3ZRBA

Structural basis for agonism and antagonism for a set of chemically related progesterone receptor modulators
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
250
structure length
250
Chain Sequence
LIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for agonism and antagonism for a set of chemically related progesterone receptor modulators.
pubmed doi rcsb
molecule keywords PROGESTERONE RECEPTOR
molecule tags Receptor
source organism Homo sapiens
total genus 104
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 3zrbA00
4J5WA 5DIGA 1X7EA 3HVLA 2VV4A 3IPQA 4J26A 2QZOB 4OIVA 2Q1VA 1EXXA 2E2RA 3CDSA 3E00A 5DWIA 1K7LA 5FQRA 2I0JA 2ZK4A 3VHVA 2VV1B 5H1EA 5DWEA 4J5WC 3HO0A 4OEAA 4IA3A 2GIUA 4DK8A 3ADWA 2A3IA 3PBAA 3OSWA 5FQPA 3K8SA 4L98A 5DMFA 5DXGA 3SP6A 5KRFA 4ZNTA 5HZCA 3DZUD 4N73A 4MG9B 3SP9A 1T65A 2POBA 4UDCA 2B1VA 5EITA 5G44A 4WHGA 2QZOA 3VJIA 1VJBA 1S0XA 3DCTA 3OSAA 3L3ZA 4DM8A 4JL4A 4ZJWA 2QGWA 2AA6A 3HC5A 1G50A 4LBDA 3V9TA 1Q4XA 1XDKB 2ZNOA 3AUNA 2R40D 2VV2A 4K7AA 5GIEA 4PVUA 2P7GA 4JAZA 2B50A 1G2NA 3G8OA 3H0AD 3WT7A 3L1BA 2OVMA 1HJ1A 1R5KA 3ADXA 2IHQA 3D24A 3T03A 4MGDB 1ZUCA 4XUMA 2NW4A 1BSXA 4KZIA 4XTAA 3TKMA 2ZNNA 5HJSA 1XLSE 3OZJA 2AX7A 4UDBA 3W0CA 3WMHA 4ZI1A 4X1GA 4ZO1B 2GTKA 3OKIA 1YMTA 4TUZB 3KMGA 4PWLA 4IW8A 5EC9A 3G9EA 2AWHA 3AN4A 1N83A 4ITEA 2QGTA 3WFFA 5G45A 2Q7IA 3FUGA 2AMBA 5KYAA 2JFAB 5L7GA 3W0IA 3W5QA 2AA5A 2Z4BA 4ZJRA 5DIEA 1YYEA 2REWA 1XIUA 4CI5A 2GPOA 2J7YA 4OJ4A 1FM9A 2QSEA 3B0QA 3DY6A 2W8YA 3L0JA 4OH6A 5ICKA 1K4WA 2NPAA 3R8AA 4DQMA 4E2JA 2QA6A 4POJA 3U9QA 2V0VA 4J5XA 1FCXA 1T7FA 3GD2A 3A9EB 4MGBA 2FSZA 2ZVTA 1R6GA 1WM0X 3AURA 4XI3A 2ZLCA 1FM6D 2Q7LA 3ADTA 1UOMA 3A2HA 3OMPA 4RAKA 1Y0SA 3GYUA 5EI1A 3KFCA 4RFWA 3UVVB 5C4OA 3X1HA 5LWPA 1PDUA 1FCZA 1X7JA 3H52A 3L03A 3ET2A 2ZL9A 1TXIA 3X36A 3EYBA 5G3JA 2HASA 1A52A 1A28A 1DKFA 5KRLA 3BEJA 4HLWA 4TV1A 1I7IA 3DZUA 2AX9A 2VSRA 3UUCA 2G0GA 3CLDA 5KRKA 2IOGA 4XT9A 1G5YA 3KDUA 4G20A 2VSTA 4IVWA 2ABIA 2NV7A 1OT7A 4IV2A 4QL8A 3WJ4A 3UP3A 1XOWA 5DV6A 3UVVA 2ZKCA 2QABA 4KZMA 4APUA 5KCTA 4NB6A 2R6YA 3VSPA 2QXSA 2XKWA 3D90A 4NQAB 1SQNA 5APJA 4OK1A 4OKBA 5ETHA 5G5WA 4CI4A 2ZY0A 2ACLB 3FC6A 5A86A 3VRUA 3P89A 1NQ0A 2VV3A 2QMVA 5C4SA 5KCUA 2HBHA 5K13A 2J7XA 5DWLA 3H0AA 4PF3A 5AAUA 4NIEA 1YJEA 5B41A 3OLFA 4G2HA 2ZFXA 5DUGA 4ZN9A 4WPFA 1GWXA 5E7VA 3TY0A 5DYBA 2OCFA 4R6SA 2P4YA 5EHJA 5HYKA 4OH5A 3MNEA 2PJLA 2QW4A 2B1ZA 2ACLA 4G2IA 5DK9A 3WFGA 3CS6A 3ET0A 3HQ5A 4IA1A 3ZRBA 3TKCA 3W5PA 2Q59B 1KV6A 1QKNA 2IOKA 2PIPL 2QA8B 2Q5GA 2ZK3A 3PLZA 5KRJA 1I7GA 4ZNHA 2P1TA 3QT0A 4XAOA 5DKBA 5DXBA 2HCDA 3VT6A 5IZ0A 5GIDA 2HB8A 2VV0A 2XYWA 4G1ZA 2QPYA 4RUJA 3CS4A 4IS8A 4IWCA 1ZDTA 4ZNVA 4X1FA 5DVCA 5DXMA 5AWJA 5KR9A 1ZDUA 3GYTA 3MNPA 1ILGA 5AAVA 1SKXA 2Q6RA 4Q50A 3UUDA 1R1KD 3DZYD 4IU7A 5DP0A 3OLLA 2O9IA 3JZBA 2YLQA 5L7HA 1K74D 1OVLA 2OVHA 3PO9A 3B3KA 4OGHA 1ZKYA 3FS1A 1I37A 4OFUA 1P93A 1UPWA 3OAPA 5AVLA 2Q59A 1XVPA 3E94A 4A4WA 5I4VA 1GS4A 2YHDA 3ET1A 4IW6A 1XP9A 3P88A 4MG8B 3ADSA 3WT5A 1U3SA 4QE6A 2OUZA 3RUUA 1T74A 2ZMHA 2PIVA 1E3KA 3OMMA 4PLEA 3VHUA 5DXPA 5KD9A 5DMCA 3CQVA 3ZQTA 2Q5SA 5DYDA 3KDTA 5AZVA 5KRHA 5DV3A 4OC7A 2VV1A 1XLSA 1R20A 5FQVA 4RMCA 3ET3A 3ILZA 4PP6A 5AK2A 2AMAA 5FQTA 4OKWA 5E15A 4CSJA 2AAXA 5LGAA 3OS9A 1PRGA 3WGPA 2G44A 1PQCA 1T79A 5DX3B 3R2AA 3V3EA 4WLBA 4MG9A 2I0GA 3FURA 1NQ1A 4REEA 3R5MA 2AXAA 2GWXA 3VT3A 4E4KA 4REFA 5DRJA 5DKGA 1XQ3A 2ATHA 5JY3A 4RZFA 1YUCA 4P6WA 1ERRA 3KMZA 1YOWA 2AX8A 1RJKA 3VHWA 1NQ7A 5G46A 3F5CB 1MV9A 3KWYA 5EGVA 1XDKA 2J14A 1ZGYA 1T7RA 4IA2A 4WVDA 3UUAB 5HJPB 4M8HA 1U3QA 3OGTA 4OKXA 3R8DA 1RDTA 2O4RA 5E0XA 4MG5A 3ADUA 3AUQA 2Q70A 3K22A 1LBDA 4ZNUA 3VJTA 5E0WA 3LMPA 4FHHA 2ZXNA 4QM0A 1M7WA 1T7MA 4MGDA 1FCYA 3B65A 2AA2A 3SZ1A 1ZAFA 1N46A 1S0ZA 4JGVA 4OZTU 3W0AA 2ZK1A 2QNVA 3OS8A 5KCEA 5DZ1A 4RZGA 4PLDA 1XV9B 4OIUA 2AX6A 1FD0A 2Q7KA 5IXKA 3V49A 4TUZA 4IUIA 3RVFA 5AZTA 4IV4A 3VT7A 1EREA 1M13A 2ZLAA 2ZNQA 3DZYA 4A2JA 2H79A 2JFAA 2PITA 3MNOA 3G0WA 4J5XC 1GWRA 1RKHA 1RK3A 3B68A 3IPSA 2GP7A 3RUTA 2YLOA 4FHIA 3E00D 2NXXA 3WJ5A 4YMQA 3NSQA 5DLRA 3P0UA 2YFEA 4WQPA 5JJMB 2ZXMA 3A9EA 4OEDA 4RZEA 3B66A 4PP5A 3DCUA 2AO6A 1PK5A 4OFRA 4MGAB 5APKA 5E14A 1ILHA 4ZO1X 2I4ZA 4FNEA 3BC5A 5DXKA 3HODA 1EXAA 2YATA 3VT4A 2PRGA 2ZK0A 2P15A 1GWQA 2I4JA 3HM1A 3M7RA 4MG7B 2BAWA 4MDDA 2QXMA 4PPSA 2OM9A 3VTBA 1UHLB 2R40A 3F7DA 3R5NA 4IVYA 2Q1HA 5DZHA 4PP3A 4DORA 3O1DA 3VRVA 4RUOX 5E19A 3V4AA 3PRGA 4RWVA 5AYGA 3NSPA 4P6XA 2NXXE 3VJHA 5KYJA 3OOFA 2YLPA 4UDDA 3RLLA 3LBDA 1PZLA 5KRCA 3AZ2A 4IA7A 3GWSX 4PXMA 3RLJA 4QK4A 1YP0A 4Q0AC 4YT1A 1YY4A 2R6WA 4JYHA 4OEYA 3R8IA 2OAXA 1XP6A 2Q61A 2Z4JA 2XYJA 3Q95B 4DK7A 4G1YA 2PINA 4PPPA 4XUHA 1MZNA 1XB7A 2XYXA 3VRWA 5KCFA 3NOAA 3KMRA 3VN2A 1N4HA 1XAPA 4N1YA 3DR1A 1NQ2A 4OJ9A 1SJ0A 2ZNPA 3WT6A 1X7RA 5M96A 4EMAA 2VV4B 2OZ7A 1PCGA 2GPVA 2B23A 1XNXA 3G8IA 2G5OA 5DUHA 3UU7B 5KCCA 1YIMA 2GL8A 2Q3YA 3ERTA 3TX7B 3Q95A 5ACCA 5DY8A 2PIXA 5L7EA 5C4TA 2P7ZA 1XPCA 5AWKA 1FM6A 2QA8A 3OLSA 2LBDA 5G43A 1FM9D 5KRIA 2ZXZA 4XHDA 2J4AA 4L96A 5F9BA 3AN3A 1LV2A 1YOKA 3IPUA 3N00A 3HLVA 1L2IA 4ONIA 5E1CA 3VT8A 3OSIA 1Z5XU 3D57A 1HG4A 2BJ4B 5DV8A 3L3XA 2HARA 4E4QA 1FBYA 3A2IA 3UU7A 1T5ZA 3WTQA 2Q7JA 2AA7A 4S0SA 2HWQA 3A78A 5DXRA 2PIOA 4RMEA 1KKQA 5JI0D 4ITFA 1Z5XE 4LNXA 2QE4A 3VI8A 1NAVA 2PNUA 2PIRA 4S14A 5DVVA 3AZ3A 2Q6JA 4MG8A 1YINA 1Z95A 3GWXA 4G21A 1QKMA 1X76A 5DIDA 2P1VA 3OMQA 1OSVA 4OZRU 4UDAA 3ZR7A 4MG6A 1T7TA 3R29A 4M8EA 4ZNWA 2GPUA 5DWJA 5KCWA 2BJ4A 1NHZA 2V7CA 1S9PA 4K4JA 2ZASA 1NYXA 3CJWA 3IXPD 4A4VA 1UPVA 3B0TA 1SR7A 4MGCA 3OKHA 4N8RA 2PIWA 4B7WA 4OZRE 2AYRA 5B5BA 3GZ9A 1NDEA 3VT9A 3VTDA 5DI7A 2HWRA 4Q13A 3FEJA 3GN8A 5FQSA 3D6DA 4JYGA 1IE9A 4OHAA 5DX3A 5APHA 5GT4A 3CDPA 3S9SA 4IQRA 4Y29A 3X31A 1MVCA 3PEQA 3L0EA 5DRMA 4JYIA 1YA3A 3W0YA 3W0GA 4J24A 5DKSA 1T73A 5DZIA 1Y9RA 4K6IA 3K23A 4OEZA 3V9YA 2P1UA 3OZ0A 4N5GA 4ZOMA 3FALB 5DXEA 4KZJA 1S19A 2Q5PA 2QR9A 3F5CA 3UUDB 3OOKA 2YJAB 2HB7A 4PRGA 1XJ7A 1Y0XX 3UUAA 5HJPA 5IAWA 2ZK2A 4DMAA 5KCDA 1TFCA 3UP0A 4MGBB 2YJDA 3D5FA 1X78A 3ADVA 4OZTE 3V9VA 1R1KA 4RE8A 3WWRA 3VT5A 3AZ1A 2AM9A 3W5TA 1PQ6A 2HVCA 3OS8C 5C4UA 1K74A 2EWPA 3A40X 1XZXX 1QKTA 5CJ6A 5AVIA 4BCRA 2QTUA 3AX8A 3FALA 1DKFB 2O4JA 3BQDA 4QJRA 4OILA 3KBAA 4TV1B 3FEIA 5DUEA 2I4PA 3W0HA 2Q8SA 3ERDA 3V3QA 1XV9A 2Q6SA 1QKUA 2FVJA 2PIUA 3A2JA 3B1MA 2ZBSA 5DU5A 1RKGA 4NUFA 3AFRA 3W5RA 3VRTA 1IE8A 1XP1A 4LSJA 1T76A 4OJBA 3FLIA 1XNNA 5DVSA 5DZ3A 4FGYA 3FXVA 1U3RA 2H77A 3CS8A 4DM6A 5SYZA 3JZCA 3K6PA 3X1IA 1H9UA 1M2ZA 3O1EA 3FC6B 2G0HA 4RMDA 3P8XA 1P8DA 2FAIA 2P54A 1T63A 2GPPA 1R20D 1X7BA 5JJMA 4S0TA 4OKTA 4WHFA 4XLDA 2POGA 2ZMIA 3KPZA 3E7CA 5G42A 3VSOA 5DSHA 1PQ9A 4MGAA 3IXPA 3OMKA 4QE8A 3GBKA 4R2UA 5DL4A 3VTCA 2P7AA 2XHSA 2JF9A 4POHA 2PKLA 4OARA 4IWFA 3VJSA 3B0WA 1NUOA 3L0LA 3B0RA 4MG7A 3W0JA 4HEEX 5DTVA 4F9MA 1E3GA 1UHLA 1OSHA 1NRLA 2ZMJA 3CTBA 3HZFA 5DWGA 5KRMA 3IA6A 5L11A 1L2JA 1NAXA 2HAMA 1KNUA 2HFPA 3A3ZX 3HC6A 1S9QA 3PCUA 4S15A 4EM9A 5KRAA 3KYTA 4ZNSA 3ZRAA 5DXBB 4YPQA 2QH6A 4NY9A 4OLMA 4ZN7A 3CWDA 4LTWA 3B5RA 5EJVA 2HC4A 2JJ3A 2ZK5A 2Q60A 1XQCA 5DZ0A 1DB1A 1RDTD 1ZEOA 2PIQA 3B67A 5DKEA 5DXQA 4G1DA 5GICA 2ZK6A 4FN9A 5HCVA 4RUPA 3RY9A 4DOSA 5AAVB 1G1UA 2YLYA 2AB2A 1I38A 3DT3A 3OMOA 4LNWA 4YNKA 3IMYA 1OVLB 5HYRA 2F4BA 4O8FA 4R06A 1U9EA 1ZH7A 1XVPB 5KROA
