3ZPCA

Acinetobacter baumannii ribd, form 1
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
357
structure length
357
Chain Sequence
SELKQDQYWMQQAIELAKRGLYSTKPNPNVGCVIVKDDQLIGEGFHPKAGQPHAEVFALRQAGEQAQGATAYVTLEPCAHYGRTPPCAEALVKAQVKKVVVACPDPNPLVAGKGVQILKNAGIEVEIGICEDLAAKLNQGFLKAMSTGMPYVRLKVASSLDGRTAMASGESKWITGSAARQDVQHWRAISGAVITGIDTVIADDCQLNVRSLHNIDIETVAQPKRVILDRRGRLPLTAKILENPETVMVMGPYRQELADLGVIQLEIQPLKTLLQTLSKQYQIYDVLIEAGATLSSAFLQEGLIDEMISYVAPTLLGQSARAMFNADFEYMAQQLRFKLLDVIQLDQDIRLRLIPTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Diaminohydroxyphosphoribosylaminopyrimidine Deaminase/5-Amino-6-(5-Phosphoribosylamino)Uracil Reductase from Acinetobacter Baumannii.
pubmed doi rcsb
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
molecule tags Oxidoreductase
source organism Acinetobacter baumannii
total genus 107
structure length 357
sequence length 357
chains with identical sequence B
ec nomenclature ec 1.1.1.193: 5-amino-6-(5-phosphoribosylamino)uracil reductase.
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00383 dCMP_cyt_deam_1 Cytidine and deoxycytidylate deaminase zinc-binding region
A PF01872 RibD_C RibD C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.140.10 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase, domain 2 3zpcA01
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 3zpcA02
1DYRA 4MSQA 2NYTA 2W9GA 1RG7A 2W3MA 1YSBA 4FGHA 4ELHA 1JTKA 1RB2A 4H98A 4KEBA 4KYAA 4P3RA 3F0XX 1U72A 1DG5A 2W3WA 4HA9A 3SA2A 1WKQA 3F0UX 1PD9A 4G8ZX 4NQLA 4LCNA 1DYHA 3SAIA 1SEJA 3VCOA 3JWCA 4G3MA 1JOLA 4F7OA 3IROA 4LC5A 3FRDX 4QLFA 5HUIA 4H97A 4OSGA 4LEKX 4XT7A 4K1RA 1CZ3A 4ILGC 4X5GA 2ZNRA 3NZ9X 3SRWX 1D1GA 1KMVA 4XE6X 1RA3A 1LUDA 2W3BA 3JWKA 3S3VA 3IA5A 2BLAA 3NXTA 1UX1A 1ZABA 1E26A 1S3WA 3EELA 3JSUA 4OWPB 5HSUA 2HVWA 3K47A 3OCQA 5DFRA 3K2HA 3OCHA 2O95A 4HRWA 4I1NA 4DDRA 4QHVA 1DDSA 1RE7A 5CCCA 3F91A 3R2NA 3DL6A 4ELBA 4EILA 3FREX 4MSJA 3NZ6X 1RX6A 3QFXA 4OWPA 5HPBA 1DIUA 3F0BX 3QLYA 3FQFA 3FY9X 5U26A 3SH2A 2C2TA 1S3YA 1DR3A 3L3RA 1DRAA 4QJCA 3QL3A 4ZFTA 4LAGX 5HI6A 3D80A 2W9HA 1LY3A 4IXED 3CSEA 3I8AX 1IA4A 4MS7A 2B3ZA 2BL9A 3IRNA 3GHVA 4M2XA 3SQYX 4I43B 2FR6A 4DPHA 2W3AA 1RA8A 2O3KA 3GYFA 2D5NA 2P87A 3QLRA 4PSTA 1DHJA 3FYVX 3SRSX 4IXGX 4D10F 3RG9A 2HM9A 3CD2A 3QG2A 1U70A 2ZNVA 1JOMA 4O8XB 4KM2A 3NRRA 2KCQA 2B3JA 4XT6A 1RX1A 3E1UA 4P66A 1RC4A 1AO8A 3DFRA 3KJSA 1DRHA 2BLBA 3GHWA 4CD2A 3SRRX 1DREA 3DH1A 3JTWA 4PSSA 4O8XA 3RO9A 7DFRA 1AI9A 1DLRA 1RA2A 5DXVA 3MPZA 4PDJA 2NX8A 2LF1A 2OG4A 2KKSA 3FQCA 5C2OA 4ECKA 4QFTA 2GD9A 3NXYA 1DF7A 3IJFX 1RX7A 1DHIA 4ELGA 2FZHA 4QJZD 2W9SA 2DHFA 2D30A 4M7VA 3TQBA 3FYWX 3F8ZA 3NZCX 1J3KA 3NXOA 3CLBA 3QLXA 2O7PA 5JG0X 4KJLA 4LD4A 1RA9A 2INQA 3EX8A 3Q1HA 1RF7A 4NX6A 2CIGA 1Z3AA 4KD7A 4P9EA 1TIYA 3RZVA 4Q6AA 4KNEA 3GI2A 4QI9A 4KJKA 1U71A 4P9DA 5FDAA 4X5HA 2Z3JA 5HQZA 1DISA 3FY8X 4WIFA 2PW9A 3UM6A 3KFYA 1DR4A 4P9CA 3FQZA 1VDRA 2CD2A 1KLKA 4PSYA 3N0HA 4P68A 1BOZA 1UX0A 5E8QA 3FRAX 1VJ3A 2QK8A 1P6OA 1DR1A 1KMSA 3QLSA 5HF2X 1DR5A 2FZIA 3TQ9A 3QLZA 3IX9A 4MSDA 4ELEA 1DAJA 3HJ3A 4LCPA 1DDRA 3DL5A 2RPZA 3FQ0A 3K74A 3HBBA 4DP3A 4XT8A 3IA4A 3NZDA 1DYJA 1CTUA 3UM5A 3GHCA 4X5FA 2ANQA 3R33A 3D84X 3TD8A 4OCMB 5DCAJ 3TQ8A 3FQOA 4XECX 3NU0A 4Q0DA 4QLGA 2XW7A 3M08A 1MVTA 3SGYA 3OAFA 3FRFX 1R5TA 2HQPA 4KY8A 3DAUA 2G6VA 1CD2A 2ITHA 1RB7A 3RZUA 4OCMA 1DRFA 4M7UA 4KY4A 1HFPA 1WN6A 1IA2A 4Q0EA 1CTTA 1AOEA 4M6KA 1BZFA 4ZD4A 4FHBA 5HSRA 4HOFA 4KJJA 4XT5A 3FQVA 4H95A 