3ZZJA

Structure of an engineered aspartate aminotransferase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
396
structure length
396
Chain Sequence
b'MFENITAAPADPILGLADLFRADERPGKINLGQGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAQQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIYANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Structure and Mechanism of a Cysteine Sulfinate Desulfinase Engineered on the Aspartate Aminotransferase Scaffold.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 139
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3zzjA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3zzjA01
4F5GA 4R5FA 4XJPA 4IYOB 5DB5A 1LW4A 4RKCA 4A72A 3GR9A 1C4KA 3GZCA 1E5EA 3QGUA 3BB8A 4TN4A 5IWQA 1C0NA 3E6GA 3K7YA 2HZPA 4AOAA 2YCTA 1X28A 1BJWA 3KE3A 3KGWA 1C9CA 3HDOA 2R5EA 1V2EA 1V72A 4N0BA 2R5CA 2QMAA 1B9IA 2FN6A 3B1DA 3ZZJA 3BN1A 4A0FA 5EFSA 2VGVA 1J04A 1AKBA 2C81A 1GDEA 4IYOA 4IXZA 4MQQA 4LW2A 3WCOA 3EI9A 1S06A 1BT4A 1SF2A 4KXKA 2VMRA 1AHYA 3PAAA 3W1JA 4P3MA 1X0MA 1DGEA 2W7EA 3GWPA 4N0WA 2X5FA 4IXSA 2BWOA 2JJHA 1B4XA 3WX9A 1EG5A 1IAYA 2AY5A 3F6TA 2YCPA 1YOOA 3HQTA 2VMOA 3N75A 1RVUA 3QBOA 5DJ1A 1VP4A 4TV7A 4JEXA 5G2PA 2W7JA 2Q7WA 2PO3A 2W8UA 3LV2A 2PB0A 1LC7A 4B9BA 2VGZA 3QM2A 2W7HA 3L44A 4K2MA 2C7TA 3Q8NA 4WLJA 2VGTA 3II0A 1S08A 1AICA 3OP7A 4EB7A 3HVYA 2CINA 1ASLA 2VI9A 3B1CA 1W7MA 2ZP7A 3EZSA 1FG7A 5EAAA 1G7WA 1B9HA 4WYEA 2YCNA 1LKCA 1WYUB 1C7OA 1LS3A 3AEJA 4UOYA 5FT8A 3WGBA 5HHYA 1BJNA 2R0TA 3FDDA 4RIZA 1N2TA 1OXPA 4BQ0A 4E77A 2EZ1A 1YIYA 2BI1A 4U2HA 3UWCA 4ZDOA 3E9KA 4F5MA 4FFCA 3BWOA 2VMTA 3FRKA 2OATA 5F9SA 1G4XA 1D7SA 3H14A 2ZY5A 3EI5A 3DR4A 3QPGA 2W7DA 3AEMC 1OATA 4IXOA 2BWNA 2D5YA 3CQ5A 4WYDA 3JW9A 5M4DA 3DU4A 1AJSB 1TOKA 2VIAA 