chains in the Genus database with same CATH superfamily
4J5WA 5DIGA 1X7EA 3HVLA 2VV4A 3IPQA 4J26A 2QZOB 4OIVA 2Q1VA 1EXXA 2E2RA 3CDSA 3E00A 5DWIA 1K7LA 5FQRA 2I0JA 2ZK4A 3VHVA 2VV1B 5H1EA 5DWEA 4J5WC 3HO0A 4OEAA 4IA3A 2GIUA 4DK8A 3ADWA 2A3IA 3PBAA 3OSWA 5FQPA 3K8SA 4L98A 5DMFA 5DXGA 3SP6A 5KRFA 4ZNTA 5HZCA 3DZUD 4N73A 4MG9B 3SP9A 1T65A 2POBA 4UDCA 2B1VA 5EITA 5G44A 4WHGA 2QZOA 3VJIA 1VJBA 1S0XA 3DCTA 3OSAA 3L3ZA 4DM8A 4JL4A 4ZJWA 2QGWA 2AA6A 3HC5A 1G50A 4LBDA 3V9TA 1Q4XA 1XDKB 2ZNOA 3AUNA 2R40D 2VV2A 4K7AA 5GIEA 4PVUA 2P7GA 4JAZA 2B50A 1G2NA 3G8OA 3H0AD 3WT7A 3L1BA 2OVMA 1HJ1A 1R5KA 3ADXA 2IHQA 3D24A 3T03A 4MGDB 1ZUCA 4XUMA 2NW4A 1BSXA 4KZIA 4XTAA 3TKMA 2ZNNA 5HJSA 1XLSE 3OZJA 2AX7A 4UDBA 3W0CA 3WMHA 4ZI1A 4X1GA 4ZO1B 2GTKA 3OKIA 1YMTA 4TUZB 3KMGA 4PWLA 4IW8A 5EC9A 3G9EA 2AWHA 3AN4A 1N83A 4ITEA 2QGTA 3WFFA 5G45A 2Q7IA 3FUGA 2AMBA 5KYAA 2JFAB 5L7GA 3W0IA 3W5QA 2AA5A 2Z4BA 4ZJRA 5DIEA 1YYEA 2REWA 1XIUA 4CI5A 2GPOA 2J7YA 4OJ4A 1FM9A 2QSEA 3B0QA 3DY6A 2W8YA 3L0JA 4OH6A 5ICKA 1K4WA 2NPAA 3R8AA 4DQMA 4E2JA 2QA6A 4POJA 3U9QA 2V0VA 4J5XA 1FCXA 1T7FA 3GD2A 3A9EB 4MGBA 2FSZA 2ZVTA 1R6GA 1WM0X 3AURA 4XI3A 2ZLCA 1FM6D 2Q7LA 3ADTA 1UOMA 3A2HA 3OMPA 4RAKA 1Y0SA 3GYUA 5EI1A 3KFCA 4RFWA 3UVVB 5C4OA 3X1HA 5LWPA 1PDUA 1FCZA 1X7JA 3H52A 3L03A 3ET2A 2ZL9A 1TXIA 3X36A 3EYBA 5G3JA 2HASA 1A52A 1A28A 1DKFA 5KRLA 3BEJA 4HLWA 4TV1A 1I7IA 3DZUA 2AX9A 2VSRA 3UUCA 2G0GA 3CLDA 5KRKA 2IOGA 4XT9A 1G5YA 3KDUA 4G20A 2VSTA 4IVWA 2ABIA 2NV7A 1OT7A 4IV2A 4QL8A 3WJ4A 3UP3A 1XOWA 5DV6A 3UVVA 2ZKCA 2QABA 4KZMA 4APUA 5KCTA 4NB6A 2R6YA 3VSPA 2QXSA 2XKWA 3D90A 4NQAB 1SQNA 5APJA 4OK1A 4OKBA 5ETHA 5G5WA 4CI4A 2ZY0A 2ACLB 3FC6A 5A86A 3VRUA 3P89A 1NQ0A 2VV3A 2QMVA 5C4SA 5KCUA 2HBHA 5K13A 2J7XA 5DWLA 3H0AA 4PF3A 5AAUA 4NIEA 1YJEA 5B41A 3OLFA 4G2HA 2ZFXA 5DUGA 4ZN9A 4WPFA 1GWXA 5E7VA 3TY0A 5DYBA 2OCFA 4R6SA 2P4YA 5EHJA 5HYKA 4OH5A 3MNEA 2PJLA 2QW4A 2B1ZA 2ACLA 4G2IA 5DK9A 3WFGA 3CS6A 3ET0A 3HQ5A 4IA1A 3ZRBA 3TKCA 3W5PA 2Q59B 1KV6A 1QKNA 2IOKA 2PIPL 2QA8B 2Q5GA 2ZK3A 3PLZA 5KRJA 1I7GA 4ZNHA 2P1TA 3QT0A 4XAOA 5DKBA 5DXBA 2HCDA 3VT6A 5IZ0A 5GIDA 2HB8A 2VV0A 2XYWA 4G1ZA 2QPYA 4RUJA 3CS4A 4IS8A 4IWCA 1ZDTA 4ZNVA 4X1FA 5DVCA 5DXMA 5AWJA 5KR9A 1ZDUA 3GYTA 3MNPA 1ILGA 5AAVA 1SKXA 2Q6RA 4Q50A 3UUDA 1R1KD 3DZYD 4IU7A 5DP0A 3OLLA 2O9IA 3JZBA 2YLQA 5L7HA 1K74D 1OVLA 2OVHA 3PO9A 3B3KA 4OGHA 1ZKYA 3FS1A 1I37A 4OFUA 1P93A 1UPWA 3OAPA 5AVLA 2Q59A 1XVPA 3E94A 4A4WA 5I4VA 1GS4A 2YHDA 3ET1A 4IW6A 1XP9A 3P88A 4MG8B 3ADSA 3WT5A 1U3SA 4QE6A 2OUZA 3RUUA 1T74A 2ZMHA 2PIVA 1E3KA 3OMMA 4PLEA 3VHUA 5DXPA 5KD9A 5DMCA 3CQVA 3ZQTA 2Q5SA 5DYDA 3KDTA 5AZVA 5KRHA 5DV3A 4OC7A 2VV1A 1XLSA 1R20A 5FQVA 4RMCA 3ET3A 3ILZA 4PP6A 5AK2A 2AMAA 5FQTA 4OKWA 5E15A 4CSJA 2AAXA 5LGAA 3OS9A 1PRGA 3WGPA 2G44A 1PQCA 1T79A 5DX3B 3R2AA 3V3EA 4WLBA 4MG9A 2I0GA 3FURA 1NQ1A 4REEA 3R5MA 2AXAA 2GWXA 3VT3A 4E4KA 4REFA 5DRJA 5DKGA 1XQ3A 2ATHA 5JY3A 4RZFA 1YUCA 4P6WA 1ERRA 3KMZA 1YOWA 2AX8A 1RJKA 3VHWA 1NQ7A 5G46A 3F5CB 1MV9A 3KWYA 5EGVA 1XDKA 2J14A 1ZGYA 1T7RA 4IA2A 4WVDA 3UUAB 5HJPB 4M8HA 1U3QA 3OGTA 4OKXA 3R8DA 1RDTA 2O4RA 5E0XA 4MG5A 3ADUA 3AUQA 2Q70A 3K22A 1LBDA 4ZNUA 3VJTA 5E0WA 3LMPA 4FHHA 2ZXNA 4QM0A 1M7WA 1T7MA 4MGDA 1FCYA 3B65A 2AA2A 3SZ1A 1ZAFA 1N46A 1S0ZA 4JGVA 4OZTU 3W0AA 2ZK1A 2QNVA 3OS8A 5KCEA 5DZ1A 4RZGA 4PLDA 1XV9B 4OIUA 2AX6A 1FD0A 2Q7KA 5IXKA 3V49A 4TUZA 4IUIA 3RVFA 5AZTA 4IV4A 3VT7A 1EREA 1M13A 2ZLAA 2ZNQA 3DZYA 4A2JA 2H79A 2JFAA 2PITA 3MNOA 3G0WA 4J5XC 1GWRA 1RKHA 1RK3A 3B68A 3IPSA 2GP7A 3RUTA 2YLOA 4FHIA 3E00D 2NXXA 3WJ5A 4YMQA 3NSQA 5DLRA 3P0UA 2YFEA 4WQPA 5JJMB 2ZXMA 3A9EA 4OEDA 4RZEA 3B66A 4PP5A 3DCUA 2AO6A 1PK5A 4OFRA 4MGAB 5APKA 5E14A 1ILHA 4ZO1X 2I4ZA 4FNEA 3BC5A 5DXKA 3HODA 1EXAA 2YATA 3VT4A 2PRGA 2ZK0A 2P15A 1GWQA 2I4JA 3HM1A 3M7RA 4MG7B 2BAWA 4MDDA 2QXMA 4PPSA 2OM9A 3VTBA 1UHLB 2R40A 3F7DA 3R5NA 4IVYA 2Q1HA 5DZHA 4PP3A 4DORA 3O1DA 3VRVA 4RUOX 5E19A 3V4AA 3PRGA 4RWVA 5AYGA 3NSPA 4P6XA 2NXXE 3VJHA 5KYJA 3OOFA 2YLPA 4UDDA 3RLLA 3LBDA 1PZLA 5KRCA 3AZ2A 4IA7A 3GWSX 4PXMA 3RLJA 4QK4A 1YP0A 4Q0AC 4YT1A 1YY4A 2R6WA 4JYHA 4OEYA 3R8IA 2OAXA 1XP6A 2Q61A 2Z4JA 2XYJA 3Q95B 4DK7A 4G1YA 2PINA 4PPPA 4XUHA 1MZNA 1XB7A 2XYXA 3VRWA 5KCFA 3NOAA 3KMRA 3VN2A 1N4HA 1XAPA 4N1YA 3DR1A 1NQ2A 4OJ9A 1SJ0A 2ZNPA 3WT6A 1X7RA 5M96A 4EMAA 2VV4B 2OZ7A 1PCGA 2GPVA 2B23A 1XNXA 3G8IA 2G5OA 5DUHA 3UU7B 5KCCA 1YIMA 2GL8A 2Q3YA 3ERTA 3TX7B 3Q95A 5ACCA 5DY8A 2PIXA 5L7EA 5C4TA 2P7ZA 1XPCA 5AWKA 1FM6A 2QA8A 3OLSA 2LBDA 5G43A 1FM9D 5KRIA 2ZXZA 4XHDA 2J4AA 4L96A 5F9BA 3AN3A 1LV2A 1YOKA 3IPUA 3N00A 3HLVA 1L2IA 4ONIA 5E1CA 3VT8A 3OSIA 1Z5XU 3D57A 1HG4A 2BJ4B 5DV8A 3L3XA 2HARA 4E4QA 1FBYA 3A2IA 3UU7A 1T5ZA 3WTQA 2Q7JA 2AA7A 4S0SA 2HWQA 3A78A 5DXRA 2PIOA 4RMEA 1KKQA 5JI0D 4ITFA 1Z5XE 4LNXA 2QE4A 3VI8A 1NAVA 2PNUA 2PIRA 4S14A 5DVVA 3AZ3A 2Q6JA 4MG8A 1YINA 1Z95A 3GWXA 4G21A 1QKMA 1X76A 5DIDA 2P1VA 3OMQA 1OSVA 4OZRU 4UDAA 3ZR7A 4MG6A 1T7TA 3R29A 4M8EA 4ZNWA 2GPUA 5DWJA 5KCWA 2BJ4A 1NHZA 2V7CA 1S9PA 4K4JA 2ZASA 1NYXA 3CJWA 3IXPD 4A4VA 1UPVA 3B0TA 1SR7A 4MGCA 3OKHA 4N8RA 2PIWA 4B7WA 4OZRE 2AYRA 5B5BA 3GZ9A 1NDEA 3VT9A 3VTDA 5DI7A 2HWRA 4Q13A 3FEJA 3GN8A 5FQSA 3D6DA 4JYGA 1IE9A 4OHAA 5DX3A 5APHA 5GT4A 3CDPA 3S9SA 4IQRA 4Y29A 3X31A 1MVCA 3PEQA 3L0EA 5DRMA 4JYIA 1YA3A 3W0YA 3W0GA 4J24A 5DKSA 1T73A 5DZIA 1Y9RA 4K6IA 3K23A 4OEZA 3V9YA 2P1UA 3OZ0A 4N5GA 4ZOMA 3FALB 5DXEA 4KZJA 1S19A 2Q5PA 2QR9A 3F5CA 3UUDB 3OOKA 2YJAB 2HB7A 4PRGA 1XJ7A 1Y0XX 3UUAA 5HJPA 5IAWA 2ZK2A 4DMAA 5KCDA 1TFCA 3UP0A 4MGBB 2YJDA 3D5FA 1X78A 3ADVA 4OZTE 