3ZQLA

Dna-bound form of tetr-like repressor simr
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
236
structure length
236
Chain Sequence
b'VSIWMHPEPAGRRSARSHRTLSRDQIVRAAVKVADTEGVEAASMRRVAAELGAGTMSLYYYVPTKEDLVELMVDEVIGETRLPDRPGPDWRAALTLAANEKRALWLRHPWLATAWRNGHPVWGPNSLRQQEFVLGTLGVFDLQVDELLSLIGLYNGYVESFVRNEVGWLEEARRTKVDMREWMRRSGPYAQQLVDSGEYPMFARVLAETVAPHMGPDQRFRSGLERLLDSIGASLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE REPRESSOR SIMREG2
publication title The Crystal Structure of the Tetr Family Transcriptional Repressor Simr Bound to DNA and the Role of a Flexible N-Terminal Extension in Minor Groove Binding.
pubmed doi rcsb
source organism Streptomyces antibioticus
molecule tags Protein-dna complex
total genus 85
structure length 236
sequence length 236
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3zqlA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3zqlA02
2JA5J 4S0HB 2ZOZA 3BT9A 1WGXA 4C3JJ 1I6HJ 2E2HJ 3ZQGA 2MGQA 2ZCXA 3BTCA 4M3DA 2DA2A 1RR7A 2R5YB 4A3BJ 3B6CA 2FX0A 3EGQA 3VW2A 3GTGJ 1BW6A 1GDTA 2E19A 2EZLA 1JUSA 1UHSA 1T33A 3CDLA 2O9LA 2FBQA 2PZ9A 3AQSA 4MXMA 3K2AA 2CUEA 4A3CJ 3VOXA 2JWTA 5J1RA 4HKUA 4XRSG 1B8IB 5FLMJ 4UDSA 3Q3SA 3E7LA 1FTTA 5HAWA 3MNLA 2DMPA 2K40A 5HBUA 3MN2A 4PXIA 2JA8J 5EFYA 1W0TA 2UXIA 1P7JA 1JT0A 1RPWA 3Q0UA 5H9TA 2CQQA 3VIBA 4BBSJ 3KKDA 2ZCNA 2H1KA 2ID3A 4ME9A 4QTRA 3HGGA 2OI8A 1AU7A 1R9TJ 5C3EJ 4IHXA 4CYCA 4QIWN 1FIAA 1MSFC 3HE0A 5BNGA 2ECCA 3ANPA 4ACIA 1IG7A 2E1OA 3BRUA 3G1LA 1U9NA 4BBRJ 4UUTA 2HXOA 1E3OC 4AC0A 1I3QJ 2LKXA 3S15J 1JUPA 1GVDA 1MBEA 5DTDA 2VKVA 2NVTJ 5FLVA 2NP5A 4GFBA 3I4MJ 1Y1VJ 4XRMA 2G7GA 1IJWC 2M9HA 5FKMA 1NK3P 2O8KA 3CQZJ 3WHBA 5GPCA 1MBGA 2CU7A 3I4NJ 2QF7A 4GCTA 4FE4A 3FKIJ 3QQAA 5CXIA 3TW7A 1TWHJ 2LLKA 3B6AA 3O8HA 3CWRA 3NPIA 5K7ZA 1F36A 2DN0A 3BHQA 3HOUJ 1IUFA 3RQIA 4XICA 2WB1N 4V2GA 3JRCA 1LFUP 4NDLA 5F0HA 5FKKA 3QKXA 1NK2P 5K7HA 3V78A 3S2DJ 1MH4A 1YRNA 4MK6A 5IP6A 4AF5A 3O8GA 3LSGA 1EF4A 4QSHA 4X6AJ 4FTHA 2OERA 4XK4A 1IGNA 3NRGA 2L0KA 2NX4A 2M0CA 3HOYJ 2QOPA 3LJLA 5GPAA 3P9TA 1QPIA 3S14J 3FIWA 1TWFJ 2ECBA 2FD5A 4A3GJ 2QKOA 1GV5A 3FK6A 3ZQCA 3VW0A 3IV5A 3JRIA 3LNQA 2I10A 3S1QJ 3Q0VA 5FGLA 3VP5A 2N8GA 3GZIA 4I6ZA 4V2FA 2MW8A 3F1BA 2E2IJ 4BY7J 3HDDA 3HEFA 5M5XJ 2NP3A 2X6OA 3LOCA 1MBJA 4GCLA 1BJZA 5FJ8J 3S16J 2DG8A 1QVUA 4MFDA 5J1UA 1D5YA 2UXHA 1WCMJ 4B1RA 2GBYA 4EEFG 4C3IJ 1OCTC 3RH2A 3KZ9A 2ME6A 3ZQLA 2IBDA 3VVXA 3IH2A 2D6YA 2NS7A 5D19A 3BG5A 2HXIA 3NI7A 1RESA 3HM5A 3GTQJ 2DMTA 1RETA 3COLA 4KWAA 1ENHA 4X1EA 5F27A 4FCYA 3S17J 5EG0A 3JRDA 2XB0X 4UUSB 3JRGA 5K58A 3OSFA 4A3MJ 2FJ1A 1UI5A 1X2NA 1ZK8A 2CQXA 3JRFA 2R5ZB 1ETKA 1LE8B 1TWAJ 4JX6A 2M8GX 3PO3J 3FISA 5E3OA 1ZGWA 1Z77A 4G12A 3WHCA 2QIBA 5M5WJ 4ABZA 3G56A 4BKXA 3LSRA 4AUXA 3HOZJ 3B81A 1SFOJ 2L7FP 3S5RA 4DZJA 3PM1A 3KNWA 4DW6A 1K83J 2YU9J 3M3YJ 1CQTA 1TWGJ 3PASA 2LD5A 2R5YA 1ITYA 5C44J 2RHAA 5FHPA 3UKGA 1U8BA 1HF0A 2MG4A 1QVTA 3VVYA 3CRJA 1G2HA 3PPBA 3NAUA 4IHYA 4M3FA 4YZEA 5D1RA 3JRBA 3RZDJ 1B8IA 1WPKA 3QPSA 4MLOA 2Y0SN 2NVYJ 2DTZA 1B72B 4A93J 4JKZA 1HLVA 4A3IJ 1WI3A 1RKTA 4CGRA 2Y31A 2REKA 3NARA 3SFIA 3ANGA 2ME0A 2GM4A 1GV2A 2YUSA 2XSDC 3BQYA 1ETQA 3BR3A 1ETXA 4RBOA 5M5YJ 3L1PA 2CRGA 1SGMA 3T6NA 4J19A 1X2MA 1JKPC 5C4YA 4D7NA 1ORKA 2HOTA 1OJLA 5IP7J 2G3BA 5E3MA 1HCRA 2NOGA 3HOXJ 3MKLA 5E3LA 2HI3A 1LFBA 1IRZA 5EGOB 2UXOA 4D5FA 3JREA 3BR5A 1DU6A 1PUFB 1HDDC 2DA7A 2L7ZA 2WGBA 1HDPA 1Y1WJ 2PBXA 1MBFA 3BQZA 2V57A 1FTZA 3S1MJ 3NNRA 1ZKGA 2XPWA 3QPLA 1P7IA 4M3EA 2O7TA 3FRQA 1MNMC 5HSZA 2PMZN 2EBIA 5CXGA 2YVHA 2WV1A 2DA4A 4C3HJ 1XS9A 3GTJJ 2NS8A 3BTJA 1JKOC 1BW5A 2QWTA 2H8RA 1APLC 4D5CA 2ZB9A 3A01B 1XC5A 2HQ5A 2VI6A 5F0FA 2OPTA 2ZCMA 4JX4A 2AO9A 2DJNA 1JTXA 3C07A 3HKZN 2MSYA 4DZPA 1T56A 3TW6A 2EZIA 4A3LJ 2G0EA 4LOCA 2JA6J 1HOMA 3BR2A 3BR0A 1FIPA 2D5VA 1H89C 2RASA 4L5EA 3BNIA 4A69C 3HOWJ 2W48A 4FE7A 3M4OJ 1Q1VA 5M3FJ 1H88C 4JL3A 5CW8A 3QBMA 2ELKA 2LR8A 2IAIA 3KKCA 1K61A 4AC6A 3G1OA 3Q0WA 3SDGA 3HGYA 2Y2ZA 1VFCA 3V6GA 5J3LA 5K7FA 5EYRA 4DYQA 5EEAA 2VKEA 2HYJA 2B63J 5DS9A 3BTIA 5EDNA 5IYDJ 4HNVA 5C4JJ 3BG9A 2AHQA 2YVEA 3HIMA 3K7AJ 1TC3C 3TP0A 2DMNA 1AKHB 1ZQ3P 2GLOA 3TEDA 4GFLA 5IYCJ 2XPUA 4I76A 3HTIA 5J1YA 2JJ7A 5DAJA 3HTAA 3BR6A 1RKWA 4M3BA 2JMWA 1OCPA 3HBLA 3DEWA 2HDDA 4MO7A 2K9QA 2IU5A 3NXCA 2LVSA 3LSPA 2CJJA 5IOYA 2XRLA 4XRSA 9ANTA 4UUSA 4A3KJ 3ZOBA 2E2JJ 1FJLA 5IYBJ 3TP3A 4M6VA 2Q24A 3GTOJ 2R5ZA 2XB5A 1LE8A 1IC8A 1JKQC 1IDZA 1F43A 4DYRA 4M3GA 2EZHA 5EZGA 2Y9YA 5GP9A 1IV6A 1U9OA 3VW1A 2DA6A 4MIMA 5M3MJ 3ZQIA 3S1RJ 2ZOYA 2UXUA 5C4XJ 3GEUA 4L62A 2LFBA 2Y9ZA 2DA3A 1I50J 5IP9J 3S1NJ 2NVQJ 1Z0XA 4IHVA 2R92J 3CJDA 3H0GJ 4JP0A 3C2BA 3BR1A 3FK7A 4A3EJ 1DU0A 4B3AA 2KT0A 2XGCA 2LY9A 1W0UA 5AQCA 2CUFA 2LTPA 2R93J 1U78A 3MVPA 1H8AC 1ETWA 1B72A 2EH3A 3F0CA 3G7RA 2UXPA 3PO2J 2DA1A 3CCYA 4D7MA 3OSGA 3OOUA 2R7ZJ 4Y52J 1A6IA 2JA7J 2NVXJ 3DPJA 1TWCJ 2QTQA 1JTYA 2ID6A 4CYCB 3ON4A 3ON2A 5JLXA 3IUVA 2X48A 4B4CA 1UG2A 2P81A 1ETOA 1MBKA 4JNNA 2M34A 2K9NA 3OIOA 3VVZA 1OFCX 5EF6A 1JKRC 2X9DA 3LSJA 2WAQN 1GUUA 2YS9A 1MSEC 1WH7A 4NN1A 2EZKA 4BXXJ 2M2EA 3ZQFA 5EGOA 3JRHA 2JK3A 4C2MJ 4A3DJ 1WH5A 1S7EA 1X58A 1ETVA 4DYCA 3VOKA 2GENA 4GCKA 5HODA 3IH4A 3W6VA 1JUMA 4IHWA 1A5JA 1PUFA 1ZTRA 5F08A 2DMQA 4NELA 2WUIA 3HB9A 3EUPA 2GFNA 2EQRA 3O60A 3S2HJ 4XIDA 3RZOJ 2LK2A 2XPVA 5D18A 1FEXA 3SJMA 3JRAA 3LHQA 2TCTA 4RDUA 1SANA 3JSJA 1ETYA 2IEKA 1JGGA 1MBHA 1POGA 2L9RA 3ZQHA 2HYTA 2L7MP 1YRNB 2JN6A 2RAEA 1JT6A 3GTLJ 2LP0A 2G7LA 2VUMJ 1XG1A 2QCOA 5F1JA 1ZR4A 1VF9A 5JLWA 3A01A 2XDNA 2DA5A 3RKQA 1NTCA 5EZHA 1ZR2A 1UMQA 2R0QC 5E3NA 3H3VK 5FKNA 1VNDA 2TRTA 3CMYA 2Y30A 3DCFA 3A03A 5FMPA 2XGEA 3BJBA 1O4XA 4GFKA 1AHDP 2K9SA 1BL0A 4W1UA 2W53A 4JX5A 2VPRA 2OF7A 4IEJA 3VUQA 3LWJA 4Y7NJ 3G1MA 5IPAA 1JJ6C 3GBGA 2GUHA 3IH3A 4A3FJ 3BG3A 3HTJA 1UI6A 2G7SA 3RD3A 2FQ4A 3HOVJ 2O7OA 3A02A 3D1NI 1GT0C 2DG7A 4A3JJ 3VPRA 4AYBN 2KDZA 3GTPJ 5IOZA 1IDYA 3GTKJ 3JR9A 1AKHA 3BTLA 2XGDA 3BCGA 4JYKA 2HOAA 4W97A 2F07A 1MH3A 2DMUA 4BY1J 5FKOA 5EG0B 4FISA 2HOSA 5FKLA 2HKUA 1BA5A 4MFEA 3AQTA 2COBA 1QRYA 3HTHA 5F04A 3E7QA 1VI0A 3GTMJ 1JJ8C 5F0CA 4ICHA
chains in the Genus database with same CATH superfamily
1W5CC 2JA5J 3B02A 4XKCA 2VE9A 4XLPF 1WGXA 1X3UA 4C3JJ 1I6HJ 2E2HJ 3ZQGA 1EH7A 2XV4S 5D6FA 1RC9A 5LLQA 4UNOA 4PSWA 5TRDA 3BTCA 4M3DA 3W6KB 1TT5B 2KJBA 1W5TA 1RR7A 2BYVE 4M74A 4XRFA 1QQIA 2R5YB 3B6CA 3D5LA 4IRIA 3VW2A 1BW6A 4E7ZA 3CDLA 1JUSA 1UHSA 2HDWA 2FMYA 4CO8A 3FWEA 2QSHX 2LKPA 2VLAA 1D1AA 3VOXA 2LBFB 5J47A 2JWTA 3ECHA 1I5ZA 4HKUA 4BXUA 2Y75A 1XDUA 3VB2A 3WTZA 4UDSA 3Q3SA 3EDPA 2AS5F 2DMPA 3VFZA 2X6WA 3IKVA 1VQ4I 5EFYA 1W7PA 3DQVC 3O3KA 2ZXJA 4K2EA 4KT6A 2RQPA 3K4CA 3ML6A 1W5SA 2V9PA 3FXQA 4JOMA 3H5NA 4XKBA 1IN6A 5D8LB 1T2KA 2K9LA 4XN0A 2VQCA 4F93B 3K8PC 1Z6RA 2OI8A 3MKZA 4PJJA 1Z91A 3GZ5A 4CYCA 1FIAA 5E20A 3HE0A 2M5WA 3E97A 3HUGA 5BNGA 2E1OA 4UVBA 4U0VA 4BUPA 4UUTA 2HXOA 2I8DA 1E3OC 3MMYB 4AC0A 1ZRDA 2LKXA 5DTDA 3J80Z 3I4MJ 1K6OA 2Z5UA 3DV8A 4HDUA 2G7GA 1W4MA 1IJWC 2M9HA 5FKMA 1NK3P 2O8KA 2ELHA 4CCOA 1MBGA 3RJPA 4EGZA 3Q5FA 2HQNA 1YHQI 4DBQA 1MDMA 1QA6A 3O8HA 4OMZA 4NC6A 1E3PA 5EEHA 1SAUA 1F36A 3FDYA 3PJRA 3KPHA 3HOUJ 4LLLA 4MHGA 2IVMA 2VT3A 1NK2P 1MKMA 3V78A 1YRNA 2A5WA 5IP6A 1H0MA 4NNJA 3L9FA 1ZLKA 2ESHA 4KN7X 1F9NA 4XK4A 3S2WA 5HNHA 1IGNA 4CSWA 3NRGA 1IZ1A 2NX4A 2WV0A 3LSTA 1Y0NA 5GPAA 2MYSA 4B3XA 4OINF 5E18F 4A3GJ 2W7NA 4BDYA 1GV5A 1QZEA 1WJEA 4RGRA 5HLHA 2FBKA 1LDKB 5IT3A 5FGLA 2N8GA 3BZKA 2BXZA 4I01A 2BY3A 2FRHA 4IKFA 3F1BA 3R61A 3WE2A 3I4PA 2MH9A 3HDDA 3K69A 4BEHB 3GEZA 2R4GA 2WAQA 2X6OA 3LOCA 3GX4X 4NHJA 4G6DA 3CCQI 5FJ8J 1QVUA 4BU2A 2L9NA 2UXHA 1WCMJ 4EEFG 1P92A 1I39A 3VVXA 3ABKH 2HXIA 2PBIA 2VBXA 3SDBA 1X4OA 4X1EA 5F27A 4FCYA 1JHHA 3CF5F 1U6GA 3IC7A 4XMYA 1KU3A 1FOYA 3DKXA 3HRSA 4M71A 3T5XA 4A3MJ 2FJ1A 1BN5A 2F4MB 2R5ZB 1ONVA 3TKYA 1JHFA 3EUHC 1TWAJ 1UJ8A 2ZSIB 2M8GX 1BI0A 1ZGWA 3WHCA 4P55A 4UVCA 4ABZA 1KYZA 1B6AA 4XLNF 4DNCA 5GTHC 4AUXA 1MJ9A 4FX0A 3B81A 3Q9VA 1HKSA 4PJLA 4YFXF 4DW6A 1RI7A 1TW3A 1K83J 2XIGA 4G94A 1T6SA 1TWGJ 2OTLI 2AQFA 5C44J 2XAJA 3BC8A 2RHAA 5FHPA 3BWGA 1F4KA 4P5OA 3FXOA 4ESFA 1FLIA 4OD5A 3PPBA 3BJ6A 4IHYA 2KZGA 2M45A 3VEPA 5KK1A 2VC1A 1WPKA 1PVEA 3QPSA 4MLOA 1B72B 4IOAF 2QQ9A 4HLYA 2F2EA 3SWHA 5LRSA 1S9HA 2YX4A 5CVIA 3NARA 3SFIA 2REKA 2ME0A 2VXZA 2YUSA 2NRAC 4F3QA 4CXFA 3BQYA 1ETQA 3H9QA 1ETXA 5LBQA 4RBOA 2V6EA 3CCLI 3T6NA 1F1ZA 2PN6A 4E70A 1RNLA 1WWXA 3M8FA 2H1LA 5C4YA 3FXJA 4D7NA 1ORKA 2YU3A 2HOTA 1OJLA 1GXQA 2DU9A 2XF5A 2G3BA 3OIPA 1HSJA 3MKLA 1FZPB 2FU4A 2K4BA 1IRZA 4U7DA 2UXOA 2LRDA 4EQQA 2OZUA 3JREA 2WTEA 4V19K 3REOA 2EFQA 4X0GA 1PUFB 3K1PA 2M1BA 2L2OA 1HDPA 3WTWC 1MBFA 2Z2SB 1FTZA 2QKMB 4BJ6C 3S3OA 1P7IA 3WG9A 3FXKA 3FRQA 5AONA 2P6SA 3GFMA 2PMZN 2EBIA 3I59B 1WJAA 2GQQA 3WTYC 3IAS2 4I7HA 5B66C 2W4SA 1W7PD 2NS8A 1JKOC 1UG0A 2R7OA 3DKYA 2Z3YA 5D4RA 3OR2C 4PZJA 5DCMA 2F6CA 1XC5A 1E2XA 1J9IA 1XTAA 2VI6A 4RGUA 5K5QA 1FYLA 2OPTA 3HKZN 4U88A 2MSYA 5ERIA 4UUVA 4A3LJ 2IGMA 5K1YA 3DEEA 3LSKA 3S3MA 3DXJF 1XB4A 3A0BC 3CJNA 2EA2A 3RSNA 3JSOA 3HSRA 3M4OJ 1OR7C 4H4KC 2M7BA 2XROA 5M3FJ 1H88C 2W82A 5CW8A 1OKRA 2L5QA 4FASD 2K4JA 5DV5A 4HG2A 2XSJC 3SDGA 3V6GA 2O03A 5EEAA 1YIJI 2OAZA 4ZYEA 3A1YA 1OQYA 4HNVA 3BG9A 2BW3A 2CWEA 4EVIA 2DMNA 3CDIA 1AKHB 4AD9A 1BOBA 2GLOA 3TEDA 4XNFA 1MIJA 4BE1A 2RKHA 2VJIA 1S7OA 2PI0A 5DAJA 3KEQA 2FJI1 5LEKA 2JMWA 2X1DA 1R4MB 1P6RA 3DEWA 2ISZA 5A2QZ 3S93A 2CJJA 5B3SH 4XRSA 2P5LC 4IX7A 4XKVA 4A3KJ 3SXYA 3DPUA 4CZZA 1HA8A 1T08B 4KYWA 4M6VA 2Q24A 4R8HA 1QZZA 3KP6A 1P9QC 4YRVA 4DYRA 1YX5A 5EZGA 4Q47A 4NQWA 3P7NA 2DA6A 4MIMA 3ZQIA 4L62A 1EJ9A 1R36A 3GZNB 2RVCA 3HKZA 1DGWY 2D1VA 2DA3A 4UV9A 1I50J 1ZH5A 2D45A 4Q5SF 3W2VA 4JP0A 2FNAA 2V1DA 1HC8A 