4H96A 1OI0A 1RB3A 1YSDA 1PDBA 2OBCA 1DG7A 1DR6A 3E0BA 3CL9A 1UWZA 4EG2A 4XT4A 3OJ6A 3FL8A 3NZAX 5HVEA 2ANOA 1UAQA 3F0VX 3DGAA 2FR5A 4MSMA 5M59B 2Z3GA 3S7AA 3FS6A 4OCLB 3G8QA 2Z3HA 2A8NA 4LD2A 3QYOA 5HT5A 1OHJA 3F0QX 1DR7A 3NXXA 5ECXA 3ROAA 1ZDRA 1TDRA 2P4GA 1HFQA 1ALNA 4KLXA 4JXEA 4EIGA 1IA1A 1PD8A 1S3VA 3KJRA 4OCLA 4HA7A 3B8FA 4I13A 2H2QA 2P8RA 3SRQX 3UM8A 3K45A 3F8YA 3SRUX 3NXRA 4EIZA 5HQYA 3SA1A 3ZPCA 8DFRA 4BGDC 3NXVA 4KL9A 1M7AA 4GH8A 4HOGA 3QL0A 1QZFA 4WIGA 3FRBX 1R5XA 3QLWA 3S9UA 3NZBX 1J3JA 2BLCA 2W3VA 3QGTA 3TQAA 1DHFA 1RX5A 2KGKA 1RA1A 3EIGA 2FZJA 4PQTA 5ECCA 4HRQA 1OHKA 5CC9A 4ELFA 4Q67A 2OIPA 4DFRA 4E0QA 2C2SA 3SR5X 3IRMA 2L28A 3DATA 5HF0X 4ZFRA 3DG8A 3NTZA 4PTJA 5GAOA 5U27A 1M79A 4OR7A 6DFRA 4IXFX 4KITC 1WN5A 2G84A 1DYIA 1JUVA 4PTHA 4KM0A 3ZPGA 3DRCA 3M09A 1DLSA 3EEJA 1RH3A 4KFJA 4O8YB 4F3WA 1RD7A 4NX7A 4HOEA 5HVBA 1LY4A 3EEMA 1S3UA 4ZD5A 1OX7A 1J3IA 4X5IA 3LG4A 2QLCA 3JVXA 1DRBA 2HXVA 4RGCA 4O8YA 1MVSA 2DRCA 4KBNA 4LAHX 3EEKA 1M78A 1MQ0A 4KAKA 3I3RA 3INVA 1WWRA 3ZEFB 2D0KA 4X5JA 5M52C 1DR2A 3JW3A 4G95A 3JWMA 1VQ2A 4FGGA 5CW6A 5EAJA 5JA3A 4P3QA 3F0SX 3QYLA 3SBGA 4LAEX 2ZZAA 1RX9A 2W4LA 4OCNB 4LCOA 1IA3A 3KY8A 3DMOA 4DPDA 4TU5X 1RX2A 2W9TA 1AF2A 2Z3IA 3KGYA 1HFRA 1RX8A 4EJ1A 3FL9A 4M6JA 4XRBA 2O96A 1RX3A 2AZNA 2HVVA 3JW5A 3JWFA 1DG8A 5HT4A 4QLEA 1RX4A 2JYBA 1YHOA 4OCNA 4M6LA
chains in the Genus database with same CATH superfamily
1DYRA 4MSQA 2NYTA 2W9GA 1RG7A 2W3MA 1YSBA 4FGHA 4ELHA 1JTKA 1RB2A 4H98A 4KEBA 1G8MA 4KYAA 4P3RA 3F0XX 1U72A 1DG5A 2W3WA 4HA9A 3SA2A 1WKQA 3F0UX 2B1GA 1PD9A 4G8ZX 4NQLA 4LCNA 1DYHA 3SAIA 1SEJA 3VCOA 3JWCA 4G3MA 1JOLA 4F7OA 3IROA 4LC5A 3FRDX 4QLFA 5HUIA 4H97A 4OSGA 4LEKX 4XT7A 4K1RA 1CZ3A 4ILGC 4X5GA 2ZNRA 3NZ9X 3SRWX 1D1GA 1KMVA 4XE6X 1RA3A 1LUDA 2W3BA 3JWKA 3S3VA 3IA5A 2BLAA 3NXTA 4EHIA 1UX1A 1ZABA 1E26A 1S3WA 3EELA 3JSUA 4OWPB 5HSUA 2HVWA 3K47A 3OCQA 5DFRA 3K2HA 3OCHA 2O95A 4HRWA 4I1NA 4DDRA 4QHVA 1DDSA 1RE7A 5CCCA 3F91A 3R2NA 3DL6A 1THZA 4ELBA 4EILA 3FREX 4MSJA 3NZ6X 1RX6A 3QFXA 4OWPA 5HPBA 1DIUA 3F0BX 3QLYA 3FQFA 3FY9X 5U26A 3SH2A 2C2TA 1S3YA 1DR3A 3L3RA 1DRAA 4QJCA 3QL3A 4ZFTA 4LAGX 5HI6A 3D80A 2W9HA 1LY3A 4IXED 3CSEA 3I8AX 1IA4A 4MS7A 2B3ZA 2BL9A 3IRNA 3GHVA 4M2XA 3SQYX 4I43B 2FR6A 4DPHA 2W3AA 1RA8A 2O3KA 3GYFA 2D5NA 2P87A 3QLRA 4PSTA 1DHJA 3FYVX 3SRSX 4IXGX 4D10F 3RG9A 2HM9A 3CD2A 3QG2A 1U70A 2ZNVA 1JOMA 4O8XB 4KM2A 3ZZMA 3NRRA 2KCQA 2B3JA 4XT6A 1RX1A 3E1UA 4P66A 1RC4A 1AO8A 3DFRA 3KJSA 1DRHA 2BLBA 3GHWA 4CD2A 3SRRX 1DREA 3DH1A 3JTWA 4PSSA 4O8XA 3RO9A 7DFRA 1AI9A 1DLRA 1RA2A 5DXVA 3MPZA 4PDJA 1ZCZA 2NX8A 2LF1A 2OG4A 2KKSA 3FQCA 5C2OA 4ECKA 4QFTA 2GD9A 3NXYA 1DF7A 3IJFX 1RX7A 1DHIA 4ELGA 2FZHA 4QJZD 2W9SA 2DHFA 2D30A 4M7VA 3TQBA 3FYWX 3F8ZA 3NZCX 1J3KA 3NXOA 3CLBA 3QLXA 2O7PA 5JG0X 4KJLA 4LD4A 1RA9A 2INQA 3EX8A 3Q1HA 1RF7A 4NX6A 2CIGA 1Z3AA 4KD7A 4P9EA 1TIYA 3RZVA 4Q6AA 4KNEA 3GI2A 4QI9A 4KJKA 1U71A 4P9DA 5FDAA 3BH1A 4X5HA 2Z3JA 5HQZA 2IU3A 1DISA 3FY8X 4WIFA 2PW9A 3UM6A 3KFYA 1DR4A 4P9CA 3FQZA 1VDRA 2CD2A 1KLKA 4PSYA 3N0HA 4P68A 1BOZA 1UX0A 5E8QA 3FRAX 1VJ3A 2QK8A 1P6OA 1DR1A 1KMSA 3QLSA 5HF2X 1DR5A 2FZIA 3TQ9A 3QLZA 3IX9A 4MSDA 4ELEA 1DAJA 3HJ3A 4LCPA 1DDRA 3DL5A 2RPZA 3FQ0A 3K74A 3HBBA 4DP3A 4XT8A 3IA4A 3NZDA 1DYJA 1CTUA 3UM5A 3GHCA 4X5FA 2ANQA 3R33A 3D84X 3TD8A 4OCMB 5DCAJ 3TQ8A 3FQOA 4XECX 3NU0A 4Q0DA 4QLGA 3VX8A 2XW7A 3M08A 1MVTA 3SGYA 3OAFA 3FRFX 1R5TA 2HQPA 4KY8A 3DAUA 2G6VA 4GGMX 1CD2A 2ITHA 1RB7A 3RZUA 4OCMA 1DRFA 4M7UA 4KY4A 1HFPA 1WN6A 1IA2A 