3V9VA 1R1KA 4RE8A 3WWRA 3VT5A 3AZ1A 2AM9A 3W5TA 1PQ6A 2HVCA 3OS8C 5C4UA 1K74A 2EWPA 3A40X 1XZXX 1QKTA 5CJ6A 5AVIA 4BCRA 2QTUA 3AX8A 3FALA 1DKFB 2O4JA 3BQDA 4QJRA 4OILA 3KBAA 4TV1B 3FEIA 5DUEA 2I4PA 3W0HA 2Q8SA 3ERDA 3V3QA 1XV9A 2Q6SA 1QKUA 2FVJA 2PIUA 3A2JA 3B1MA 2ZBSA 5DU5A 1RKGA 4NUFA 3AFRA 3W5RA 3VRTA 1IE8A 1XP1A 4LSJA 1T76A 4OJBA 3FLIA 1XNNA 5DVSA 5DZ3A 4FGYA 3FXVA 1U3RA 2H77A 3CS8A 4DM6A 5SYZA 3JZCA 3K6PA 3X1IA 1H9UA 1M2ZA 3O1EA 3FC6B 2G0HA 4RMDA 3P8XA 1P8DA 2FAIA 2P54A 1T63A 2GPPA 1R20D 1X7BA 5JJMA 4S0TA 4OKTA 4WHFA 4XLDA 2POGA 2ZMIA 3KPZA 3E7CA 5G42A 3VSOA 5DSHA 1PQ9A 4MGAA 3IXPA 3OMKA 4QE8A 3GBKA 4R2UA 5DL4A 3VTCA 2P7AA 2XHSA 2JF9A 4POHA 2PKLA 4OARA 4IWFA 3VJSA 3B0WA 1NUOA 3L0LA 3B0RA 4MG7A 3W0JA 4HEEX 5DTVA 4F9MA 1E3GA 1UHLA 1OSHA 1NRLA 2ZMJA 3CTBA 3HZFA 5DWGA 5KRMA 3IA6A 5L11A 1L2JA 1NAXA 2HAMA 1KNUA 2HFPA 3A3ZX 3HC6A 1S9QA 3PCUA 4S15A 4EM9A 5KRAA 3KYTA 4ZNSA 3ZRAA 5DXBB 4YPQA 2QH6A 4NY9A 4OLMA 4ZN7A 3CWDA 4LTWA 3B5RA 5EJVA 2HC4A 2JJ3A 2ZK5A 2Q60A 1XQCA 5DZ0A 1DB1A 1RDTD 1ZEOA 2PIQA 3B67A 5DKEA 5DXQA 4G1DA 5GICA 2ZK6A 4FN9A 5HCVA 4RUPA 3RY9A 4DOSA 5AAVB 1G1UA 2YLYA 2AB2A 1I38A 3DT3A 3OMOA 4LNWA 4YNKA 3IMYA 1OVLB 5HYRA 2F4BA 4O8FA 4R06A 1U9EA 1ZH7A 1XVPB 5KROA
chains in the Genus database with same CATH topology
4J5WA 5DIGA 1X7EA 3HVLA 2VV4A 3IPQA 4J26A 2QZOB 4OIVA 2Q1VA 1EXXA 2E2RA 3CDSA 3E00A 5DWIA 1K7LA 5FQRA 2I0JA 2ZK4A 3VHVA 2VV1B 5H1EA 5DWEA 4J5WC 3HO0A 4OEAA 4IA3A 2GIUA 4DK8A 3ADWA 2A3IA 3PBAA 3OSWA 5FQPA 3K8SA 4L98A 5DMFA 5DXGA 3SP6A 5KRFA 4ZNTA 5HZCA 3DZUD 4N73A 4MG9B 3SP9A 1T65A 2POBA 4UDCA 2B1VA 5EITA 5G44A 4WHGA 2QZOA 3VJIA 1VJBA 1S0XA 3DCTA 3OSAA 3L3ZA 4DM8A 4JL4A 4ZJWA 2QGWA 2AA6A 3HC5A 1G50A 4LBDA 3V9TA 1Q4XA 1XDKB 2ZNOA 3AUNA 2R40D 2VV2A 4K7AA 5GIEA 4PVUA 2P7GA 4JAZA 2B50A 1G2NA 3G8OA 3H0AD 3WT7A 3L1BA 2OVMA 1HJ1A 1R5KA 3ADXA 2IHQA 3D24A 3T03A 4MGDB 1ZUCA 4XUMA 2NW4A 1BSXA 4KZIA 4XTAA 3TKMA 2ZNNA 5HJSA 1XLSE 3OZJA 2AX7A 4UDBA 3W0CA 3WMHA 4ZI1A 4X1GA 4ZO1B 2GTKA 3OKIA 1YMTA 4TUZB 3KMGA 4PWLA 4IW8A 5EC9A 3G9EA 2AWHA 3AN4A 1N83A 4ITEA 2QGTA 3WFFA 5G45A 2Q7IA 3FUGA 2AMBA 5KYAA 2JFAB 5L7GA 3W0IA 3W5QA 2AA5A 2Z4BA 4ZJRA 5DIEA 1YYEA 2REWA 1XIUA 4CI5A 2GPOA 2J7YA 4OJ4A 1FM9A 2QSEA 3B0QA 3DY6A 2W8YA 3L0JA 4OH6A 5ICKA 1K4WA 2NPAA 3R8AA 4DQMA 4E2JA 2QA6A 4POJA 3U9QA 2V0VA 4J5XA 1FCXA 1T7FA 3GD2A 3A9EB 4MGBA 2FSZA 2ZVTA 1R6GA 1WM0X 3AURA 4XI3A 2ZLCA 1FM6D 2Q7LA 3ADTA 1UOMA 3A2HA 3OMPA 4RAKA 1Y0SA 3GYUA 5EI1A 3KFCA 4RFWA 3UVVB 5C4OA 3X1HA 5LWPA 1PDUA 1FCZA 1X7JA 3H52A 3L03A 3ET2A 2ZL9A 1TXIA 3X36A 3EYBA 5G3JA 2HASA 1A52A 1A28A 1DKFA 5KRLA 3BEJA 4HLWA 4TV1A 1I7IA 3DZUA 2AX9A 2VSRA 3UUCA 2G0GA 3CLDA 5KRKA 2IOGA 4XT9A 1G5YA 3KDUA 4G20A 2VSTA 4IVWA 2ABIA 2NV7A 1OT7A 4IV2A 4QL8A 3WJ4A 3UP3A 1XOWA 5DV6A 3UVVA 2ZKCA 2QABA 4KZMA 4APUA 5KCTA 4NB6A 2R6YA 3VSPA 2QXSA 2XKWA 3D90A 4NQAB 1SQNA 5APJA 4OK1A 4OKBA 5ETHA 5G5WA 4CI4A 2ZY0A 2ACLB 3FC6A 5A86A 3VRUA 3P89A 1NQ0A 2VV3A 2QMVA 5C4SA 5KCUA 2HBHA 5K13A 2J7XA 5DWLA 3H0AA 4PF3A 5AAUA 4NIEA 1YJEA 5B41A 3OLFA 4G2HA 2ZFXA 5DUGA 4ZN9A 4WPFA 1GWXA 5E7VA 3TY0A 5DYBA 2OCFA 4R6SA 2P4YA 5EHJA 5HYKA 4OH5A 3MNEA 2PJLA 2QW4A 2B1ZA 2ACLA 4G2IA 5DK9A 3WFGA 3CS6A 3ET0A 3HQ5A 4IA1A 3ZRBA 3TKCA 3W5PA 2Q59B 1KV6A 1QKNA 2IOKA 2PIPL 2QA8B 2Q5GA 2ZK3A 3PLZA 5KRJA 1I7GA 4ZNHA 2P1TA 3QT0A 4XAOA 5DKBA 5DXBA 2HCDA 3VT6A 5IZ0A 5GIDA 2HB8A 2VV0A 2XYWA 4G1ZA 2QPYA 4RUJA 3CS4A 4IS8A 4IWCA 1ZDTA 4ZNVA 4X1FA 5DVCA 5DXMA 5AWJA 5KR9A 1ZDUA 3GYTA 3MNPA 1ILGA 5AAVA 1SKXA 2Q6RA 4Q50A 3UUDA 1R1KD 3DZYD 4IU7A 5DP0A 3OLLA 2O9IA 3JZBA 2YLQA 5L7HA 1K74D 1OVLA 2OVHA 3PO9A 3B3KA 4OGHA 1ZKYA 3FS1A 1I37A 4OFUA 1P93A 1UPWA 3OAPA 5AVLA 2Q59A 1XVPA 3E94A 4A4WA 5I4VA 1GS4A 2YHDA 3ET1A 4IW6A 1XP9A 3P88A 4MG8B 3ADSA 3WT5A 1U3SA 4QE6A 2OUZA 3RUUA 1T74A 2ZMHA 2PIVA 1E3KA 3OMMA 4PLEA 3VHUA 5DXPA 5KD9A 5DMCA 3CQVA 3ZQTA 2Q5SA 5DYDA 3KDTA 5AZVA 5KRHA 5DV3A 4OC7A 2VV1A 1XLSA 1R20A 5FQVA 4RMCA 3ET3A 3ILZA 4PP6A 5AK2A 2AMAA 5FQTA 4OKWA 5E15A 4CSJA 2AAXA 5LGAA 3OS9A 1PRGA 3WGPA 2G44A 1PQCA 1T79A 5DX3B 3R2AA 3V3EA 4WLBA 4MG9A 2I0GA 3FURA 1NQ1A 4REEA 3R5MA 2AXAA 2GWXA 3VT3A 4E4KA 4REFA 5DRJA 5DKGA 1XQ3A 2ATHA 5JY3A 4RZFA 1YUCA 4P6WA 1ERRA 3KMZA 1YOWA 2AX8A 1RJKA 3VHWA 1NQ7A 5G46A 3F5CB 1MV9A 3KWYA 5EGVA 1XDKA 2J14A 1ZGYA 1T7RA 4IA2A 4WVDA 3UUAB 5HJPB 4M8HA 1U3QA 3OGTA 4OKXA 3R8DA 1RDTA 2O4RA 5E0XA 4MG5A 3ADUA 3AUQA 2Q70A 3K22A 1LBDA 4ZNUA 3VJTA 5E0WA 3LMPA 4FHHA 2ZXNA 4QM0A 1M7WA 1T7MA 4MGDA 1FCYA 3B65A 2AA2A 3SZ1A 1ZAFA 1N46A 1S0ZA 4JGVA 4OZTU 3W0AA 2ZK1A 2QNVA 3OS8A 5KCEA 5DZ1A 4RZGA 4PLDA 1XV9B 4OIUA 2AX6A 1FD0A 2Q7KA 5IXKA 3V49A 4TUZA 4IUIA 3RVFA 5AZTA 4IV4A 3VT7A 1EREA 1M13A 2ZLAA 2ZNQA 3DZYA 4A2JA 2H79A 2JFAA 2PITA 3MNOA 3G0WA 4J5XC 1GWRA 1RKHA 1RK3A 3B68A 3IPSA 2GP7A 3RUTA 2YLOA 4FHIA 3E00D 2NXXA 3WJ5A 4YMQA 3NSQA 5DLRA 3P0UA 2YFEA 4WQPA 5JJMB 2ZXMA 3A9EA 4OEDA 4RZEA 3B66A 4PP5A 3DCUA 2AO6A 1PK5A 4OFRA 4MGAB 5APKA 5E14A 1ILHA 4ZO1X 2I4ZA 4FNEA 3BC5A 5DXKA 3HODA 1EXAA 2YATA 3VT4A 2PRGA 2ZK0A 2P15A 1GWQA 2I4JA 3HM1A 3M7RA 4MG7B 2BAWA 4MDDA 2QXMA 4PPSA 2OM9A 3VTBA 1UHLB 2R40A 3F7DA 3R5NA 4IVYA 2Q1HA 5DZHA 4PP3A 4DORA 3O1DA 3VRVA 4RUOX 5E19A 3V4AA 3PRGA 4RWVA 5AYGA 3NSPA 4P6XA 2NXXE 3VJHA 5KYJA 3OOFA 2YLPA 4UDDA 3RLLA 3LBDA 1PZLA 5KRCA 3AZ2A 4IA7A 3GWSX 4PXMA 3RLJA 4QK4A 1YP0A 4Q0AC 4YT1A 1YY4A 2R6WA 4JYHA 4OEYA 3R8IA 2OAXA 1XP6A 2Q61A 2Z4JA 2XYJA 3Q95B 4DK7A 4G1YA 2PINA 4PPPA 4XUHA 1MZNA 1XB7A 2XYXA 3VRWA 5KCFA 3NOAA 3KMRA 3VN2A 1N4HA 1XAPA 4N1YA 3DR1A 1NQ2A 4OJ9A 1SJ0A 2ZNPA 3WT6A 1X7RA 5M96A 4EMAA 2VV4B 2OZ7A 1PCGA 2GPVA 2B23A 1XNXA 3G8IA 2G5OA 5DUHA 3UU7B 5KCCA 1YIMA 2GL8A 2Q3YA 3ERTA 3TX7B 3Q95A 5ACCA 5DY8A 2PIXA 5L7EA 5C4TA 2P7ZA 1XPCA 5AWKA 1FM6A 2QA8A 3OLSA 2LBDA 5G43A 1FM9D 5KRIA 2ZXZA 4XHDA 2J4AA 4L96A 5F9BA 3AN3A 1LV2A 1YOKA 3IPUA 3N00A 3HLVA 1L2IA 4ONIA 5E1CA 3VT8A 3OSIA 1Z5XU 3D57A 1HG4A 2BJ4B 5DV8A 3L3XA 2HARA 4E4QA 1FBYA 3A2IA 3UU7A 1T5ZA 3WTQA 2Q7JA 2AA7A 4S0SA 2HWQA 3A78A 5DXRA 2PIOA 4RMEA 1KKQA 5JI0D 4ITFA 1Z5XE 4LNXA 2QE4A 3VI8A 1NAVA 2PNUA 2PIRA 4S14A 5DVVA 3AZ3A 2Q6JA 4MG8A 1YINA 1Z95A 3GWXA 4G21A 1QKMA 1X76A 5DIDA 2P1VA 3OMQA 1OSVA 4OZRU 4UDAA 3ZR7A 4MG6A 1T7TA 3R29A 4M8EA 4ZNWA 2GPUA 5DWJA 5KCWA 2BJ4A 1NHZA 2V7CA 1S9PA 4K4JA 2ZASA 1NYXA 3CJWA 3IXPD 4A4VA 1UPVA 3B0TA 1SR7A 4MGCA 3OKHA 4N8RA 2PIWA 4B7WA 4OZRE 2AYRA 5B5BA 3GZ9A 1NDEA 3VT9A 3VTDA 5DI7A 2HWRA 4Q13A 3FEJA 3GN8A 5FQSA 3D6DA 4JYGA 1IE9A 