1GEXA 3TFTA 4ZWVA 4W1VA 2QA3A 3FVUA 2VYCA 1AY4A 2XBNA 3N0LA 3GZDC 4E3RA 2AY3A 3EIBA 1X2AA 1CJ0A 5BJ3A 2OGAA 2ZJGA 4CBRA 2G6WA 4GE7A 2CFBA 1MGVA 2DKBA 1YJZA 2W7MA 1M32A 3BV0A 1PMMA 1C7GA 1FC4A 1GD9A 2NMPA 2QLRA 3RCHB 2CTZA 2VMUA 3PIUA 4JF1A 3MEBA 7AATA 1V2FA 3GSBA 3AELA 2WK8A 4WXBA 1D7UA 1MDZA 4LNLA 1ASCA 3JWBA 1AJSA 4WXFA 1UKJA 4GEBA 4ZASA 4ZLVA 1AY8A 2Z1YA 2DGLA 4ZSYA 3AEMA 3ASBA 3JZLA 3MBBA 4WBTA 4MQRA 1LC5A 2HOYA 4AO4A 3R9AA 3BC8A 2TPLA 3WLXA 4M2JA 2FYFA 4HVKA 1I48A 2X8UA 4AZKA 2BHXA 3GZDA 5DX5A 3RCHA 2ZC0A 3W1HA 2O0RA 4ZSWA 2CSTA 1DJUA 5EIGB 4W91A 2BIEA 3TQXA 5EUNA 4HF8A 4F5JA 2EZ2A 2BI3A 2AEVA 4AH3A 1QZ9A 3WZFA 3I16A 4R8DA 1ASMA 5BJ4A 5HDMA 3IHJA 4WLHA 2VMSA 4QGRA 4ATPA 1H0CA 2W7FA 1I41A 3A9ZA 5DJ9A 2RFVA 2YKVA 2JGTA 4LW4A 1BJ4A 3PJ0A 2AY9A 4JE5A 4UHNA 3OKSA 3NU8A 4I8AA 5M49A 2FQ6A 1W3UA 1DKAA 2JJEA 1YIZA 3B1EA 5G2QA 5EIGA 1BQDA 3LG0A 1T3IA 1YNUA 1WKHA 2FM1A 3PA9A 4LNMA 1GEYA 3F9TA 3GBXA 1B5OA 2YRRA 1G4VA 3AEPA 2HUIA 2VMPA 3NNKA 4WYAA 2DGKA 4Y0IA 1KKPA 3HL2A 1GCKA 3P6KA 1PG8A 4EFFA 4GRXA 1WSTA 2VLHA 3ECDA 3NUBA 5D5SA 4F5KA 1SZSA 2R5CB 4JE5D 1OHVA 3ACZA 3ATHA 1N31A 1SZKA 1AJRA 1TASA 4JEYA 4A0RA 4AZJA 1ASNA 2HP2A 3EIAA 4CBSA 2FNIA 4L0OA 3WGCA 3ELPA 2GMSA 2C44A 2W8TA 3DODA 1AMSA 2V0YA 3JU7A 1WYTB 2CH2A 5C6UA 4OYTA 4PFNA 1JS6A 1Z7DA 2ZY3A 4DBCA 1LK9A 1BW0A 3QN6A 3G7QA 3DYDA 3LY1A 2OKJA 1IBJA 1AY5A 1QISA 2BYJA 5E5IA 4JEWA 1LC8A 1IX7A 4MGRA 2D7ZA 3R4TA 1I29A 3FSLA 2OKKA 4XJMA 2VMQA 2Z20A 2F8JA 3RQ1A 3VAXA 4PFFA 1AMQA 4ADCA 1M0NA 3NU7A 2AY8A 4GSAA 4LNJA 1WYTA 3FFRA 2GQNA 3HBXA 1YJYA 1ZC9A 3BS8A 4MKJA 1KMKA 1DJ9A 3K40A 3I4JA 1MLZA 3DXVA 1TARA 4WYCA 1ECXA 1KL1A 1O4SA 1QJ3A 3W1IA 4F4EA 2DR1A 4OC9A 2OGEA 4M2KA 3WY7A 1UU0A 1S09A 1QITA 3NTJA 4W8IA 2JJGA 2Z61A 8AATA 1D2FA 4BA5A 