4Q0EA 1CTTA 1AOEA 4M6KA 1BZFA 4ZD4A 4FHBA 5HSRA 4HOFA 4KJJA 4XT5A 3FQVA 4H95A 1M9NA 4H96A 1OI0A 1RB3A 1YSDA 1PDBA 2OBCA 1DG7A 1DR6A 3E0BA 3CL9A 1UWZA 4EG2A 4XT4A 3OJ6A 3FL8A 3NZAX 5HVEA 2ANOA 1UAQA 3F0VX 3DGAA 2FR5A 4MSMA 5M59B 2Z3GA 3S7AA 3FS6A 4OCLB 3G8QA 2Z3HA 4A1OA 2A8NA 4LD2A 3QYOA 5HT5A 1OHJA 3F0QX 1DR7A 3NXXA 5ECXA 3ROAA 1ZDRA 1TDRA 2P4GA 1HFQA 1ALNA 4KLXA 4JXEA 4EIGA 1IA1A 1PD8A 1S3VA 1PKXA 4J6EA 3KJRA 4OCLA 4HA7A 3B8FA 4I13A 2H2QA 2P8RA 3SRQX 3UM8A 3K45A 3F8YA 3SRUX 3NXRA 4EIZA 5HQYA 3SA1A 3ZPCA 8DFRA 4BGDC 3NXVA 4KL9A 1M7AA 4GH8A 4HOGA 3QL0A 1QZFA 4WIGA 3FRBX 1R5XA 3QLWA 3S9UA 3NZBX 1J3JA 2BLCA 2W3VA 3QGTA 3TQAA 1DHFA 1RX5A 2KGKA 1RA1A 3EIGA 2FZJA 4PQTA 5ECCA 4HRQA 1OHKA 5CC9A 4ELFA 2IU0A 4Q67A 2OIPA 4DFRA 4E0QA 2C2SA 3SR5X 3IRMA 2L28A 3DATA 5HF0X 4ZFRA 3DG8A 3NTZA 4PTJA 5GAOA 5U27A 1M79A 4OR7A 6DFRA 4IXFX 4KITC 1WN5A 2G84A 1DYIA 1JUVA 4PTHA 4KM0A 3ZPGA 3DRCA 3M09A 1DLSA 3EEJA 1RH3A 4KFJA 1VK9A 4O8YB 4F3WA 1RD7A 1OZ0A 4NX7A 4HOEA 5HVBA 2B1IA 1LY4A 3EEMA 1S3UA 4ZD5A 1OX7A 1J3IA 4X5IA 3LG4A 2QLCA 3JVXA 1DRBA 2HXVA 4RGCA 4O8YA 1MVSA 2DRCA 4KBNA 4LAHX 3EEKA 1M78A 1MQ0A 4KAKA 3I3RA 3INVA 1WWRA 3ZEFB 2D0KA 4X5JA 5M52C 1DR2A 3JW3A 4G95A 3JWMA 1VQ2A 4FGGA 5CW6A 5EAJA 5JA3A 4P3QA 3F0SX 3QYLA 3SBGA 4LAEX 2ZZAA 1RX9A 2W4LA 4OCNB 4LCOA 1IA3A 3KY8A 3DMOA 4DPDA 4TU5X 1RX2A 2W9TA 1AF2A 2Z3IA 1P4RA 3KGYA 1HFRA 1PL0A 1RX8A 4EJ1A 3FL9A 4M6JA 4XRBA 2O96A 1RX3A 2AZNA 2HVVA 3JW5A 3JWFA 1DG8A 5HT4A 4QLEA 1RX4A 2JYBA 1YHOA 4OCNA 4M6LA
chains in the Genus database with same CATH topology
1DYRA 4MSQA 2NYTA 2W9GA 1RG7A 2W3MA 1YSBA 4FGHA 4ELHA 1JTKA 1RB2A 4H98A 4KEBA 4KYAA 4P3RA 3F0XX 1U72A 1DG5A 2W3WA 4HA9A 3SA2A 1WKQA 3F0UX 1PD9A 4G8ZX 4NQLA 4LCNA 1DYHA 3SAIA 1SEJA 3VCOA 3JWCA 4G3MA 1JOLA 4F7OA 3IROA 4LC5A 3FRDX 4QLFA 5HUIA 4H97A 4OSGA 4LEKX 4XT7A 4K1RA 1CZ3A 4ILGC 4X5GA 2ZNRA 3NZ9X 3SRWX 1D1GA 1KMVA 4XE6X 1RA3A 1LUDA 2W3BA 3JWKA 3S3VA 3IA5A 2BLAA 3NXTA 1UX1A 1ZABA 1E26A 1S3WA 3EELA 3JSUA 4OWPB 5HSUA 2HVWA 3K47A 3OCQA 5DFRA 3K2HA 3OCHA 2O95A 4HRWA 4I1NA 4DDRA 4QHVA 1DDSA 1RE7A 5CCCA 3F91A 3R2NA 3DL6A 4ELBA 4EILA 3FREX 4MSJA 3NZ6X 1RX6A 3QFXA 4OWPA 5HPBA 1DIUA 3F0BX 3QLYA 3FQFA 3FY9X 5U26A 3SH2A 2C2TA 1S3YA 1DR3A 3L3RA 1DRAA 4QJCA 3QL3A 4ZFTA 4LAGX 5HI6A 3D80A 2W9HA 1LY3A 4IXED 3CSEA 3I8AX 1IA4A 4MS7A 2B3ZA 2BL9A 3IRNA 3GHVA 4M2XA 3SQYX 4I43B 2FR6A 4DPHA 2W3AA 1RA8A 2O3KA 3GYFA 2D5NA 2P87A 3QLRA 4PSTA 1DHJA 3FYVX 3SRSX 4IXGX 4D10F 3RG9A 2HM9A 3CD2A 3QG2A 1U70A 2ZNVA 1JOMA 4O8XB 4KM2A 3NRRA 2KCQA 2B3JA 4XT6A 1RX1A 3E1UA 4P66A 1RC4A 1AO8A 3DFRA 3KJSA 1DRHA 2BLBA 3GHWA 4CD2A 3SRRX 1DREA 3DH1A 3JTWA 4PSSA 4O8XA 3RO9A 7DFRA 1AI9A 1DLRA 1RA2A 5DXVA 3MPZA 4PDJA 2NX8A 2LF1A 2OG4A 2KKSA 3FQCA 5C2OA 4ECKA 4QFTA 2GD9A 3NXYA 1DF7A 3IJFX 1RX7A 1DHIA 4ELGA 2FZHA 4QJZD 2W9SA 2DHFA 2D30A 4M7VA 3TQBA 3FYWX 3F8ZA 3NZCX 1J3KA 3NXOA 3CLBA 3QLXA 2O7PA 5JG0X 4KJLA 4LD4A 1RA9A 2INQA 3EX8A 3Q1HA 1RF7A 4NX6A 2CIGA 1Z3AA 4KD7A 4P9EA 1TIYA 3RZVA 4Q6AA 4KNEA 3GI2A 4QI9A 4KJKA 1U71A 4P9DA 5FDAA 4X5HA 2Z3JA 5HQZA 1DISA 3FY8X 4WIFA 2PW9A 3UM6A 3KFYA 1DR4A 4P9CA 3FQZA 1VDRA 2CD2A 1KLKA 4PSYA 3N0HA 4P68A 1BOZA 1UX0A 5E8QA 3FRAX 1VJ3A 2QK8A 1P6OA 1DR1A 1KMSA 3QLSA 5HF2X 1DR5A 2FZIA 3TQ9A 3QLZA 3IX9A 4MSDA 4ELEA 1DAJA 3HJ3A 4LCPA 1DDRA 3DL5A 2RPZA 3FQ0A 3K74A 3HBBA 4DP3A 4XT8A 3IA4A 3NZDA 1DYJA 1CTUA 3UM5A 3GHCA 4X5FA 2ANQA 3R33A 3D84X 3TD8A 4OCMB 5DCAJ 3TQ8A 3FQOA 4XECX 3NU0A 4Q0DA 4QLGA 2XW7A 3M08A 1MVTA 3SGYA 3OAFA 3FRFX 1R5TA 2HQPA 4KY8A 3DAUA 