4OHAA 5DX3A 5APHA 5GT4A 3CDPA 3S9SA 4IQRA 4Y29A 3X31A 1MVCA 3PEQA 3L0EA 5DRMA 4JYIA 1YA3A 3W0YA 3W0GA 4J24A 5DKSA 1T73A 5DZIA 1Y9RA 4K6IA 3K23A 4OEZA 3V9YA 2P1UA 3OZ0A 4N5GA 4ZOMA 3FALB 5DXEA 4KZJA 1S19A 2Q5PA 2QR9A 3F5CA 3UUDB 3OOKA 2YJAB 2HB7A 4PRGA 1XJ7A 1Y0XX 3UUAA 5HJPA 5IAWA 2ZK2A 4DMAA 5KCDA 1TFCA 3UP0A 4MGBB 2YJDA 3D5FA 1X78A 3ADVA 4OZTE 3V9VA 1R1KA 4RE8A 3WWRA 3VT5A 3AZ1A 2AM9A 3W5TA 1PQ6A 2HVCA 3OS8C 5C4UA 1K74A 2EWPA 3A40X 1XZXX 1QKTA 5CJ6A 5AVIA 4BCRA 2QTUA 3AX8A 3FALA 1DKFB 2O4JA 3BQDA 4QJRA 4OILA 3KBAA 4TV1B 3FEIA 5DUEA 2I4PA 3W0HA 2Q8SA 3ERDA 3V3QA 1XV9A 2Q6SA 1QKUA 2FVJA 2PIUA 3A2JA 3B1MA 2ZBSA 5DU5A 1RKGA 4NUFA 3AFRA 3W5RA 3VRTA 1IE8A 1XP1A 4LSJA 1T76A 4OJBA 3FLIA 1XNNA 5DVSA 5DZ3A 4FGYA 3FXVA 1U3RA 2H77A 3CS8A 4DM6A 5SYZA 3JZCA 3K6PA 3X1IA 1H9UA 1M2ZA 3O1EA 3FC6B 2G0HA 4RMDA 3P8XA 1P8DA 2FAIA 2P54A 1T63A 2GPPA 1R20D 1X7BA 5JJMA 4S0TA 4OKTA 4WHFA 4XLDA 2POGA 2ZMIA 3KPZA 3E7CA 5G42A 3VSOA 5DSHA 1PQ9A 4MGAA 3IXPA 3OMKA 4QE8A 3GBKA 4R2UA 5DL4A 3VTCA 2P7AA 2XHSA 2JF9A 4POHA 2PKLA 4OARA 4IWFA 3VJSA 3B0WA 1NUOA 3L0LA 3B0RA 4MG7A 3W0JA 4HEEX 5DTVA 4F9MA 1E3GA 1UHLA 1OSHA 1NRLA 2ZMJA 3CTBA 3HZFA 5DWGA 5KRMA 3IA6A 5L11A 1L2JA 1NAXA 2HAMA 1KNUA 2HFPA 3A3ZX 3HC6A 1S9QA 3PCUA 4S15A 4EM9A 5KRAA 3KYTA 4ZNSA 3ZRAA 5DXBB 4YPQA 2QH6A 4NY9A 4OLMA 4ZN7A 3CWDA 4LTWA 3B5RA 5EJVA 2HC4A 2JJ3A 2ZK5A 2Q60A 1XQCA 5DZ0A 1DB1A 1RDTD 1ZEOA 2PIQA 3B67A 5DKEA 5DXQA 4G1DA 5GICA 2ZK6A 4FN9A 5HCVA 4RUPA 3RY9A 4DOSA 5AAVB 1G1UA 2YLYA 2AB2A 1I38A 3DT3A 3OMOA 4LNWA 4YNKA 3IMYA 1OVLB 5HYRA 2F4BA 4O8FA 4R06A 1U9EA 1ZH7A 1XVPB 5KROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J5W A;  5DIG A;  1X7E A;  3HVL A;  2VV4 A;  3IPQ A;  4J26 A;  2QZO B;  4OIV A;  2Q1V A;  1EXX A;  2E2R A;  3CDS A;  3E00 A;  5DWI A;  1K7L A;  5FQR A;  2I0J A;  2ZK4 A;  3VHV A;  2VV1 B;  5H1E A;  5DWE A;  4J5W C;  3HO0 A;  4OEA A;  4IA3 A;  2GIU A;  4DK8 A;  3ADW A;  2A3I A;  3PBA A;  3OSW A;  5FQP A;  3K8S A;  4L98 A;  5DMF A;  5DXG A;  3SP6 A;  5KRF A;  4ZNT A;  5HZC A;  3DZU D;  4N73 A;  4MG9 B;  3SP9 A;  1T65 A;  2POB A;  4UDC A;  2B1V A;  5EIT A;  5G44 A;  4WHG A;  2QZO A;  3VJI A;  1VJB A;  1S0X A;  3DCT A;  3OSA A;  3L3Z A;  4DM8 A;  4JL4 A;  4ZJW A;  2QGW A;  2AA6 A;  3HC5 A;  1G50 A;  4LBD A;  3V9T A;  1Q4X A;  1XDK B;  2ZNO A;  3AUN A;  2R40 D;  2VV2 A;  4K7A A;  5GIE A;  4PVU A;  2P7G A;  4JAZ A;  2B50 A;  1G2N A;  3G8O A;  3H0A D;  3WT7 A;  3L1B A;  2OVM A;  1HJ1 A;  1R5K A;  3ADX A;  2IHQ A;  3D24 A;  3T03 A;  4MGD B;  1ZUC A;  4XUM A;  2NW4 A;  1BSX A;  4KZI A;  4XTA A;  3TKM A;  2ZNN A;  5HJS A;  1XLS E;  3OZJ A;  2AX7 A;  4UDB A;  3W0C A;  3WMH A;  4ZI1 A;  4X1G A;  4ZO1 B;  2GTK A;  3OKI A;  1YMT A;  4TUZ B;  3KMG A;  4PWL A;  4IW8 A;  5EC9 A;  3G9E A;  2AWH A;  3AN4 A;  1N83 A;  4ITE A;  2QGT A;  3WFF A;  5G45 A;  2Q7I A;  3FUG A;  2AMB A;  5KYA A;  2JFA B;  5L7G A;  3W0I A;  3W5Q A;  2AA5 A;  2Z4B A;  4ZJR A;  5DIE A;  1YYE A;  2REW A;  1XIU A;  4CI5 A;  2GPO A;  2J7Y A;  4OJ4 A;  1FM9 A;  2QSE A;  3B0Q A;  3DY6 A;  2W8Y A;  3L0J A;  4OH6 A;  5ICK A;  1K4W A;  2NPA A;  3R8A A;  4DQM A;  4E2J A;  2QA6 A;  4POJ A;  3U9Q A;  2V0V A;  4J5X A;  1FCX A;  1T7F A;  3GD2 A;  3A9E B;  4MGB A;  2FSZ A;  2ZVT A;  1R6G A;  1WM0 X;  3AUR A;  4XI3 A;  2ZLC A;  1FM6 D;  2Q7L A;  3ADT A;  1UOM A;  3A2H A;  3OMP A;  4RAK A;  1Y0S A;  3GYU A;  5EI1 A;  3KFC A;  4RFW A;  3UVV B;  5C4O A;  3X1H A;  5LWP A;  1PDU A;  1FCZ A;  1X7J A;  3H52 A;  3L03 A;  3ET2 A;  2ZL9 A;  1TXI A;  3X36 A;  3EYB A;  5G3J A;  2HAS A;  1A52 A;  1A28 A;  1DKF A;  5KRL A;  3BEJ A;  4HLW A;  4TV1 A;  1I7I A;  3DZU A;  2AX9 A;  2VSR A;  3UUC A;  2G0G A;  3CLD A;  5KRK A;  2IOG A;  4XT9 A;  1G5Y A;  3KDU A;  4G20 A;  2VST A;  4IVW A;  2ABI A;  2NV7 A;  1OT7 A;  4IV2 A;  4QL8 A;  3WJ4 A;  3UP3 A;  1XOW A;  5DV6 A;  3UVV A;  2ZKC A;  2QAB A;  4KZM A;  4APU A;  5KCT A;  4NB6 A;  2R6Y A;  3VSP A;  2QXS A;  2XKW A;  3D90 A;  4NQA B;  1SQN A;  5APJ A;  4OK1 A;  4OKB A;  5ETH A;  5G5W A;  4CI4 A;  2ZY0 A;  2ACL B;  3FC6 A;  5A86 A;  3VRU A;  3P89 A;  1NQ0 A;  2VV3 A;  2QMV A;  5C4S A;  5KCU A;  2HBH A;  5K13 A;  2J7X A;  5DWL A;  3H0A A;  4PF3 A;  5AAU A;  4NIE A;  1YJE A;  5B41 A;  3OLF A;  4G2H A;  2ZFX A;  5DUG A;  4ZN9 A;  4WPF A;  1GWX A;  5E7V A;  3TY0 A;  5DYB A;  2OCF A;  4R6S A;  2P4Y A;  5EHJ A;  5HYK A;  4OH5 A;  3MNE A;  2PJL A;  2QW4 A;  2B1Z A;  2ACL A;  4G2I A;  5DK9 A;  3WFG A;  3CS6 A;  3ET0 A;  3HQ5 A;  4IA1 A;  3ZRB A;  3TKC A;  3W5P A;  2Q59 B;  1KV6 A;  1QKN A;  2IOK A;  2PIP L;  2QA8 B;  2Q5G A;  2ZK3 A;  3PLZ A;  5KRJ A;  1I7G A;  4ZNH A;  2P1T A;  3QT0 A;  4XAO A;  5DKB A;  5DXB A;  2HCD A;  3VT6 A;  5IZ0 A;  5GID A;  2HB8 A;  2VV0 A;  2XYW A;  4G1Z A;  2QPY A;  4RUJ A;  3CS4 A;  4IS8 A;  4IWC A;  1ZDT A;  4ZNV A;  4X1F A;  5DVC A;  5DXM A;  5AWJ A;  5KR9 A;  1ZDU A;  3GYT A;  3MNP A;  1ILG A;  5AAV A;  1SKX A;  2Q6R A;  4Q50 A;  3UUD A;  1R1K D;  3DZY D;  4IU7 A;  5DP0 A;  3OLL A;  2O9I A;  3JZB A;  2YLQ A;  5L7H A;  1K74 D;  1OVL A;  2OVH A;  3PO9 A;  3B3K A;  4OGH A;  1ZKY A;  3FS1 A;  1I37 A;  4OFU A;  1P93 A;  1UPW A;  3OAP A;  5AVL A;  2Q59 A;  1XVP A;  3E94 A;  4A4W A;  5I4V A;  1GS4 A;  2YHD A;  3ET1 A;  4IW6 A;  1XP9 A;  3P88 A;  4MG8 B;  3ADS A;  3WT5 A;  1U3S A;  4QE6 A;  2OUZ A;  3RUU A;  1T74 A;  2ZMH A;  2PIV A;  1E3K A;  3OMM A;  4PLE A;  3VHU A;  5DXP A;  5KD9 A;  5DMC A;  3CQV A;  3ZQT A;  2Q5S A;  5DYD A;  3KDT A;  5AZV A;  5KRH A;  5DV3 A;  4OC7 A;  2VV1 A;  1XLS A;  1R20 A;  5FQV A;  4RMC A;  3ET3 A;  3ILZ A;  4PP6 A;  5AK2 A;  2AMA A;  5FQT A;  4OKW A;  5E15 A;  4CSJ A;  2AAX A;  5LGA A;  3OS9 A;  1PRG A;  3WGP A;  2G44 A;  1PQC A;  1T79 A;  5DX3 B;  3R2A A;  3V3E A;  4WLB A;  4MG9 A;  2I0G A;  3FUR A;  1NQ1 A;  4REE A;  3R5M A;  2AXA A;  2GWX A;  3VT3 A;  4E4K A;  4REF A;  5DRJ A;  5DKG A;  1XQ3 A;  2ATH A;  5JY3 A;  4RZF A;  1YUC A;  4P6W A;  1ERR A;  3KMZ A;  1YOW A;  2AX8 A;  1RJK A;  3VHW A;  1NQ7 A;  5G46 A;  3F5C B;  1MV9 A;  3KWY A;  5EGV A;  1XDK A;  2J14 A;  1ZGY A;  1T7R A;  4IA2 A;  4WVD A;  3UUA B;  5HJP B;  4M8H A;  1U3Q A;  3OGT A;  4OKX A;  3R8D A;  1RDT A;  2O4R A;  5E0X A;  4MG5 A;  3ADU A;  3AUQ A;  2Q70 A;  3K22 A;  1LBD A;  4ZNU A;  3VJT A;  5E0W A;  3LMP A;  4FHH A;  2ZXN A;  4QM0 A;  1M7W A;  1T7M A;  4MGD A;  1FCY A;  3B65 A;  