2FMLA 4UXNA 4EJWA 3EUAA 3QYEA 2LTPA 4L9JA 4GYGA 3GF2A 1T98A 3LQRA 1ETWA 3L2UA 2PX9A 4ENMA 4XL9A 3PO2J 5JI6A 4UY8I 3MZHA 2ID6A 2V6CA 1T39A 3IUVA 3G6EI 2RGVA 5B5EC 3K4JA 4B4CA 4M73A 2P81A 3MKYB 5E8IA 5LGUA 4JNNA 4MEXF 2LDUA 3OIOA 3H3UA 2ZNYA 1V5GA 1OFCX 2E5NA 5EF6A 3ZMSA 3LSJA 1MMSA 2QZ8A 3CJQB 2CUZA 2MBFA 3J81Z 5EJCA 3C3WA 1QU3A 1WH7A 4GO1A 3EUKL 4IF4A 3ZQFA 2L54A 4F91B 3EYYA 1X58A 4GCKA 1DQUA 5HODA 3W6VA 4LLGF 4IHWA 4E4HA 1ZTRA 3GFJA 2DMQA 4EM1A 3HRUA 4NELA 1K4TA 2GFNA 3O60A 1Y56A 1PYVA 3C18A 1R71A 1XD7A 2X0LA 1XSVA 4C30A 3IRQA 3KP7A 1NG7A 4ASNA 4BQQA 2BOLA 3SZPA 1ZLJA 3E6CC 4DQ2A 1MBHA 2EA4A 3WG7H 5FRNA 1LEBA 2V1NA 2HYTA 2KHMA 1D1BA 3J80K 2RAEA 4C9YA 2IT0A 1RUNA 2ZCWA 2ZMEB 3QWLA 4QPQA 2ZMEC 4CCNA 5J6XA 3WODF 2Y0SA 5J40A 5BQTA 5JLWA 3CCJI 1UMQA 5F1RA 1D0YA 5E3NA 1HQCA 2JSPA 5FGMA 3TDZC 3K2ZA 4ZDLA 2Y30A 3DCFA 3TBIA 3A03A 1S7AA 1O4XA 3O2PE 2G7UA 1BL0A 3RKYA 2NNNA 2W53A 4PCQA 4IEJA 2OF7A 4O6JA 2GOXB 3LWJA 2QYOA 3C7JA 2ZJPF 3G1MA 5IPAA 1TNTA 1JJ6C 2EPFA 3KZIC 4Y4RA 1R00A 2A6EF 3I3LA 3K4NA 1UI6A 1X1DA 4HRIA 1R5ID 2G7SA 2FQ4A 1BI2A 3VSLA 1EH6A 4A3JJ 2A6TA 3GTPJ 4AYBN 5IT9K 2QSFX 3PQJA 1FX7A 1UAAA 1MMGA 2DMUA 1ZAOA 3PSIA 4YFNF 4PGGA 5J8FA 4BY1J 1WJBA 2R7TA 5FKLA 1ZREA 2V1UA 2HKUA 3P9CA 1LVKA 3AQTA 3LQQA 2DQLA 5F04A 5DM6F 3E7QA 2PLYA 3GTMJ 1Z7LA 1FC3A 2Z33A 2EFNA 2OZ6A 1X19A 4KUMA 3BT9A 1XSXA 5CJ9A 1TQMA 2PEXA 4JQFA 2BGCA 1S29A 3R4KA 1IXRC 2LYCA 3QP5A 1WJDA 1Z7UA 3OYCA 2DFEA 3KZYA 1XGOA 3E6MA 3OYBA 3KLNA 1GDTA 2EZLA 3AQSA 5BS6A 2O9LA 2PZ9A 1RRJA 4PFPA 4MXMA 2NYXA 1UCRA 4ENJA 2K85A 4IHTA 4II3A 4HDVA 4XRSG 1B8IB 2R7UA 2W25A 3PNYA 5F64A 3FMRA 4HV5A 4N0BA 5TGTA 1IO2A 2LG4A 3ZRGA 5HBUA 4BNCA 4F55A 4OAZA 3L7WA 3MN2A 4PXIA 1W0TA 2EIJH 2UXIA 2HS5A 1OYWA 2MC4A 2PJRA 2CQQA 3VIBA 4BBSJ 3KKDA 3CDHA 2H1KA 1PP8F 4RGXA 4YEJA 3CP8A 2NNYA 1K78B 5FROA 2E35A 5C3EJ 1FOKA 2ZKZA 2KMUA 1FBSA 4AYBA 3JTHA 4C2UA 2ECCA 3WU1B 4ACIA 2JTVA 2OUMA 2WADA 1PUEE 2MD5A 3I58A 4JBAA 1U2WA 1I3QJ 3S15J 3E6DA 1JUPA 2MA3A 4I98B 1MBEA 3F8CA 5FO5A 3QAHA 1LPQA 1Z3YA 3D5RC 4GFBA 4XRMA 3N05A 1SVOA 2JT1A 3CQZJ 3WHBA 3OYFA 2CU7A 3I4NJ 3DFGA 3VYRB 2OTJI 1YG2A 3T0YA 2KIMA 3B6AA 4RAFA 4Y17A 3NPIA 3LSHA 4GCVA 2DN0A 3IUOA 4BQAA 1S3JA 1HKTA 3BHQA 1U0JA 1EH8A 3RQIA 3JRCA 4XICA 3H5RA 1LFUP 4NDLA 5FKKA 4ANJA 2DPUA 2F4IA 1IN5A 3S2DJ 4LG0A 3O8GA 2L02A 4QSHA 1O3RA 2OERA 3HIFA 3JTGA 1MD0A 2ZNZA 3I64A 2M0CA 4A5NA 2RQQA 3P9TA 4RAYA 4EM0B 2KRHA 5DUKA 3S14J 2ECBA 2FD5A 4G9YA 4ZYHA 1YQAA 1TW2A 3QYFA 1I27A 2DJIA 3MD2A 2QBYB 1V3FA 3LNQA 2I10A 3S1QJ 3Q0VA 1OMIA 2BVLA 2M0MA 4HAMA 3TO7A 2XAUA 3ABUA 1HKQA 3FMSA 1XGSA 3LA2A 4BY7J 2PFBA 3NWSA 3HEFA 1PJRA 1VQ7I 3PUBA 1BIAA 3CC4I 2MABA 2ZJ2A 1MBJA 2EB7A 4IQ4A 2HU9A 2W85A 2VC0A 3U9GA 4B1RA 2GBYA 2ME6A 3VWBA 2IBDA 2DQRA 3GW2A 3IH2A 4PGHA 2D6YA 2NS7A 1MZBA 3MQ0A 1RESA 3HM5A 3GTQJ 2OV7A 3WGIA 2ICWG 4BDZA 3HRTA 3COLA 1ENHA 2EK5A 2H09A 1MW7A 3AKZA 4UUSB 1WKMA 1H9GA 5K58A 2VIXA 1D3YA 1ZK8A 4P1WA 2VT2A 1ETKA 5TISC 1LE8B 2LMDA 1KQ8A 4JX6A 1OCRH 3PO3J 2QENA 3FISA 3FZVA 4R1HA 5E3OA 3VOEA 2HYFA 2CQKA 5M5WJ 2JPCA 3DTEA 5E1XA 5L3BA 3J7ZI 4BKXA 2R7ZJ 1R6RA 3O6BB 3S5RA 2WC2A 1P4XA 3HHGA 3PM1A 4DZJA 3L2RA 1W36C 2MD0A 4U0WA 3BZCA 4BE0A 2LD5A 5A2QK 2R5YA 3PASA 5DEQA 1JI8A 3AL0B 3JAMK 1FP2A 5LRRA 5ICFA 3VVYA 2R7SA 1N25A 3CRJA 6PAXA 4BXFA 2DTRA 2DOEA 3ZMTA 2LBFA 2UXNA 5D1RA 5JVGF 3RZDJ 3OR1C 4S05A 1SVMA 1LJ9A 2L9SA 2DTZA 2O5RA 4A93J 4JKZA 1V55H 1BM9A 2L7KA 3KP4A 4CCLA 2E5ZA 4A3IJ 1WI3A 5E8GA 3WU2C 2YX7A 2P5VA 5CLSA 1O57A 1QNTA 2HQRA 3LWFA 1XPXA 1BJAA 3LMMA 4GDFA 3S32A 5FLXZ 4ITVA 3V8KA 1SGMA 2AXTC 4RMNA 3WTSC 1YIOA 2MLGA 3TMOA 2B0LA 2RN7A 4KJZA 1GVJA 2ZXHA 3OYGA 5DDGA 5E3LA 2XGXA 1SFXA 2CW7A 2R7RA 5EGOB 4D5FA 1VTNC 5HDNA 2CQNA 2R7VA 3PUFA 1SAXA 1JXSA 2QGUA 1HDDC 5BPIA 2L7ZA 5JVTA 2WGBA 3H5AA 3ROUA 3SHFA 3S1MJ 2KL4A 1ZKGA 1IW7F 1IRXA 3KIOA 2XPWA 1TQIA 3BY6A 5ICCA 3L2QA 3RKXA 1U5TB 1U5TC 2VKDA 3E1SA 5JR3A 3CESA 2P8TA 4KIBA 3U1KA 5HSZA 3CTAA 2YVHA 2FBIA 2HQAA 1IRGA 2EV5A 4OAYA 3J81K 3N4MA 4C3HJ 1XS9A 2P0WA 3CO6C 4XOPA 1A35A 3T8RA 4D5CA 2ZB9A 1NHAA 2KDOA 3F22A 2DDAA 2E71A 3NQOA 2DFFA 3FXLA 2ZCMA 2X4HA 2YPRA 4DZPA 1G59A 4OIQF 4C2MA 2EFWA 2PMUA 4RS8A 3WGGA 4GXOA 1SMTA 2JA6J 1HOMA 3MZ8A 2VKHA 3BR0A 1L0OC 5FFXA 3TO6A 3OS2A 3HOWJ 2BV6A 3JW4A 2DT5A 3GXOA 2NOJB 2GA1A 1G3TA 1B9MA 2LR8A 5J8CA 5L3EA 2IAIA 2VODA 1ZG3A 3FBIB 3G71I 1K61A 2XAQA 3G1OA 1ULYA 5JHFA 2Y2ZA 3QU3A 3CMAI 1T8IA 2HNHA 4M6XA 5EYRA 3F8BA 4HPQA 2B63J 4ZH4F 1J59A 4AIDA 3G4SI 2HYGD 3DBRB 3WTUC 4AIHA 5EDNA 4TV7A 3Q9SA 3M1EA 4BEHA 5C4JJ 2AHQA 4OWRB 1CF7B 1TC3C 3TP0A 4Z6YA 4IJAA 4PSXA 3VYSB 2YVXA 5ILVA 3FF5A 1CGPA 3IKTA 4GFLA 4P96A 4ZYGA 2XPUA 1IV8A 4ZDOA 3ABMH 4I76A 3ASOH 3CO7C 4L9NA 4CGZA 1IUYA 3BR6A 2OD5A 2QQBA 2B9SA 2HDDA 4MO7A 2JPBA 2R3SA 2K9QA 2UXXA 2F5FA 2CFOA 2KIQA 3IP4B 4KITB 2IU5A 5IOYA 3HSFA 4MTEA 1XX5A 1BC7C 1V5FA 2IA2A 3E5XA 2J5PA 1LQ1A 3TP3A 3W2AA 2XC7A 3GTOJ 2R5ZA 3EUHA 5AIPA 3PNVA 2JQ7A 5J4YA 1T38A 1IDZA 2EZHA 3EETA 2Q0OA 1IV6A 3W2WA 1U9OA 5K5RA 2MLKA 2O0YA 2KPMA 3GEUA 1O3QA 5CVVA 2CYYA 4CDGA 2LFBA 3HC7A 1X1CA 5KCMA 5IP9J 3S1NJ 5B1BH 2NVQJ 4IHVA 2HOEA 3FK7A 4KISA 3ERMA 4B3AA 3PFIA 2EV0A 3PQKA 2IS2A 3J7YJ 1W0UA 5E1ZB 2BXYA 2CUFA 2ZSHB 3SZTA 2IS4A 2E1NA 3OYIA 5DUIA 3ZCOA 1ODDA 1ZN2A 3CD6I 2D1HA 1B72A 1X1AA 3MKWB 1JGSA 3F0CA 3A0HC 4U7BA 3G7RA 2UXPA 2DA1A 3JCUC 1R22A 2IGOA 4XN3A 1R1UA 2AQEA 4HSTA 1A6IA 5F6FA 2HGCA 4Y52J 4N4OB 1TWCJ 2DCEA 4LLNA 3OYHA 3ON4A 4XLCA 1R49A 1SVLA 5JLXA 4Y33A 3ZMDA 3HYIA 2KP6A 4EJUA 1MBKA 2FA5A 4WXHA 3COAC 2ZFUA 1OCCH 3E5QA 1V54H 4MQVA 1VQ6I 5H2FC 1P2FA 4AWXB 4ZTJA 2KRCA 2JVGA 4D0PA 1MSEC 1E0EA 3WE3A 1YYVA 4ZJZA 2H6BA 3ZMVA 1I6XA 3AG4H 2GIZA 4C2MJ 4A3DJ 1WH5A 2DK5A 1ETVA 2GENA 3K4BA 4C2TA 2X1CA 4U9NA 5LGNA 1A5JA 1PUFA 5CVJA 4DIQA 5F08A 3IAM2 2WUIA 3HB9A 2EQRA 2LK2A 3NEUA 4M9ZA 1DPRA 5D18A 1OCZH 4HF1A 3SJMA 3JRAA 3LHQA 2TCTA 2K27A 1XGNA 3E3VA 2VQHA 4XLFA 3I59A 3VSKA 3HXLA 3X2QH 3JSJA 1LEAA 2L9RA 2L7MP 3GTLJ 2E7XA 4AVPA 2VJ5A 2X6XA 3R6SA 2QUFA 2VJ4A 2QCOA 5F1JA 5DD8A 1VF9A 1ZR2A 3MAJA 1NTCA 5CVUA 3SFZA 3V4GA 3T1BA 2R0QC 4I0BA 1J2XA 5DCFA 2LREA 3I9V2 1UB9A 1WJ5A 2GZWA 3DPTA 1J5YA 1SD7A 1X1BA 5GTIC 5HVQC 1GXPA 3BJBA 4GFKA 2MC3A 1AHDP 5L3DA 3VUQA 3DU6A 1N75A 1OR7A 3LAPA 1QHGA 5D5UB 2GUHA 1Q1HA 1WQ2A 5LEJA 1DGRM 1USTA 2R7QA 4EMSA 3HOSA 3IH3A 2CH0A 4J00A 4EJTA 2VXDA 3U1DA 2LOOA 4Y13A 3HOVJ 2VBWA 2H8WA 3A02A 1B1BA 1VQOI 1GT0C 1C0WA 1ZG1A 5LGTA 1QO0D 1FWZA 3BG7A 2KDZA 1AKHA 5GAGJ 3K9TA 1ACIA 2XF7A 4BQNA 2STWA 4W97A 2VBZA 2F07A 2K5CA 3RPUA 4R79A 4EATA 5EG0B 1KQ9A 4HF2A 3WU0A 1FMWA 1MMDA 1R1TA 4MFEA 5FB2A 3IHUA 1DPUA 2PMZA 4FHTA 2VPLA 2KIUA 2CO5A 1JJ8C 5F0CA 4ICHA 3CLOA 3F8MA 4S0HB 2M4KA 2XHKA 3ZP5A 3FM3A 1A36A 2FOKA 4WXCA 2MGQA 1BR2A 1MJAA 5HNFA 2ZCXA 3DPLC 4A3BJ 4ZTFA 2OCEA 5GADJ 3OWTA 4M9XA 3F6OA 2E19A 3NRVA 1T33A 3QODA 3I53A 3FHZA 2Z16A 3K2AA 5BMZA 4LG3A 4A3CJ 5J1RA 2O3FA 3OYMA 3CC2I 1GLNA 4ZZLA 2K86A 5FLMJ 5L3FA 2IS1A 4FT8A 2M7AA 3DBHB 5HAWA 1V4RA 4ESJA 3MNLA 2K40A 2J5OA 5D4SA 2OJED 2JA8J 1KYWA 3ECOA 1RPWA 4EJVA 4YG2F 1JT0A 1HSTA 1IF1A 2ZCNA 3VDXA 2JVHA 1ON1A 2CFXA 3ZQ7A 3C1DA 3RPQA 4DBRA 1PDNC 2WY7Q 4XSXF 5HS7A 1R9TJ 4IHXA 1LFPA 3DTIA 3AG3H 3H9GA 1SFUA 3K70C 3CC7I 3DU5A 3G1LA 1K7AA 4BBRJ 3AG1H 2HTSA 2XAFA 1FBUA 2I5UA 5KAIC 4GRIA 1W1WE 2NVTJ 2BHZA 5FLVA 3V7CA 4LITA 2NP5A 1Y1VJ 3CCMI 3DF8A 5FLXK 1UHWA 2F5EA 2DXIA 5GPCA 2DPDA 3V8JA 1G4DA 2F5CA 3H92A 4WK8F 3LSIA 2VE8A 3KLOA 3TW7A 4F7ZA 1TWHJ 2W84A 4E7HA 3HG9A 1NG6A 4HSRA 5K7ZA 4BHPA 3GFIA 2Q8KA 2IP2A 2VJJA 3IWFA 1IUFA 5HLTA 2WB1N 2DYRH 4V2GA 1WJFA 1STZA 5F0HA 3ZGKA 4IXAA 2Q2EB 1USSA 3PSFA 5K7HA 2JRMA 1G3WA 4N9IA 1MH4A 4KMUX 3I5UA 3KP3A 4AF5A 3ZR8X 3KE2A 2IPQX 2L4AA 3E6BA 1EF4A 2NS0A 4X6AJ 2BZTA 2ZMEA 2CQ7A 4PK4A 3G73A 3K10A 2L0KA 1T0FC 1ZARA 2QWWA 2QOPA 3LJLA 3OS0A 2IA1A 1R58A 2JUCA 2R7DA 3PFYA 1QPIA 1Z05A 3H3ZA 2UV1A 1TWFJ 2MH2A 1Z67A 2QKOA 3FK6A 2A61A 3OY9A 2QSGX 2M30A 1EA3A 4LMYA 1P4WA 4DOZA 2L9VA 4I6ZA 4N4NB 4V2FA 2MW8A 2DK8A 2E2IJ 2R7WA 1HW5A 2BY2A 2QKLB 3ZQQA 1D5VA 1B9NA 3CLQA 4KNYA 4GCLA 3HTSB 4H0EA 2KRFA 3S16J 2TDXA 1XCVA 4MFDA 5J1UA 4HNTA 1D5YA 3PIOF 1UFMA 2YR2A 2JSCA 2L4MA 3GWZA 1H9TA 4IRVA 3RIRA 1FBQA 3V7SA 3KZ9A 3J7AO 3ZQLA 2UWMA 2KLOA 3KEYA 3VTIA 3ISPA 2DMTA 4BQOA 4KWAA 2NAZA 1B59A 3RCOA 5B1AH 3S17J 2ZXWH 2XB0X 1ZHFA 3KZZA 4ETSA 3JRGA 3H0DA 3GLXA 2IGNA 2JA2A 1UI5A 4B8XA 1X2NA 2CQXA 3JRFA 3KCCA 3BCBA 4YIFA 2W1OA 1Z77A 4G12A 4ENNA 2K3FA 2O6GE 3K1NA 4A2UA 3HOZJ 1SD5A 3S3NA 1KA8A 2L7FP 1SFOJ 4A0YA 3KNWA 2KFDA 3C2HA 3A2KA 4LB6B 2A05A 1YX3A 4FX4A 3WTTC 1CQTA 5KNLA 4XQFA 1ITYA 3CJTB 1QPMA 1TBXA 2A2FX 3BLYA 3HL2A 3UKGA 3WGHA 1U8BA 5D6EA 2MG4A 1G2HA 1B4AA 3NAUA 4XLEA 3P9IA 4OOIA 1VQPI 1YJNI 1DP3A 1Y0UA 1WHUA 5GAHJ 4YZEA 1D0XA 3RKWA 3JRBA 1B8IA 3QYBA 2XAHA 4IOCF 3CCUI 2NVYJ 4CCMA 2BE5F 1DDNA 2KISA 2XASA 2V9VA 1HLVA 1SFKA 4HF0A 3HSEA 3DEUA 2P7CB 3HZJA 3RPUD 1ZRFA 2E34A 4A6DA 1BI3A 4HOBA 4XR6A 2COMA 3HRMA 3BR3A 2FXAA 3FXRA 2EILH 3MCZA 2DW4A 1VZ0A 2JUGA 3L1PA 1K78A 4ENKA 3LFUA 2X85A 2EV6A 3L09A 4UB6C 3OS1A 3TQNA 2HVSA 3KEOA 5E3MA 1HCRA 2NOGA 5AIQA 3HOXJ 1HW1A 2HI3A 1LFBA 3OYJA 2DYSH 4LK0F 2DAOA 3GFLA 1AOYA 1T95A 1BBYA 1S8NA 5HS8A 1KZHA 2DT6A 3HJEA 4I99C 2WAEA 1BIBA 1VQ8I 2PBXA 5ILUA 1K6YA 1IXSB 2PJPA 5JHUA 3NNRA 1LDJA 1I3AA 3BP8A 4NBQA 3QPLA 1ZGJA 4HW0A 4HYEA 4M3EA 3TGNA 4HQEA 2RDPA 2O7TA 4HBLA 3CCVI 1YOVB 1MNMC 4RLFA 2VOPA 3U2RA 4HQMA 2QQ8A 4BJTA 3BTJA 2QWTA 4Z2YA 4B48A 1APLC 2P6TA 3GVAA 1AA7A 5FFZA 3A01B 1WSUA 5L3CA 3OYKA 2W24A 2ISYA 2V9KA 2AO9A 2DJNA 4HEA2 1XCBA 4JX4A 4UB8C 1T56A 3TW6A 3D5SC 2EZIA 3AG2H 3BR2A 1FIPA 2KIFA 3V7RA 1H89C 3L2CA 5FRMA 4HX4A 2UZKA 3GMEA 2BY0A 4FE7A 5D5VB 1Q1VA 2CV2A 1L3LA 4JL3A 4RLQA 3QBMA 4Q48A 1OLTA 1XDSA 3BG6A 3KFWX 3KKCA 