4F5FA 1AAMA 3P1TA 4EMYA 3ZRPA 3VK3A 1EJIA 1ASFA 1AHFA 1RV4A 1RVYA 4DGTA 4OCAA 2YRIA 3BCBA 4MY5A 1OXOA 3A8UX 4U1TA 2JISA 2EPJA 3EI6A 1D7VA 3UAKA 3MAFA 4P7YA 4A6RA 1M0PA 1BKGA 1M4NA 2W8VA 2Z9XA 4OMAA 1J32A 2YHKA 4CXRA 2CJDA 1ARIA 3M5UA 4WXGA 2E7UA 5FT6A 3WCNA 2BWPA 1JG8A 4OBVA 3VP6A 2AY2A 4GE4A 4XQ2A 3EI7A 1IJIA 1LW5A 2W7GA 1MDXA 5EUEA 1UU2A 1M0OA 3DZZA 1ZOBA 4RLGA 3DC1A 3HT4A 1S0AA 2DKJA 2ZSMA 3B8XA 3TCMA 4XAUA 1SPAA 4J5UA 3ELEA 3D6KA 4ZDLA 1E5FA 3AV7A 4F5LA 2AEUA 4ISYA 5G4JA 2VMWA 3K28A 2D61A 3NX3A 2Z9VA 3MAUA 1M7YA 2HP1A 4BMKA 2D7YA 3NYUA 3CQ6A 2ZY4A 2BI5A 2JG2A 2VIBA 1JF9A 2CY8A 4JEZA 2Z67A 5EUDA 1WKGA 1U08A 2W8WA 1IUGA 1W7LA 1GC0A 2AATA 2D66A 3FQ7A 1WYVA 4IY7A 2PB2A 5TF5A 3HLMA 4ITXA 2BYLA 4RM1A 5M4BA 1TATA 1KKJA 1AHEA 2ZSLA 4WYFA 3PPLA 1AHGA 2C0RA 2CB1A 4R2NA 3AATA 3NYTA 3FZ6A 4ATQA 1M6SA 9AATA 1CZCA 4UQVA 1ASEA 5G4IA 3VK2A 4E1OA 3FTBA 4CVQA 1KL2A 5K8BA 1ASGA 5I92A 1ORDA 1CZEA 2BI9A 1IVRA 3FVXA 4JF0A 1Z3ZA 3CAIA 4IX8A 2X3LA 4JEVA 1AKCA 1VEFA 3G8MA 4OBUA 2VMVA 1QJ5A 3AOWA 2EGYA 3L8AA 4E3QA 2GMUA 2VMNA 4XJLA 1XI9A 2Z1ZA 2Z9WA 4ITGA 4PIWA 1CL2A 3PDXA 2QB3A 3BWNC 3GJUA 4WP0A 2CH1A 4BA4A 4WD2A 2E54A 2AY1A 1TPLA 4WYGA 1C7NA 3A2BA 4GE9A 3DRDA 3LVKA 1JS3A 1VJOA 1XEYA 2GSAA 2YKUA 3PGYA 2YKXA 4XEWA 1G7XA 5E4ZA 5AX8A 4ZWMA 2W7LA 3TATA 2X5DA 2W7KA 3BCAA 4ADDA 4PVFA 1OHWA 1D7RA 3FVSA 5M46A 4W1WA 1DTYA 3COGA 3RBLA 4XK1A 4IW7A 4ZM3A 3LVLB 1AIAA 4FL0A 3FFHA 3AEJC 4O6ZA 3QHXA 3MADA 3VK4A 2ZY2A 2VI8A 4Q31A 4ZM4A 4Q6RA 1ASAA 1ARTA 1CL1A 2HOXA 1SFFA 2HUUA 3PD6B 2HUFA 1ZODA 3A9XA 2ZUKA 4ZDPA 1ARGA 1S07A 1SVVA 1MLYA 1B5PA 2YOBA 4ZAHA 3KKIA 1ELQA 1X29A 3EUCA 2W7IA 2GB3A 3HMUA 1PMOA 4XJOA 3FCRA 1TOIA 2OQXA 3AOVA 3FQ8A 4R5ZA 1KMJA 3BWNA 4W5KA 4EU1A 1IX8A 2O1BA 3KGXA 4J8LA 2VMYA 1N8PA 4CXQA 