2AA2 A;  3SZ1 A;  1ZAF A;  1N46 A;  1S0Z A;  4JGV A;  4OZT U;  3W0A A;  2ZK1 A;  2QNV A;  3OS8 A;  5KCE A;  5DZ1 A;  4RZG A;  4PLD A;  1XV9 B;  4OIU A;  2AX6 A;  1FD0 A;  2Q7K A;  5IXK A;  3V49 A;  4TUZ A;  4IUI A;  3RVF A;  5AZT A;  4IV4 A;  3VT7 A;  1ERE A;  1M13 A;  2ZLA A;  2ZNQ A;  3DZY A;  4A2J A;  2H79 A;  2JFA A;  2PIT A;  3MNO A;  3G0W A;  4J5X C;  1GWR A;  1RKH A;  1RK3 A;  3B68 A;  3IPS A;  2GP7 A;  3RUT A;  2YLO A;  4FHI A;  3E00 D;  2NXX A;  3WJ5 A;  4YMQ A;  3NSQ A;  5DLR A;  3P0U A;  2YFE A;  4WQP A;  5JJM B;  2ZXM A;  3A9E A;  4OED A;  4RZE A;  3B66 A;  4PP5 A;  3DCU A;  2AO6 A;  1PK5 A;  4OFR A;  4MGA B;  5APK A;  5E14 A;  1ILH A;  4ZO1 X;  2I4Z A;  4FNE A;  3BC5 A;  5DXK A;  3HOD A;  1EXA A;  2YAT A;  3VT4 A;  2PRG A;  2ZK0 A;  2P15 A;  1GWQ A;  2I4J A;  3HM1 A;  3M7R A;  4MG7 B;  2BAW A;  4MDD A;  2QXM A;  4PPS A;  2OM9 A;  3VTB A;  1UHL B;  2R40 A;  3F7D A;  3R5N A;  4IVY A;  2Q1H A;  5DZH A;  4PP3 A;  4DOR A;  3O1D A;  3VRV A;  4RUO X;  5E19 A;  3V4A A;  3PRG A;  4RWV A;  5AYG A;  3NSP A;  4P6X A;  2NXX E;  3VJH A;  5KYJ A;  3OOF A;  2YLP A;  4UDD A;  3RLL A;  3LBD A;  1PZL A;  5KRC A;  3AZ2 A;  4IA7 A;  3GWS X;  4PXM A;  3RLJ A;  4QK4 A;  1YP0 A;  4Q0A C;  4YT1 A;  1YY4 A;  2R6W A;  4JYH A;  4OEY A;  3R8I A;  2OAX A;  1XP6 A;  2Q61 A;  2Z4J A;  2XYJ A;  3Q95 B;  4DK7 A;  4G1Y A;  2PIN A;  4PPP A;  4XUH A;  1MZN A;  1XB7 A;  2XYX A;  3VRW A;  5KCF A;  3NOA A;  3KMR A;  3VN2 A;  1N4H A;  1XAP A;  4N1Y A;  3DR1 A;  1NQ2 A;  4OJ9 A;  1SJ0 A;  2ZNP A;  3WT6 A;  1X7R A;  5M96 A;  4EMA A;  2VV4 B;  2OZ7 A;  1PCG A;  2GPV A;  2B23 A;  1XNX A;  3G8I A;  2G5O A;  5DUH A;  3UU7 B;  5KCC A;  1YIM A;  2GL8 A;  2Q3Y A;  3ERT A;  3TX7 B;  3Q95 A;  5ACC A;  5DY8 A;  2PIX A;  5L7E A;  5C4T A;  2P7Z A;  1XPC A;  5AWK A;  1FM6 A;  2QA8 A;  3OLS A;  2LBD A;  5G43 A;  1FM9 D;  5KRI A;  2ZXZ A;  4XHD A;  2J4A A;  4L96 A;  5F9B A;  3AN3 A;  1LV2 A;  1YOK A;  3IPU A;  3N00 A;  3HLV A;  1L2I A;  4ONI A;  5E1C A;  3VT8 A;  3OSI A;  1Z5X U;  3D57 A;  1HG4 A;  2BJ4 B;  5DV8 A;  3L3X A;  2HAR A;  4E4Q A;  1FBY A;  3A2I A;  3UU7 A;  1T5Z A;  3WTQ A;  2Q7J A;  2AA7 A;  4S0S A;  2HWQ A;  3A78 A;  5DXR A;  2PIO A;  4RME A;  1KKQ A;  5JI0 D;  4ITF A;  1Z5X E;  4LNX A;  2QE4 A;  3VI8 A;  1NAV A;  2PNU A;  2PIR A;  4S14 A;  5DVV A;  3AZ3 A;  2Q6J A;  4MG8 A;  1YIN A;  1Z95 A;  3GWX A;  4G21 A;  1QKM A;  1X76 A;  5DID A;  2P1V A;  3OMQ A;  1OSV A;  4OZR U;  4UDA A;  3ZR7 A;  4MG6 A;  1T7T A;  3R29 A;  4M8E A;  4ZNW A;  2GPU A;  5DWJ A;  5KCW A;  2BJ4 A;  1NHZ A;  2V7C A;  1S9P A;  4K4J A;  2ZAS A;  1NYX A;  3CJW A;  3IXP D;  4A4V A;  1UPV A;  3B0T A;  1SR7 A;  4MGC A;  3OKH A;  4N8R A;  2PIW A;  4B7W A;  4OZR E;  2AYR A;  5B5B A;  3GZ9 A;  1NDE A;  3VT9 A;  3VTD A;  5DI7 A;  2HWR A;  4Q13 A;  3FEJ A;  3GN8 A;  5FQS A;  3D6D A;  4JYG A;  1IE9 A;  4OHA A;  5DX3 A;  5APH A;  5GT4 A;  3CDP A;  3S9S A;  4IQR A;  4Y29 A;  3X31 A;  1MVC A;  3PEQ A;  3L0E A;  5DRM A;  4JYI A;  1YA3 A;  3W0Y A;  3W0G A;  4J24 A;  5DKS A;  1T73 A;  5DZI A;  1Y9R A;  4K6I A;  3K23 A;  4OEZ A;  3V9Y A;  2P1U A;  3OZ0 A;  4N5G A;  4ZOM A;  3FAL B;  5DXE A;  4KZJ A;  1S19 A;  2Q5P A;  2QR9 A;  3F5C A;  3UUD B;  3OOK A;  2YJA B;  2HB7 A;  4PRG A;  1XJ7 A;  1Y0X X;  3UUA A;  5HJP A;  5IAW A;  2ZK2 A;  4DMA A;  5KCD A;  1TFC A;  3UP0 A;  4MGB B;  2YJD A;  3D5F A;  1X78 A;  3ADV A;  4OZT E;  3V9V A;  1R1K A;  4RE8 A;  3WWR A;  3VT5 A;  3AZ1 A;  2AM9 A;  3W5T A;  1PQ6 A;  2HVC A;  3OS8 C;  5C4U A;  1K74 A;  2EWP A;  3A40 X;  1XZX X;  1QKT A;  5CJ6 A;  5AVI A;  4BCR A;  2QTU A;  3AX8 A;  3FAL A;  1DKF B;  2O4J A;  3BQD A;  4QJR A;  4OIL A;  3KBA A;  4TV1 B;  3FEI A;  5DUE A;  2I4P A;  3W0H A;  2Q8S A;  3ERD A;  3V3Q A;  1XV9 A;  2Q6S A;  1QKU A;  2FVJ A;  2PIU A;  3A2J A;  3B1M A;  2ZBS A;  5DU5 A;  1RKG A;  4NUF A;  3AFR A;  3W5R A;  3VRT A;  1IE8 A;  1XP1 A;  4LSJ A;  1T76 A;  4OJB A;  3FLI A;  1XNN A;  5DVS A;  5DZ3 A;  4FGY A;  3FXV A;  1U3R A;  2H77 A;  3CS8 A;  4DM6 A;  5SYZ A;  3JZC A;  3K6P A;  3X1I A;  1H9U A;  1M2Z A;  3O1E A;  3FC6 B;  2G0H A;  4RMD A;  3P8X A;  1P8D A;  2FAI A;  2P54 A;  1T63 A;  2GPP A;  1R20 D;  1X7B A;  5JJM A;  4S0T A;  4OKT A;  4WHF A;  4XLD A;  2POG A;  2ZMI A;  3KPZ A;  3E7C A;  5G42 A;  3VSO A;  5DSH A;  1PQ9 A;  4MGA A;  3IXP A;  3OMK A;  4QE8 A;  3GBK A;  4R2U A;  5DL4 A;  3VTC A;  2P7A A;  2XHS A;  2JF9 A;  4POH A;  2PKL A;  4OAR A;  4IWF A;  3VJS A;  3B0W A;  1NUO A;  3L0L A;  3B0R A;  4MG7 A;  3W0J A;  4HEE X;  5DTV A;  4F9M A;  1E3G A;  1UHL A;  1OSH A;  1NRL A;  2ZMJ A;  3CTB A;  3HZF A;  5DWG A;  5KRM A;  3IA6 A;  5L11 A;  1L2J A;  1NAX A;  2HAM A;  1KNU A;  2HFP A;  3A3Z X;  3HC6 A;  1S9Q A;  3PCU A;  4S15 A;  4EM9 A;  5KRA A;  3KYT A;  4ZNS A;  3ZRA A;  5DXB B;  4YPQ A;  2QH6 A;  4NY9 A;  4OLM A;  4ZN7 A;  3CWD A;  4LTW A;  3B5R A;  5EJV A;  2HC4 A;  2JJ3 A;  2ZK5 A;  2Q60 A;  1XQC A;  5DZ0 A;  1DB1 A;  1RDT D;  1ZEO A;  2PIQ A;  3B67 A;  5DKE A;  5DXQ A;  4G1D A;  5GIC A;  2ZK6 A;  4FN9 A;  5HCV A;  4RUP A;  3RY9 A;  4DOS A;  5AAV B;  1G1U A;  2YLY A;  2AB2 A;  1I38 A;  3DT3 A;  3OMO A;  4LNW A;  4YNK A;  3IMY A;  1OVL B;  5HYR A;  2F4B A;  4O8F A;  4R06 A;  1U9E A;  1ZH7 A;  1XVP B;  5KRO A; 
#chains in the Genus database with same CATH topology
 4J5W A;  5DIG A;  1X7E A;  3HVL A;  2VV4 A;  3IPQ A;  4J26 A;  2QZO B;  4OIV A;  2Q1V A;  1EXX A;  2E2R A;  3CDS A;  3E00 A;  5DWI A;  1K7L A;  5FQR A;  2I0J A;  2ZK4 A;  3VHV A;  2VV1 B;  5H1E A;  5DWE A;  4J5W C;  3HO0 A;  4OEA A;  4IA3 A;  2GIU A;  4DK8 A;  3ADW A;  2A3I A;  3PBA A;  3OSW A;  5FQP A;  3K8S A;  4L98 A;  5DMF A;  5DXG A;  3SP6 A;  5KRF A;  4ZNT A;  5HZC A;  3DZU D;  4N73 A;  4MG9 B;  3SP9 A;  1T65 A;  2POB A;  4UDC A;  2B1V A;  5EIT A;  5G44 A;  4WHG A;  2QZO A;  3VJI A;  1VJB A;  1S0X A;  3DCT A;  3OSA A;  3L3Z A;  4DM8 A;  4JL4 A;  4ZJW A;  2QGW A;  2AA6 A;  3HC5 A;  1G50 A;  4LBD A;  3V9T A;  1Q4X A;  1XDK B;  2ZNO A;  3AUN A;  2R40 D;  2VV2 A;  4K7A A;  5GIE A;  4PVU A;  2P7G A;  4JAZ A;  2B50 A;  1G2N A;  3G8O A;  3H0A D;  3WT7 A;  3L1B A;  2OVM A;  1HJ1 A;  1R5K A;  3ADX A;  2IHQ A;  3D24 A;  3T03 A;  4MGD B;  1ZUC A;  4XUM A;  2NW4 A;  1BSX A;  4KZI A;  4XTA A;  3TKM A;  2ZNN A;  5HJS A;  1XLS E;  3OZJ A;  2AX7 A;  4UDB A;  3W0C A;  3WMH A;  4ZI1 