2QBYA 2DOFA 3HHHA 4AVZA 4AC6A 3TO9A 3HGYA 1VFCA 4B43A 5J3LA 4DYQA 2B7EA 2X1EA 3C2GA 3R60A 2HYJA 3KP5A 4B44A 1QBJA 5D5XB 2BY1A 1G3SA 3BTIA 3QU6A 3BZ6A 1MNEA 3HIMA 4UHTA 2EIKH 4EM2A 1X3ZB 1ZQ3P 5J4VA 5E1WA 2PQ8A 4IVNA 5IYCJ 2LY2A 5E17F 3H35A 1LVAA 2JJ7A 3CUQB 3MWMA 3CUQC 3HTAA 4G8XA 1X3WB 1RKWA 4M3BA 2F5DA 3HBLA 2HVRA 3NXCA 2LVSA 2M4GA 3LSPA 2XRLA 9ANTA 1A04A 4UUSA 3OYEA 2FNPA 2DFHA 3M8EA 5IYBJ 1KU2A 2X51A 1FJLA 3GLLA 4MGRA 2XB5A 3DP7A 3F23A 1LE8A 3OV8A 1IC8A 1ZELA 2GXAA 1F43A 2Y9YA 2D2WA 1TZLA 5GP9A 4XONA 4CCJA 3VW1A 2CW8A 5M3MJ 5CPRB 1Z21A 3AL0C 5C4XJ 4HZFA 4NB5A 1O3SA 2HZTA 3WTXC 2Y9ZA 4NC8A 5CQEA 2OQRA 3RDIA 4XOTA 2IS6A 4IZZA 3MZYA 3H0GJ 1AWCA 3CJDA 3C2BA 4A3EJ 4DJAA 4B09A 2STTA 3OYDA 4L5IA 2E1MB 3H1CA 3EPZA 2E1MC 5TJJA 2KT0A 1W7PB 2LY9A 2XGCA 3QPTA 5AQCA 2FEZA 3J7AY 3OMYA 4WXDA 2R93J 1FT9A 4U0YA 4A6EA 1U78A 4NC7A 4HV6A 1BR4A 1I1SA 2CSOA 2V26A 1QGPA 2GXGA 2KZVA 2EWNA 1MGTA 1P4AA 2BEOA 3BJAA 4D7MA 2JA7J 2NVXJ 1NH3A 1G8XA 3DPJA 4A5MA 2ACJA 3QPHA 1D8KA 5HS9A 4CYCB 3M9AA 2X48A 2E36A 1UG2A 3HUGB 1ETOA 4IRHA 2M34A 2V7FA 2K9NA 4PJMA 3ZN0A 4OIRF 4EJOA 3SZGA 2RREA 2QA4I 1J7KA 2V1XA 2DI3A 1JKRC 3ULQB 2FSWA 2WAQN 2LSOA 1GUUA 2YS9A 1WI9A 2F5VA 4BXXJ 4EGYA 4RM2A 4XORA 3QP6A 2LC2A 2M2EA 5IY5H 5EGOA 3JRHA 4GYIA 1UELB 1MMAA 4DYCA 1IRFA 2E60A 1JUMA 3I54A 2CG4A 4LIVA 3F21A 3EUPA 1MDMB 3TDUC 4BHBA 2XVCA 3RZOJ 3E0JB 2HVQA 2XPVA 4M6YA 3FKJA 1FEXA 4IQJA 1U5TA 4IL6C 3RI4A 4RDUA 5CYVA 3HPHA 1ETYA 4BGDA 2ADUA 4II2A 3K4LA 3ZQHA 4YIIA 1YRNB 3OYAA 1JT6A 2DDBA 2OA4A 2DODA 3GO5A 2VUMJ 1XG1A 1ZR4A 2DFIA 2ELJA 3RKQA 4YFKF 4CZCA 3MEXA 1HBXG 2H94A 1I1GA 5KVRA 3H3VK 4UV8A 2M8EA 2V4JC 4WCGA 4UVAA 3CMYA 3CCEI 5FMPA 4P9FA 2XGEA 1J75A 3LL7A 5L3GA 1E3HA 4WIBA 4W1UA 2BHYA 1G3YA 4Y7NJ 3ESWB 5IT9Z 1Y8RB 3M1CA 3L2WA 2B3WA 2B1EA 1N78A 2HDCA 4RGSA 2HPIA 5FD6A 2L3DA 4OD4A 4A3FJ 2G9WA 4LJZF 4MQ9F 3WTVC 3BG3A 1Y6IA 2QLZA 3QOEA 3EYIA 5LHGA 2L01A 3D1NI 2GWRA 2DG7A 3RYPA 2ZO4A 3KETA 1CF7A 5IOZA 1IDYA 2VOOA 2OCCH 1ON2A 2XGDA 3BTLA 4RB3C 3ELKA 3BCGA 4HA8A 2HOAA 2GA2A 4JYKA 1FOXA 1SD6A 3QRFF 3DLLF 1MH3A 4LFUA 4FISA 2X6YA 4ZC3A 3SEQA 5D8KB 4F52A 1VQNI 4U9LA 2COBA 4PDKA 1QRYA 3HTHA 4WF2A 1D0ZA 1VI0A 3KX2A 4RAGA 1TLHB 2P4WA 2ZOZA 2A07F 2ZJQF 2FUG2 4E7IA 4B47A 2F48A 3KYCB 3OYNA 2IA0A 3FHNA 2KKOA 3OL4A 2DA2A 2LY1A 3HPGA 1OPCA 1FYKA 4A0XA 4KDPA 2FX0A 3P9KA 3EGQA 3K1MA 1MNDA 4E6KG 3GTGJ 1YJWI 2FE3A 2R7XA 1UZCA 2RNGA 2FBQA 2EFOA 2ZC2A 2CUEA 1Y8QB 2ZBKA 1LUJB 3IL2A 3E7LA 1FTTA 4HNUA 3I55I 2GIVA 1FP1D 2VL8A 4FQGA 4U87A 3S8PA 2IJLA 5JFRA 1YITI 4E7SA 1P7JA 2IXSA 4ZZDA 3Q0UA 3DLAA 1EV7A 5H9TA 2P5KA 4I0AA 1YI2I 1D1CA 5H20A 1QZYA 2ID3A 4O3MA 4ME9A 5HDKA 3F8FA 5GAEJ 4QTRA 3F8NA 3HGGA 2V79A 5DD4A 2CV0A 2HEOA 1AU7A 4J01A 4BYYA 3LAJA 1ZG5A 4QIWN 3DKWA 1MSFC 2WWYA 4FETA 4CUGA 1GHCA 4A12A 3ZXSA 3ANPA 1TQPA 1WVRA 1IG7A 2XKPA 3BRUA 1U9NA 1YW9A 5E79C 2LH9A 1LKXA 3K4MA 1GVDA 2VKVA 4ZYDA 1IAWA 1YS7A 1Y39A 1W36D 3OIQA 3ASNH 2VQLA 2XUBA 1R5GA 3OOPA 2P7VB 2QF7A 4GCTA 1U8RA 4FE4A 3FKIJ 3QQAA 5CXIA 3CZ6A 2HWVA 4IO9F 1DUXC 1VQ9I 2LLKA 2IGKA 4KIGA 2DOAA 4G6TB 5CQGA 4E7KA 3CWRA 4BS9A 1WZ2A 3KP2A 1S5LC 5DCMB 4L0YB 3QKXA 1RR8C 3L2VA 3T8TA 2Z99A 3CCRI 1ZRCA 4MK6A 1KU9A 2PFVA 2IRFG 3BROA 3LSGA 4FTHA 3BJOA 2JRTA 3HOYJ 3W3CA 3ABTA 3FIWA 1FY7A 2HKOA 3ZMZA 3ZQCA 3VW0A 2G7HA 2WY8Q 3IV5A 3JRIA 4RB0A 3VP5A 1J09A 2DO7A 2Q1ZB 4KIFA 3GZIA 2WBMA 5BPDA 3H9JA 2CUJA 4XLHA 2DBBA 2GAUA 5M5XJ 3VODA 2NP3A 2BW3B 3F3XA 4LD5A 4KA4A 3JSPA 1BJZA 1SMYF 4G7HF 2DG8A 4LB5A 1ZYRF 3NS4A 5LFAA 2ZXIA 1OCTC 4ZYAA 4C3IJ 4Q4ZF 3RH2A 3BDDA 5LHHA 3L00A 4RAZA 5D19A 1RIOH 3BG5A 2O8XA 2QVOA 3OYLA 3NI7A 1OISA 1RETA 2A3SA 2A69F 3DWLE 4IHSA 4G7OF 5EG0A 3JRDA 2BBYA 2RNJA 4L9VA 3OSFA 5KHDA 3FX3A 3ABLH 1XMAA 1KU7A 3FXUA 1SD4A 1SFEA 4NQWB 3JAMZ 4BACA 3BCAA 1PP7U 3V42A 2QIBA 1S6LA 4IRGA 1MJBA 2VASA 3G56A 3LSRA 1YW7A 1J0RA 2Y48A 3I71A 4KMFA 3V8LA 1DP7P 1UHMA 3AAFA 2K9MA 2YU9J 1Z9CA 3M3YJ 2HR3A 2PG4A 2BVMA 1R1VA 1MMNA 3IWZA 5ED4A 1HF0A 3ONQA 1QVTA 2GXBA 1S72I 5CVRA 4YIRX 3DBLB 4M3FA 2HTJA 1FNNA 2QEXI 4BHCA 1QHHD 2A5YB 3BPVA 3B73A 3AFHA 2M3AA 2XF6A 2Y0SN 1FOWA 4OU0A 3N97A 3G3ZA 3OL3A 4ON0A 4DGWB 3M8JA 5LHIA 1RKTA 2ZFWA 4XSZF 4CGRA 1TTYA 2Y31A 3ANGA 1VQKI 2GM4A 3TL4X 1GV2A 2XSDC 1YO5C 2GOMA 2IW5A 2XDVA 5M5YJ 2CRGA 3FBNB 1U3EM 1D8JA 4J19A 1X2MA 1JKPC 4L0ZB 3CCSI 3K4KA 3LFKA 5IP7J 4M9SA 3RYRA 2LF8A 1VQMI 3I56I 1RZ4A 1K4SA 4HX7A 4L5JA 1HW2A 5BOXA 3RQ4A 1YS6A 3BR5A 2EFPA 1DU6A 1SEUA 5DYMA 3FMQA 2DA7A 2KQRA 1A31A 4CYDA 1FMVA 1Y1WJ 4CH7A 2V57A 3BQZA 1KGSA 2RC4A 3RTRA 4D1QA 1EKEA 1O7FA 4AIKA 4ZDPA 4KT5C 4XBFA 5CXGA 2WV1A 1FSHA 4BJ5C 2DA4A 1X1PA 3ZN1A 3PNTA 3UR3C 3GTJJ 4NUBA 1BW5A 1JE8A 2LNBA 2H8RA 4PFOA 1IN8A 4E7JA 2RV8A 2ZY9A 2HQ5A 2H27A 2Q2EA 5F0FA 2A6HF 3C07A 1JTXA 2M87A 4EV0A 2G0EA 4LOCA 2EIMH 2K02A 3LA7A 2D5VA 1T0FA 4L5EA 2RASA 1WRJA 3BNIA 4A69C 1BI1A 2W48A 4BH9A 4RB2C 1FSEA 1XMKA 4GGGA 2DLLA 4A0ZA 2W00A 2ELKA 2VQGA 4BAYA 1XMXA 3TOAA 2VONA 3QOPA 1K79A 2H6CA 2KJCA 3F9KA 3Q0WA 1XN7A 1LDDA 2VB6A 5K7FA 1FYMA 4Y15A 2Z1DA 4AIJA 2VKEA 2FOWA 4Y3OA 2FQ3A 5DS9A 2CW0F 1RUOA 5IYDJ 2YVEA 3K7AJ 4I2OA 4P9UA 4F92B 3W6JB 3MFKA 4QLCU 4HLXA 1N77A 1M1EB 2QQAA 3IRRA 3CJRB 3HTIA 5J1YA 2WA0A 3ERED 3KYLA 1HXDA 5ICGA 2E1CA 1OCPA 2AXLA 3DTKA 1R7JA 3A4CA 5CKTA 4G6QA 2WAFA 3HTUA 4MNUA 3CF2A 1V5EA 1KQ0A 3ZOBA 5DM7F 4MTDA 2XAGA 2E2JJ 4MEYF 2C6YA 3R0JA 2WB1A 4KFCA 4AU7A 1JKQC 2O61A 1YLFA 2R7FA 3FXMA 4M3GA 1XGMA 1F5TA 4RM3A 4PJNA 2CMPA 2K7LA 2VN2A 3H36A 2PMHA 3PIPF 3S1RJ 4CHUA 2ZOYA 1LNWA 2UXUA 3BPXA 5FD5A 5HLGA 2ETHA 2CS3A 3F72A 5HLIA 4XM3A 3SEZA 4BE2A 1YTYA 1R23A 2K3PA 3EQLF 5HDGA 4CCKA 5EEGA 1WFXA 1Z0XA 2VBYA 2R92J 1BC8C 2OC6A 2Y69H 3LA3A 3BR1A 4RA2A 1DU0A 1IXCA 1ERDA 4KN4X 2OBPA 2PJRB 4PUSA 3MVPA 1H8AC 2HZDA 2EH3A 3GUDA 5H6RA 3CCYA 1TT0A 3OOUA 3OSGA 3M07A 2EINH 2HKXA 2QTQA 2NVUB 1JTYA 3SYTA 1TNSA 2OU2A 3ON2A 2DT7B 1YE9A 2ESNA 3ZMUA 4JK1X 3ZPLA 3R0AA 2EJRA 2FBHA 2A68F 2HFHA 3CMEI 1YJ9I 1OYYA 3VVZA 3LSMA 2X9DA 1R4NB 2Z9OA 4YELA 3U21A 1X4PA 4LK1F 1SC7A 4NN1A 2EZKA 5LD2C 2JZYA 1XSDA 1OYIA 3BOQA 4S04A 4OMYA 2JK3A 3FM5A 3VOKA 1S7EA 3SQNA 3GZ6A 3UNGC 3IH4A 3D0SA 5ICEA 2E7WA 2XKOA 4I09A 3S2HJ 4XIDA 4HX8A 1O7LA 2ZJRF 5D5WB 5ILSA 5K5OA 3GYHX 3M7GA 1SANA 2IEKA 3PL8A 2UUZA 1TL8A 1JGGA 1POGA 2XRNA 3CP2A 2JN6A 1FPQA 1KONA 4LGWA 1Z3XA 1G6NA 3G2BA 4BL0B 2LP0A 4LG0B 4OIPF 2G7LA 2QM3A 3A01A 2XDNA 2DA5A 4CA0A 5EZHA 4O5VA 5FKNA 1VNDA 1Z6TA 3CMMA 2TRTA 4XKWA 1ZGAA 3K0LA 4E7LA 4XLAA 4IPAA 4LIUA 3I0TA 1R5HA 2Y0MA 2K9SA 4KICA 1E17A 4JX5A 2VPRA 3NWTA 3K70D 2CV1A 4M72A 3KYDB 4D9JA 3CUOA 4AM3A 3GBGA 4PJ0C 4DVYP 3F6VA 1VQ5I 2CGPA 1OCOH 4RB1A 2FF4A 1IN7A 5H6QA 3P5JA 4N9HA 4WWCA 1BOAA 2W57A 4QWQA 3HTJA 2F4OB 2NXNB 3RD3A 2OQGA 4L18B 2O7OA 1O3TA 1BR1A 2HPMA 4L9TA 1TP4A 3VYUB 4G7ZF 3VPRA 2LKSA 1Z1DA 3GCMA 4CICA 3HOTA 3GTKJ 3JR9A 5KAFC 1YFHA 3K6GA 1REPC 1LB2A 3TOBA 5FKOA 2YSRA 3VYTB 1VQLI 3CUQA 4I02A 2HOSA 1A6QA 4OIOF 1BA5A 2LF7A 1WJCA 4ESBA 1IN4A 5HOOA 2MFZA 3E5UA 4QPOA 1YW8A 4WX9A
chains in the Genus database with same CATH topology
2JA5J 4S0HB 2ZOZA 3BT9A 1WGXA 4C3JJ 1I6HJ 2E2HJ 3ZQGA 2MGQA 2ZCXA 3BTCA 4M3DA 2DA2A 1RR7A 2R5YB 4A3BJ 3B6CA 2FX0A 3EGQA 3VW2A 3GTGJ 1BW6A 1GDTA 2E19A 2EZLA 1JUSA 1UHSA 1T33A 3CDLA 2O9LA 2FBQA 2PZ9A 3AQSA 4MXMA 3K2AA 2CUEA 4A3CJ 3VOXA 2JWTA 5J1RA 4HKUA 4XRSG 1B8IB 5FLMJ 4UDSA 3Q3SA 3E7LA 1FTTA 5HAWA 3MNLA 2DMPA 2K40A 5HBUA 3MN2A 4PXIA 2JA8J 5EFYA 1W0TA 2UXIA 1P7JA 1JT0A 1RPWA 3Q0UA 5H9TA 2CQQA 3VIBA 4BBSJ 3KKDA 2ZCNA 2H1KA 2ID3A 4ME9A 4QTRA 3HGGA 2OI8A 1AU7A 1R9TJ 5C3EJ 4IHXA 4CYCA 4QIWN 1FIAA 1MSFC 3HE0A 5BNGA 2ECCA 3ANPA 4ACIA 1IG7A 2E1OA 3BRUA 3G1LA 1U9NA 4BBRJ 4UUTA 2HXOA 1E3OC 4AC0A 1I3QJ 2LKXA 3S15J 1JUPA 1GVDA 1MBEA 5DTDA 2VKVA 2NVTJ 5FLVA 2NP5A 4GFBA 3I4MJ 1Y1VJ 4XRMA 2G7GA 1IJWC 2M9HA 5FKMA 1NK3P 2O8KA 3CQZJ 3WHBA 5GPCA 1MBGA 2CU7A 3I4NJ 2QF7A 4GCTA 4FE4A 3FKIJ 3QQAA 5CXIA 3TW7A 1TWHJ 2LLKA 3B6AA 3O8HA 3CWRA 3NPIA 5K7ZA 1F36A 2DN0A 3BHQA 3HOUJ 1IUFA 3RQIA 4XICA 2WB1N 4V2GA 3JRCA 1LFUP 4NDLA 5F0HA 5FKKA 3QKXA 1NK2P 5K7HA 3V78A 3S2DJ 1MH4A 1YRNA 4MK6A 5IP6A 4AF5A 3O8GA 3LSGA 1EF4A 4QSHA 4X6AJ 4FTHA 2OERA 4XK4A 1IGNA 3NRGA 2L0KA 2NX4A 2M0CA 3HOYJ 2QOPA 3LJLA 5GPAA 3P9TA 1QPIA 3S14J 3FIWA 1TWFJ 2ECBA 2FD5A 4A3GJ 2QKOA 1GV5A 3FK6A 3ZQCA 3VW0A 3IV5A 3JRIA 3LNQA 2I10A 3S1QJ 3Q0VA 5FGLA 3VP5A 2N8GA 3GZIA 4I6ZA 4V2FA 2MW8A 3F1BA 2E2IJ 4BY7J 3HDDA 3HEFA 5M5XJ 2NP3A 2X6OA 3LOCA 1MBJA 4GCLA 1BJZA 5FJ8J 3S16J 2DG8A 1QVUA 4MFDA 5J1UA 1D5YA 2UXHA 1WCMJ 4B1RA 2GBYA 4EEFG 4C3IJ 1OCTC 3RH2A 3KZ9A 2ME6A 3ZQLA 2IBDA 3VVXA 3IH2A 2D6YA 2NS7A 5D19A 3BG5A 2HXIA 3NI7A 1RESA 3HM5A 3GTQJ 2DMTA 1RETA 3COLA 4KWAA 1ENHA 4X1EA 5F27A 4FCYA 3S17J 5EG0A 3JRDA 2XB0X 4UUSB 3JRGA 5K58A 3OSFA 4A3MJ 2FJ1A 1UI5A 1X2NA 1ZK8A 2CQXA 3JRFA 2R5ZB 1ETKA 1LE8B 1TWAJ 4JX6A 2M8GX 3PO3J 3FISA 5E3OA 1ZGWA 1Z77A 4G12A 3WHCA 2QIBA 5M5WJ 4ABZA 3G56A 4BKXA 3LSRA 4AUXA 3HOZJ 3B81A 1SFOJ 2L7FP 3S5RA 4DZJA 3PM1A 3KNWA 4DW6A 1K83J 2YU9J 3M3YJ 1CQTA 1TWGJ 3PASA 2LD5A 2R5YA 1ITYA 5C44J 2RHAA 5FHPA 3UKGA 1U8BA 1HF0A 2MG4A 1QVTA 3VVYA 3CRJA 1G2HA 3PPBA 3NAUA 4IHYA 4M3FA 4YZEA 5D1RA 3JRBA 3RZDJ 1B8IA 1WPKA 3QPSA 4MLOA 2Y0SN 2NVYJ 2DTZA 1B72B 4A93J 4JKZA 1HLVA 4A3IJ 1WI3A 1RKTA 4CGRA 2Y31A 2REKA 3NARA 3SFIA 3ANGA 2ME0A 2GM4A 1GV2A 2YUSA 2XSDC 3BQYA 1ETQA 3BR3A 1ETXA 4RBOA 5M5YJ 3L1PA 2CRGA 1SGMA 3T6NA 4J19A 1X2MA 1JKPC 5C4YA 4D7NA 1ORKA 2HOTA 1OJLA 5IP7J 2G3BA 5E3MA 1HCRA 2NOGA 3HOXJ 3MKLA 5E3LA 2HI3A 1LFBA 1IRZA 5EGOB 2UXOA 4D5FA 3JREA 3BR5A 1DU6A 1PUFB 1HDDC 2DA7A 2L7ZA 2WGBA 1HDPA 1Y1WJ 2PBXA 1MBFA 3BQZA 2V57A 1FTZA 3S1MJ 3NNRA 1ZKGA 2XPWA 3QPLA 1P7IA 4M3EA 2O7TA 3FRQA 1MNMC 5HSZA 2PMZN 2EBIA 5CXGA 2YVHA 2WV1A 2DA4A 4C3HJ 1XS9A 3GTJJ 2NS8A 3BTJA 1JKOC 1BW5A 