDA 3PP3K 3M17A 5FK9B 5TDPB 3QI9B 4P9HL 1Q9LA 1MJ8L 2HT4D 5FHAH 5MEPB 4CVXA 3DUSB 5L0QB 5ITFA 1B2WH 3IDYB 3LIZL 3PL6A 3QP3A 3VCLB 1BP3B 5GGUA 3LRSA 2FJFB 4PP2B 1N5AA 1V5JA 1FL3A 5C8JA 5JW5B 4DK6A 1BOGB 5HYJA 5AD0A 3T04D 4NHCL 4HBQA 5DDHA 3UYOD 5IVNA 4C55A 1IKNC 1KJMA 3C2AL 4ZUVB 5ICZA 4XHJC 5GRVL 2E9WA 2H32B 5DC4B 1A1OB 1IGCL 1LO0H 2X7LB 2BNQB 5B3NA 2BNQD 2Y7QB 3QDME 1Z9SA 3B3IB 2VZ1A 4M3JA 4WTZG 4R90H 2XN9D 2A0LD 1UYWL 2NY7L 3FQWA 3L5XH 3T2NH 3U0PB 4L4VD 3TIDB 5T5FH 2I9TA 3VGFA 3DXAB 1OP9A 1QLFB 4AL8H 3GDBA 4FQQB 1RK0B 3QIBC 1OAYL 1YN7A 1DQML 5A3IC 1HKLL 4QT5A 5TFSL 1HYRC 1BFSA 2VDML 2QKIA 2D31A 1JGVL 5A16A 4NYLA 4KUZH 2I5YH 4LCUB 5EU3B 2HKFH 3QSKB 3B8YA 1QFHA 1CBVL 3UTZA 3MMEB 2L4OA 4WEBL 4FQHA 5KVMC 3B9VA 3IU4L 4L4TE 3TO4A 3TYGH 5SWQB 2DTSA 3VA2C 3VFSB 4KHXH 4LSPH 3RUGA 5C0CB 1MJJB 1XCTB 2UZIH 4YDJA 3X14A 2R2CA 5D2NB 3P30L 3L5IA 1AHWA 1ZGLB 3BPCA 1Y0LB 1AQDB 1IL1B 3L3DB 1GC1C 3N1FC 4AMKH 4IIQB 1YNTB 3GB7A 4IDLA 1KJ3H 2D4DA 2N7BA 1RJCA 1OT1A 4HC1A 4HIHA 5EIQA 4GRLA 2ITCA 4JPKH 5EWIL 5F6HJ 3IDXL 4PTUA 3GSNL 4MA7H 3LRGA 3IDNB 2BOBA 3BAEL 2HT4C 3MJ9H 5HHVH 4U1SB 4ZQKA 3N1PC 2EIEA 4N8VB 1MOEA 1U8HA 3DGGB 2HRPL 1AGCA 4Y4HA 3KYNB 3WYRA 4UDTA 5GSVA 3S5LA 1NBVH 4GKSA 4YR6A 5ERWA 5SWSB 4IEFB 3DV6A 4JO3L 2R15A 4TVPD 4P2CG 1VFBB 2DQFA 4PRDB 4QHUA 3SDYL 1LD9B 1GC1L 2WUBL 3VGBA 3FFCB 4RAUB 1OAXH 3V7AG 2P7TB 2PN5A 3KPNA 3ZKSD 5DUBB 1JTOA 4RGNB 2YWYA 4MD4B 3UZVB 3QWOA 3NH7L 4PLKD 4FHBD 4N90E 3VJ6B 1AI1L 5ANMB 3T0VA 2DIBA 1UWGH 5IEKA 1FAIH 2QSQA 3JTSB 5FUZL 1JBJA 4JHAH 4LGRB 2CH8A 2Q3AA 5KN5A 3QUZA 2UYLA 4TRPH 4OD1H 1OQOA 3MLTA 4R4NC 1G1YA 4S1SH 4YDIL 1QO3B 