2G6VA 1CD2A 2ITHA 1RB7A 3RZUA 4OCMA 1DRFA 4M7UA 4KY4A 1HFPA 1WN6A 1IA2A 4Q0EA 1CTTA 1AOEA 4M6KA 1BZFA 4ZD4A 4FHBA 5HSRA 4HOFA 4KJJA 4XT5A 3FQVA 4H95A 4H96A 1OI0A 1RB3A 1YSDA 1PDBA 2OBCA 1DG7A 1DR6A 3E0BA 3CL9A 1UWZA 4EG2A 4XT4A 3OJ6A 3FL8A 3NZAX 5HVEA 2ANOA 1UAQA 3F0VX 3DGAA 2FR5A 4MSMA 5M59B 2Z3GA 3S7AA 3FS6A 4OCLB 3G8QA 2Z3HA 2A8NA 4LD2A 3QYOA 5HT5A 1OHJA 3F0QX 1DR7A 3NXXA 5ECXA 3ROAA 1ZDRA 1TDRA 2P4GA 1HFQA 1ALNA 4KLXA 4JXEA 4EIGA 1IA1A 1PD8A 1S3VA 3KJRA 4OCLA 4HA7A 3B8FA 4I13A 2H2QA 2P8RA 3SRQX 3UM8A 3K45A 3F8YA 3SRUX 3NXRA 4EIZA 5HQYA 3SA1A 3ZPCA 8DFRA 4BGDC 3NXVA 4KL9A 1M7AA 4GH8A 4HOGA 3QL0A 1QZFA 4WIGA 3FRBX 1R5XA 3QLWA 3S9UA 3NZBX 1J3JA 2BLCA 2W3VA 3QGTA 3TQAA 1DHFA 1RX5A 2KGKA 1RA1A 3EIGA 2FZJA 4PQTA 5ECCA 4HRQA 1OHKA 5CC9A 4ELFA 4Q67A 2OIPA 4DFRA 4E0QA 2C2SA 3SR5X 3IRMA 2L28A 3DATA 5HF0X 4ZFRA 3DG8A 3NTZA 4PTJA 5GAOA 5U27A 1M79A 4OR7A 6DFRA 4IXFX 4KITC 1WN5A 2G84A 1DYIA 1JUVA 4PTHA 4KM0A 3ZPGA 3DRCA 3M09A 1DLSA 3EEJA 1RH3A 4KFJA 4O8YB 4F3WA 1RD7A 4NX7A 4HOEA 5HVBA 1LY4A 3EEMA 1S3UA 4ZD5A 1OX7A 1J3IA 4X5IA 3LG4A 2QLCA 3JVXA 1DRBA 2HXVA 4RGCA 4O8YA 1MVSA 2DRCA 4KBNA 4LAHX 3EEKA 1M78A 1MQ0A 4KAKA 3I3RA 3INVA 1WWRA 3ZEFB 2D0KA 4X5JA 5M52C 1DR2A 3JW3A 4G95A 3JWMA 1VQ2A 4FGGA 5CW6A 5EAJA 5JA3A 4P3QA 3F0SX 3QYLA 3SBGA 4LAEX 2ZZAA 1RX9A 2W4LA 4OCNB 4LCOA 1IA3A 3KY8A 3DMOA 4DPDA 4TU5X 1RX2A 2W9TA 1AF2A 2Z3IA 3KGYA 1HFRA 1RX8A 4EJ1A 3FL9A 4M6JA 4XRBA 2O96A 1RX3A 2AZNA 2HVVA 3JW5A 3JWFA 1DG8A 5HT4A 4QLEA 1RX4A 2JYBA 1YHOA 4OCNA 4M6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DYR A;  4MSQ A;  2NYT A;  2W9G A;  1RG7 A;  2W3M A;  1YSB A;  4FGH A;  4ELH A;  1JTK A;  1RB2 A;  4H98 A;  4KEB A;  4KYA A;  4P3R A;  3F0X X;  1U72 A;  1DG5 A;  2W3W A;  4HA9 A;  3SA2 A;  1WKQ A;  3F0U X;  1PD9 A;  4G8Z X;  4NQL A;  4LCN A;  1DYH A;  3SAI A;  1SEJ A;  3VCO A;  3JWC A;  4G3M A;  1JOL A;  4F7O A;  3IRO A;  4LC5 A;  3FRD X;  4QLF A;  5HUI A;  4H97 A;  4OSG A;  4LEK X;  4XT7 A;  4K1R A;  1CZ3 A;  4ILG C;  4X5G A;  2ZNR A;  3NZ9 X;  3SRW X;  1D1G A;  1KMV A;  4XE6 X;  1RA3 A;  1LUD A;  2W3B A;  3JWK A;  3S3V A;  3IA5 A;  2BLA A;  3NXT A;  1UX1 A;  1ZAB A;  1E26 A;  1S3W A;  3EEL A;  3JSU A;  4OWP B;  5HSU A;  2HVW A;  3K47 A;  3OCQ A;  5DFR A;  3K2H A;  3OCH A;  2O95 A;  4HRW A;  4I1N A;  4DDR A;  4QHV A;  1DDS A;  1RE7 A;  5CCC A;  3F91 A;  3R2N A;  3DL6 A;  4ELB A;  4EIL A;  3FRE X;  4MSJ A;  3NZ6 X;  1RX6 A;  3QFX A;  4OWP A;  5HPB A;  1DIU A;  3F0B X;  3QLY A;  3FQF A;  3FY9 X;  5U26 A;  3SH2 A;  2C2T A;  1S3Y A;  1DR3 A;  3L3R A;  1DRA A;  4QJC A;  3QL3 A;  4ZFT A;  4LAG X;  5HI6 A;  3D80 A;  2W9H A;  1LY3 A;  4IXE D;  3CSE A;  3I8A X;  1IA4 A;  4MS7 A;  2B3Z A;  2BL9 A;  3IRN A;  3GHV A;  4M2X A;  3SQY X;  4I43 B;  2FR6 A;  4DPH A;  2W3A A;  1RA8 A;  2O3K A;  3GYF A;  2D5N A;  2P87 A;  3QLR A;  4PST A;  1DHJ A;  3FYV X;  3SRS X;  4IXG X;  4D10 F;  3RG9 A;  2HM9 A;  3CD2 A;  3QG2 A;  1U70 A;  2ZNV A;  1JOM A;  4O8X B;  4KM2 A;  3NRR A;  2KCQ A;  2B3J A;  4XT6 A;  1RX1 A;  3E1U A;  4P66 A;  1RC4 A;  1AO8 A;  3DFR A;  3KJS A;  1DRH A;  2BLB A;  3GHW A;  4CD2 A;  3SRR X;  1DRE A;  3DH1 A;  3JTW A;  4PSS A;  4O8X A;  3RO9 A;  7DFR A;  1AI9 A;  1DLR A;  1RA2 A;  5DXV A;  3MPZ A;  4PDJ A;  2NX8 A;  2LF1 A;  2OG4 A;  2KKS A;  3FQC A;  5C2O A;  4ECK A;  4QFT A;  2GD9 A;  3NXY A;  1DF7 A;  3IJF X;  1RX7 A;  1DHI A;  4ELG A;  2FZH A;  4QJZ D;  2W9S A;  2DHF A;  2D30 A;  4M7V A;  3TQB A;  3FYW X;  3F8Z A;  