A;  4X1G A;  4ZO1 B;  2GTK A;  3OKI A;  1YMT A;  4TUZ B;  3KMG A;  4PWL A;  4IW8 A;  5EC9 A;  3G9E A;  2AWH A;  3AN4 A;  1N83 A;  4ITE A;  2QGT A;  3WFF A;  5G45 A;  2Q7I A;  3FUG A;  2AMB A;  5KYA A;  2JFA B;  5L7G A;  3W0I A;  3W5Q A;  2AA5 A;  2Z4B A;  4ZJR A;  5DIE A;  1YYE A;  2REW A;  1XIU A;  4CI5 A;  2GPO A;  2J7Y A;  4OJ4 A;  1FM9 A;  2QSE A;  3B0Q A;  3DY6 A;  2W8Y A;  3L0J A;  4OH6 A;  5ICK A;  1K4W A;  2NPA A;  3R8A A;  4DQM A;  4E2J A;  2QA6 A;  4POJ A;  3U9Q A;  2V0V A;  4J5X A;  1FCX A;  1T7F A;  3GD2 A;  3A9E B;  4MGB A;  2FSZ A;  2ZVT A;  1R6G A;  1WM0 X;  3AUR A;  4XI3 A;  2ZLC A;  1FM6 D;  2Q7L A;  3ADT A;  1UOM A;  3A2H A;  3OMP A;  4RAK A;  1Y0S A;  3GYU A;  5EI1 A;  3KFC A;  4RFW A;  3UVV B;  5C4O A;  3X1H A;  5LWP A;  1PDU A;  1FCZ A;  1X7J A;  3H52 A;  3L03 A;  3ET2 A;  2ZL9 A;  1TXI A;  3X36 A;  3EYB A;  5G3J A;  2HAS A;  1A52 A;  1A28 A;  1DKF A;  5KRL A;  3BEJ A;  4HLW A;  4TV1 A;  1I7I A;  3DZU A;  2AX9 A;  2VSR A;  3UUC A;  2G0G A;  3CLD A;  5KRK A;  2IOG A;  4XT9 A;  1G5Y A;  3KDU A;  4G20 A;  2VST A;  4IVW A;  2ABI A;  2NV7 A;  1OT7 A;  4IV2 A;  4QL8 A;  3WJ4 A;  3UP3 A;  1XOW A;  5DV6 A;  3UVV A;  2ZKC A;  2QAB A;  4KZM A;  4APU A;  5KCT A;  4NB6 A;  2R6Y A;  3VSP A;  2QXS A;  2XKW A;  3D90 A;  4NQA B;  1SQN A;  5APJ A;  4OK1 A;  4OKB A;  5ETH A;  5G5W A;  4CI4 A;  2ZY0 A;  2ACL B;  3FC6 A;  5A86 A;  3VRU A;  3P89 A;  1NQ0 A;  2VV3 A;  2QMV A;  5C4S A;  5KCU A;  2HBH A;  5K13 A;  2J7X A;  5DWL A;  3H0A A;  4PF3 A;  5AAU A;  4NIE A;  1YJE A;  5B41 A;  3OLF A;  4G2H A;  2ZFX A;  5DUG A;  4ZN9 A;  4WPF A;  1GWX A;  5E7V A;  3TY0 A;  5DYB A;  2OCF A;  4R6S A;  2P4Y A;  5EHJ A;  5HYK A;  4OH5 A;  3MNE A;  2PJL A;  2QW4 A;  2B1Z A;  2ACL A;  4G2I A;  5DK9 A;  3WFG A;  3CS6 A;  3ET0 A;  3HQ5 A;  4IA1 A;  3ZRB A;  3TKC A;  3W5P A;  2Q59 B;  1KV6 A;  1QKN A;  2IOK A;  2PIP L;  2QA8 B;  2Q5G A;  2ZK3 A;  3PLZ A;  5KRJ A;  1I7G A;  4ZNH A;  2P1T A;  3QT0 A;  4XAO A;  5DKB A;  5DXB A;  2HCD A;  3VT6 A;  5IZ0 A;  5GID A;  2HB8 A;  2VV0 A;  2XYW A;  4G1Z A;  2QPY A;  4RUJ A;  3CS4 A;  4IS8 A;  4IWC A;  1ZDT A;  4ZNV A;  4X1F A;  5DVC A;  5DXM A;  5AWJ A;  5KR9 A;  1ZDU A;  3GYT A;  3MNP A;  1ILG A;  5AAV A;  1SKX A;  2Q6R A;  4Q50 A;  3UUD A;  1R1K D;  3DZY D;  4IU7 A;  5DP0 A;  3OLL A;  2O9I A;  3JZB A;  2YLQ A;  5L7H A;  1K74 D;  1OVL A;  2OVH A;  3PO9 A;  3B3K A;  4OGH A;  1ZKY A;  3FS1 A;  1I37 A;  4OFU A;  1P93 A;  1UPW A;  3OAP A;  5AVL A;  2Q59 A;  1XVP A;  3E94 A;  4A4W A;  5I4V A;  1GS4 A;  2YHD A;  3ET1 A;  4IW6 A;  1XP9 A;  3P88 A;  4MG8 B;  3ADS A;  3WT5 A;  1U3S A;  4QE6 A;  2OUZ A;  3RUU A;  1T74 A;  2ZMH A;  2PIV A;  1E3K A;  3OMM A;  4PLE A;  3VHU A;  5DXP A;  5KD9 A;  5DMC A;  3CQV A;  3ZQT A;  2Q5S A;  5DYD A;  3KDT A;  5AZV A;  5KRH A;  5DV3 A;  4OC7 A;  2VV1 A;  1XLS A;  1R20 A;  5FQV A;  4RMC A;  3ET3 A;  3ILZ A;  4PP6 A;  5AK2 A;  2AMA A;  5FQT A;  4OKW A;  5E15 A;  4CSJ A;  2AAX A;  5LGA A;  3OS9 A;  1PRG A;  3WGP A;  2G44 A;  1PQC A;  1T79 A;  5DX3 B;  3R2A A;  3V3E A;  4WLB A;  4MG9 A;  2I0G A;  3FUR A;  1NQ1 A;  4REE A;  3R5M A;  2AXA A;  2GWX A;  3VT3 A;  4E4K A;  4REF A;  5DRJ A;  5DKG A;  1XQ3 A;  2ATH A;  5JY3 A;  4RZF A;  1YUC A;  4P6W A;  1ERR A;  3KMZ A;  1YOW A;  2AX8 A;  1RJK A;  3VHW A;  1NQ7 A;  5G46 A;  3F5C B;  1MV9 A;  3KWY A;  5EGV A;  1XDK A;  2J14 A;  1ZGY A;  1T7R A;  4IA2 A;  4WVD A;  3UUA B;  5HJP B;  4M8H A;  1U3Q A;  3OGT A;  4OKX A;  3R8D A;  1RDT A;  2O4R A;  5E0X A;  4MG5 A;  3ADU A;  3AUQ A;  2Q70 A;  3K22 A;  1LBD A;  4ZNU A;  3VJT A;  5E0W A;  3LMP A;  4FHH A;  2ZXN A;  4QM0 A;  1M7W A;  1T7M A;  4MGD A;  1FCY A;  3B65 A;  2AA2 A;  3SZ1 A;  1ZAF A;  1N46 A;  1S0Z A;  4JGV A;  4OZT U;  3W0A A;  2ZK1 A;  2QNV A;  3OS8 A;  5KCE A;  5DZ1 A;  4RZG A;  4PLD A;  1XV9 B;  4OIU A;  2AX6 A;  1FD0 A;  2Q7K A;  5IXK A;  3V49 A;  4TUZ A;  4IUI A;  3RVF A;  5AZT A;  4IV4 A;  3VT7 A;  1ERE A;  1M13 A;  2ZLA A;  2ZNQ A;  3DZY A;  4A2J A;  2H79 A;  2JFA A;  2PIT A;  3MNO A;  3G0W A;  4J5X C;  1GWR A;  1RKH A;  1RK3 A;  3B68 A;  3IPS A;  2GP7 A;  3RUT A;  2YLO A;  4FHI A;  3E00 D;  2NXX A;  3WJ5 A;  4YMQ A;  3NSQ A;  5DLR A;  3P0U A;  2YFE A;  4WQP A;  5JJM B;  2ZXM A;  3A9E A;  4OED A;  4RZE A;  3B66 A;  4PP5 A;  3DCU A;  2AO6 A;  1PK5 A;  4OFR A;  4MGA B;  5APK A;  5E14 A;  1ILH A;  4ZO1 X;  2I4Z A;  4FNE A;  3BC5 A;  5DXK A;  3HOD A;  1EXA A;  2YAT A;  3VT4 A;  2PRG A;  2ZK0 A;  2P15 A;  1GWQ A;  2I4J A;  3HM1 A;  3M7R A;  4MG7 B;  2BAW A;  4MDD A;  2QXM A;  4PPS A;  2OM9 A;  3VTB A;  1UHL B;  2R40 A;  3F7D A;  3R5N A;  4IVY A;  2Q1H A;  5DZH A;  4PP3 A;  4DOR A;  3O1D A;  3VRV A;  4RUO X;  5E19 A;  3V4A A;  3PRG A;  4RWV A;  5AYG A;  3NSP A;  4P6X A;  2NXX E;  3VJH A;  5KYJ A;  3OOF A;  2YLP A;  4UDD A;  3RLL A;  3LBD A;  1PZL A;  5KRC A;  3AZ2 A;  4IA7 A;  3GWS X;  4PXM A;  3RLJ A;  4QK4 A;  1YP0 A;  4Q0A C;  4YT1 A;  1YY4 A;  2R6W A;  4JYH A;  4OEY A;  3R8I A;  2OAX A;  1XP6 A;  2Q61 A;  2Z4J A;  2XYJ A;  3Q95 B;  4DK7 A;  4G1Y A;  2PIN A;  4PPP A;  4XUH A;  1MZN A;  1XB7 A;  2XYX A;  3VRW A;  5KCF A;  3NOA A;  3KMR A;  3VN2 A;  1N4H A;  1XAP A;  4N1Y A;  3DR1 A;  1NQ2 A;  4OJ9 A;  1SJ0 A;  2ZNP A;  3WT6 A;  1X7R A;  5M96 A;  4EMA A;  2VV4 B;  2OZ7 A;  1PCG A;  2GPV A;  2B23 A;  1XNX A;  3G8I A;  2G5O A;  5DUH A;  3UU7 B;  5KCC A;  1YIM A;  2GL8 A;  2Q3Y A;  3ERT A;  3TX7 B;  3Q95 A;  5ACC A;  5DY8 A;  2PIX A;  5L7E A;  5C4T A;  2P7Z A;  1XPC A;  5AWK A;  1FM6 A;  2QA8 A;  3OLS A;  2LBD A;  5G43 A;  1FM9 D;  5KRI A;  2ZXZ A;  4XHD A;  2J4A A;  4L96 A;  5F9B A;  3AN3 A;  1LV2 A;  1YOK A;  3IPU A;  3N00 A;  3HLV A;  1L2I A;  4ONI A;  5E1C A;  3VT8 A;  3OSI A;  1Z5X U;  3D57 A;  1HG4 A;  2BJ4 B;  5DV8 A;  3L3X A;  2HAR A;  4E4Q A;  1FBY A;  3A2I A;  3UU7 A;  1T5Z A;  3WTQ A;  2Q7J A;  2AA7 A;  4S0S A;  2HWQ A;  3A78 A;  5DXR A;  2PIO A;  4RME A;  1KKQ A;  5JI0 D;  4ITF A;  1Z5X E;  4LNX A;  2QE4 A;  3VI8 A;  1NAV A;  2PNU A;  2PIR A;  4S14 A;  5DVV A;  3AZ3 A;  2Q6J A;  4MG8 A;  1YIN A;  1Z95 A;  3GWX A;  4G21 A;  1QKM A;  1X76 A;  5DID A;  2P1V A;  3OMQ A;  1OSV A;  4OZR U;  4UDA A;  3ZR7 A;  4MG6 A;  1T7T A;  3R29 A;  4M8E A;  4ZNW A;  2GPU A;  5DWJ A;  5KCW A;  2BJ4 A;  1NHZ A;  2V7C A;  1S9P A;  4K4J A;  2ZAS A;  1NYX A;  3CJW A;  3IXP D;  4A4V A;  