2QWTA 2H8RA 1APLC 4D5CA 2ZB9A 3A01B 1XC5A 2HQ5A 2VI6A 5F0FA 2OPTA 2ZCMA 4JX4A 2AO9A 2DJNA 1JTXA 3C07A 3HKZN 2MSYA 4DZPA 1T56A 3TW6A 2EZIA 4A3LJ 2G0EA 4LOCA 2JA6J 1HOMA 3BR2A 3BR0A 1FIPA 2D5VA 1H89C 2RASA 4L5EA 3BNIA 4A69C 3HOWJ 2W48A 4FE7A 3M4OJ 1Q1VA 5M3FJ 1H88C 4JL3A 5CW8A 3QBMA 2ELKA 2LR8A 2IAIA 3KKCA 1K61A 4AC6A 3G1OA 3Q0WA 3SDGA 3HGYA 2Y2ZA 1VFCA 3V6GA 5J3LA 5K7FA 5EYRA 4DYQA 5EEAA 2VKEA 2HYJA 2B63J 5DS9A 3BTIA 5EDNA 5IYDJ 4HNVA 5C4JJ 3BG9A 2AHQA 2YVEA 3HIMA 3K7AJ 1TC3C 3TP0A 2DMNA 1AKHB 1ZQ3P 2GLOA 3TEDA 4GFLA 5IYCJ 2XPUA 4I76A 3HTIA 5J1YA 2JJ7A 5DAJA 3HTAA 3BR6A 1RKWA 4M3BA 2JMWA 1OCPA 3HBLA 3DEWA 2HDDA 4MO7A 2K9QA 2IU5A 3NXCA 2LVSA 3LSPA 2CJJA 5IOYA 2XRLA 4XRSA 9ANTA 4UUSA 4A3KJ 3ZOBA 2E2JJ 1FJLA 5IYBJ 3TP3A 4M6VA 2Q24A 3GTOJ 2R5ZA 2XB5A 1LE8A 1IC8A 1JKQC 1IDZA 1F43A 4DYRA 4M3GA 2EZHA 5EZGA 2Y9YA 5GP9A 1IV6A 1U9OA 3VW1A 2DA6A 4MIMA 5M3MJ 3ZQIA 3S1RJ 2ZOYA 2UXUA 5C4XJ 3GEUA 4L62A 2LFBA 2Y9ZA 2DA3A 1I50J 5IP9J 3S1NJ 2NVQJ 1Z0XA 4IHVA 2R92J 3CJDA 3H0GJ 4JP0A 3C2BA 3BR1A 3FK7A 4A3EJ 1DU0A 4B3AA 2KT0A 2XGCA 2LY9A 1W0UA 5AQCA 2CUFA 2LTPA 2R93J 1U78A 3MVPA 1H8AC 1ETWA 1B72A 2EH3A 3F0CA 3G7RA 2UXPA 3PO2J 2DA1A 3CCYA 4D7MA 3OSGA 3OOUA 2R7ZJ 4Y52J 1A6IA 2JA7J 2NVXJ 3DPJA 1TWCJ 2QTQA 1JTYA 2ID6A 4CYCB 3ON4A 3ON2A 5JLXA 3IUVA 2X48A 4B4CA 1UG2A 2P81A 1ETOA 1MBKA 4JNNA 2M34A 2K9NA 3OIOA 3VVZA 1OFCX 5EF6A 1JKRC 2X9DA 3LSJA 2WAQN 1GUUA 2YS9A 1MSEC 1WH7A 4NN1A 2EZKA 4BXXJ 2M2EA 3ZQFA 5EGOA 3JRHA 2JK3A 4C2MJ 4A3DJ 1WH5A 1S7EA 1X58A 1ETVA 4DYCA 3VOKA 2GENA 4GCKA 5HODA 3IH4A 3W6VA 1JUMA 4IHWA 1A5JA 1PUFA 1ZTRA 5F08A 2DMQA 4NELA 2WUIA 3HB9A 3EUPA 2GFNA 2EQRA 3O60A 3S2HJ 4XIDA 3RZOJ 2LK2A 2XPVA 5D18A 1FEXA 3SJMA 3JRAA 3LHQA 2TCTA 4RDUA 1SANA 3JSJA 1ETYA 2IEKA 1JGGA 1MBHA 1POGA 2L9RA 3ZQHA 2HYTA 2L7MP 1YRNB 2JN6A 2RAEA 1JT6A 3GTLJ 2LP0A 2G7LA 2VUMJ 1XG1A 2QCOA 5F1JA 1ZR4A 1VF9A 5JLWA 3A01A 2XDNA 2DA5A 3RKQA 1NTCA 5EZHA 1ZR2A 1UMQA 2R0QC 5E3NA 3H3VK 5FKNA 1VNDA 2TRTA 3CMYA 2Y30A 3DCFA 3A03A 5FMPA 2XGEA 3BJBA 1O4XA 4GFKA 1AHDP 2K9SA 1BL0A 4W1UA 2W53A 4JX5A 2VPRA 2OF7A 4IEJA 3VUQA 3LWJA 4Y7NJ 3G1MA 5IPAA 1JJ6C 3GBGA 2GUHA 3IH3A 4A3FJ 3BG3A 3HTJA 1UI6A 2G7SA 3RD3A 2FQ4A 3HOVJ 2O7OA 3A02A 3D1NI 1GT0C 2DG7A 4A3JJ 3VPRA 4AYBN 2KDZA 3GTPJ 5IOZA 1IDYA 3GTKJ 3JR9A 1AKHA 3BTLA 2XGDA 3BCGA 4JYKA 2HOAA 4W97A 2F07A 1MH3A 2DMUA 4BY1J 5FKOA 5EG0B 4FISA 2HOSA 5FKLA 2HKUA 1BA5A 4MFEA 3AQTA 2COBA 1QRYA 3HTHA 5F04A 3E7QA 1VI0A 3GTMJ 1JJ8C 5F0CA 4ICHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA5 J;  4S0H B;  2ZOZ A;  3BT9 A;  1WGX A;  4C3J J;  1I6H J;  2E2H J;  3ZQG A;  2MGQ A;  2ZCX A;  3BTC A;  4M3D A;  2DA2 A;  1RR7 A;  2R5Y B;  4A3B J;  3B6C A;  2FX0 A;  3EGQ A;  3VW2 A;  3GTG J;  1BW6 A;  1GDT A;  2E19 A;  2EZL A;  1JUS A;  1UHS A;  1T33 A;  3CDL A;  2O9L A;  2FBQ A;  2PZ9 A;  3AQS A;  4MXM A;  3K2A A;  2CUE A;  4A3C J;  3VOX A;  2JWT A;  5J1R A;  4HKU A;  4XRS G;  1B8I B;  5FLM J;  4UDS A;  3Q3S A;  3E7L A;  1FTT A;  5HAW A;  3MNL A;  2DMP A;  2K40 A;  5HBU A;  3MN2 A;  4PXI A;  2JA8 J;  5EFY A;  1W0T A;  2UXI A;  1P7J A;  1JT0 A;  1RPW A;  3Q0U A;  5H9T A;  2CQQ A;  3VIB A;  4BBS J;  3KKD A;  2ZCN A;  2H1K A;  2ID3 A;  4ME9 A;  4QTR A;  3HGG A;  2OI8 A;  1AU7 A;  1R9T J;  5C3E J;  4IHX A;  4CYC A;  4QIW N;  1FIA A;  1MSF C;  3HE0 A;  5BNG A;  2ECC A;  3ANP A;  4ACI A;  1IG7 A;  2E1O A;  3BRU A;  3G1L A;  1U9N A;  4BBR J;  4UUT A;  2HXO A;  1E3O C;  4AC0 A;  1I3Q J;  2LKX A;  3S15 J;  1JUP A;  1GVD A;  1MBE A;  5DTD A;  2VKV A;  2NVT J;  5FLV A;  2NP5 A;  4GFB A;  3I4M J;  1Y1V J;  4XRM A;  2G7G A;  1IJW C;  2M9H A;  5FKM A;  1NK3 P;  2O8K A;  3CQZ J;  3WHB A;  5GPC A;  1MBG A;  2CU7 A;  3I4N J;  2QF7 A;  4GCT A;  4FE4 A;  3FKI J;  3QQA A;  5CXI A;  3TW7 A;  1TWH J;  2LLK A;  3B6A A;  3O8H A;  3CWR A;  3NPI A;  5K7Z A;  1F36 A;  2DN0 A;  3BHQ A;  3HOU J;  1IUF A;  3RQI A;  4XIC A;  2WB1 N;  4V2G A;  3JRC A;  1LFU P;  4NDL A;  5F0H A;  5FKK A;  3QKX A;  1NK2 P;  5K7H A;  3V78 A;  3S2D J;  1MH4 A;  1YRN A;  4MK6 A;  5IP6 A;  4AF5 A;  3O8G A;  3LSG A;  1EF4 A;  4QSH A;  4X6A J;  4FTH A;  2OER A;  4XK4 A;  1IGN A;  3NRG A;  2L0K A;  2NX4 A;  2M0C A;  3HOY J;  2QOP A;  3LJL A;  5GPA A;  3P9T A;  1QPI A;  3S14 J;  3FIW A;  1TWF J;  2ECB A;  2FD5 A;  4A3G J;  2QKO A;  1GV5 A;  3FK6 A;  3ZQC A;  3VW0 A;  3IV5 A;  3JRI A;  3LNQ A;  2I10 A;  3S1Q J;  3Q0V A;  5FGL A;  3VP5 A;  2N8G A;  3GZI A;  4I6Z A;  4V2F A;  2MW8 A;  3F1B A;  2E2I J;  4BY7 J;  3HDD A;  3HEF A;  5M5X J;  2NP3 A;  2X6O A;  3LOC A;  1MBJ A;  4GCL A;  1BJZ A;  5FJ8 J;  3S16 J;  2DG8 A;  1QVU A;  4MFD A;  5J1U A;  1D5Y A;  2UXH A;  1WCM J;  4B1R A;  2GBY A;  4EEF G;  4C3I J;  1OCT C;  3RH2 A;  3KZ9 A;  2ME6 A;  3ZQL A;  2IBD A;  3VVX A;  3IH2 A;  2D6Y A;  2NS7 A;  5D19 A;  3BG5 A;  2HXI A;  3NI7 A;  1RES A;  3HM5 A;  3GTQ J;  2DMT A;  1RET A;  3COL A;  4KWA A;  1ENH A;  4X1E A;  5F27 A;  4FCY A;  3S17 J;  5EG0 A;  3JRD A;  2XB0 X;  4UUS B;  3JRG A;  5K58 A;  3OSF A;  4A3M J;  2FJ1 A;  1UI5 A;  1X2N A;  1ZK8 A;  2CQX A;  3JRF A;  2R5Z B;  1ETK A;  1LE8 B;  1TWA J;  4JX6 A;  2M8G X;  3PO3 J;  3FIS A;  5E3O A;  1ZGW A;  1Z77 A;  4G12 A;  3WHC A;  2QIB A;  5M5W J;  4ABZ A;  3G56 A;  4BKX A;  3LSR A;  4AUX A;  3HOZ J;  3B81 A;  1SFO J;  2L7F P;  3S5R A;  4DZJ A;  3PM1 A;  3KNW A;  4DW6 A;  1K83 J;  2YU9 J;  3M3Y J;  1CQT A;  1TWG J;  3PAS A;  2LD5 A;  2R5Y A;  1ITY A;  5C44 J;  2RHA A;  5FHP A;  3UKG A;  1U8B A;  1HF0 A;  2MG4 A;  1QVT A;  3VVY A;  3CRJ A;  1G2H A;  3PPB A;  3NAU A;  4IHY A;  4M3F A;  4YZE A;  5D1R A;  3JRB A;  3RZD J;  1B8I A;  1WPK A;  3QPS A;  4MLO A;  2Y0S N;  2NVY J;  2DTZ A;  1B72 B;  4A93 J;  4JKZ A;  1HLV A;  4A3I J;  1WI3 A;  1RKT A;  4CGR A;  2Y31 A;  2REK A;  3NAR A;  3SFI A;  3ANG A;  2ME0 A;  2GM4 A;  1GV2 A;  2YUS A;  2XSD C;  3BQY A;  1ETQ A;  3BR3 A;  1ETX A;  4RBO A;  5M5Y J;  3L1P A;  2CRG A;  1SGM A;  3T6N A;  4J19 A;  1X2M A;  1JKP C;  5C4Y A;  4D7N A;  1ORK A;  2HOT A;  1OJL A;  5IP7 J;  2G3B A;  5E3M A;  1HCR A;  2NOG A;  3HOX J;  3MKL A;  5E3L A;  2HI3 A;  1LFB A;  1IRZ A;  5EGO B;  2UXO A;  4D5F A;  3JRE A;  3BR5 A;  1DU6 A;  1PUF B;  1HDD C;  2DA7 A;  2L7Z A;  2WGB A;  1HDP A;  1Y1W J;  2PBX A;  1MBF A;  3BQZ A;  2V57 A;  1FTZ A;  3S1M J;  3NNR A;  1ZKG A;  2XPW A;  3QPL A;  1P7I A;  4M3E A;  2O7T A;  3FRQ A;  1MNM C;  5HSZ A;  2PMZ N;  2EBI A;  5CXG A;  2YVH A;  2WV1 A;  2DA4 A;  4C3H J;  1XS9 A;  3GTJ J;  2NS8 A;  3BTJ A;  1JKO C;  1BW5 A;  2QWT A;  2H8R A;  1APL C;  4D5C A;  2ZB9 A;  3A01 B;  1XC5 A;  2HQ5 A;  2VI6 A;  5F0F A;  2OPT A;  2ZCM A;  4JX4 A;  2AO9 A;  2DJN A;  1JTX A;  3C07 A;  3HKZ N;  2MSY A;  4DZP A;  1T56 A;  3TW6 A;  2EZI A;  4A3L J;  2G0E A;  4LOC A;  2JA6 J;  1HOM A;  3BR2 A;  3BR0 A;  1FIP A;  2D5V A;  1H89 C;  2RAS A;  4L5E A;  3BNI A;  4A69 C;  3HOW J;  2W48 A;  4FE7 A;  3M4O J;  1Q1V A;  5M3F J;  1H88 C;  4JL3 A;  5CW8 A;  3QBM A;  2ELK A;  2LR8 A;  2IAI A;  3KKC A;  1K61 A;  4AC6 A;  3G1O A;  3Q0W A;  3SDG A;  3HGY A;  2Y2Z A;  1VFC A;  3V6G A;  5J3L A;  5K7F A;  5EYR A;  4DYQ A;  5EEA A;  2VKE A;  2HYJ A;  2B63 J;  5DS9 A;  3BTI A;  5EDN A;  5IYD J;  4HNV A;  5C4J J;  3BG9 A;  2AHQ A;  2YVE A;  3HIM A;  3K7A J;  1TC3 C;  3TP0 A;  2DMN A;  1AKH B;  1ZQ3 P;  2GLO A;  3TED A;  4GFL A;  5IYC J;  2XPU A;  4I76 A;  3HTI A;  5J1Y A;  2JJ7 A;  5DAJ A;  3HTA A;  3BR6 A;  1RKW A;  4M3B A;  2JMW A;  1OCP A;  3HBL A;  3DEW A;  2HDD A;  4MO7 A;  2K9Q A;  2IU5 A;  3NXC A;  2LVS A;  3LSP A;  2CJJ A;  5IOY A;  2XRL A;  4XRS A;  9ANT A;  4UUS A;  4A3K J;  3ZOB A;  2E2J J;  1FJL A;  5IYB J;  3TP3 A;  4M6V A;  2Q24 A;  3GTO J;  2R5Z A;  2XB5 A;  1LE8 A;  1IC8 A;  1JKQ C;  1IDZ A;  1F43 A;  4DYR A;  4M3G A;  2EZH A;  5EZG A;  2Y9Y A;  5GP9 A;  1IV6 A;  1U9O A;  3VW1 A;  2DA6 A;  4MIM A;  5M3M J;  3ZQI A;  3S1R J;  2ZOY A;  2UXU A;  5C4X J;  3GEU A;  4L62 A;  2LFB A;  2Y9Z A;  2DA3 A;  1I50 J;  5IP9 J;  3S1N J;  2NVQ J;  1Z0X A;  4IHV A;  2R92 J;  3CJD A;  3H0G J;  4JP0 A;  3C2B A;  3BR1 A;  3FK7 A;  4A3E J;  1DU0 A;  4B3A A;  2KT0 A;  2XGC A;  2LY9 A;  1W0U A;  5AQC A;  2CUF A;  2LTP A;  2R93 J;  1U78 A;  3MVP A;  1H8A C;  1ETW A;  1B72 A;  2EH3 A;  3F0C A;  3G7R A;  2UXP A;  3PO2 J;  2DA1 A;  3CCY A;  4D7M A;  3OSG A;  3OOU A;  2R7Z J;  4Y52 J;  1A6I A;  2JA7 J;  2NVX J;  3DPJ A;  1TWC J;  2QTQ A;  1JTY A;  2ID6 A;  4CYC B;  3ON4 A;  3ON2 A;  5JLX A;  3IUV A;  2X48 A;  4B4C A;  1UG2 A;  2P81 A;  1ETO A;  1MBK A;  4JNN A;  2M34 A;  2K9N A;  3OIO A;  3VVZ A;  1OFC X;  5EF6 A;  1JKR C;  2X9D A;  3LSJ A;  2WAQ N;  1GUU A;  2YS9 A;  1MSE C;  1WH7 A;  4NN1 A;  2EZK A;  4BXX J;  2M2E A;  3ZQF A;  5EGO A;  3JRH A;  2JK3 A;  4C2M J;  4A3D J;  1WH5 A;  1S7E A;  1X58 A;  1ETV A;  4DYC A;  3VOK A;  2GEN A;  4GCK A;  5HOD A;  3IH4 A;  3W6V A;  1JUM A;  4IHW A;  1A5J A;  1PUF A;  1ZTR A;  5F08 A;  2DMQ A;  4NEL A;  2WUI A;  3HB9 A;  3EUP A;  2GFN A;  2EQR A;  3O60 A;  3S2H J;  4XID A;  3RZO J;  2LK2 A;  2XPV A;  5D18 A;  1FEX A;  3SJM A;  3JRA A;  3LHQ A;  2TCT A;  4RDU A;  1SAN A;  3JSJ A;  1ETY A;  2IEK A;  1JGG A;  1MBH A;  1POG A;  2L9R A;  3ZQH A;  2HYT A;  2L7M P;  1YRN B;  2JN6 A;  2RAE A;  1JT6 A;  3GTL J;  2LP0 A;  2G7L A;  2VUM J;  1XG1 A;  2QCO A;  5F1J A;  1ZR4 A;  1VF9 A;  5JLW A;  3A01 A;  2XDN A;  2DA5 A;  3RKQ A;  1NTC A;  5EZH A;  1ZR2 A;  1UMQ A;  2R0Q C;  5E3N A;  3H3V K;  5FKN A;  1VND A;  2TRT A;  3CMY A;  2Y30 A;  3DCF A;  3A03 A;  5FMP A;  2XGE A;  3BJB A;  1O4X A;  4GFK A;  1AHD P;  2K9S A;  1BL0 A;  4W1U A;  2W53 A;  4JX5 A;  2VPR A;  2OF7 A;  4IEJ A;  3VUQ A;  3LWJ A;  4Y7N J;  3G1M A;  5IPA A;  1JJ6 C;  3GBG A;  2GUH A;  3IH3 A;  4A3F J;  3BG3 A;  3HTJ A;  1UI6 A;  2G7S A;  3RD3 A;  2FQ4 A;  3HOV J;  2O7O A;  3A02 A;  3D1N I;  1GT0 C;  2DG7 A;  4A3J J;  3VPR A;  4AYB N;  2KDZ A;  3GTP J;  5IOZ A;  1IDY A;  3GTK J;  3JR9 A;  1AKH A;  3BTL A;  2XGD A;  3BCG A;  4JYK A;  2HOA A;  4W97 A;  2F07 A;  1MH3 A;  2DMU A;  4BY1 J;  5FKO A;  5EG0 B;  4FIS A;  2HOS A;  5FKL A;  2HKU A;  1BA5 A;  4MFE A;  3AQT A;  2COB A;  1QRY A;  3HTH A;  5F04 A;  3E7Q A;  1VI0 A;  3GTM J;  1JJ8 C;  5F0C A;  4ICH A; 