2CDEB 2YD3A 3K4DA 4OI8A 1LVEA 4Z7NF 4OKDA 4FS0A 5GGSB 1DBAL 4TOYH 2OX5A 4AQ1B 4PJHF 5HGDA 1U8LA 1F2XK 1R24B 1DEDA 1MLCA 2PTVA 1I7TB 2DQGH 1V3JA 2F5AL 4W6WB 5JOFB 1XZ0B 1HHGA 3OSKA 4NNPH 2YC1A 1NBZA 3NPSB 1SJEB 3JWOC 4XPBH 1FYHB 4RAVA 3QDMD 1JTPA 1M6OA 2DL2A 5KSBF 2HT2C 1EJOH 1J87A 4U6HA 1MI5D 5B3JF 4EIZC 1NLBH 5I74B 5GS2H 3FO0L 3RWFB 4UUJB 2Q86A 4MDJA 3PP4L 4X9IA 1X5AA 2EDKA 4KAQL 3KXFE 5FYJH 1U8MB 4HIIA 5EH1A 1YPZE 4LAQL 3DRQB 1RZKH 1QYGH 2XRAL 5I30H 1AFVL 3CFCH 1J10A 3UPRA 2F19H 4L4TB 3QEQA 2HTLD 1E6OH 1BIIB 3BKCL 3M8OL 1Q0YL 2FHFA 3D9AH 4JDTH 2XQBH 3U0WH 5IFAL 3UYPA 5CZKA 3C60B 1P1ZB 2FJGA 3JWOL 3GZKA 4HGKC 1T4KB 4RISL 3DURA 4OLXH 3CLEL 2YPLA 4R4BA 3EUUA 2JB6A 3MROB 3FO2A 4M7KH 4WO4D 4Y19A 5IMOA 4OLUL 4WWKA 5H2BA 3W82A 3L3GA 4KQ4H 1C5DA 4F37F 1YJDH 1FLTX 3VXRE 4L8DA 4XBGB 1I8KB 3C5ZC 2Q8BL 3TN0C 4PJIA 3RL2A 1MPAL 3HC0B 2UV3A 4PJAF 2O61A 1KCSL 4R8WL 1KNOB 3KPMB 4EDXB 1S7VB 5HPOA 4HC1H 5DC9B 4ETYA 5LGKA 1UXWB 3VI4F 3CMOH 4JB9L 5T3XH 2ARJA 1WEJL 5D7SH 4OFVA 1EA9C 3B4NA 4ZXBB 2ZSVA 2A6DA 2ESVE 1MSPA 3KLDA 1A6AB 4OTXH 2DQJH 3BDYH 1NMAL 2AV1A 1OARL 2F53D 2YD9A 4MDIA 4AG4H 2VXUL 4R2GD 1ZLSH 5ACMA 2ZP0T 2W9EL 2V2XA 3IJHA 4XWGH 4MNQA 3RWGA 3CX2A 4B7LA 1FVDB 3CGTA 3FB5A 3WDIA 4E0RB 2FGWH 2YKLH 4MX7B 3RY5A 1D5ZA 4WFGE 4LVOB 4GG6E 3NFNB 1XGYH 1QKZL 4JZJA 1A5FH 4AY0A 4OV5B 4U6VH 4OT1L 4YDLB 4PJXA 4UV7L 5K59F 3H0TB 5BZWB 1N3NB 1T89A 2OJEB 3QWQB 1YUHB 3TT3L 1HCFX 2FX9L 3HZYA 4D3CL 4KY1L 5TQ2H 4Y8AA 3K8MA 4PJDA 4LDEB 3LKPA 2YUWA 1IT9L 1CGUA 2HTLC 3ZYZA 2R9HC 2OMBA 4CL7A 3UDWC 3HAEG 2ZG2A 3O6KL 3PG2A 3T4YB 1M05A 2JCCA 3G9VA 1NDMB 4HDIA 4I0PA 4BQ9A 5GS0L 2GT9A 