1UPV A;  3B0T A;  1SR7 A;  4MGC A;  3OKH A;  4N8R A;  2PIW A;  4B7W A;  4OZR E;  2AYR A;  5B5B A;  3GZ9 A;  1NDE A;  3VT9 A;  3VTD A;  5DI7 A;  2HWR A;  4Q13 A;  3FEJ A;  3GN8 A;  5FQS A;  3D6D A;  4JYG A;  1IE9 A;  4OHA A;  5DX3 A;  5APH A;  5GT4 A;  3CDP A;  3S9S A;  4IQR A;  4Y29 A;  3X31 A;  1MVC A;  3PEQ A;  3L0E A;  5DRM A;  4JYI A;  1YA3 A;  3W0Y A;  3W0G A;  4J24 A;  5DKS A;  1T73 A;  5DZI A;  1Y9R A;  4K6I A;  3K23 A;  4OEZ A;  3V9Y A;  2P1U A;  3OZ0 A;  4N5G A;  4ZOM A;  3FAL B;  5DXE A;  4KZJ A;  1S19 A;  2Q5P A;  2QR9 A;  3F5C A;  3UUD B;  3OOK A;  2YJA B;  2HB7 A;  4PRG A;  1XJ7 A;  1Y0X X;  3UUA A;  5HJP A;  5IAW A;  2ZK2 A;  4DMA A;  5KCD A;  1TFC A;  3UP0 A;  4MGB B;  2YJD A;  3D5F A;  1X78 A;  3ADV A;  4OZT E;  3V9V A;  1R1K A;  4RE8 A;  3WWR A;  3VT5 A;  3AZ1 A;  2AM9 A;  3W5T A;  1PQ6 A;  2HVC A;  3OS8 C;  5C4U A;  1K74 A;  2EWP A;  3A40 X;  1XZX X;  1QKT A;  5CJ6 A;  5AVI A;  4BCR A;  2QTU A;  3AX8 A;  3FAL A;  1DKF B;  2O4J A;  3BQD A;  4QJR A;  4OIL A;  3KBA A;  4TV1 B;  3FEI A;  5DUE A;  2I4P A;  3W0H A;  2Q8S A;  3ERD A;  3V3Q A;  1XV9 A;  2Q6S A;  1QKU A;  2FVJ A;  2PIU A;  3A2J A;  3B1M A;  2ZBS A;  5DU5 A;  1RKG A;  4NUF A;  3AFR A;  3W5R A;  3VRT A;  1IE8 A;  1XP1 A;  4LSJ A;  1T76 A;  4OJB A;  3FLI A;  1XNN A;  5DVS A;  5DZ3 A;  4FGY A;  3FXV A;  1U3R A;  2H77 A;  3CS8 A;  4DM6 A;  5SYZ A;  3JZC A;  3K6P A;  3X1I A;  1H9U A;  1M2Z A;  3O1E A;  3FC6 B;  2G0H A;  4RMD A;  3P8X A;  1P8D A;  2FAI A;  2P54 A;  1T63 A;  2GPP A;  1R20 D;  1X7B A;  5JJM A;  4S0T A;  4OKT A;  4WHF A;  4XLD A;  2POG A;  2ZMI A;  3KPZ A;  3E7C A;  5G42 A;  3VSO A;  5DSH A;  1PQ9 A;  4MGA A;  3IXP A;  3OMK A;  4QE8 A;  3GBK A;  4R2U A;  5DL4 A;  3VTC A;  2P7A A;  2XHS A;  2JF9 A;  4POH A;  2PKL A;  4OAR A;  4IWF A;  3VJS A;  3B0W A;  1NUO A;  3L0L A;  3B0R A;  4MG7 A;  3W0J A;  4HEE X;  5DTV A;  4F9M A;  1E3G A;  1UHL A;  1OSH A;  1NRL A;  2ZMJ A;  3CTB A;  3HZF A;  5DWG A;  5KRM A;  3IA6 A;  5L11 A;  1L2J A;  1NAX A;  2HAM A;  1KNU A;  2HFP A;  3A3Z X;  3HC6 A;  1S9Q A;  3PCU A;  4S15 A;  4EM9 A;  5KRA A;  3KYT A;  4ZNS A;  3ZRA A;  5DXB B;  4YPQ A;  2QH6 A;  4NY9 A;  4OLM A;  4ZN7 A;  3CWD A;  4LTW A;  3B5R A;  5EJV A;  2HC4 A;  2JJ3 A;  2ZK5 A;  2Q60 A;  1XQC A;  5DZ0 A;  1DB1 A;  1RDT D;  1ZEO A;  2PIQ A;  3B67 A;  5DKE A;  5DXQ A;  4G1D A;  5GIC A;  2ZK6 A;  4FN9 A;  5HCV A;  4RUP A;  3RY9 A;  4DOS A;  5AAV B;  1G1U A;  2YLY A;  2AB2 A;  1I38 A;  3DT3 A;  3OMO A;  4LNW A;  4YNK A;  3IMY A;  1OVL B;  5HYR A;  2F4B A;  4O8F A;  4R06 A;  1U9E A;  1ZH7 A;  1XVP B;  5KRO A; 
#chains in the Genus database with same CATH homology
 4J5W A;  5DIG A;  1X7E A;  3HVL A;  2VV4 A;  3IPQ A;  4J26 A;  2QZO B;  4OIV A;  2Q1V A;  1EXX A;  2E2R A;  3CDS A;  3E00 A;  5DWI A;  1K7L A;  5FQR A;  2I0J A;  2ZK4 A;  3VHV A;  2VV1 B;  5H1E A;  5DWE A;  4J5W C;  3HO0 A;  4OEA A;  4IA3 A;  2GIU A;  4DK8 A;  3ADW A;  2A3I A;  3PBA A;  3OSW A;  5FQP A;  3K8S A;  4L98 A;  5DMF A;  5DXG A;  3SP6 A;  5KRF A;  4ZNT A;  5HZC A;  3DZU D;  4N73 A;  4MG9 B;  3SP9 A;  1T65 A;  2POB A;  4UDC A;  2B1V A;  5EIT A;  5G44 A;  4WHG A;  2QZO A;  3VJI A;  1VJB A;  1S0X A;  3DCT A;  3OSA A;  3L3Z A;  4DM8 A;  4JL4 A;  4ZJW A;  2QGW A;  2AA6 A;  3HC5 A;  1G50 A;  4LBD A;  3V9T A;  1Q4X A;  1XDK B;  2ZNO A;  3AUN A;  2R40 D;  2VV2 A;  4K7A A;  5GIE A;  4PVU A;  2P7G A;  4JAZ A;  2B50 A;  1G2N A;  3G8O A;  3H0A D;  3WT7 A;  3L1B A;  2OVM A;  1HJ1 A;  1R5K A;  3ADX A;  2IHQ A;  3D24 A;  3T03 A;  4MGD B;  1ZUC A;  4XUM A;  2NW4 A;  1BSX A;  4KZI A;  4XTA A;  3TKM A;  2ZNN A;  5HJS A;  1XLS E;  3OZJ A;  2AX7 A;  4UDB A;  3W0C A;  3WMH A;  4ZI1 A;  4X1G A;  4ZO1 B;  2GTK A;  3OKI A;  1YMT A;  4TUZ B;  3KMG A;  4PWL A;  4IW8 A;  5EC9 A;  3G9E A;  2AWH A;  3AN4 A;  1N83 A;  4ITE A;  2QGT A;  3WFF A;  5G45 A;  2Q7I A;  3FUG A;  2AMB A;  5KYA A;  2JFA B;  5L7G A;  3W0I A;  3W5Q A;  2AA5 A;  2Z4B A;  4ZJR A;  5DIE A;  1YYE A;  2REW A;  1XIU A;  4CI5 A;  2GPO A;  2J7Y A;  4OJ4 A;  1FM9 A;  2QSE A;  3B0Q A;  3DY6 A;  2W8Y A;  3L0J A;  4OH6 A;  5ICK A;  1K4W A;  2NPA A;  3R8A A;  4DQM A;  4E2J A;  2QA6 A;  4POJ A;  3U9Q A;  2V0V A;  4J5X A;  1FCX A;  1T7F A;  3GD2 A;  3A9E B;  4MGB A;  2FSZ A;  2ZVT A;  1R6G A;  1WM0 X;  3AUR A;  4XI3 A;  2ZLC A;  1FM6 D;  2Q7L A;  3ADT A;  1UOM A;  3A2H A;  3OMP A;  4RAK A;  1Y0S A;  3GYU A;  5EI1 A;  3KFC A;  4RFW A;  3UVV B;  5C4O A;  3X1H A;  5LWP A;  1PDU A;  1FCZ A;  1X7J A;  3H52 A;  3L03 A;  3ET2 A;  2ZL9 A;  1TXI A;  3X36 A;  3EYB A;  5G3J A;  2HAS A;  1A52 A;  1A28 A;  1DKF A;  5KRL A;  3BEJ A;  4HLW A;  4TV1 A;  1I7I A;  3DZU A;  2AX9 A;  2VSR A;  3UUC A;  2G0G A;  3CLD A;  5KRK A;  2IOG A;  4XT9 A;  1G5Y A;  3KDU A;  4G20 A;  2VST A;  4IVW A;  2ABI A;  2NV7 A;  1OT7 A;  4IV2 A;  4QL8 A;  3WJ4 A;  3UP3 A;  1XOW A;  5DV6 A;  3UVV A;  2ZKC A;  2QAB A;  4KZM A;  4APU A;  5KCT A;  4NB6 A;  2R6Y A;  3VSP A;  2QXS A;  2XKW A;  3D90 A;  4NQA B;  1SQN A;  5APJ A;  4OK1 A;  4OKB A;  5ETH A;  5G5W A;  4CI4 A;  2ZY0 A;  2ACL B;  3FC6 A;  5A86 A;  3VRU A;  3P89 A;  1NQ0 A;  2VV3 A;  2QMV A;  5C4S A;  5KCU A;  2HBH A;  5K13 A;  2J7X A;  5DWL A;  3H0A A;  4PF3 A;  5AAU A;  4NIE A;  1YJE A;  5B41 A;  3OLF A;  4G2H A;  2ZFX A;  5DUG A;  4ZN9 A;  4WPF A;  1GWX A;  5E7V A;  3TY0 A;  5DYB A;  2OCF A;  4R6S A;  2P4Y A;  5EHJ A;  5HYK A;  4OH5 A;  3MNE A;  2PJL A;  2QW4 A;  2B1Z A;  2ACL A;  4G2I A;  5DK9 A;  3WFG A;  3CS6 A;  3ET0 A;  3HQ5 A;  4IA1 A;  3ZRB A;  3TKC A;  3W5P A;  2Q59 B;  1KV6 A;  1QKN A;  2IOK A;  2PIP L;  2QA8 B;  2Q5G A;  2ZK3 A;  3PLZ A;  5KRJ A;  1I7G A;  4ZNH A;  2P1T A;  3QT0 A;  4XAO A;  5DKB A;  5DXB A;  2HCD A;  3VT6 A;  5IZ0 A;  5GID A;  2HB8 A;  2VV0 A;  2XYW A;  4G1Z A;  2QPY A;  4RUJ A;  3CS4 A;  4IS8 A;  4IWC A;  1ZDT A;  4ZNV A;  4X1F A;  5DVC A;  5DXM A;  5AWJ A;  5KR9 A;  1ZDU A;  3GYT A;  3MNP A;  1ILG A;  5AAV A;  1SKX A;  2Q6R A;  4Q50 A;  3UUD A;  1R1K D;  3DZY D;  4IU7 A;  5DP0 A;  3OLL A;  2O9I A;  3JZB A;  2YLQ A;  5L7H A;  1K74 D;  1OVL A;  2OVH A;  3PO9 A;  3B3K A;  4OGH A;  1ZKY A;  3FS1 A;  1I37 A;  4OFU A;  1P93 A;  1UPW A;  3OAP A;  5AVL A;  2Q59 A;  1XVP A;  3E94 A;  4A4W A;  5I4V A;  1GS4 A;  2YHD A;  3ET1 A;  4IW6 A;  1XP9 A;  3P88 A;  4MG8 B;  3ADS A;  3WT5 A;  1U3S A;  4QE6 A;  2OUZ A;  3RUU A;  