3NZC X;  1J3K A;  3NXO A;  3CLB A;  3QLX A;  2O7P A;  5JG0 X;  4KJL A;  4LD4 A;  1RA9 A;  2INQ A;  3EX8 A;  3Q1H A;  1RF7 A;  4NX6 A;  2CIG A;  1Z3A A;  4KD7 A;  4P9E A;  1TIY A;  3RZV A;  4Q6A A;  4KNE A;  3GI2 A;  4QI9 A;  4KJK A;  1U71 A;  4P9D A;  5FDA A;  4X5H A;  2Z3J A;  5HQZ A;  1DIS A;  3FY8 X;  4WIF A;  2PW9 A;  3UM6 A;  3KFY A;  1DR4 A;  4P9C A;  3FQZ A;  1VDR A;  2CD2 A;  1KLK A;  4PSY A;  3N0H A;  4P68 A;  1BOZ A;  1UX0 A;  5E8Q A;  3FRA X;  1VJ3 A;  2QK8 A;  1P6O A;  1DR1 A;  1KMS A;  3QLS A;  5HF2 X;  1DR5 A;  2FZI A;  3TQ9 A;  3QLZ A;  3IX9 A;  4MSD A;  4ELE A;  1DAJ A;  3HJ3 A;  4LCP A;  1DDR A;  3DL5 A;  2RPZ A;  3FQ0 A;  3K74 A;  3HBB A;  4DP3 A;  4XT8 A;  3IA4 A;  3NZD A;  1DYJ A;  1CTU A;  3UM5 A;  3GHC A;  4X5F A;  2ANQ A;  3R33 A;  3D84 X;  3TD8 A;  4OCM B;  5DCA J;  3TQ8 A;  3FQO A;  4XEC X;  3NU0 A;  4Q0D A;  4QLG A;  2XW7 A;  3M08 A;  1MVT A;  3SGY A;  3OAF A;  3FRF X;  1R5T A;  2HQP A;  4KY8 A;  3DAU A;  2G6V A;  1CD2 A;  2ITH A;  1RB7 A;  3RZU A;  4OCM A;  1DRF A;  4M7U A;  4KY4 A;  1HFP A;  1WN6 A;  1IA2 A;  4Q0E A;  1CTT A;  1AOE A;  4M6K A;  1BZF A;  4ZD4 A;  4FHB A;  5HSR A;  4HOF A;  4KJJ A;  4XT5 A;  3FQV A;  4H95 A;  4H96 A;  1OI0 A;  1RB3 A;  1YSD A;  1PDB A;  2OBC A;  1DG7 A;  1DR6 A;  3E0B A;  3CL9 A;  1UWZ A;  4EG2 A;  4XT4 A;  3OJ6 A;  3FL8 A;  3NZA X;  5HVE A;  2ANO A;  1UAQ A;  3F0V X;  3DGA A;  2FR5 A;  4MSM A;  5M59 B;  2Z3G A;  3S7A A;  3FS6 A;  4OCL B;  3G8Q A;  2Z3H A;  2A8N A;  4LD2 A;  3QYO A;  5HT5 A;  1OHJ A;  3F0Q X;  1DR7 A;  3NXX A;  5ECX A;  3ROA A;  1ZDR A;  1TDR A;  2P4G A;  1HFQ A;  1ALN A;  4KLX A;  4JXE A;  4EIG A;  1IA1 A;  1PD8 A;  1S3V A;  3KJR A;  4OCL A;  4HA7 A;  3B8F A;  4I13 A;  2H2Q A;  2P8R A;  3SRQ X;  3UM8 A;  3K45 A;  3F8Y A;  3SRU X;  3NXR A;  4EIZ A;  5HQY A;  3SA1 A;  3ZPC A;  8DFR A;  4BGD C;  3NXV A;  4KL9 A;  1M7A A;  4GH8 A;  4HOG A;  3QL0 A;  1QZF A;  4WIG A;  3FRB X;  1R5X A;  3QLW A;  3S9U A;  3NZB X;  1J3J A;  2BLC A;  2W3V A;  3QGT A;  3TQA A;  1DHF A;  1RX5 A;  2KGK A;  1RA1 A;  3EIG A;  2FZJ A;  4PQT A;  5ECC A;  4HRQ A;  1OHK A;  5CC9 A;  4ELF A;  4Q67 A;  2OIP A;  4DFR A;  4E0Q A;  2C2S A;  3SR5 X;  3IRM A;  2L28 A;  3DAT A;  5HF0 X;  4ZFR A;  3DG8 A;  3NTZ A;  4PTJ A;  5GAO A;  5U27 A;  1M79 A;  4OR7 A;  6DFR A;  4IXF X;  4KIT C;  1WN5 A;  2G84 A;  1DYI A;  1JUV A;  4PTH A;  4KM0 A;  3ZPG A;  3DRC A;  3M09 A;  1DLS A;  3EEJ A;  1RH3 A;  4KFJ A;  4O8Y B;  4F3W A;  1RD7 A;  4NX7 A;  4HOE A;  5HVB A;  1LY4 A;  3EEM A;  1S3U A;  4ZD5 A;  1OX7 A;  1J3I A;  4X5I A;  3LG4 A;  2QLC A;  3JVX A;  1DRB A;  2HXV A;  4RGC A;  4O8Y A;  1MVS A;  2DRC A;  4KBN A;  4LAH X;  3EEK A;  1M78 A;  1MQ0 A;  4KAK A;  3I3R A;  3INV A;  1WWR A;  3ZEF B;  2D0K A;  4X5J A;  5M52 C;  1DR2 A;  3JW3 A;  4G95 A;  3JWM A;  1VQ2 A;  4FGG A;  5CW6 A;  5EAJ A;  5JA3 A;  4P3Q A;  3F0S X;  3QYL A;  3SBG A;  4LAE X;  2ZZA A;  1RX9 A;  2W4L A;  4OCN B;  4LCO A;  1IA3 A;  3KY8 A;  3DMO A;  4DPD A;  4TU5 X;  1RX2 A;  2W9T A;  1AF2 A;  2Z3I A;  3KGY A;  1HFR A;  1RX8 A;  4EJ1 A;  3FL9 A;  4M6J A;  4XRB A;  2O96 A;  1RX3 A;  2AZN A;  2HVV A;  3JW5 A;  3JWF A;  1DG8 A;  5HT4 A;  4QLE A;  1RX4 A;  2JYB A;  1YHO A;  4OCN A;  4M6L A; 
#chains in the Genus database with same CATH topology