2W8JA 5LH9A 3E2ZB 4RJ0A 1OHYA 2R2NA 3I5TA 4MQPA 3G0TA 3NYSA 2CANA 3MAFB 2BKWA 5G0AA 2AY7A 2D64A 5EQCA 4A0HA 3JWAA 4B98A 4RKDA 1ARSA 3FQAA 3NDNA 1GBNA 1AHXA 1AMRA 3AENB 2QB2A 1GC2A 3PD6A 4RITA 2CJHA 2E7JA 3A9YA 3ZRQA 3RBFA 1UU1A 1ELUA 1IAXA 4ADBA 4AO9A 4KYOA 5HXXA 3FZ8A 1O62A 1QIRA 4A0GA 2BI2A 1CQ7A 1TOEA 4Y0HA 1SZUA 2YKYA 3NRAA 2ZYJA 4H51A 1MDOA 2VGUA 2Z9UA 3E2ZA 3TFUA 3UE8A 3WKRA 1ARHA 1AMAA 1ASDA 1EQBA 2VMZA 3DXWA 3JTXA 5LHAA 3FZ7A 4UHMA 1CS1A 1FG3A 2VGWA 2FNUA 3N5MA 4A6TA 4KAMA 4Q75A 4UHOA 4F5HA 1RV3A 2O7CA 3LVJA 3AENA 1W7NA 5F8VA 3FDBA 3MKJA 1AX4A 1O61A 1BQAA 1WYUA 2D65A 2JJFA 4MSOA 4EB5A 3FD0A 3GETA 1P3WA 1TOGA 5FT5A 3MC6C 1WYVB 1BS0A 3LVMA 3EI8A 4TMRA 3VOMA 4NOGA 2E7IA 1QGNA 2ORDA 3T32A 4M2MA 3ZRRA 1B8GA 3E77A 1AIBA 1BJOB 3IF2A 4OT8A 1MAQA 1IX6A 1DFOA 2V1PA 3E2YA 2BIGA 1Y4IA 3E2FA 4RJYA 2HOZA 1W23A 4DQ6A 3ZZKA 2DGMA 5FT4A 1YAAA 2WKAA 4RAEA 1CQ8A 5JAYA 1ASBA 1V2DA 4MKKA 5G09A 4Y0DA 2QBTA 3BCXA 3FKDA 4F5IA 2VGSA 3ISLA 4Q76A 5E3KA 3NUIA 3ASAA 3F0HA 3PDBB 3QI6A 4WB0B 4ADEA 4BHDA 3LWSA 2XH1A 4W1XA 3DR7A 3RI6A 1M0QA 1DGDA 4GDYA 2VMXA 1GC4A 3RUYA 4OTLA 4A6UA 4LC3A 4K2IA 2EH6A 2D63A 3CBFA 1AAWA 1GC3A 4K2BA 1BJOA 1MAPA 2WK7A 2CJGA 2HORA 1I43A 1TOJA 3B46A 3WKSA 3EZ1A 3MC6A 1H1CA 1AKAA 2BIAA 4WB0A 2DOUA 1GEWA 1YJSA 5J8QA 1DJEA 2AY6A 1CQ6A 3H7FA 3USFA 2WK9A 4A00A 1O69A 5EAVA 2EO5A 5D95A 3PDBA 2VLFA 2AY4A 3AEOA 1PFFA 3CQ4A
chains in the Genus database with same CATH superfamily
4F5GA 4R5FA 4XJPA 4IYOB 5DB5A 1LW4A 4RKCA 4A72A 3GR9A 1C4KA 3GZCA 1E5EA 3QGUA 3BB8A 4TN4A 5IWQA 1C0NA 3E6GA 3K7YA 2HZPA 4AOAA 2YCTA 1X28A 1BJWA 3KE3A 3KGWA 1C9CA 3HDOA 2R5EA 1V2EA 1V72A 4N0BA 2R5CA 2QMAA 1B9IA 2FN6A 3B1DA 3ZZJA 3BN1A 4A0FA 2KFPA 5EFSA 2VGVA 1J04A 1AKBA 2C81A 1GDEA 4IYOA 4IXZA 4MQQA 4LW2A 