#chains in the Genus database with same CATH topology
 1W5C C;  2JA5 J;  3B02 A;  4XKC A;  2VE9 A;  4XLP F;  1WGX A;  1X3U A;  4C3J J;  1I6H J;  2E2H J;  3ZQG A;  1EH7 A;  2XV4 S;  5D6F A;  1RC9 A;  5LLQ A;  4UNO A;  4PSW A;  5TRD A;  3BTC A;  4M3D A;  3W6K B;  1TT5 B;  2KJB A;  1W5T A;  1RR7 A;  2BYV E;  4M74 A;  4XRF A;  1QQI A;  2R5Y B;  3B6C A;  3D5L A;  4IRI A;  3VW2 A;  1BW6 A;  4E7Z A;  3CDL A;  1JUS A;  1UHS A;  2HDW A;  2FMY A;  4CO8 A;  3FWE A;  2QSH X;  2LKP A;  2VLA A;  1D1A A;  3VOX A;  2LBF B;  5J47 A;  2JWT A;  3ECH A;  1I5Z A;  4HKU A;  4BXU A;  2Y75 A;  1XDU A;  3VB2 A;  3WTZ A;  4UDS A;  3Q3S A;  3EDP A;  2AS5 F;  2DMP A;  3VFZ A;  2X6W A;  3IKV A;  1VQ4 I;  5EFY A;  1W7P A;  3DQV C;  3O3K A;  2ZXJ A;  4K2E A;  4KT6 A;  2RQP A;  3K4C A;  3ML6 A;  1W5S A;  2V9P A;  3FXQ A;  4JOM A;  3H5N A;  4XKB A;  1IN6 A;  5D8L B;  1T2K A;  2K9L A;  4XN0 A;  2VQC A;  4F93 B;  3K8P C;  1Z6R A;  2OI8 A;  3MKZ A;  4PJJ A;  1Z91 A;  3GZ5 A;  4CYC A;  1FIA A;  5E20 A;  3HE0 A;  2M5W A;  3E97 A;  3HUG A;  5BNG A;  2E1O A;  4UVB A;  4U0V A;  4BUP A;  4UUT A;  2HXO A;  2I8D A;  1E3O C;  3MMY B;  4AC0 A;  1ZRD A;  2LKX A;  5DTD A;  3J80 Z;  3I4M J;  1K6O A;  2Z5U A;  3DV8 A;  4HDU A;  2G7G A;  1W4M A;  1IJW C;  2M9H A;  5FKM A;  1NK3 P;  2O8K A;  2ELH A;  4CCO A;  1MBG A;  3RJP A;  4EGZ A;  3Q5F A;  2HQN A;  1YHQ I;  4DBQ A;  1MDM A;  1QA6 A;  3O8H A;  4OMZ A;  4NC6 A;  1E3P A;  5EEH A;  1SAU A;  1F36 A;  3FDY A;  3PJR A;  3KPH A;  3HOU J;  4LLL A;  4MHG A;  2IVM A;  2VT3 A;  1NK2 P;  1MKM A;  3V78 A;  1YRN A;  2A5W A;  5IP6 A;  1H0M A;  4NNJ A;  3L9F A;  1ZLK A;  2ESH A;  4KN7 X;  1F9N A;  4XK4 A;  3S2W A;  5HNH A;  1IGN A;  4CSW A;  3NRG A;  1IZ1 A;  2NX4 A;  2WV0 A;  3LST A;  1Y0N A;  5GPA A;  2MYS A;  4B3X A;  4OIN F;  5E18 F;  4A3G J;  2W7N A;  4BDY A;  1GV5 A;  1QZE A;  1WJE A;  4RGR A;  5HLH A;  2FBK A;  1LDK B;  5IT3 A;  5FGL A;  2N8G A;  3BZK A;  2BXZ A;  4I01 A;  2BY3 A;  2FRH A;  4IKF A;  3F1B A;  3R61 A;  3WE2 A;  3I4P A;  2MH9 A;  3HDD A;  3K69 A;  4BEH B;  3GEZ A;  2R4G A;  2WAQ A;  2X6O A;  3LOC A;  3GX4 X;  4NHJ A;  4G6D A;  3CCQ I;  5FJ8 J;  1QVU A;  4BU2 A;  2L9N A;  2UXH A;  1WCM J;  4EEF G;  1P92 A;  1I39 A;  3VVX A;  3ABK H;  2HXI A;  2PBI A;  2VBX A;  3SDB A;  1X4O A;  4X1E A;  5F27 A;  4FCY A;  1JHH A;  3CF5 F;  1U6G A;  3IC7 A;  4XMY A;  1KU3 A;  1FOY A;  3DKX A;  3HRS A;  4M71 A;  3T5X A;  4A3M J;  2FJ1 A;  1BN5 A;  2F4M B;  2R5Z B;  1ONV A;  3TKY A;  1JHF A;  3EUH C;  1TWA J;  1UJ8 A;  2ZSI B;  2M8G X;  1BI0 A;  1ZGW A;  3WHC A;  4P55 A;  4UVC A;  4ABZ A;  1KYZ A;  1B6A A;  4XLN F;  4DNC A;  5GTH C;  4AUX A;  1MJ9 A;  4FX0 A;  3B81 A;  3Q9V A;  1HKS A;  4PJL A;  4YFX F;  4DW6 A;  1RI7 A;  1TW3 A;  1K83 J;  2XIG A;  4G94 A;  1T6S A;  1TWG J;  2OTL I;  2AQF A;  5C44 J;  2XAJ A;  3BC8 A;  2RHA A;  5FHP A;  3BWG A;  1F4K A;  4P5O A;  3FXO A;  4ESF A;  1FLI A;  4OD5 A;  3PPB A;  3BJ6 A;  4IHY A;  2KZG A;  2M45 A;  3VEP A;  5KK1 A;  2VC1 A;  1WPK A;  1PVE A;  3QPS A;  4MLO A;  1B72 B;  4IOA F;  2QQ9 A;  4HLY A;  2F2E A;  3SWH A;  5LRS A;  1S9H A;  2YX4 A;  5CVI A;  3NAR A;  3SFI A;  2REK A;  2ME0 A;  2VXZ A;  2YUS A;  2NRA C;  4F3Q A;  4CXF A;  3BQY A;  1ETQ A;  3H9Q A;  1ETX A;  5LBQ A;  4RBO A;  2V6E A;  3CCL I;  3T6N A;  1F1Z A;  2PN6 A;  4E70 A;  1RNL A;  1WWX A;  3M8F A;  2H1L A;  5C4Y A;  3FXJ A;  4D7N A;  1ORK A;  2YU3 A;  2HOT A;  1OJL A;  1GXQ A;  2DU9 A;  2XF5 A;  2G3B A;  3OIP A;  1HSJ A;  3MKL A;  1FZP B;  2FU4 A;  2K4B A;  1IRZ A;  4U7D A;  2UXO A;  2LRD A;  4EQQ A;  2OZU A;  3JRE A;  2WTE A;  4V19 K;  3REO A;  2EFQ A;  4X0G A;  1PUF B;  3K1P A;  2M1B A;  2L2O A;  1HDP A;  3WTW C;  1MBF A;  2Z2S B;  1FTZ A;  2QKM B;  4BJ6 C;  3S3O A;  1P7I A;  3WG9 A;  3FXK A;  3FRQ A;  5AON A;  2P6S A;  3GFM A;  2PMZ N;  2EBI A;  3I59 B;  1WJA A;  2GQQ A;  3WTY C;  3IAS 2;  4I7H A;  5B66 C;  2W4S A;  1W7P D;  2NS8 A;  1JKO C;  1UG0 A;  2R7O A;  3DKY A;  2Z3Y A;  5D4R A;  3OR2 C;  4PZJ A;  5DCM A;  2F6C A;  1XC5 A;  1E2X A;  1J9I A;  1XTA A;  2VI6 A;  4RGU A;  5K5Q A;  1FYL A;  2OPT A;  3HKZ N;  4U88 A;  2MSY A;  5ERI A;  4UUV A;  4A3L J;  2IGM A;  5K1Y A;  3DEE A;  3LSK A;  3S3M A;  3DXJ F;  1XB4 A;  3A0B C;  3CJN A;  2EA2 A;  3RSN A;  3JSO A;  3HSR A;  3M4O J;  1OR7 C;  4H4K C;  2M7B A;  2XRO A;  5M3F J;  1H88 C;  2W82 A;  5CW8 A;  1OKR A;  2L5Q A;  4FAS D;  2K4J A;  5DV5 A;  4HG2 A;  2XSJ C;  3SDG A;  3V6G A;  2O03 A;  5EEA A;  1YIJ I;  2OAZ A;  4ZYE A;  3A1Y A;  1OQY A;  4HNV A;  3BG9 A;  2BW3 A;  2CWE A;  4EVI A;  2DMN A;  3CDI A;  1AKH B;  4AD9 A;  1BOB A;  2GLO A;  3TED A;  4XNF A;  1MIJ A;  4BE1 A;  2RKH A;  2VJI A;  1S7O A;  2PI0 A;  5DAJ A;  3KEQ A;  2FJI 1;  5LEK A;  2JMW A;  2X1D A;  1R4M B;  1P6R A;  3DEW A;  2ISZ A;  5A2Q Z;  3S93 A;  2CJJ A;  5B3S H;  4XRS A;  2P5L C;  4IX7 A;  4XKV A;  4A3K J;  3SXY A;  3DPU A;  4CZZ A;  1HA8 A;  1T08 B;  4KYW A;  4M6V A;  2Q24 A;  4R8H A;  1QZZ A;  3KP6 A;  1P9Q C;  4YRV A;  4DYR A;  1YX5 A;  5EZG A;  4Q47 A;  4NQW A;  3P7N A;  2DA6 A;  4MIM A;  3ZQI A;  4L62 A;  1EJ9 A;  1R36 A;  3GZN B;  2RVC A;  3HKZ A;  1DGW Y;  2D1V A;  2DA3 A;  4UV9 A;  1I50 J;  1ZH5 A;  2D45 A;  4Q5S F;  3W2V A;  4JP0 A;  2FNA A;  2V1D A;  1HC8 A;  2FML A;  4UXN A;  4EJW A;  3EUA A;  3QYE A;  2LTP A;  4L9J A;  4GYG A;  3GF2 A;  1T98 A;  3LQR A;  1ETW A;  3L2U A;  2PX9 A;  4ENM A;  4XL9 A;  3PO2 J;  5JI6 A;  4UY8 I;  3MZH A;  2ID6 A;  2V6C A;  1T39 A;  3IUV A;  3G6E I;  2RGV A;  5B5E C;  3K4J A;  4B4C A;  4M73 A;  2P81 A;  3MKY B;  5E8I A;  5LGU A;  4JNN A;  4MEX F;  2LDU A;  3OIO A;  3H3U A;  2ZNY A;  1V5G A;  1OFC X;  2E5N A;  5EF6 A;  3ZMS A;  3LSJ A;  1MMS A;  2QZ8 A;  3CJQ B;  2CUZ A;  2MBF A;  3J81 Z;  5EJC A;  3C3W A;  1QU3 A;  1WH7 A;  4GO1 A;  3EUK L;  4IF4 A;  3ZQF A;  2L54 A;  4F91 B;  3EYY A;  1X58 A;  4GCK A;  1DQU A;  5HOD A;  3W6V A;  4LLG F;  4IHW A;  4E4H A;  1ZTR A;  3GFJ A;  2DMQ A;  4EM1 A;  3HRU A;  4NEL A;  1K4T A;  2GFN A;  3O60 A;  1Y56 A;  1PYV A;  3C18 A;  1R71 A;  1XD7 A;  2X0L A;  1XSV A;  4C30 A;  3IRQ A;  3KP7 A;  1NG7 A;  4ASN A;  4BQQ A;  2BOL A;  3SZP A;  1ZLJ A;  3E6C C;  4DQ2 A;  1MBH A;  2EA4 A;  3WG7 H;  5FRN A;  1LEB A;  2V1N A;  2HYT A;  2KHM A;  1D1B A;  3J80 K;  2RAE A;  4C9Y A;  2IT0 A;  1RUN A;  2ZCW A;  2ZME B;  3QWL A;  4QPQ A;  2ZME C;  4CCN A;  5J6X A;  3WOD F;  2Y0S A;  5J40 A;  5BQT A;  5JLW A;  3CCJ I;  1UMQ A;  5F1R A;  1D0Y A;  5E3N A;  1HQC A;  2JSP A;  5FGM A;  3TDZ C;  3K2Z A;  4ZDL A;  2Y30 A;  3DCF A;  3TBI A;  3A03 A;  1S7A A;  1O4X A;  3O2P E;  2G7U A;  1BL0 A;  3RKY A;  2NNN A;  2W53 A;  4PCQ A;  4IEJ A;  2OF7 A;  4O6J A;  2GOX B;  3LWJ A;  2QYO A;  3C7J A;  2ZJP F;  3G1M A;  5IPA A;  1TNT A;  1JJ6 C;  2EPF A;  3KZI C;  4Y4R A;  1R00 A;  2A6E F;  3I3L A;  3K4N A;  1UI6 A;  1X1D A;  4HRI A;  1R5I D;  2G7S A;  2FQ4 A;  1BI2 A;  3VSL A;  1EH6 A;  4A3J J;  2A6T A;  3GTP J;  4AYB N;  5IT9 K;  2QSF X;  3PQJ A;  1FX7 A;  1UAA A;  1MMG A;  2DMU A;  1ZAO A;  3PSI A;  4YFN F;  4PGG A;  5J8F A;  4BY1 J;  1WJB A;  2R7T A;  5FKL A;  1ZRE A;  2V1U A;  2HKU A;  3P9C A;  1LVK A;  3AQT A;  3LQQ A;  2DQL A;  5F04 A;  5DM6 F;  3E7Q A;  2PLY A;  3GTM J;  1Z7L A;  1FC3 A;  2Z33 A;  2EFN A;  2OZ6 A;  1X19 A;  4KUM A;  3BT9 A;  1XSX A;  5CJ9 A;  1TQM A;  2PEX A;  4JQF A;  2BGC A;  1S29 A;  3R4K A;  1IXR C;  2LYC A;  3QP5 A;  1WJD A;  1Z7U A;  3OYC A;  2DFE A;  3KZY A;  1XGO A;  3E6M A;  3OYB A;  3KLN A;  1GDT A;  2EZL A;  3AQS A;  5BS6 A;  2O9L A;  2PZ9 A;  1RRJ A;  4PFP A;  4MXM A;  2NYX A;  1UCR A;  4ENJ A;  2K85 A;  4IHT A;  4II3 A;  4HDV A;  4XRS G;  1B8I B;  2R7U A;  2W25 A;  3PNY A;  5F64 A;  3FMR A;  4HV5 A;  4N0B A;  5TGT A;  1IO2 A;  2LG4 A;  3ZRG A;  5HBU A;  4BNC A;  4F55 A;  4OAZ A;  3L7W A;  3MN2 A;  4PXI A;  1W0T A;  2EIJ H;  2UXI A;  2HS5 A;  1OYW A;  2MC4 A;  2PJR A;  2CQQ A;  3VIB A;  4BBS J;  3KKD A;  3CDH A;  2H1K A;  1PP8 F;  4RGX A;  4YEJ A;  3CP8 A;  2NNY A;  1K78 B;  5FRO A;  2E35 A;  5C3E J;  1FOK A;  2ZKZ A;  2KMU A;  1FBS A;  4AYB A;  3JTH A;  4C2U A;  2ECC A;  3WU1 B;  4ACI A;  2JTV A;  2OUM A;  2WAD A;  1PUE E;  2MD5 A;  3I58 A;  4JBA A;  1U2W A;  1I3Q J;  3S15 J;  3E6D A;  1JUP A;  2MA3 A;  4I98 B;  1MBE A;  3F8C A;  5FO5 A;  3QAH A;  1LPQ A;  1Z3Y A;  3D5R C;  4GFB A;  4XRM A;  3N05 A;  1SVO A;  2JT1 A;  3CQZ J;  3WHB A;  3OYF A;  2CU7 A;  3I4N J;  3DFG A;  3VYR B;  2OTJ I;  1YG2 A;  3T0Y A;  2KIM A;  3B6A A;  4RAF A;  4Y17 A;  3NPI A;  3LSH A;  4GCV A;  2DN0 A;  3IUO A;  4BQA A;  1S3J A;  1HKT A;  3BHQ A;  1U0J A;  1EH8 A;  3RQI A;  3JRC A;  4XIC A;  3H5R A;  1LFU P;  4NDL A;  5FKK A;  4ANJ A;  2DPU A;  2F4I A;  1IN5 A;  3S2D J;  4LG0 A;  3O8G A;  2L02 A;  4QSH A;  1O3R A;  2OER A;  3HIF A;  3JTG A;  1MD0 A;  2ZNZ A;  3I64 A;  2M0C A;  4A5N A;  2RQQ A;  3P9T A;  4RAY A;  4EM0 B;  2KRH A;  5DUK A;  3S14 J;  2ECB A;  2FD5 A;  4G9Y A;  4ZYH A;  1YQA A;  1TW2 A;  3QYF A;  1I27 A;  