 1DYR A;  4MSQ A;  2NYT A;  2W9G A;  1RG7 A;  2W3M A;  1YSB A;  4FGH A;  4ELH A;  1JTK A;  1RB2 A;  4H98 A;  4KEB A;  1G8M A;  4KYA A;  4P3R A;  3F0X X;  1U72 A;  1DG5 A;  2W3W A;  4HA9 A;  3SA2 A;  1WKQ A;  3F0U X;  2B1G A;  1PD9 A;  4G8Z X;  4NQL A;  4LCN A;  1DYH A;  3SAI A;  1SEJ A;  3VCO A;  3JWC A;  4G3M A;  1JOL A;  4F7O A;  3IRO A;  4LC5 A;  3FRD X;  4QLF A;  5HUI A;  4H97 A;  4OSG A;  4LEK X;  4XT7 A;  4K1R A;  1CZ3 A;  4ILG C;  4X5G A;  2ZNR A;  3NZ9 X;  3SRW X;  1D1G A;  1KMV A;  4XE6 X;  1RA3 A;  1LUD A;  2W3B A;  3JWK A;  3S3V A;  3IA5 A;  2BLA A;  3NXT A;  4EHI A;  1UX1 A;  1ZAB A;  1E26 A;  1S3W A;  3EEL A;  3JSU A;  4OWP B;  5HSU A;  2HVW A;  3K47 A;  3OCQ A;  5DFR A;  3K2H A;  3OCH A;  2O95 A;  4HRW A;  4I1N A;  4DDR A;  4QHV A;  1DDS A;  1RE7 A;  5CCC A;  3F91 A;  3R2N A;  3DL6 A;  1THZ A;  4ELB A;  4EIL A;  3FRE X;  4MSJ A;  3NZ6 X;  1RX6 A;  3QFX A;  4OWP A;  5HPB A;  1DIU A;  3F0B X;  3QLY A;  3FQF A;  3FY9 X;  5U26 A;  3SH2 A;  2C2T A;  1S3Y A;  1DR3 A;  3L3R A;  1DRA A;  4QJC A;  3QL3 A;  4ZFT A;  4LAG X;  5HI6 A;  3D80 A;  2W9H A;  1LY3 A;  4IXE D;  3CSE A;  3I8A X;  1IA4 A;  4MS7 A;  2B3Z A;  2BL9 A;  3IRN A;  3GHV A;  4M2X A;  3SQY X;  4I43 B;  2FR6 A;  4DPH A;  2W3A A;  1RA8 A;  2O3K A;  3GYF A;  2D5N A;  2P87 A;  3QLR A;  4PST A;  1DHJ A;  3FYV X;  3SRS X;  4IXG X;  4D10 F;  3RG9 A;  2HM9 A;  3CD2 A;  3QG2 A;  1U70 A;  2ZNV A;  1JOM A;  4O8X B;  4KM2 A;  3ZZM A;  3NRR A;  2KCQ A;  2B3J A;  4XT6 A;  1RX1 A;  3E1U A;  4P66 A;  1RC4 A;  1AO8 A;  3DFR A;  3KJS A;  1DRH A;  2BLB A;  3GHW A;  4CD2 A;  3SRR X;  1DRE A;  3DH1 A;  3JTW A;  4PSS A;  4O8X A;  3RO9 A;  7DFR A;  1AI9 A;  1DLR A;  1RA2 A;  5DXV A;  3MPZ A;  4PDJ A;  1ZCZ A;  2NX8 A;  2LF1 A;  2OG4 A;  2KKS A;  3FQC A;  5C2O A;  4ECK A;  4QFT A;  2GD9 A;  3NXY A;  1DF7 A;  3IJF X;  1RX7 A;  1DHI A;  4ELG A;  2FZH A;  4QJZ D;  2W9S A;  2DHF A;  2D30 A;  4M7V A;  3TQB A;  3FYW X;  3F8Z A;  3NZC X;  1J3K A;  3NXO A;  3CLB A;  3QLX A;  2O7P A;  5JG0 X;  4KJL A;  4LD4 A;  1RA9 A;  2INQ A;  3EX8 A;  3Q1H A;  1RF7 A;  4NX6 A;  2CIG A;  1Z3A A;  4KD7 A;  4P9E A;  1TIY A;  3RZV A;  4Q6A A;  4KNE A;  3GI2 A;  4QI9 A;  4KJK A;  1U71 A;  4P9D A;  5FDA A;  3BH1 A;  4X5H A;  2Z3J A;  5HQZ A;  2IU3 A;  1DIS A;  3FY8 X;  4WIF A;  2PW9 A;  3UM6 A;  3KFY A;  1DR4 A;  4P9C A;  3FQZ A;  1VDR A;  2CD2 A;  1KLK A;  4PSY A;  3N0H A;  4P68 A;  1BOZ A;  1UX0 A;  5E8Q A;  3FRA X;  1VJ3 A;  2QK8 A;  1P6O A;  1DR1 A;  1KMS A;  3QLS A;  5HF2 X;  1DR5 A;  2FZI A;  3TQ9 A;  3QLZ A;  3IX9 A;  4MSD A;  4ELE A;  1DAJ A;  3HJ3 A;  4LCP A;  1DDR A;  3DL5 A;  2RPZ A;  3FQ0 A;  3K74 A;  3HBB A;  4DP3 A;  4XT8 A;  3IA4 A;  3NZD A;  1DYJ A;  1CTU A;  3UM5 A;  3GHC A;  4X5F A;  2ANQ A;  3R33 A;  3D84 X;  3TD8 A;  4OCM B;  5DCA J;  3TQ8 A;  3FQO A;  4XEC X;  3NU0 A;  4Q0D A;  4QLG A;  3VX8 A;  2XW7 A;  3M08 A;  1MVT A;  3SGY A;  3OAF A;  3FRF X;  1R5T A;  2HQP A;  4KY8 A;  3DAU A;  2G6V A;  4GGM X;  1CD2 A;  2ITH A;  1RB7 A;  3RZU A;  4OCM A;  1DRF A;  4M7U A;  4KY4 A;  1HFP A;  1WN6 A;  1IA2 A;  4Q0E A;  1CTT A;  1AOE A;  4M6K A;  1BZF A;  4ZD4 A;  4FHB A;  5HSR A;  4HOF A;  4KJJ A;  4XT5 A;  3FQV A;  4H95 A;  1M9N A;  4H96 A;  1OI0 A;  1RB3 A;  1YSD A;  1PDB A;  2OBC A;  1DG7 A;  1DR6 A;  3E0B A;  3CL9 A;  1UWZ A;  4EG2 A;  4XT4 A;  3OJ6 A;  3FL8 A;  3NZA X;  5HVE A;  2ANO A;  1UAQ A;  3F0V X;  3DGA A;  2FR5 A;  4MSM A;  5M59 B;  2Z3G A;  3S7A A;  3FS6 A;  4OCL B;  3G8Q A;  2Z3H A;  4A1O A;  2A8N A;  4LD2 A;  3QYO A;  5HT5 A;  1OHJ A;  3F0Q X;  1DR7 A;  3NXX A;  5ECX A;  3ROA A;  1ZDR A;  1TDR A;  2P4G A;  1HFQ A;  1ALN A;  