3WCOA 3EI9A 1S06A 1BT4A 1SF2A 4KXKA 2VMRA 1AHYA 3PAAA 3W1JA 4P3MA 1X0MA 1DGEA 2W7EA 3GWPA 4N0WA 2X5FA 4IXSA 2BWOA 2JJHA 3N4RA 1B4XA 3WX9A 1EG5A 1IAYA 2AY5A 3F6TA 2YCPA 1YOOA 3HQTA 2VMOA 3N75A 1RVUA 3QBOA 5DJ1A 1VP4A 4TV7A 4JEXA 5G2PA 2W7JA 2Q7WA 2PO3A 2W8UA 3LV2A 2PB0A 1LC7A 4B9BA 2VGZA 3QM2A 2W7HA 3L44A 4K2MA 2C7TA 3Q8NA 4WLJA 2VGTA 3II0A 1S08A 1AICA 3OP7A 4EB7A 3HVYA 2CINA 1ASLA 2VI9A 3B1CA 1W7MA 2ZP7A 3EZSA 1FG7A 5EAAA 3N7NA 1G7WA 1B9HA 4WYEA 2YCNA 1LKCA 1WYUB 1C7OA 1LS3A 3AEJA 4UOYA 5FT8A 3WGBA 5HHYA 1BJNA 2R0TA 3FDDA 4RIZA 1N2TA 1OXPA 4BQ0A 4E77A 2EZ1A 5KTBA 1YIYA 2BI1A 4U2HA 3UWCA 4ZDOA 3E9KA 4F5MA 4FFCA 3BWOA 2VMTA 3FRKA 2OATA 5F9SA 2EYQA 1G4XA 1D7SA 3H14A 2ZY5A 3EI5A 2A1VA 3DR4A 3QPGA 2W7DA 3AEMC 1OATA 4IXOA 2BWNA 2D5YA 3CQ5A 4WYDA 3JW9A 5M4DA 3DU4A 1AJSB 1TOKA 2VIAA 1GEXA 3TFTA 4ZWVA 4W1VA 2QA3A 3FVUA 2VYCA 1AY4A 2XBNA 3N0LA 3GZDC 4E3RA 2AY3A 3EIBA 1X2AA 1CJ0A 5BJ3A 2OGAA 2ZJGA 4CBRA 2G6WA 4GE7A 2CFBA 2WB6A 1MGVA 2DKBA 1YJZA 2W7MA 1M32A 3BV0A 1PMMA 1C7GA 1FC4A 1GD9A 2NMPA 2QLRA 3RCHB 2CTZA 2VMUA 3PIUA 4JF1A 3MEBA 7AATA 1V2FA 3GSBA 3AELA 2WK8A 4WXBA 1D7UA 1MDZA 4LNLA 1ASCA 3JWBA 1AJSA 4WXFA 1UKJA 4GEBA 4ZASA 4ZLVA 1AY8A 2Z1YA 2DGLA 4ZSYA 3AEMA 3ASBA 3JZLA 3MBBA 4WBTA 4MQRA 1LC5A 2HOYA 4AO4A 3R9AA 3BC8A 2TPLA 4H63Q 3WLXA 4M2JA 2FYFA 4HVKA 1I48A 2X8UA 4AZKA 2BHXA 3GZDA 5DX5A 3RCHA 2ZC0A 3W1HA 2O0RA 4ZSWA 2CSTA 1DJUA 5EIGB 4W91A 2BIEA 3TQXA 5EUNA 4HF8A 4F5JA 2EZ2A 2BI3A 2AEVA 4AH3A 1QZ9A 3WZFA 3I16A 4R8DA 1ASMA 5BJ4A 5HDMA 3IHJA 4WLHA 2VMSA 4QGRA 4ATPA 1H0CA 2W7FA 1I41A 3A9ZA 5DJ9A 2RFVA 2YKVA 2JGTA 4LW4A 1BJ4A 3PJ0A 2AY9A 4JE5A 4UHNA 3OKSA 3NU8A 4I8AA 5M49A 2FQ6A 1W3UA 1DKAA 2JJEA 1YIZA 3B1EA 4K05A 5G2QA 5EIGA 1BQDA 3LG0A 1T3IA 1YNUA 1WKHA 2FM1A 3PA9A 4LNMA 1GEYA 3F9TA 