3F8UB 2BHZA 3ARGC 2ADFH 1VERA 4OCSH 2DBJA 2XKNB 5E8NA 5EOCJ 3V9FA 2HFGH 2F15A 4PLNC 3RP1A 3T2PA 4YEFA 2L7JA 1ULVA 5HHOD 3U83A 4LEOA 4R0LC 2DQTH 1U91B 5CP3A 1HOCA 5GJSH 2ZUUA 3KXFB 4YLQT 5CGMA 1YPZB 2DQUH 1I9IL 3P11H 2YPKB 4LBEA 2FECI 3B6SB 3VG9C 3RWHB 4EXPX 2C1OB 4PRHE 4NC1C 2YEZA 1OTTD 5DJZB 4ZFZA 2G5RA 3GM8A 3VG0L 3MBEC 3SGEH 4IRZH 1H15A 2DS4A 4AT6B 1SY6L 2QQNL 1T03H 2IAMC 2RJMA 3E6HB 3MRDB 1NCTA 2IH1A 1EERB 4PYGA 5C0AA 2WBJA 3ARBB 1KCLA 1FFOA 3V6ZA 2HJLA 4MNHB 4TUKH 5AG9A 3BIKA 1RMFH 4K8RD 4ZYKB 3QRFM 5EU6A 3VXRB 3IDJB 3FN0H 4KKNA 5CZXD 4HWEH 2AXGA 3VXRD 4X7DC 4X83A 1AD9A 2AK1H 2OM5A 2ZUWA 1ERNA 1UB5B 2LE9A 3L7EB 4DQOH 1AGDB 5KTEL 2IAND 5F6IC 1S7UA 3RL1B 3BSZL 3IGAA 3MJ6A 4X5XB 1MWAH 4U1LB 3RZCB 5DMYA 1P5VA 5DRNA 2E9BA 2XACC 2B1HL 5MERB 1KTKE 1QVOA 4HUKB 4UNTA 5I17B 3HG1D 3KYMA 2MHAA 3B9KA 4HHAB 4C57C 2V5YA 4HFUH 4O4YH 1WBYA 4U05A 2N1KA 2DF3A 3OR6B 1T5XA 3QO1B 3BZ4B 3GRWA 2ESVD 4G80A 3TZVC 4UOJA 2DQEH 4OZGB 1TNMA 4MQSB 1TPXB 2C3WA 4YUEH 1VADA 3LEYH 4OLEA 4FZ8H 4BKLA 2VISA 5KSAA 2R2EA 3MCKA 5I9QB 1MIMH 1YEHH 3MODH 3GM0A 5J6GA 2WMPA 4GAYB 4N5ED 3QUXA 1KPRA 3IJYA 3MRNA 4KK8D 4GG6B 5EO1B 2VLJE 2XT1B 4UT9L 4P2OA 5JHDA 4AENB 2NXYC 4WW2C 4HD9A 3BWAA 4OB5L 2WSKA 4K7PX 4PJCA 1VACA 3P73A 4NQEA 1OCWL 2NY0B 4X6BB 4H88L 3CVHB 5CMAB 2FL5A 2Z91A 1RUAL 3QUMB 5A2LH 1B90A 1D6VH 2BVQB 3SGKA 5IHZB 2QQKH 1E4JA 2HFEB 4QRUB 3W39B 3MNZA 1JCKA 3GBNH 3D1MC 3HPLB 4H0IA 2VQUA 3LQAC 3IRPX 5DYOB 4PJ8C 4XNMA 3FB8A 1NAML 3OZ9H 3BGAA 5HGHB 1PQZA 3EW3B 5CEYA 2V5SA 4PJ7F 4JFXA 3ARTA 1WAAE 3QEUB 4FZEH 4JFDE 4PG2C 5HGGS 2EEAA 3MRLB 5CEZE 5E2WH 5IESL 1QLEL 3EGSB 5E99L 5I16B 