2DJI A;  3MD2 A;  2QBY B;  1V3F A;  3LNQ A;  2I10 A;  3S1Q J;  3Q0V A;  1OMI A;  2BVL A;  2M0M A;  4HAM A;  3TO7 A;  2XAU A;  3ABU A;  1HKQ A;  3FMS A;  1XGS A;  3LA2 A;  4BY7 J;  2PFB A;  3NWS A;  3HEF A;  1PJR A;  1VQ7 I;  3PUB A;  1BIA A;  3CC4 I;  2MAB A;  2ZJ2 A;  1MBJ A;  2EB7 A;  4IQ4 A;  2HU9 A;  2W85 A;  2VC0 A;  3U9G A;  4B1R A;  2GBY A;  2ME6 A;  3VWB A;  2IBD A;  2DQR A;  3GW2 A;  3IH2 A;  4PGH A;  2D6Y A;  2NS7 A;  1MZB A;  3MQ0 A;  1RES A;  3HM5 A;  3GTQ J;  2OV7 A;  3WGI A;  2ICW G;  4BDZ A;  3HRT A;  3COL A;  1ENH A;  2EK5 A;  2H09 A;  1MW7 A;  3AKZ A;  4UUS B;  1WKM A;  1H9G A;  5K58 A;  2VIX A;  1D3Y A;  1ZK8 A;  4P1W A;  2VT2 A;  1ETK A;  5TIS C;  1LE8 B;  2LMD A;  1KQ8 A;  4JX6 A;  1OCR H;  3PO3 J;  2QEN A;  3FIS A;  3FZV A;  4R1H A;  5E3O A;  3VOE A;  2HYF A;  2CQK A;  5M5W J;  2JPC A;  3DTE A;  5E1X A;  5L3B A;  3J7Z I;  4BKX A;  2R7Z J;  1R6R A;  3O6B B;  3S5R A;  2WC2 A;  1P4X A;  3HHG A;  3PM1 A;  4DZJ A;  3L2R A;  1W36 C;  2MD0 A;  4U0W A;  3BZC A;  4BE0 A;  2LD5 A;  5A2Q K;  2R5Y A;  3PAS A;  5DEQ A;  1JI8 A;  3AL0 B;  3JAM K;  1FP2 A;  5LRR A;  5ICF A;  3VVY A;  2R7S A;  1N25 A;  3CRJ A;  6PAX A;  4BXF A;  2DTR A;  2DOE A;  3ZMT A;  2LBF A;  2UXN A;  5D1R A;  5JVG F;  3RZD J;  3OR1 C;  4S05 A;  1SVM A;  1LJ9 A;  2L9S A;  2DTZ A;  2O5R A;  4A93 J;  4JKZ A;  1V55 H;  1BM9 A;  2L7K A;  3KP4 A;  4CCL A;  2E5Z A;  4A3I J;  1WI3 A;  5E8G A;  3WU2 C;  2YX7 A;  2P5V A;  5CLS A;  1O57 A;  1QNT A;  2HQR A;  3LWF A;  1XPX A;  1BJA A;  3LMM A;  4GDF A;  3S32 A;  5FLX Z;  4ITV A;  3V8K A;  1SGM A;  2AXT C;  4RMN A;  3WTS C;  1YIO A;  2MLG A;  3TMO A;  2B0L A;  2RN7 A;  4KJZ A;  1GVJ A;  2ZXH A;  3OYG A;  5DDG A;  5E3L A;  2XGX A;  1SFX A;  2CW7 A;  2R7R A;  5EGO B;  4D5F A;  1VTN C;  5HDN A;  2CQN A;  2R7V A;  3PUF A;  1SAX A;  1JXS A;  2QGU A;  1HDD C;  5BPI A;  2L7Z A;  5JVT A;  2WGB A;  3H5A A;  3ROU A;  3SHF A;  3S1M J;  2KL4 A;  1ZKG A;  1IW7 F;  1IRX A;  3KIO A;  2XPW A;  1TQI A;  3BY6 A;  5ICC A;  3L2Q A;  3RKX A;  1U5T B;  1U5T C;  2VKD A;  3E1S A;  5JR3 A;  3CES A;  2P8T A;  4KIB A;  3U1K A;  5HSZ A;  3CTA A;  2YVH A;  2FBI A;  2HQA A;  1IRG A;  2EV5 A;  4OAY A;  3J81 K;  3N4M A;  4C3H J;  1XS9 A;  2P0W A;  3CO6 C;  4XOP A;  1A35 A;  3T8R A;  4D5C A;  2ZB9 A;  1NHA A;  2KDO A;  3F22 A;  2DDA A;  2E71 A;  3NQO A;  2DFF A;  3FXL A;  2ZCM A;  2X4H A;  2YPR A;  4DZP A;  1G59 A;  4OIQ F;  4C2M A;  2EFW A;  2PMU A;  4RS8 A;  3WGG A;  4GXO A;  1SMT A;  2JA6 J;  1HOM A;  3MZ8 A;  2VKH A;  3BR0 A;  1L0O C;  5FFX A;  3TO6 A;  3OS2 A;  3HOW J;  2BV6 A;  3JW4 A;  2DT5 A;  3GXO A;  2NOJ B;  2GA1 A;  1G3T A;  1B9M A;  2LR8 A;  5J8C A;  5L3E A;  2IAI A;  2VOD A;  1ZG3 A;  3FBI B;  3G71 I;  1K61 A;  2XAQ A;  3G1O A;  1ULY A;  5JHF A;  2Y2Z A;  3QU3 A;  3CMA I;  1T8I A;  2HNH A;  4M6X A;  5EYR A;  3F8B A;  4HPQ A;  2B63 J;  4ZH4 F;  1J59 A;  4AID A;  3G4S I;  2HYG D;  3DBR B;  3WTU C;  4AIH A;  5EDN A;  4TV7 A;  3Q9S A;  3M1E A;  4BEH A;  5C4J J;  2AHQ A;  4OWR B;  1CF7 B;  1TC3 C;  3TP0 A;  4Z6Y A;  4IJA A;  4PSX A;  3VYS B;  2YVX A;  5ILV A;  3FF5 A;  1CGP A;  3IKT A;  4GFL A;  4P96 A;  4ZYG A;  2XPU A;  1IV8 A;  4ZDO A;  3ABM H;  4I76 A;  3ASO H;  3CO7 C;  4L9N A;  4CGZ A;  1IUY A;  3BR6 A;  2OD5 A;  2QQB A;  2B9S A;  2HDD A;  4MO7 A;  2JPB A;  2R3S A;  2K9Q A;  2UXX A;  2F5F A;  2CFO A;  2KIQ A;  3IP4 B;  4KIT B;  2IU5 A;  5IOY A;  3HSF A;  4MTE A;  1XX5 A;  1BC7 C;  1V5F A;  2IA2 A;  3E5X A;  2J5P A;  1LQ1 A;  3TP3 A;  3W2A A;  2XC7 A;  3GTO J;  2R5Z A;  3EUH A;  5AIP A;  3PNV A;  2JQ7 A;  5J4Y A;  1T38 A;  1IDZ A;  2EZH A;  3EET A;  2Q0O A;  1IV6 A;  3W2W A;  1U9O A;  5K5R A;  2MLK A;  2O0Y A;  2KPM A;  3GEU A;  1O3Q A;  5CVV A;  2CYY A;  4CDG A;  2LFB A;  3HC7 A;  1X1C A;  5KCM A;  5IP9 J;  3S1N J;  5B1B H;  2NVQ J;  4IHV A;  2HOE A;  3FK7 A;  4KIS A;  3ERM A;  4B3A A;  3PFI A;  2EV0 A;  3PQK A;  2IS2 A;  3J7Y J;  1W0U A;  5E1Z B;  2BXY A;  2CUF A;  2ZSH B;  3SZT A;  2IS4 A;  2E1N A;  3OYI A;  5DUI A;  3ZCO A;  1ODD A;  1ZN2 A;  3CD6 I;  2D1H A;  1B72 A;  1X1A A;  3MKW B;  1JGS A;  3F0C A;  3A0H C;  4U7B A;  3G7R A;  2UXP A;  2DA1 A;  3JCU C;  1R22 A;  2IGO A;  4XN3 A;  1R1U A;  2AQE A;  4HST A;  1A6I A;  5F6F A;  2HGC A;  4Y52 J;  4N4O B;  1TWC J;  2DCE A;  4LLN A;  3OYH A;  3ON4 A;  4XLC A;  1R49 A;  1SVL A;  5JLX A;  4Y33 A;  3ZMD A;  3HYI A;  2KP6 A;  4EJU A;  1MBK A;  2FA5 A;  4WXH A;  3COA C;  2ZFU A;  1OCC H;  3E5Q A;  1V54 H;  4MQV A;  1VQ6 I;  5H2F C;  1P2F A;  4AWX B;  4ZTJ A;  2KRC A;  2JVG A;  4D0P A;  1MSE C;  1E0E A;  3WE3 A;  1YYV A;  4ZJZ A;  2H6B A;  3ZMV A;  1I6X A;  3AG4 H;  2GIZ A;  4C2M J;  4A3D J;  1WH5 A;  2DK5 A;  1ETV A;  2GEN A;  3K4B A;  4C2T A;  2X1C A;  4U9N A;  5LGN A;  1A5J A;  1PUF A;  5CVJ A;  4DIQ A;  5F08 A;  3IAM 2;  2WUI A;  3HB9 A;  2EQR A;  2LK2 A;  3NEU A;  4M9Z A;  1DPR A;  5D18 A;  1OCZ H;  4HF1 A;  3SJM A;  3JRA A;  3LHQ A;  2TCT A;  2K27 A;  1XGN A;  3E3V A;  2VQH A;  4XLF A;  3I59 A;  3VSK A;  3HXL A;  3X2Q H;  3JSJ A;  1LEA A;  2L9R A;  2L7M P;  3GTL J;  2E7X A;  4AVP A;  2VJ5 A;  2X6X A;  3R6S A;  2QUF A;  2VJ4 A;  2QCO A;  5F1J A;  5DD8 A;  1VF9 A;  1ZR2 A;  3MAJ A;  1NTC A;  5CVU A;  3SFZ A;  3V4G A;  3T1B A;  2R0Q C;  4I0B A;  1J2X A;  5DCF A;  2LRE A;  3I9V 2;  1UB9 A;  1WJ5 A;  2GZW A;  3DPT A;  1J5Y A;  1SD7 A;  1X1B A;  5GTI C;  5HVQ C;  1GXP A;  3BJB A;  4GFK A;  2MC3 A;  1AHD P;  5L3D A;  3VUQ A;  3DU6 A;  1N75 A;  1OR7 A;  3LAP A;  1QHG A;  5D5U B;  2GUH A;  1Q1H A;  1WQ2 A;  5LEJ A;  1DGR M;  1UST A;  2R7Q A;  4EMS A;  3HOS A;  3IH3 A;  2CH0 A;  4J00 A;  4EJT A;  2VXD A;  3U1D A;  2LOO A;  4Y13 A;  3HOV J;  2VBW A;  2H8W A;  3A02 A;  1B1B A;  1VQO I;  1GT0 C;  1C0W A;  1ZG1 A;  5LGT A;  1QO0 D;  1FWZ A;  3BG7 A;  2KDZ A;  1AKH A;  5GAG J;  3K9T A;  1ACI A;  2XF7 A;  4BQN A;  2STW A;  4W97 A;  2VBZ A;  2F07 A;  2K5C A;  3RPU A;  4R79 A;  4EAT A;  5EG0 B;  1KQ9 A;  4HF2 A;  3WU0 A;  1FMW A;  1MMD A;  1R1T A;  4MFE A;  5FB2 A;  3IHU A;  1DPU A;  2PMZ A;  4FHT A;  2VPL A;  2KIU A;  2CO5 A;  1JJ8 C;  5F0C A;  4ICH A;  3CLO A;  3F8M A;  4S0H B;  2M4K A;  2XHK A;  3ZP5 A;  3FM3 A;  1A36 A;  2FOK A;  4WXC A;  2MGQ A;  1BR2 A;  1MJA A;  5HNF A;  2ZCX A;  3DPL C;  4A3B J;  4ZTF A;  2OCE A;  5GAD J;  3OWT A;  4M9X A;  3F6O A;  2E19 A;  3NRV A;  1T33 A;  3QOD A;  3I53 A;  3FHZ A;  2Z16 A;  3K2A A;  5BMZ A;  4LG3 A;  4A3C J;  5J1R A;  2O3F A;  3OYM A;  3CC2 I;  1GLN A;  4ZZL A;  2K86 A;  5FLM J;  5L3F A;  2IS1 A;  4FT8 A;  2M7A A;  3DBH B;  5HAW A;  1V4R A;  4ESJ A;  3MNL A;  2K40 A;  2J5O A;  5D4S A;  2OJE D;  2JA8 J;  1KYW A;  3ECO A;  1RPW A;  4EJV A;  4YG2 F;  1JT0 A;  1HST A;  1IF1 A;  2ZCN A;  3VDX A;  2JVH A;  1ON1 A;  2CFX A;  3ZQ7 A;  3C1D A;  3RPQ A;  4DBR A;  1PDN C;  2WY7 Q;  4XSX F;  5HS7 A;  1R9T J;  4IHX A;  1LFP A;  3DTI A;  3AG3 H;  3H9G A;  1SFU A;  3K70 C;  3CC7 I;  3DU5 A;  3G1L A;  1K7A A;  4BBR J;  3AG1 H;  2HTS A;  2XAF A;  1FBU A;  2I5U A;  5KAI C;  4GRI A;  1W1W E;  2NVT J;  2BHZ A;  5FLV A;  3V7C A;  4LIT A;  2NP5 A;  1Y1V J;  3CCM I;  3DF8 A;  5FLX K;  1UHW A;  2F5E A;  2DXI A;  5GPC A;  2DPD A;  3V8J A;  1G4D A;  2F5C A;  3H92 A;  4WK8 F;  3LSI A;  2VE8 A;  3KLO A;  3TW7 A;  4F7Z A;  1TWH J;  2W84 A;  4E7H A;  3HG9 A;  1NG6 A;  4HSR A;  5K7Z A;  4BHP A;  3GFI A;  2Q8K A;  2IP2 A;  2VJJ A;  3IWF A;  1IUF A;  5HLT A;  2WB1 N;  2DYR H;  4V2G A;  1WJF A;  1STZ A;  5F0H A;  3ZGK A;  4IXA A;  2Q2E B;  1USS A;  3PSF A;  5K7H A;  2JRM A;  1G3W A;  4N9I A;  1MH4 A;  4KMU X;  3I5U A;  3KP3 A;  4AF5 A;  3ZR8 X;  3KE2 A;  2IPQ X;  2L4A A;  3E6B A;  1EF4 A;  2NS0 A;  4X6A J;  2BZT A;  2ZME A;  2CQ7 A;  4PK4 A;  3G73 A;  3K10 A;  2L0K A;  1T0F C;  1ZAR A;  2QWW A;  2QOP A;  3LJL A;  3OS0 A;  2IA1 A;  1R58 A;  2JUC A;  2R7D A;  3PFY A;  1QPI A;  1Z05 A;  3H3Z A;  2UV1 A;  1TWF J;  2MH2 A;  1Z67 A;  2QKO A;  3FK6 A;  2A61 A;  3OY9 A;  2QSG X;  2M30 A;  1EA3 A;  4LMY A;  1P4W A;  4DOZ A;  2L9V A;  4I6Z A;  4N4N B;  4V2F A;  2MW8 A;  2DK8 A;  2E2I J;  2R7W A;  1HW5 A;  2BY2 A;  2QKL B;  3ZQQ A;  1D5V A;  1B9N A;  3CLQ A;  4KNY A;  4GCL A;  3HTS B;  4H0E A;  2KRF A;  3S16 J;  2TDX A;  1XCV A;  4MFD A;  5J1U A;  4HNT A;  1D5Y A;  3PIO F;  1UFM A;  2YR2 A;  2JSC A;  2L4M A;  3GWZ A;  1H9T A;  4IRV A;  3RIR A;  1FBQ A;  3V7S A;  3KZ9 A;  3J7A O;  3ZQL A;  2UWM A;  2KLO A;  3KEY A;  3VTI A;  3ISP A;  2DMT A;  4BQO A;  4KWA A;  2NAZ A;  1B59 A;  3RCO A;  5B1A H;  3S17 J;  2ZXW H;  2XB0 X;  1ZHF A;  3KZZ A;  4ETS A;  3JRG A;  3H0D A;  3GLX A;  2IGN A;  2JA2 A;  1UI5 A;  4B8X A;  1X2N A;  2CQX A;  3JRF A;  3KCC A;  3BCB A;  4YIF A;  2W1O A;  1Z77 A;  4G12 A;  4ENN A;  2K3F A;  2O6G E;  3K1N A;  4A2U A;  3HOZ J;  1SD5 A;  3S3N A;  1KA8 A;  2L7F P;  1SFO J;  4A0Y A;  3KNW A;  2KFD A;  3C2H A;  3A2K A;  4LB6 B;  2A05 A;  1YX3 A;  4FX4 A;  3WTT C;  1CQT A;  5KNL A;  4XQF A;  1ITY A;  3CJT B;  1QPM A;  1TBX A;  2A2F X;  3BLY A;  3HL2 A;  3UKG A;  3WGH A;  1U8B A;  5D6E A;  2MG4 A;  1G2H A;  1B4A A;  3NAU A;  4XLE A;  3P9I A;  4OOI A;  1VQP I;  1YJN I;  1DP3 A;  1Y0U A;  1WHU A;  5GAH J;  4YZE A;  1D0X A;  3RKW A;  3JRB A;  1B8I A;  3QYB A;  2XAH A;  4IOC F;  3CCU I;  2NVY J;  4CCM A;  2BE5 F;  1DDN A;  2KIS A;  2XAS A;  2V9V A;  1HLV A;  1SFK A;  4HF0 A;  3HSE A;  3DEU A;  2P7C B;  3HZJ A;  3RPU D;  1ZRF A;  2E34 A;  4A6D A;  1BI3 A;  4HOB A;  4XR6 A;  2COM A;  3HRM A;  3BR3 A;  2FXA A;  3FXR A;  2EIL H;  3MCZ A;  2DW4 A;  1VZ0 A;  2JUG A;  3L1P A;  1K78 A;  4ENK A;  3LFU A;  