1T74 A;  2ZMH A;  2PIV A;  1E3K A;  3OMM A;  4PLE A;  3VHU A;  5DXP A;  5KD9 A;  5DMC A;  3CQV A;  3ZQT A;  2Q5S A;  5DYD A;  3KDT A;  5AZV A;  5KRH A;  5DV3 A;  4OC7 A;  2VV1 A;  1XLS A;  1R20 A;  5FQV A;  4RMC A;  3ET3 A;  3ILZ A;  4PP6 A;  5AK2 A;  2AMA A;  5FQT A;  4OKW A;  5E15 A;  4CSJ A;  2AAX A;  5LGA A;  3OS9 A;  1PRG A;  3WGP A;  2G44 A;  1PQC A;  1T79 A;  5DX3 B;  3R2A A;  3V3E A;  4WLB A;  4MG9 A;  2I0G A;  3FUR A;  1NQ1 A;  4REE A;  3R5M A;  2AXA A;  2GWX A;  3VT3 A;  4E4K A;  4REF A;  5DRJ A;  5DKG A;  1XQ3 A;  2ATH A;  5JY3 A;  4RZF A;  1YUC A;  4P6W A;  1ERR A;  3KMZ A;  1YOW A;  2AX8 A;  1RJK A;  3VHW A;  1NQ7 A;  5G46 A;  3F5C B;  1MV9 A;  3KWY A;  5EGV A;  1XDK A;  2J14 A;  1ZGY A;  1T7R A;  4IA2 A;  4WVD A;  3UUA B;  5HJP B;  4M8H A;  1U3Q A;  3OGT A;  4OKX A;  3R8D A;  1RDT A;  2O4R A;  5E0X A;  4MG5 A;  3ADU A;  3AUQ A;  2Q70 A;  3K22 A;  1LBD A;  4ZNU A;  3VJT A;  5E0W A;  3LMP A;  4FHH A;  2ZXN A;  4QM0 A;  1M7W A;  1T7M A;  4MGD A;  1FCY A;  3B65 A;  2AA2 A;  3SZ1 A;  1ZAF A;  1N46 A;  1S0Z A;  4JGV A;  4OZT U;  3W0A A;  2ZK1 A;  2QNV A;  3OS8 A;  5KCE A;  5DZ1 A;  4RZG A;  4PLD A;  1XV9 B;  4OIU A;  2AX6 A;  1FD0 A;  2Q7K A;  5IXK A;  3V49 A;  4TUZ A;  4IUI A;  3RVF A;  5AZT A;  4IV4 A;  3VT7 A;  1ERE A;  1M13 A;  2ZLA A;  2ZNQ A;  3DZY A;  4A2J A;  2H79 A;  2JFA A;  2PIT A;  3MNO A;  3G0W A;  4J5X C;  1GWR A;  1RKH A;  1RK3 A;  3B68 A;  3IPS A;  2GP7 A;  3RUT A;  2YLO A;  4FHI A;  3E00 D;  2NXX A;  3WJ5 A;  4YMQ A;  3NSQ A;  5DLR A;  3P0U A;  2YFE A;  4WQP A;  5JJM B;  2ZXM A;  3A9E A;  4OED A;  4RZE A;  3B66 A;  4PP5 A;  3DCU A;  2AO6 A;  1PK5 A;  4OFR A;  4MGA B;  5APK A;  5E14 A;  1ILH A;  4ZO1 X;  2I4Z A;  4FNE A;  3BC5 A;  5DXK A;  3HOD A;  1EXA A;  2YAT A;  3VT4 A;  2PRG A;  2ZK0 A;  2P15 A;  1GWQ A;  2I4J A;  3HM1 A;  3M7R A;  4MG7 B;  2BAW A;  4MDD A;  2QXM A;  4PPS A;  2OM9 A;  3VTB A;  1UHL B;  2R40 A;  3F7D A;  3R5N A;  4IVY A;  2Q1H A;  5DZH A;  4PP3 A;  4DOR A;  3O1D A;  3VRV A;  4RUO X;  5E19 A;  3V4A A;  3PRG A;  4RWV A;  5AYG A;  3NSP A;  4P6X A;  2NXX E;  3VJH A;  5KYJ A;  3OOF A;  2YLP A;  4UDD A;  3RLL A;  3LBD A;  1PZL A;  5KRC A;  3AZ2 A;  4IA7 A;  3GWS X;  4PXM A;  3RLJ A;  4QK4 A;  1YP0 A;  4Q0A C;  4YT1 A;  1YY4 A;  2R6W A;  4JYH A;  4OEY A;  3R8I A;  2OAX A;  1XP6 A;  2Q61 A;  2Z4J A;  2XYJ A;  3Q95 B;  4DK7 A;  4G1Y A;  2PIN A;  4PPP A;  4XUH A;  1MZN A;  1XB7 A;  2XYX A;  3VRW A;  5KCF A;  3NOA A;  3KMR A;  3VN2 A;  1N4H A;  1XAP A;  4N1Y A;  3DR1 A;  1NQ2 A;  4OJ9 A;  1SJ0 A;  2ZNP A;  3WT6 A;  1X7R A;  5M96 A;  4EMA A;  2VV4 B;  2OZ7 A;  1PCG A;  2GPV A;  2B23 A;  1XNX A;  3G8I A;  2G5O A;  5DUH A;  3UU7 B;  5KCC A;  1YIM A;  2GL8 A;  2Q3Y A;  3ERT A;  3TX7 B;  3Q95 A;  5ACC A;  5DY8 A;  2PIX A;  5L7E A;  5C4T A;  2P7Z A;  1XPC A;  5AWK A;  1FM6 A;  2QA8 A;  3OLS A;  2LBD A;  5G43 A;  1FM9 D;  5KRI A;  2ZXZ A;  4XHD A;  2J4A A;  4L96 A;  5F9B A;  3AN3 A;  1LV2 A;  1YOK A;  3IPU A;  3N00 A;  3HLV A;  1L2I A;  4ONI A;  5E1C A;  3VT8 A;  3OSI A;  1Z5X U;  3D57 A;  1HG4 A;  2BJ4 B;  5DV8 A;  3L3X A;  2HAR A;  4E4Q A;  1FBY A;  3A2I A;  3UU7 A;  1T5Z A;  3WTQ A;  2Q7J A;  2AA7 A;  4S0S A;  2HWQ A;  3A78 A;  5DXR A;  2PIO A;  4RME A;  1KKQ A;  5JI0 D;  4ITF A;  1Z5X E;  4LNX A;  2QE4 A;  3VI8 A;  1NAV A;  2PNU A;  2PIR A;  4S14 A;  5DVV A;  3AZ3 A;  2Q6J A;  4MG8 A;  1YIN A;  1Z95 A;  3GWX A;  4G21 A;  1QKM A;  1X76 A;  5DID A;  2P1V A;  3OMQ A;  1OSV A;  4OZR U;  4UDA A;  3ZR7 A;  4MG6 A;  1T7T A;  3R29 A;  4M8E A;  4ZNW A;  2GPU A;  5DWJ A;  5KCW A;  2BJ4 A;  1NHZ A;  2V7C A;  1S9P A;  4K4J A;  2ZAS A;  1NYX A;  3CJW A;  3IXP D;  4A4V A;  1UPV A;  3B0T A;  1SR7 A;  4MGC A;  3OKH A;  4N8R A;  2PIW A;  4B7W A;  4OZR E;  2AYR A;  5B5B A;  3GZ9 A;  1NDE A;  3VT9 A;  3VTD A;  5DI7 A;  2HWR A;  4Q13 A;  3FEJ A;  3GN8 A;  5FQS A;  3D6D A;  4JYG A;  1IE9 A;  4OHA A;  5DX3 A;  5APH A;  5GT4 A;  3CDP A;  3S9S A;  4IQR A;  4Y29 A;  3X31 A;  1MVC A;  3PEQ A;  3L0E A;  5DRM A;  4JYI A;  1YA3 A;  3W0Y A;  3W0G A;  4J24 A;  5DKS A;  1T73 A;  5DZI A;  1Y9R A;  4K6I A;  3K23 A;  4OEZ A;  3V9Y A;  2P1U A;  3OZ0 A;  4N5G A;  4ZOM A;  3FAL B;  5DXE A;  4KZJ A;  1S19 A;  2Q5P A;  2QR9 A;  3F5C A;  3UUD B;  3OOK A;  2YJA B;  2HB7 A;  4PRG A;  1XJ7 A;  1Y0X X;  3UUA A;  5HJP A;  5IAW A;  2ZK2 A;  4DMA A;  5KCD A;  1TFC A;  3UP0 A;  4MGB B;  2YJD A;  3D5F A;  1X78 A;  3ADV A;  4OZT E;  3V9V A;  1R1K A;  4RE8 A;  3WWR A;  3VT5 A;  3AZ1 A;  2AM9 A;  3W5T A;  1PQ6 A;  2HVC A;  3OS8 C;  5C4U A;  1K74 A;  2EWP A;  3A40 X;  1XZX X;  1QKT A;  5CJ6 A;  5AVI A;  4BCR A;  2QTU A;  3AX8 A;  3FAL A;  1DKF B;  2O4J A;  3BQD A;  4QJR A;  4OIL A;  3KBA A;  4TV1 B;  3FEI A;  5DUE A;  2I4P A;  3W0H A;  2Q8S A;  3ERD A;  3V3Q A;  1XV9 A;  2Q6S A;  1QKU A;  2FVJ A;  2PIU A;  3A2J A;  3B1M A;  2ZBS A;  5DU5 A;  1RKG A;  4NUF A;  3AFR A;  3W5R A;  3VRT A;  1IE8 A;  1XP1 A;  4LSJ A;  1T76 A;  4OJB A;  3FLI A;  1XNN A;  5DVS A;  5DZ3 A;  4FGY A;  3FXV A;  1U3R A;  2H77 A;  3CS8 A;  4DM6 A;  5SYZ A;  3JZC A;  3K6P A;  3X1I A;  1H9U A;  1M2Z A;  3O1E A;  3FC6 B;  2G0H A;  4RMD A;  3P8X A;  1P8D A;  2FAI A;  2P54 A;  1T63 A;  2GPP A;  1R20 D;  1X7B A;  5JJM A;  4S0T A;  4OKT A;  4WHF A;  4XLD A;  2POG A;  2ZMI A;  3KPZ A;  3E7C A;  5G42 A;  3VSO A;  5DSH A;  1PQ9 A;  4MGA A;  3IXP A;  3OMK A;  4QE8 A;  3GBK A;  4R2U A;  5DL4 A;  3VTC A;  2P7A A;  2XHS A;  2JF9 A;  4POH A;  2PKL A;  4OAR A;  4IWF A;  3VJS A;  3B0W A;  1NUO A;  3L0L A;  3B0R A;  4MG7 A;  3W0J A;  4HEE X;  5DTV A;  4F9M A;  1E3G A;  1UHL A;  1OSH A;  1NRL A;  2ZMJ A;  3CTB A;  3HZF A;  5DWG A;  5KRM A;  3IA6 A;  5L11 A;  1L2J A;  1NAX A;  2HAM A;  1KNU A;  2HFP A;  3A3Z X;  3HC6 A;  1S9Q A;  3PCU A;  4S15 A;  4EM9 A;  5KRA A;  3KYT A;  4ZNS A;  3ZRA A;  5DXB B;  4YPQ A;  2QH6 A;  4NY9 A;  4OLM A;  4ZN7 A;  3CWD A;  4LTW A;  3B5R A;  5EJV A;  2HC4 A;  2JJ3 A;  2ZK5 A;  2Q60 A;  1XQC A;  5DZ0 A;  1DB1 A;  1RDT D;  1ZEO A;  2PIQ A;  3B67 A;  5DKE A;  5DXQ A;  4G1D A;  5GIC A;  2ZK6 A;  4FN9 A;  5HCV A;  4RUP A;  3RY9 A;  4DOS A;  5AAV B;  1G1U A;  2YLY A;  2AB2 A;  1I38 A;  3DT3 A;  3OMO A;  4LNW A;  4YNK A;  3IMY A;  1OVL B;  5HYR A;  2F4B A;  4O8F A;  4R06 A;  1U9E A;  1ZH7 A;  1XVP B;  5KRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...