3EOAB 5CZXC 1KTLB 1T04A 3HPJB 4NUJB 3PWPA 3UJIL 1C12A 5I1LA 1Q72H 4JM2A 2X1PA 2CLRA 4BJLA 4I4WB 1BLNB 1E28B 3S37L 3C6LB 4FNLH 3ZE0F 3C6LD 2FIRT 3KPOB 4PRHB 1WFUA 2D9CA 3LQAL 1C5CL 1F4AA 5DTFB 2FEEI 1U3HC 5BV7B 4DVBB 5IBTH 1HSAA 4NDMB 2LAAA 1MY7A 5CP3H 2YPVL 3D0VB 2EH8L 1MHCA 1P4BH 1NCBL 2CXGA 3EO0B 5TDNA 4L4JA 2CDFB 5K9KA 3DMMC 4RA0C 5BJTA 2D03L 3K2UH 1DBKL 4NNXB 2VDQH 3BPOC 3RTQA 5D1ZB 3DYMA 3GKWL 3V6OA 2AXFA 4PYHA 5JPMB 2NQCA 1V3LA 2ADJB 5I1HL 4PGJA 5EOQH 2ZCKL 1CFSA 3GUTA 3JVGA 1VFOA 2P8PA 1EPFA 2X4PA 3T8XB 2ORBL 3DX7B 1CD1B 5M94B 2FR4B 1IRAY 3MYZA 5ICXA 1EHLL 4PV8B 2FZ3B 4YHOH 5DZNA 5IMKA 4WV1C 1XH3A 4ODVH 4ODXB 4NQTA 5CD3B 4NHUB 4YHLH 3NAAH 1KIRB 1QSEA 4D0BB 1ADQH 4OF0A 3ULUE 1DUZA 4NM8L 4HPOL 4QRPD 1D9KC 4GUPA 2XKUA 4ZUSB 3REVB 5DJ8A 2BVUA 3RVWD 5J3HD 4OZIA 3KWWA 3WNPA 5FGSA 5B38G 3MFFB 4Y5VC 1X5YA 5BCAA 5DJXB 4ACPA 2VLJB 4QHNB 3MRIB 5ALBH 4ZFGL 2FRGP 4Z18A 4YBLC 2FH8A 4X4YA 1ZHNB 1FC1A 3ULVD 3VD9A 4M4RA 1QR4A 3BI9X 1EVTC 1S7SA 5FXCH 1ZANL 5ALCL 3PIQB 1ZA3A 1KPUB 3SBWC 1FORH 5ESQA 3ET9F 3U36B 3OKDA 3D0LB 3RHWK 1G9EA 5C3TA 4HBCH 5I76B 2DDQL 5FKPA 1MRCH 2Y07H 1JV5B 4F8TA 1YEIL 4JQVC 4ZODA 3HMXA 1BZ9B 4GRMB 2DB8A 1BQLL 4LSDA 5E9DE 4OD3H 8CGTA 4RFOH 5EO0B 1ZT7B 1S5HB 4MNGE 3ARDA 2IBGA 4JFDB 4M1DH 5I19H 5ESAA 1HN1A 5DJDA 5FDWA 5CEZD 4LSVH 2IBZX 1OB1A 3V7MA 4XPHL 4X7SL 2VXVH 3PHOB 4XXCC 5F7LB 5LAXA 3TVMD 4QRTB 1IBGL 1RD6A 4YZFE 4ZOAA 4AEFA 3IFPB 1X9QA 3GHEL 5JHLH 3V4PH 1TETH 2I25N 4MCYA 4DN4H 3D39E 3SKMA 2FBJL 3PWUB 1CTNA 1MNUH 3FO9B 2YK1H 4CMMB 1G0XA 3BZDA 3D69A 5JXED 1VEMA 1MCJA 4N0RA 5FCUH 1NFDF 1FPTL 4J6RH 3JUZA 1KTDA 1JNNH 1RI8A 4YHKH 3ZL4L 