2X85 A;  2EV6 A;  3L09 A;  4UB6 C;  3OS1 A;  3TQN A;  2HVS A;  3KEO A;  5E3M A;  1HCR A;  2NOG A;  5AIQ A;  3HOX J;  1HW1 A;  2HI3 A;  1LFB A;  3OYJ A;  2DYS H;  4LK0 F;  2DAO A;  3GFL A;  1AOY A;  1T95 A;  1BBY A;  1S8N A;  5HS8 A;  1KZH A;  2DT6 A;  3HJE A;  4I99 C;  2WAE A;  1BIB A;  1VQ8 I;  2PBX A;  5ILU A;  1K6Y A;  1IXS B;  2PJP A;  5JHU A;  3NNR A;  1LDJ A;  1I3A A;  3BP8 A;  4NBQ A;  3QPL A;  1ZGJ A;  4HW0 A;  4HYE A;  4M3E A;  3TGN A;  4HQE A;  2RDP A;  2O7T A;  4HBL A;  3CCV I;  1YOV B;  1MNM C;  4RLF A;  2VOP A;  3U2R A;  4HQM A;  2QQ8 A;  4BJT A;  3BTJ A;  2QWT A;  4Z2Y A;  4B48 A;  1APL C;  2P6T A;  3GVA A;  1AA7 A;  5FFZ A;  3A01 B;  1WSU A;  5L3C A;  3OYK A;  2W24 A;  2ISY A;  2V9K A;  2AO9 A;  2DJN A;  4HEA 2;  1XCB A;  4JX4 A;  4UB8 C;  1T56 A;  3TW6 A;  3D5S C;  2EZI A;  3AG2 H;  3BR2 A;  1FIP A;  2KIF A;  3V7R A;  1H89 C;  3L2C A;  5FRM A;  4HX4 A;  2UZK A;  3GME A;  2BY0 A;  4FE7 A;  5D5V B;  1Q1V A;  2CV2 A;  1L3L A;  4JL3 A;  4RLQ A;  3QBM A;  4Q48 A;  1OLT A;  1XDS A;  3BG6 A;  3KFW X;  3KKC A;  2QBY A;  2DOF A;  3HHH A;  4AVZ A;  4AC6 A;  3TO9 A;  3HGY A;  1VFC A;  4B43 A;  5J3L A;  4DYQ A;  2B7E A;  2X1E A;  3C2G A;  3R60 A;  2HYJ A;  3KP5 A;  4B44 A;  1QBJ A;  5D5X B;  2BY1 A;  1G3S A;  3BTI A;  3QU6 A;  3BZ6 A;  1MNE A;  3HIM A;  4UHT A;  2EIK H;  4EM2 A;  1X3Z B;  1ZQ3 P;  5J4V A;  5E1W A;  2PQ8 A;  4IVN A;  5IYC J;  2LY2 A;  5E17 F;  3H35 A;  1LVA A;  2JJ7 A;  3CUQ B;  3MWM A;  3CUQ C;  3HTA A;  4G8X A;  1X3W B;  1RKW A;  4M3B A;  2F5D A;  3HBL A;  2HVR A;  3NXC A;  2LVS A;  2M4G A;  3LSP A;  2XRL A;  9ANT A;  1A04 A;  4UUS A;  3OYE A;  2FNP A;  2DFH A;  3M8E A;  5IYB J;  1KU2 A;  2X51 A;  1FJL A;  3GLL A;  4MGR A;  2XB5 A;  3DP7 A;  3F23 A;  1LE8 A;  3OV8 A;  1IC8 A;  1ZEL A;  2GXA A;  1F43 A;  2Y9Y A;  2D2W A;  1TZL A;  5GP9 A;  4XON A;  4CCJ A;  3VW1 A;  2CW8 A;  5M3M J;  5CPR B;  1Z21 A;  3AL0 C;  5C4X J;  4HZF A;  4NB5 A;  1O3S A;  2HZT A;  3WTX C;  2Y9Z A;  4NC8 A;  5CQE A;  2OQR A;  3RDI A;  4XOT A;  2IS6 A;  4IZZ A;  3MZY A;  3H0G J;  1AWC A;  3CJD A;  3C2B A;  4A3E J;  4DJA A;  4B09 A;  2STT A;  3OYD A;  4L5I A;  2E1M B;  3H1C A;  3EPZ A;  2E1M C;  5TJJ A;  2KT0 A;  1W7P B;  2LY9 A;  2XGC A;  3QPT A;  5AQC A;  2FEZ A;  3J7A Y;  3OMY A;  4WXD A;  2R93 J;  1FT9 A;  4U0Y A;  4A6E A;  1U78 A;  4NC7 A;  4HV6 A;  1BR4 A;  1I1S A;  2CSO A;  2V26 A;  1QGP A;  2GXG A;  2KZV A;  2EWN A;  1MGT A;  1P4A A;  2BEO A;  3BJA A;  4D7M A;  2JA7 J;  2NVX J;  1NH3 A;  1G8X A;  3DPJ A;  4A5M A;  2ACJ A;  3QPH A;  1D8K A;  5HS9 A;  4CYC B;  3M9A A;  2X48 A;  2E36 A;  1UG2 A;  3HUG B;  1ETO A;  4IRH A;  2M34 A;  2V7F A;  2K9N A;  4PJM A;  3ZN0 A;  4OIR F;  4EJO A;  3SZG A;  2RRE A;  2QA4 I;  1J7K A;  2V1X A;  2DI3 A;  1JKR C;  3ULQ B;  2FSW A;  2WAQ N;  2LSO A;  1GUU A;  2YS9 A;  1WI9 A;  2F5V A;  4BXX J;  4EGY A;  4RM2 A;  4XOR A;  3QP6 A;  2LC2 A;  2M2E A;  5IY5 H;  5EGO A;  3JRH A;  4GYI A;  1UEL B;  1MMA A;  4DYC A;  1IRF A;  2E60 A;  1JUM A;  3I54 A;  2CG4 A;  4LIV A;  3F21 A;  3EUP A;  1MDM B;  3TDU C;  4BHB A;  2XVC A;  3RZO J;  3E0J B;  2HVQ A;  2XPV A;  4M6Y A;  3FKJ A;  1FEX A;  4IQJ A;  1U5T A;  4IL6 C;  3RI4 A;  4RDU A;  5CYV A;  3HPH A;  1ETY A;  4BGD A;  2ADU A;  4II2 A;  3K4L A;  3ZQH A;  4YII A;  1YRN B;  3OYA A;  1JT6 A;  2DDB A;  2OA4 A;  2DOD A;  3GO5 A;  2VUM J;  1XG1 A;  1ZR4 A;  2DFI A;  2ELJ A;  3RKQ A;  4YFK F;  4CZC A;  3MEX A;  1HBX G;  2H94 A;  1I1G A;  5KVR A;  3H3V K;  4UV8 A;  2M8E A;  2V4J C;  4WCG A;  4UVA A;  3CMY A;  3CCE I;  5FMP A;  4P9F A;  2XGE A;  1J75 A;  3LL7 A;  5L3G A;  1E3H A;  4WIB A;  4W1U A;  2BHY A;  1G3Y A;  4Y7N J;  3ESW B;  5IT9 Z;  1Y8R B;  3M1C A;  3L2W A;  2B3W A;  2B1E A;  1N78 A;  2HDC A;  4RGS A;  2HPI A;  5FD6 A;  2L3D A;  4OD4 A;  4A3F J;  2G9W A;  4LJZ F;  4MQ9 F;  3WTV C;  3BG3 A;  1Y6I A;  2QLZ A;  3QOE A;  3EYI A;  5LHG A;  2L01 A;  3D1N I;  2GWR A;  2DG7 A;  3RYP A;  2ZO4 A;  3KET A;  1CF7 A;  5IOZ A;  1IDY A;  2VOO A;  2OCC H;  1ON2 A;  2XGD A;  3BTL A;  4RB3 C;  3ELK A;  3BCG A;  4HA8 A;  2HOA A;  2GA2 A;  4JYK A;  1FOX A;  1SD6 A;  3QRF F;  3DLL F;  1MH3 A;  4LFU A;  4FIS A;  2X6Y A;  4ZC3 A;  3SEQ A;  5D8K B;  4F52 A;  1VQN I;  4U9L A;  2COB A;  4PDK A;  1QRY A;  3HTH A;  4WF2 A;  1D0Z A;  1VI0 A;  3KX2 A;  4RAG A;  1TLH B;  2P4W A;  2ZOZ A;  2A07 F;  2ZJQ F;  2FUG 2;  4E7I A;  4B47 A;  2F48 A;  3KYC B;  3OYN A;  2IA0 A;  3FHN A;  2KKO A;  3OL4 A;  2DA2 A;  2LY1 A;  3HPG A;  1OPC A;  1FYK A;  4A0X A;  4KDP A;  2FX0 A;  3P9K A;  3EGQ A;  3K1M A;  1MND A;  4E6K G;  3GTG J;  1YJW I;  2FE3 A;  2R7X A;  1UZC A;  2RNG A;  2FBQ A;  2EFO A;  2ZC2 A;  2CUE A;  1Y8Q B;  2ZBK A;  1LUJ B;  3IL2 A;  3E7L A;  1FTT A;  4HNU A;  3I55 I;  2GIV A;  1FP1 D;  2VL8 A;  4FQG A;  4U87 A;  3S8P A;  2IJL A;  5JFR A;  1YIT I;  4E7S A;  1P7J A;  2IXS A;  4ZZD A;  3Q0U A;  3DLA A;  1EV7 A;  5H9T A;  2P5K A;  4I0A A;  1YI2 I;  1D1C A;  5H20 A;  1QZY A;  2ID3 A;  4O3M A;  4ME9 A;  5HDK A;  3F8F A;  5GAE J;  4QTR A;  3F8N A;  3HGG A;  2V79 A;  5DD4 A;  2CV0 A;  2HEO A;  1AU7 A;  4J01 A;  4BYY A;  3LAJ A;  1ZG5 A;  4QIW N;  3DKW A;  1MSF C;  2WWY A;  4FET A;  4CUG A;  1GHC A;  4A12 A;  3ZXS A;  3ANP A;  1TQP A;  1WVR A;  1IG7 A;  2XKP A;  3BRU A;  1U9N A;  1YW9 A;  5E79 C;  2LH9 A;  1LKX A;  3K4M A;  1GVD A;  2VKV A;  4ZYD A;  1IAW A;  1YS7 A;  1Y39 A;  1W36 D;  3OIQ A;  3ASN H;  2VQL A;  2XUB A;  1R5G A;  3OOP A;  2P7V B;  2QF7 A;  4GCT A;  1U8R A;  4FE4 A;  3FKI J;  3QQA A;  5CXI A;  3CZ6 A;  2HWV A;  4IO9 F;  1DUX C;  1VQ9 I;  2LLK A;  2IGK A;  4KIG A;  2DOA A;  4G6T B;  5CQG A;  4E7K A;  3CWR A;  4BS9 A;  1WZ2 A;  3KP2 A;  1S5L C;  5DCM B;  4L0Y B;  3QKX A;  1RR8 C;  3L2V A;  3T8T A;  2Z99 A;  3CCR I;  1ZRC A;  4MK6 A;  1KU9 A;  2PFV A;  2IRF G;  3BRO A;  3LSG A;  4FTH A;  3BJO A;  2JRT A;  3HOY J;  3W3C A;  3ABT A;  3FIW A;  1FY7 A;  2HKO A;  3ZMZ A;  3ZQC A;  3VW0 A;  2G7H A;  2WY8 Q;  3IV5 A;  3JRI A;  4RB0 A;  3VP5 A;  1J09 A;  2DO7 A;  2Q1Z B;  4KIF A;  3GZI A;  2WBM A;  5BPD A;  3H9J A;  2CUJ A;  4XLH A;  2DBB A;  2GAU A;  5M5X J;  3VOD A;  2NP3 A;  2BW3 B;  3F3X A;  4LD5 A;  4KA4 A;  3JSP A;  1BJZ A;  1SMY F;  4G7H F;  2DG8 A;  4LB5 A;  1ZYR F;  3NS4 A;  5LFA A;  2ZXI A;  1OCT C;  4ZYA A;  4C3I J;  4Q4Z F;  3RH2 A;  3BDD A;  5LHH A;  3L00 A;  4RAZ A;  5D19 A;  1RIO H;  3BG5 A;  2O8X A;  2QVO A;  3OYL A;  3NI7 A;  1OIS A;  1RET A;  2A3S A;  2A69 F;  3DWL E;  4IHS A;  4G7O F;  5EG0 A;  3JRD A;  2BBY A;  2RNJ A;  4L9V A;  3OSF A;  5KHD A;  3FX3 A;  3ABL H;  1XMA A;  1KU7 A;  3FXU A;  1SD4 A;  1SFE A;  4NQW B;  3JAM Z;  4BAC A;  3BCA A;  1PP7 U;  3V42 A;  2QIB A;  1S6L A;  4IRG A;  1MJB A;  2VAS A;  3G56 A;  3LSR A;  1YW7 A;  1J0R A;  2Y48 A;  3I71 A;  4KMF A;  3V8L A;  1DP7 P;  1UHM A;  3AAF A;  2K9M A;  2YU9 J;  1Z9C A;  3M3Y J;  2HR3 A;  2PG4 A;  2BVM A;  1R1V A;  1MMN A;  3IWZ A;  5ED4 A;  1HF0 A;  3ONQ A;  1QVT A;  2GXB A;  1S72 I;  5CVR A;  4YIR X;  3DBL B;  4M3F A;  2HTJ A;  1FNN A;  2QEX I;  4BHC A;  1QHH D;  2A5Y B;  3BPV A;  3B73 A;  3AFH A;  2M3A A;  2XF6 A;  2Y0S N;  1FOW A;  4OU0 A;  3N97 A;  3G3Z A;  3OL3 A;  4ON0 A;  4DGW B;  3M8J A;  5LHI A;  1RKT A;  2ZFW A;  4XSZ F;  4CGR A;  1TTY A;  2Y31 A;  3ANG A;  1VQK I;  2GM4 A;  3TL4 X;  1GV2 A;  2XSD C;  1YO5 C;  2GOM A;  2IW5 A;  2XDV A;  5M5Y J;  2CRG A;  3FBN B;  1U3E M;  1D8J A;  4J19 A;  1X2M A;  1JKP C;  4L0Z B;  3CCS I;  3K4K A;  3LFK A;  5IP7 J;  4M9S A;  3RYR A;  2LF8 A;  1VQM I;  3I56 I;  1RZ4 A;  1K4S A;  4HX7 A;  4L5J A;  1HW2 A;  5BOX A;  3RQ4 A;  1YS6 A;  3BR5 A;  2EFP A;  1DU6 A;  1SEU A;  5DYM A;  3FMQ A;  2DA7 A;  2KQR A;  1A31 A;  4CYD A;  1FMV A;  1Y1W J;  4CH7 A;  2V57 A;  3BQZ A;  1KGS A;  2RC4 A;  3RTR A;  4D1Q A;  1EKE A;  1O7F A;  4AIK A;  4ZDP A;  4KT5 C;  4XBF A;  5CXG A;  2WV1 A;  1FSH A;  4BJ5 C;  2DA4 A;  1X1P A;  3ZN1 A;  3PNT A;  3UR3 C;  3GTJ J;  4NUB A;  1BW5 A;  1JE8 A;  2LNB A;  2H8R A;  4PFO A;  1IN8 A;  4E7J A;  2RV8 A;  2ZY9 A;  2HQ5 A;  2H27 A;  2Q2E A;  5F0F A;  2A6H F;  3C07 A;  1JTX A;  2M87 A;  4EV0 A;  2G0E A;  4LOC A;  2EIM H;  2K02 A;  3LA7 A;  2D5V A;  1T0F A;  4L5E A;  2RAS A;  1WRJ A;  3BNI A;  4A69 C;  1BI1 A;  2W48 A;  4BH9 A;  4RB2 C;  1FSE A;  1XMK A;  4GGG A;  2DLL A;  4A0Z A;  2W00 A;  2ELK A;  2VQG A;  4BAY A;  1XMX A;  3TOA A;  2VON A;  3QOP A;  1K79 A;  2H6C A;  2KJC A;  3F9K A;  3Q0W A;  1XN7 A;  1LDD A;  2VB6 A;  5K7F A;  1FYM A;  4Y15 A;  2Z1D A;  4AIJ A;  2VKE A;  2FOW A;  4Y3O A;  2FQ3 A;  5DS9 A;  2CW0 F;  1RUO A;  5IYD J;  2YVE A;  3K7A J;  4I2O A;  4P9U A;  4F92 B;  3W6J B;  3MFK A;  4QLC U;  4HLX A;  1N77 A;  1M1E B;  2QQA A;  3IRR A;  3CJR B;  3HTI A;  5J1Y A;  2WA0 A;  3ERE D;  3KYL A;  1HXD A;  5ICG A;  2E1C A;  1OCP A;  2AXL A;  3DTK A;  1R7J A;  3A4C A;  5CKT A;  4G6Q A;  2WAF A;  3HTU A;  4MNU A;  3CF2 A;  1V5E A;  1KQ0 A;  3ZOB A;  5DM7 F;  4MTD A;  2XAG A;  2E2J J;  4MEY F;  2C6Y A;  3R0J A;  2WB1 A;  4KFC A;  4AU7 A;  1JKQ C;  2O61 A;  1YLF A;  2R7F A;  3FXM A;  4M3G A;  1XGM A;  1F5T A;  4RM3 A;  4PJN A;  2CMP A;  2K7L A;  2VN2 A;  3H36 A;  2PMH A;  3PIP F;  3S1R J;  4CHU A;  2ZOY A;  1LNW A;  2UXU A;  3BPX A;  5FD5 A;  5HLG A;  2ETH A;  2CS3 A;  3F72 A;  5HLI A;  4XM3 A;  3SEZ A;  4BE2 A;  1YTY A;  1R23 A;  2K3P A;  3EQL F;  5HDG A;  4CCK A;  5EEG A;  1WFX A;  1Z0X A;  2VBY A;  2R92 J;  1BC8 C;  2OC6 A;  2Y69 H;  3LA3 A;  3BR1 A;  4RA2 A;  1DU0 A;  1IXC A;  1ERD A;  4KN4 X;  2OBP A;  2PJR B;  4PUS A;  3MVP A;  1H8A C;  2HZD A;  2EH3 A;  