4KLX A;  4JXE A;  4EIG A;  1IA1 A;  1PD8 A;  1S3V A;  1PKX A;  4J6E A;  3KJR A;  4OCL A;  4HA7 A;  3B8F A;  4I13 A;  2H2Q A;  2P8R A;  3SRQ X;  3UM8 A;  3K45 A;  3F8Y A;  3SRU X;  3NXR A;  4EIZ A;  5HQY A;  3SA1 A;  3ZPC A;  8DFR A;  4BGD C;  3NXV A;  4KL9 A;  1M7A A;  4GH8 A;  4HOG A;  3QL0 A;  1QZF A;  4WIG A;  3FRB X;  1R5X A;  3QLW A;  3S9U A;  3NZB X;  1J3J A;  2BLC A;  2W3V A;  3QGT A;  3TQA A;  1DHF A;  1RX5 A;  2KGK A;  1RA1 A;  3EIG A;  2FZJ A;  4PQT A;  5ECC A;  4HRQ A;  1OHK A;  5CC9 A;  4ELF A;  2IU0 A;  4Q67 A;  2OIP A;  4DFR A;  4E0Q A;  2C2S A;  3SR5 X;  3IRM A;  2L28 A;  3DAT A;  5HF0 X;  4ZFR A;  3DG8 A;  3NTZ A;  4PTJ A;  5GAO A;  5U27 A;  1M79 A;  4OR7 A;  6DFR A;  4IXF X;  4KIT C;  1WN5 A;  2G84 A;  1DYI A;  1JUV A;  4PTH A;  4KM0 A;  3ZPG A;  3DRC A;  3M09 A;  1DLS A;  3EEJ A;  1RH3 A;  4KFJ A;  1VK9 A;  4O8Y B;  4F3W A;  1RD7 A;  1OZ0 A;  4NX7 A;  4HOE A;  5HVB A;  2B1I A;  1LY4 A;  3EEM A;  1S3U A;  4ZD5 A;  1OX7 A;  1J3I A;  4X5I A;  3LG4 A;  2QLC A;  3JVX A;  1DRB A;  2HXV A;  4RGC A;  4O8Y A;  1MVS A;  2DRC A;  4KBN A;  4LAH X;  3EEK A;  1M78 A;  1MQ0 A;  4KAK A;  3I3R A;  3INV A;  1WWR A;  3ZEF B;  2D0K A;  4X5J A;  5M52 C;  1DR2 A;  3JW3 A;  4G95 A;  3JWM A;  1VQ2 A;  4FGG A;  5CW6 A;  5EAJ A;  5JA3 A;  4P3Q A;  3F0S X;  3QYL A;  3SBG A;  4LAE X;  2ZZA A;  1RX9 A;  2W4L A;  4OCN B;  4LCO A;  1IA3 A;  3KY8 A;  3DMO A;  4DPD A;  4TU5 X;  1RX2 A;  2W9T A;  1AF2 A;  2Z3I A;  1P4R A;  3KGY A;  1HFR A;  1PL0 A;  1RX8 A;  4EJ1 A;  3FL9 A;  4M6J A;  4XRB A;  2O96 A;  1RX3 A;  2AZN A;  2HVV A;  3JW5 A;  3JWF A;  1DG8 A;  5HT4 A;  4QLE A;  1RX4 A;  2JYB A;  1YHO A;  4OCN A;  4M6L A; 
#chains in the Genus database with same CATH homology
 1DYR A;  4MSQ A;  2NYT A;  2W9G A;  1RG7 A;  2W3M A;  1YSB A;  4FGH A;  4ELH A;  1JTK A;  1RB2 A;  4H98 A;  4KEB A;  4KYA A;  4P3R A;  3F0X X;  1U72 A;  1DG5 A;  2W3W A;  4HA9 A;  3SA2 A;  1WKQ A;  3F0U X;  1PD9 A;  4G8Z X;  4NQL A;  4LCN A;  1DYH A;  3SAI A;  1SEJ A;  3VCO A;  3JWC A;  4G3M A;  1JOL A;  4F7O A;  3IRO A;  4LC5 A;  3FRD X;  4QLF A;  5HUI A;  4H97 A;  4OSG A;  4LEK X;  4XT7 A;  4K1R A;  1CZ3 A;  4ILG C;  4X5G A;  2ZNR A;  3NZ9 X;  3SRW X;  1D1G A;  1KMV A;  4XE6 X;  1RA3 A;  1LUD A;  2W3B A;  3JWK A;  3S3V A;  3IA5 A;  2BLA A;  3NXT A;  1UX1 A;  1ZAB A;  1E26 A;  1S3W A;  3EEL A;  3JSU A;  4OWP B;  5HSU A;  2HVW A;  3K47 A;  3OCQ A;  5DFR A;  3K2H A;  3OCH A;  2O95 A;  4HRW A;  4I1N A;  4DDR A;  4QHV A;  1DDS A;  1RE7 A;  5CCC A;  3F91 A;  3R2N A;  3DL6 A;  4ELB A;  4EIL A;  3FRE X;  4MSJ A;  3NZ6 X;  1RX6 A;  3QFX A;  4OWP A;  5HPB A;  1DIU A;  3F0B X;  3QLY A;  3FQF A;  3FY9 X;  5U26 A;  3SH2 A;  2C2T A;  1S3Y A;  1DR3 A;  3L3R A;  1DRA A;  4QJC A;  3QL3 A;  4ZFT A;  4LAG X;  5HI6 A;  3D80 A;  2W9H A;  1LY3 A;  4IXE D;  3CSE A;  3I8A X;  1IA4 A;  4MS7 A;  2B3Z A;  2BL9 A;  3IRN A;  3GHV A;  4M2X A;  3SQY X;  4I43 B;  2FR6 A;  4DPH A;  2W3A A;  1RA8 A;  2O3K A;  3GYF A;  2D5N A;  2P87 A;  3QLR A;  4PST A;  1DHJ A;  3FYV X;  3SRS X;  4IXG X;  4D10 F;  3RG9 A;  2HM9 A;  3CD2 A;  3QG2 A;  1U70 A;  2ZNV A;  1JOM A;  4O8X B;  4KM2 A;  3NRR A;  2KCQ A;  2B3J A;  4XT6 A;  1RX1 A;  3E1U A;  4P66 A;  1RC4 A;  1AO8 A;  3DFR A;  3KJS A;  1DRH A;  2BLB A;  3GHW A;  4CD2 A;  3SRR X;  1DRE A;  3DH1 A;  3JTW A;  4PSS A;  4O8X A;  3RO9 A;  7DFR A;  1AI9 A;  1DLR A;  1RA2 A;  5DXV A;  3MPZ A;  4PDJ A;  2NX8 A;  2LF1 A;  2OG4 A;  2KKS A;  3FQC