4OIAA 2VL5B 1G7JA 1K2DA 2WIIB 3RNQA 4DUXA 3QCUH 4TSBL 3O9WA 4IHOB 3DARA 3PWVB 2X5PA 1PYWA 1IGIL 1NSNL 5J3HC 4N0YH 5CINL 1KB9J 3O4LA 4EN3D 3ARWA 3FT3A 4KQ3H 3MSPA 1IAIL 1UJ3A 2GSIA 4HPYL 4FFYH 4U1NA 1M4KA 1FQ9C 4P5TA 4UINH 4HX1B 4KXZI 1MCEA 4Q2ZA 4R3SB 5F9WC 3HE7B 4BH7B 3CLFL 3BZFB 4G9DA 4XCNB 5I8CB 1MELA 3HZKB 1K8IA 3QDJA 2UY7A 4KZEH 4XC1L 1BGXL 1JMZA 1WIUA 3TC9A 4AEHL 1HINL 2XQYG 1UFUA 4GG8B 3CFEA 4X99B 4BH8A 4AYFA 1HH9A 1C5BL 1J1OL 1YEKL 5JR1L 4NT6A 2WBKA 4P4RA 4GAJL 4LSUH 2NY5L 3X3FH 5JA9A 5C0EB 2QSVA 1UZ8A 3V5KA 4LLMB 4FG6C 2H9GA 2JF1A 4Z7UA 4HXAL 3EOYG 1JGEA 4JPWH 1ORQA 3VWKD 3V5DB 1A3QA 2KBGA 4M6OL 2FO4A 2C4FT 4XAWL 4CW1B 5CP7B 4LQFL 4HLZH 5EBWB 3BO8A 1HH6B 2V17H 1FFPA 3LMJL 4GQ9H 5DR5L 4I77H 5JO5A 3AY4A 1ZHKA 3E2HC 2EEDA 1G7PB 1A6VH 5DS8A 5HDBE 2L0DA 4A6YA 2JIXB 1VFUA 1YNKH 4P3DA 1RJYB 3EAKA 3FTGB 3TVMC 3OB0K 1MVFA 4RFEA 3TV3L 2HMIC 1BPVA 2C1PA 3U7WH 3VXOB 3O45B 3MA9H 1YPZF 4NWUH 3OF6D 1BEYL 3CFJB 1RURL 3R1GL 4HS3B 2XA8L 5F9DC 2X89D 4I3SL 1CFVH 4YE4L 4EI6B 5I1JH 4ALAH 4RWYH 4K3HA 4L29B 4YBHA 5C6TL 1I9RH 1DE4A 1R5IB 3MXWL 2X1OA 4G6FD 3GSWB 1KG0B 4JDZA 5F7FA 3VDCA 5JDJA 1YY9C 3I85A 5FOJA 3LPFA 5DQJA 5E9DB 2YOCA 3O8XD 3ZYJA 2A6JA 2Y5TA 1RUML 3U46A 4JR9L 1RUKH 3OJMB 5H94A 4MNGB 2GYSA 4KK9C 5L88L 3HAEB 5T33H 3EYOA 5LCVH 4RWHA 1YY8B 4QY8A 2J8UE 2IFFH 3ROLA 1BVZA 5BZDB 3GMRA 2OK0L 1UACL 3U7YL 3VXNA 2EDOA 4LLVB 4FQ1H 4JN2B 1RFDL 4X6CB 4YGVA 4QHMB 5ADOL 5CLWA 4IRSB 4ETQA 5GHWH 1NGXA 3D39B 2H8PA 1WJ3A 3QUYB 3VFMA 2DTML 1F02I 1XAUA 5ETUB 2NR6D 1A7BA 4IRJD 1IEHA 3MZTA 2RQ8A 2W60A 3FB7A 4MAUH 4QTIH 2VRAA 3FHAA 3S96B 3BQUD 3C5JA 5CWSB 4Z76A 4U0RC 3LCYA 