3GUD A;  5H6R A;  3CCY A;  1TT0 A;  3OOU A;  3OSG A;  3M07 A;  2EIN H;  2HKX A;  2QTQ A;  2NVU B;  1JTY A;  3SYT A;  1TNS A;  2OU2 A;  3ON2 A;  2DT7 B;  1YE9 A;  2ESN A;  3ZMU A;  4JK1 X;  3ZPL A;  3R0A A;  2EJR A;  2FBH A;  2A68 F;  2HFH A;  3CME I;  1YJ9 I;  1OYY A;  3VVZ A;  3LSM A;  2X9D A;  1R4N B;  2Z9O A;  4YEL A;  3U21 A;  1X4P A;  4LK1 F;  1SC7 A;  4NN1 A;  2EZK A;  5LD2 C;  2JZY A;  1XSD A;  1OYI A;  3BOQ A;  4S04 A;  4OMY A;  2JK3 A;  3FM5 A;  3VOK A;  1S7E A;  3SQN A;  3GZ6 A;  3UNG C;  3IH4 A;  3D0S A;  5ICE A;  2E7W A;  2XKO A;  4I09 A;  3S2H J;  4XID A;  4HX8 A;  1O7L A;  2ZJR F;  5D5W B;  5ILS A;  5K5O A;  3GYH X;  3M7G A;  1SAN A;  2IEK A;  3PL8 A;  2UUZ A;  1TL8 A;  1JGG A;  1POG A;  2XRN A;  3CP2 A;  2JN6 A;  1FPQ A;  1KON A;  4LGW A;  1Z3X A;  1G6N A;  3G2B A;  4BL0 B;  2LP0 A;  4LG0 B;  4OIP F;  2G7L A;  2QM3 A;  3A01 A;  2XDN A;  2DA5 A;  4CA0 A;  5EZH A;  4O5V A;  5FKN A;  1VND A;  1Z6T A;  3CMM A;  2TRT A;  4XKW A;  1ZGA A;  3K0L A;  4E7L A;  4XLA A;  4IPA A;  4LIU A;  3I0T A;  1R5H A;  2Y0M A;  2K9S A;  4KIC A;  1E17 A;  4JX5 A;  2VPR A;  3NWT A;  3K70 D;  2CV1 A;  4M72 A;  3KYD B;  4D9J A;  3CUO A;  4AM3 A;  3GBG A;  4PJ0 C;  4DVY P;  3F6V A;  1VQ5 I;  2CGP A;  1OCO H;  4RB1 A;  2FF4 A;  1IN7 A;  5H6Q A;  3P5J A;  4N9H A;  4WWC A;  1BOA A;  2W57 A;  4QWQ A;  3HTJ A;  2F4O B;  2NXN B;  3RD3 A;  2OQG A;  4L18 B;  2O7O A;  1O3T A;  1BR1 A;  2HPM A;  4L9T A;  1TP4 A;  3VYU B;  4G7Z F;  3VPR A;  2LKS A;  1Z1D A;  3GCM A;  4CIC A;  3HOT A;  3GTK J;  3JR9 A;  5KAF C;  1YFH A;  3K6G A;  1REP C;  1LB2 A;  3TOB A;  5FKO A;  2YSR A;  3VYT B;  1VQL I;  3CUQ A;  4I02 A;  2HOS A;  1A6Q A;  4OIO F;  1BA5 A;  2LF7 A;  1WJC A;  4ESB A;  1IN4 A;  5HOO A;  2MFZ A;  3E5U A;  4QPO A;  1YW8 A;  4WX9 A; 
#chains in the Genus database with same CATH homology
 2JA5 J;  4S0H B;  2ZOZ A;  3BT9 A;  1WGX A;  4C3J J;  1I6H J;  2E2H J;  3ZQG A;  2MGQ A;  2ZCX A;  3BTC A;  4M3D A;  2DA2 A;  1RR7 A;  2R5Y B;  4A3B J;  3B6C A;  2FX0 A;  3EGQ A;  3VW2 A;  3GTG J;  1BW6 A;  1GDT A;  2E19 A;  2EZL A;  1JUS A;  1UHS A;  1T33 A;  3CDL A;  2O9L A;  2FBQ A;  2PZ9 A;  3AQS A;  4MXM A;  3K2A A;  2CUE A;  4A3C J;  3VOX A;  2JWT A;  5J1R A;  4HKU A;  4XRS G;  1B8I B;  5FLM J;  4UDS A;  3Q3S A;  3E7L A;  1FTT A;  5HAW A;  3MNL A;  2DMP A;  2K40 A;  5HBU A;  3MN2 A;  4PXI A;  2JA8 J;  5EFY A;  1W0T A;  2UXI A;  1P7J A;  1JT0 A;  1RPW A;  3Q0U A;  5H9T A;  2CQQ A;  3VIB A;  4BBS J;  3KKD A;  2ZCN A;  2H1K A;  2ID3 A;  4ME9 A;  4QTR A;  3HGG A;  2OI8 A;  1AU7 A;  1R9T J;  5C3E J;  4IHX A;  4CYC A;  4QIW N;  1FIA A;  1MSF C;  3HE0 A;  5BNG A;  2ECC A;  3ANP A;  4ACI A;  1IG7 A;  2E1O A;  3BRU A;  3G1L A;  1U9N A;  4BBR J;  4UUT A;  2HXO A;  1E3O C;  4AC0 A;  1I3Q J;  2LKX A;  3S15 J;  1JUP A;  1GVD A;  1MBE A;  5DTD A;  2VKV A;  2NVT J;  5FLV A;  2NP5 A;  4GFB A;  3I4M J;  1Y1V J;  4XRM A;  2G7G A;  1IJW C;  2M9H A;  5FKM A;  1NK3 P;  2O8K A;  3CQZ J;  3WHB A;  5GPC A;  1MBG A;  2CU7 A;  3I4N J;  2QF7 A;  4GCT A;  4FE4 A;  3FKI J;  3QQA A;  5CXI A;  3TW7 A;  1TWH J;  2LLK A;  3B6A A;  3O8H A;  3CWR A;  3NPI A;  5K7Z A;  1F36 A;  2DN0 A;  3BHQ A;  3HOU J;  1IUF A;  3RQI A;  4XIC A;  2WB1 N;  4V2G A;  3JRC A;  1LFU P;  4NDL A;  5F0H A;  5FKK A;  3QKX A;  1NK2 P;  5K7H A;  3V78 A;  3S2D J;  1MH4 A;  1YRN A;  4MK6 A;  5IP6 A;  4AF5 A;  3O8G A;  3LSG A;  1EF4 A;  4QSH A;  4X6A J;  4FTH A;  2OER A;  4XK4 A;  1IGN A;  3NRG A;  2L0K A;  2NX4 A;  2M0C A;  3HOY J;  2QOP A;  3LJL A;  5GPA A;  3P9T A;  1QPI A;  3S14 J;  3FIW A;  1TWF J;  2ECB A;  2FD5 A;  4A3G J;  2QKO A;  1GV5 A;  3FK6 A;  3ZQC A;  3VW0 A;  3IV5 A;  3JRI A;  3LNQ A;  2I10 A;  3S1Q J;  3Q0V A;  5FGL A;  3VP5 A;  2N8G A;  3GZI A;  4I6Z A;  4V2F A;  2MW8 A;  3F1B A;  2E2I J;  4BY7 J;  3HDD A;  3HEF A;  5M5X J;  2NP3 A;  2X6O A;  3LOC A;  1MBJ A;  4GCL A;  1BJZ A;  5FJ8 J;  3S16 J;  2DG8 A;  1QVU A;  4MFD A;  5J1U A;  1D5Y A;  2UXH A;  1WCM J;  4B1R A;  2GBY A;  4EEF G;  4C3I J;  1OCT C;  3RH2 A;  3KZ9 A;  2ME6 A;  3ZQL A;  2IBD A;  3VVX A;  3IH2 A;  2D6Y A;  2NS7 A;  5D19 A;  3BG5 A;  2HXI A;  3NI7 A;  1RES A;  3HM5 A;  3GTQ J;  2DMT A;  1RET A;  3COL A;  4KWA A;  1ENH A;  4X1E A;  5F27 A;  4FCY A;  3S17 J;  5EG0 A;  3JRD A;  2XB0 X;  4UUS B;  3JRG A;  5K58 A;  3OSF A;  4A3M J;  2FJ1 A;  1UI5 A;  1X2N A;  1ZK8 A;  2CQX A;  3JRF A;  2R5Z B;  1ETK A;  1LE8 B;  1TWA J;  4JX6 A;  2M8G X;  3PO3 J;  3FIS A;  5E3O A;  1ZGW A;  1Z77 A;  4G12 A;  3WHC A;  2QIB A;  5M5W J;  4ABZ A;  3G56 A;  4BKX A;  3LSR A;  4AUX A;  3HOZ J;  3B81 A;  1SFO J;  2L7F P;  3S5R A;  4DZJ A;  3PM1 A;  3KNW A;  4DW6 A;  1K83 J;  2YU9 J;  3M3Y J;  1CQT A;  1TWG J;  3PAS A;  2LD5 A;  2R5Y A;  1ITY A;  5C44 J;  2RHA A;  5FHP A;  3UKG A;  1U8B A;  1HF0 A;  2MG4 A;  1QVT A;  3VVY A;  3CRJ A;  1G2H A;  3PPB A;  3NAU A;  4IHY A;  4M3F A;  4YZE A;  5D1R A;  3JRB A;  3RZD J;  1B8I A;  1WPK A;  3QPS A;  4MLO A;  2Y0S N;  2NVY J;  2DTZ A;  1B72 B;  4A93 J;  4JKZ A;  1HLV A;  4A3I J;  1WI3 A;  1RKT A;  4CGR A;  2Y31 A;  2REK A;  3NAR A;  3SFI A;  3ANG A;  2ME0 A;  2GM4 A;  1GV2 A;  2YUS A;  2XSD C;  3BQY A;  1ETQ A;  3BR3 A;  1ETX A;  4RBO A;  5M5Y J;  3L1P A;  2CRG A;  1SGM A;  3T6N A;  4J19 A;  1X2M A;  1JKP C;  5C4Y A;  4D7N A;  1ORK A;  2HOT A;  1OJL A;  5IP7 J;  2G3B A;  5E3M A;  1HCR A;  2NOG A;  3HOX J;  3MKL A;  5E3L A;  2HI3 A;  1LFB A;  1IRZ A;  5EGO B;  2UXO A;  4D5F A;  3JRE A;  3BR5 A;  1DU6 A;  1PUF B;  1HDD C;  2DA7 A;  2L7Z A;  2WGB A;  1HDP A;  1Y1W J;  2PBX A;  1MBF A;  3BQZ A;  2V57 A;  1FTZ A;  3S1M J;  3NNR A;  1ZKG A;  2XPW A;  3QPL A;  1P7I A;  4M3E A;  2O7T A;  3FRQ A;  1MNM C;  5HSZ A;  2PMZ N;  2EBI A;  5CXG A;  2YVH A;  2WV1 A;  2DA4 A;  4C3H J;  1XS9 A;  3GTJ J;  2NS8 A;  3BTJ A;  1JKO C;  1BW5 A;  2QWT A;  2H8R A;  1APL C;  4D5C A;  2ZB9 A;  3A01 B;  1XC5 A;  2HQ5 A;  2VI6 A;  5F0F A;  2OPT A;  2ZCM A;  4JX4 A;  2AO9 A;  2DJN A;  1JTX A;  3C07 A;  3HKZ N;  2MSY A;  4DZP A;  1T56 A;  3TW6 A;  2EZI A;  4A3L J;  2G0E A;  4LOC A;  2JA6 J;  1HOM A;  3BR2 A;  3BR0 A;  1FIP A;  2D5V A;  1H89 C;  2RAS A;  4L5E A;  3BNI A;  4A69 C;  3HOW J;  2W48 A;  4FE7 A;  3M4O J;  1Q1V A;  5M3F J;  1H88 C;  4JL3 A;  5CW8 A;  3QBM A;  2ELK A;  2LR8 A;  2IAI A;  3KKC A;  1K61 A;  4AC6 A;  3G1O A;  3Q0W A;  3SDG A;  3HGY A;  2Y2Z A;  1VFC A;  3V6G A;  5J3L A;  5K7F A;  5EYR A;  4DYQ A;  5EEA A;  2VKE A;  2HYJ A;  2B63 J;  5DS9 A;  3BTI A;  5EDN A;  5IYD J;  4HNV A;  5C4J J;  3BG9 A;  2AHQ A;  2YVE A;  3HIM A;  3K7A J;  1TC3 C;  3TP0 A;  2DMN A;  1AKH B;  1ZQ3 P;  2GLO A;  3TED A;  4GFL A;  5IYC J;  2XPU A;  4I76 A;  3HTI A;  5J1Y A;  2JJ7 A;  5DAJ A;  3HTA A;  3BR6 A;  1RKW A;  4M3B A;  2JMW A;  1OCP A;  3HBL A;  3DEW A;  2HDD A;  4MO7 A;  2K9Q A;  2IU5 A;  3NXC A;  2LVS A;  3LSP A;  2CJJ A;  5IOY A;  2XRL A;  4XRS A;  9ANT A;  4UUS A;  4A3K J;  3ZOB A;  2E2J J;  1FJL A;  5IYB J;  3TP3 A;  4M6V A;  2Q24 A;  3GTO J;  2R5Z A;  2XB5 A;  1LE8 A;  1IC8 A;  1JKQ C;  1IDZ A;  1F43 A;  4DYR A;  4M3G A;  2EZH A;  5EZG A;  2Y9Y A;  5GP9 A;  1IV6 A;  1U9O A;  3VW1 A;  2DA6 A;  4MIM A;  5M3M J;  3ZQI A;  3S1R J;  2ZOY A;  2UXU A;  5C4X J;  3GEU A;  4L62 A;  2LFB A;  2Y9Z A;  2DA3 A;  1I50 J;  5IP9 J;  3S1N J;  2NVQ J;  1Z0X A;  4IHV A;  2R92 J;  3CJD A;  3H0G J;  4JP0 A;  3C2B A;  3BR1 A;  3FK7 A;  4A3E J;  1DU0 A;  4B3A A;  2KT0 A;  2XGC A;  2LY9 A;  1W0U A;  5AQC A;  2CUF A;  2LTP A;  2R93 J;  1U78 A;  3MVP A;  1H8A C;  1ETW A;  1B72 A;  2EH3 A;  3F0C A;  3G7R A;  2UXP A;  3PO2 J;  2DA1 A;  3CCY A;  4D7M A;  3OSG A;  3OOU A;  2R7Z J;  4Y52 J;  1A6I A;  2JA7 J;  2NVX J;  3DPJ A;  1TWC J;  2QTQ A;  1JTY A;  2ID6 A;  4CYC B;  3ON4 A;  3ON2 A;  5JLX A;  3IUV A;  2X48 A;  4B4C A;  1UG2 A;  2P81 A;  1ETO A;  1MBK A;  4JNN A;  2M34 A;  2K9N A;  3OIO A;  3VVZ A;  1OFC X;  5EF6 A;  1JKR C;  2X9D A;  3LSJ A;  2WAQ N;  1GUU A;  2YS9 A;  1MSE C;  1WH7 A;  4NN1 A;  2EZK A;  4BXX J;  2M2E A;  3ZQF A;  5EGO A;  3JRH A;  2JK3 A;  4C2M J;  4A3D J;  1WH5 A;  1S7E A;  1X58 A;  1ETV A;  4DYC A;  3VOK A;  2GEN A;  4GCK A;  5HOD A;  3IH4 A;  3W6V A;  1JUM A;  4IHW A;  1A5J A;  1PUF A;  1ZTR A;  5F08 A;  2DMQ A;  4NEL A;  2WUI A;  3HB9 A;  3EUP A;  2GFN A;  2EQR A;  3O60 A;  3S2H J;  4XID A;  3RZO J;  2LK2 A;  2XPV A;  5D18 A;  1FEX A;  3SJM A;  3JRA A;  3LHQ A;  2TCT A;  4RDU A;  1SAN A;  3JSJ A;  1ETY A;  2IEK A;  1JGG A;  1MBH A;  1POG A;  2L9R A;  3ZQH A;  2HYT A;  2L7M P;  1YRN B;  2JN6 A;  2RAE A;  1JT6 A;  3GTL J;  2LP0 A;  2G7L A;  2VUM J;  1XG1 A;  2QCO A;  5F1J A;  1ZR4 A;  1VF9 A;  5JLW A;  3A01 A;  2XDN A;  2DA5 A;  3RKQ A;  1NTC A;  5EZH A;  1ZR2 A;  1UMQ A;  2R0Q C;  5E3N A;  3H3V K;  5FKN A;  1VND A;  2TRT A;  3CMY A;  2Y30 A;  3DCF A;  3A03 A;  5FMP A;  2XGE A;  3BJB A;  1O4X A;  4GFK A;  1AHD P;  2K9S A;  1BL0 A;  4W1U A;  2W53 A;  4JX5 A;  2VPR A;  2OF7 A;  4IEJ A;  3VUQ A;  3LWJ A;  4Y7N J;  3G1M A;  5IPA A;  1JJ6 C;  3GBG A;  2GUH A;  3IH3 A;  4A3F J;  3BG3 A;  3HTJ A;  1UI6 A;  2G7S A;  3RD3 A;  2FQ4 A;  3HOV J;  2O7O A;  3A02 A;  3D1N I;  1GT0 C;  2DG7 A;  4A3J J;  3VPR A;  4AYB N;  2KDZ A;  3GTP J;  5IOZ A;  1IDY A;  3GTK J;  3JR9 A;  1AKH A;  3BTL A;  2XGD A;  3BCG A;  4JYK A;  2HOA A;  4W97 A;  2F07 A;  1MH3 A;  2DMU A;  4BY1 J;  5FKO A;  5EG0 B;  4FIS A;  2HOS A;  5FKL A;  2HKU A;  1BA5 A;  4MFE A;  3AQT A;  2COB A;  1QRY A;  3HTH A;  5F04 A;  3E7Q A;  1VI0 A;  3GTM J;  1JJ8 C;  5F0C A;  4ICH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...