A;  5C2O A;  4ECK A;  4QFT A;  2GD9 A;  3NXY A;  1DF7 A;  3IJF X;  1RX7 A;  1DHI A;  4ELG A;  2FZH A;  4QJZ D;  2W9S A;  2DHF A;  2D30 A;  4M7V A;  3TQB A;  3FYW X;  3F8Z A;  3NZC X;  1J3K A;  3NXO A;  3CLB A;  3QLX A;  2O7P A;  5JG0 X;  4KJL A;  4LD4 A;  1RA9 A;  2INQ A;  3EX8 A;  3Q1H A;  1RF7 A;  4NX6 A;  2CIG A;  1Z3A A;  4KD7 A;  4P9E A;  1TIY A;  3RZV A;  4Q6A A;  4KNE A;  3GI2 A;  4QI9 A;  4KJK A;  1U71 A;  4P9D A;  5FDA A;  4X5H A;  2Z3J A;  5HQZ A;  1DIS A;  3FY8 X;  4WIF A;  2PW9 A;  3UM6 A;  3KFY A;  1DR4 A;  4P9C A;  3FQZ A;  1VDR A;  2CD2 A;  1KLK A;  4PSY A;  3N0H A;  4P68 A;  1BOZ A;  1UX0 A;  5E8Q A;  3FRA X;  1VJ3 A;  2QK8 A;  1P6O A;  1DR1 A;  1KMS A;  3QLS A;  5HF2 X;  1DR5 A;  2FZI A;  3TQ9 A;  3QLZ A;  3IX9 A;  4MSD A;  4ELE A;  1DAJ A;  3HJ3 A;  4LCP A;  1DDR A;  3DL5 A;  2RPZ A;  3FQ0 A;  3K74 A;  3HBB A;  4DP3 A;  4XT8 A;  3IA4 A;  3NZD A;  1DYJ A;  1CTU A;  3UM5 A;  3GHC A;  4X5F A;  2ANQ A;  3R33 A;  3D84 X;  3TD8 A;  4OCM B;  5DCA J;  3TQ8 A;  3FQO A;  4XEC X;  3NU0 A;  4Q0D A;  4QLG A;  2XW7 A;  3M08 A;  1MVT A;  3SGY A;  3OAF A;  3FRF X;  1R5T A;  2HQP A;  4KY8 A;  3DAU A;  2G6V A;  1CD2 A;  2ITH A;  1RB7 A;  3RZU A;  4OCM A;  1DRF A;  4M7U A;  4KY4 A;  1HFP A;  1WN6 A;  1IA2 A;  4Q0E A;  1CTT A;  1AOE A;  4M6K A;  1BZF A;  4ZD4 A;  4FHB A;  5HSR A;  4HOF A;  4KJJ A;  4XT5 A;  3FQV A;  4H95 A;  4H96 A;  1OI0 A;  1RB3 A;  1YSD A;  1PDB A;  2OBC A;  1DG7 A;  1DR6 A;  3E0B A;  3CL9 A;  1UWZ A;  4EG2 A;  4XT4 A;  3OJ6 A;  3FL8 A;  3NZA X;  5HVE A;  2ANO A;  1UAQ A;  3F0V X;  3DGA A;  2FR5 A;  4MSM A;  5M59 B;  2Z3G A;  3S7A A;  3FS6 A;  4OCL B;  3G8Q A;  2Z3H A;  2A8N A;  4LD2 A;  3QYO A;  5HT5 A;  1OHJ A;  3F0Q X;  1DR7 A;  3NXX A;  5ECX A;  3ROA A;  1ZDR A;  1TDR A;  2P4G A;  1HFQ A;  1ALN A;  4KLX A;  4JXE A;  4EIG A;  1IA1 A;  1PD8 A;  1S3V A;  3KJR A;  4OCL A;  4HA7 A;  3B8F A;  4I13 A;  2H2Q A;  2P8R A;  3SRQ X;  3UM8 A;  3K45 A;  3F8Y A;  3SRU X;  3NXR A;  4EIZ A;  5HQY A;  3SA1 A;  3ZPC A;  8DFR A;  4BGD C;  3NXV A;  4KL9 A;  1M7A A;  4GH8 A;  4HOG A;  3QL0 A;  1QZF A;  4WIG A;  3FRB X;  1R5X A;  3QLW A;  3S9U A;  3NZB X;  1J3J A;  2BLC A;  2W3V A;  3QGT A;  3TQA A;  1DHF A;  1RX5 A;  2KGK A;  1RA1 A;  3EIG A;  2FZJ A;  4PQT A;  5ECC A;  4HRQ A;  1OHK A;  5CC9 A;  4ELF A;  4Q67 A;  2OIP A;  4DFR A;  4E0Q A;  2C2S A;  3SR5 X;  3IRM A;  2L28 A;  3DAT A;  5HF0 X;  4ZFR A;  3DG8 A;  3NTZ A;  4PTJ A;  5GAO A;  5U27 A;  1M79 A;  4OR7 A;  6DFR A;  4IXF X;  4KIT C;  1WN5 A;  2G84 A;  1DYI A;  1JUV A;  4PTH A;  4KM0 A;  3ZPG A;  3DRC A;  3M09 A;  1DLS A;  3EEJ A;  1RH3 A;  4KFJ A;  4O8Y B;  4F3W A;  1RD7 A;  4NX7 A;  4HOE A;  5HVB A;  1LY4 A;  3EEM A;  1S3U A;  4ZD5 A;  1OX7 A;  1J3I A;  4X5I A;  3LG4 A;  2QLC A;  3JVX A;  1DRB A;  2HXV A;  4RGC A;  4O8Y A;  1MVS A;  2DRC A;  4KBN A;  4LAH X;  3EEK A;  1M78 A;  1MQ0 A;  4KAK A;  3I3R A;  3INV A;  1WWR A;  3ZEF B;  2D0K A;  4X5J A;  5M52 C;  1DR2 A;  3JW3 A;  4G95 A;  3JWM A;  1VQ2 A;  4FGG A;  5CW6 A;  5EAJ A;  5JA3 A;  4P3Q A;  3F0S X;  3QYL A;  3SBG A;  4LAE X;  2ZZA A;  1RX9 A;  2W4L A;  4OCN B;  4LCO A;  1IA3 A;  3KY8 A;  3DMO A;  4DPD A;  4TU5 X;  1RX2 A;  2W9T A;  1AF2 A;  2Z3I A;  3KGY A;  1HFR A;  1RX8 A;  4EJ1 A;  3FL9 A;  4M6J A;  4XRB A;  2O96 A;  1RX3 A;  2AZN A;  2HVV A;  3JW5 A;  3JWF A;  1DG8 A;  5HT4 A;  4QLE A;  1RX4 A;  2JYB A;  1YHO A;  4OCN A;  4M6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...