5AG8A 5FYLL 4FQXD 4DKEH 4UIKL 3VXPA 1BFVL 1BD2E 4XCFH 5LXGH 3JSSA 2NMSA 5DA4A 1U58A 5CBAB 3ZT6A 1U8IA 1A4JB 4Y5XC 5INCA 3G6JA 1Q38A 3GO1H 4HG4K 5E6YA 2UUDK 4PJEE 2OJZL 5CIPA 1B3JA 2GQHA 3WL9A 9CGTA 4F8QA 3RY6A 3Q6FA 1IFHH 3D25A 4JFZL 3VFRA 3MX0A 4OAWA 2E6JA 1NEUA 2Z4QB 1FIGH 5FOBA 2DBLH 2VITA 3U1SH 5C0NC 1J05B 4LMQE 4Y4FD 2A9MH 2AJUH 4Q9RL 2DQIL 4NZDA 1PKQE 2G60H 4PJ5A 5B4MC 1QP1A 3V0AC 1U6AL 5C08A 2G9HB 4XMPH 4U31A 1ZTXH 4QCIA 3V4VH 5FYKH 5ITBL 3ESVF 2XPGB 1I9EA 5B8CC 2CDGB 3QIWA 1YN6A 4HKXB 3WO4C 1UM4L 4BK5A 5D5ME 4POZD 4WCYL 4XMLH 1KGCE 3TBYB 5C0JB 4NKQB 1DQJA 1X5KA 4HXBL 3AU1B 5EFIB 3CXDL 2V5MA 4U33A 1VESA 4LHQB 4NQVB 4MMXC 2FLRT 5I66B 1XIWD 5ECJE 5HHXL 1EFXD 2GJZA 2R69H 1P2CB 5FV1L 5F96L 5IR1A 4L3ED 5HHME 1A6ZA 4AIXA 1GGYA 5CAYB 3H7LA 2EXYC 3T0WA 1VHPA 4H5SB 1F90L 3SJVA 3SDAB 3WFCH 3CUPB 2W91A 3DHMA 1IVLA 3PV6B 2NY4D 5HPMB 2YA2A 5TPWL 5EBLB 4MXQD 4ERSL 2XXMB 1E27B 1RZIA 4ZS6D 3A6OA 3OTTA 5CJBA 4BUHA 4ZTOH 5JQ6L 4KZDH 4PGDB 2FATH 3P4MB 4I18C 2B0SL 2CRIA 3GSNB 5DJAB 2VAAA 3QH3B 2PO6D 1MCRA 1S7RA 1I3GH 1TZIB 3KHQA 2C7UA 2EDTA 1IC7L 4IRJC 4LSRH 4XCCL 4A6YH 5F7UA 3UAJD 3P9LB 4G6ML 3I02A 3B5HA 1JWUA 4L8BA 3BH9A 4XGZA 4QWWC 4BQ6A 3L95B 4YWGL 3OKLA 4IOFC 4FQXC 4YAQB 5SX5H 1R0AL 3RBGA 3UJTL 2J8UB 2DIJA 4XVSH 4QXTB 2A6KA 1JFQL 1XF4A 2R29L 4H25A 4JFYB 1ZLUK 4ZPVB 1OW0A 3H3PL 3BEWB 3CU1A 2EKJA 2PETA 3WN5A 2CK0L 3LB6D 4W81A 4E41D 2OR8A 4FFVD 3I3BA 4FP8H 4PG9A 1F6FB 2HG5B 4NZTH 4XP1H 3TBWA 2ITDB 3NFPB 3BYYA 2ILLA 4MXWH 1A64A 3WJJC 4FXLA 3RKDC 1NGWB 1TLKA 5DQ9B 4YHYC 4Z78A 1BREA 1I3VA 3HE6B 5DRXB 3AREA 1IGJA 4X6EA 5C92A 4X6DE 1I85C 1QBLL 1T22A 3DX6B 1BD2B 3KPRA 2NW3B 5IOPB 2WINA 3NCMA 1HHKA 2F54A 5IQ9B 5LWYL 4P46D 4PJEB 4K2UL 3WS6C 5GGVL 1JRHL 2Z31D 1XIWC 5IT2H 4PBXA 1OSZA 3A6BL 5JOPD 2ED9A 4U3CA 5IEHB 1NGPL 2JJWA 1MF2L 1IAKA 2HVJB 5IB2A 3ULVF 4PTTA 5F9OH 1X3DA 4L9LC 3OAUL 3SE3A 3V4UH 1ZGLM 1S9YB 2CKBA 4L8SB 5EIVA 2ED7A 3PXHA 1IGYB 1PBYA 3O6FD 4ZS6C 4PRIE 5D7IE 1RK1B 3KG5A 3T0EA 5CIPH 4PD4K 3OBAA 4KU1A 2AEQH 2DYPA 3UMTA 1EHXA 5HDQL 1QRND 3RVVC 4IMLA 1MCLA 2PO6C 3MC0A 1YMHB 5AYUL 4WGWB 2VZUA 1I7UB 5D5MB 2HKHL 1T1WB 4GW5A 4K9EH 3DIFA 1A1MB 3UTSA 3IDGB 4D0CB 4GSDH 2NZ9D 4F9PA 5D1QA 5DEGA 2AQ3A 5E6IC 3T1FA 4LIQL 5D9SB 1RY7B 1WAAF 3CDGA 4OLZL 3U48A 1QNZL 3QIUC 4ONOA 1C7SA 2J4WH 2R0LL 3BPNB 3TIEB 3I2CH 1A6UH 3SPVA 4A2LA 5HHMB 4HJJH 5HHMD 5CCKH 4OGXL 1R5WA 1RHHB 4U1JA 4YPGA 5B38B 3U4EA 4LLAA 4RBPK 3TP4A 4JY4A 4YXKL 3WFEH 1ZVSB 4XB7A 1N2RA 3HI5L 3OJDB 3KDMB 2R1WB 1I8LA 3NMEA 4FFVC 4LLYB 3VXSA 5DMGD 3TA3C 1A4KB 3QDGA 5FHAL 1FN4A 5HI3C 5AZ2L 3L5JA 3U79A 4UU9B 1B2WL 4EIGB 4M6NH 3KNBB 3E3QC 3TNNB 5CSGA 2PTTA 5EIIA 4NC1E 1OP3K 5CZVH 2CUHA 5IMLA 1Q9OB 4IS6A 1CGSH 4JQIH 4EJ1C 3IXTB 2W0KA 1TQBB 3CVIL 2XWJA 1OGTA 4RNRB 1EK3A 4K3DH 2Z31C 1F3JA 1WK0A 4NCC1 1LO0L 3I75A 3V8OA 3EJYD 5FM5M 5HJ3A 1QOKA 5KAQG 4M7ZC 1ITCA 3F6LA 3H8NA 5CJOH 5HYIA 2ERJB 3HLAA 3V0VB 3TH3T 3PL6D 4K7FB 1U8QB 4R90L 3T2NL 3L5XL 3EDJA 5M7QA 5T5FL 4LAJH 3MXVH 4TYUA 3TN0B 4OGYH 2X4TB 5ELIA 4AL8L 1F6AA 3O4OB 1VKXB 4N9GA 3N1QC 1VFAA 5D6CB 1I8IA 5MEQB 3TNMA 4BSVB 3FO1B 2FWOB 2I5YL 2AK4E 3H7BB 3ULUF 4UQ2A 5EZLB 4HMEA 2HKFL 3QO0B 4X6DB 4U7MA 1SMOA 3TYGL 4PJHA 1PFCA 4KHXL 4LSPL 3EJZD 5ACZA 5GXBB 3QPQC 4QTHA 1D6EB 2UZIL 1UM6H 1EAPB 1JK8B 4M7LH 4PV9B