3GBXA 1B5OA 2YRRA 1G4VA 3AEPA 2HUIA 2VMPA 3NNKA 4WYAA 2DGKA 4Y0IA 1KKPA 3HL2A 1GCKA 3P6KA 1PG8A 4EFFA 4GRXA 1WSTA 2VLHA 3ECDA 3NUBA 5D5SA 4F5KA 1SZSA 2R5CB 4JE5D 1OHVA 3ACZA 3ATHA 1N31A 1SZKA 1AJRA 1TASA 4JEYA 4A0RA 4AZJA 1ASNA 2HP2A 3EIAA 4CBSA 2FNIA 4L0OA 3WGCA 3ELPA 2GMSA 2C44A 2W8TA 3DODA 1AMSA 2V0YA 3JU7A 1WYTB 2CH2A 5C6UA 4OYTA 4PFNA 1JS6A 1Z7DA 2ZY3A 4DBCA 1LK9A 1BW0A 3QN6A 3G7QA 3DYDA 3LY1A 2OKJA 1IBJA 1AY5A 1QISA 2BYJA 3N4XA 5E5IA 4JEWA 1LC8A 1IX7A 4MGRA 2D7ZA 3R4TA 1I29A 3FSLA 2OKKA 4XJMA 2VMQA 2Z20A 2F8JA 3RQ1A 3VAXA 4PFFA 1AMQA 4ADCA 1M0NA 3NU7A 2AY8A 4GSAA 4LNJA 1WYTA 3FFRA 2GQNA 3HBXA 1YJYA 1ZC9A 3BS8A 4MKJA 1KAFA 1KMKA 1DJ9A 3K40A 3I4JA 1MLZA 3DXVA 1TARA 4WYCA 1ECXA 1KL1A 1O4SA 1QJ3A 3W1IA 4F4EA 2DR1A 4OC9A 2OGEA 4M2KA 3WY7A 1UU0A 1S09A 1QITA 3NTJA 4W8IA 2JJGA 2Z61A 8AATA 1D2FA 4BA5A 4F5FA 1AAMA 3P1TA 4EMYA 3ZRPA 3VK3A 1EJIA 1ASFA 1AHFA 1RV4A 1RVYA 4DGTA 4OCAA 2YRIA 3BCBA 4MY5A 1OXOA 3A8UX 4U1TA 2JISA 2EPJA 3EI6A 1D7VA 3UAKA 3MAFA 4P7YA 4A6RA 1M0PA 1BKGA 1M4NA 2W8VA 2Z9XA 4OMAA 1J32A 2YHKA 4CXRA 2CJDA 1ARIA 3M5UA 4WXGA 2E7UA 5FT6A 3WCNA 2BWPA 1JG8A 4OBVA 3VP6A 2AY2A 3H9XA 4GE4A 4XQ2A 3EI7A 1IJIA 1LW5A 2W7GA 1MDXA 5EUEA 1UU2A 1M0OA 3DZZA 1ZOBA 4RLGA 3DC1A 3HT4A 1S0AA 2DKJA 2ZSMA 3B8XA 3TCMA 4XAUA 1SPAA 4J5UA 3ELEA 3D6KA 4ZDLA 1E5FA 3AV7A 4F5LA 2AEUA 4ISYA 5G4JA 2VMWA 3K28A 2D61A 3NX3A 2Z9VA 3MAUA 1M7YA 2HP1A 4BMKA 2D7YA 3NYUA 3CQ6A 2ZY4A 2BI5A 2JG2A 2VIBA 1JF9A 2CY8A 4JEZA 2Z67A 5EUDA 1WKGA 1U08A 2W8WA 1IUGA 1W7LA 1GC0A 2AATA 2D66A 3FQ7A 1WYVA 4IY7A 2PB2A 5TF5A 3HLMA 4ITXA 2BYLA 4RM1A 5M4BA 1TATA 1KKJA 1AHEA 2ZSLA 4WYFA 3PPLA 1AHGA 2C0RA 2CB1A 4R2NA 3AATA 3NYTA 3FZ6A 4ATQA 1M6SA 9AATA 1CZCA 4UQVA 1ASEA 5G4IA 3VK2A 4E1OA 3FTBA 4CVQA 1KL2A 5K8BA 1ASGA 5I92A 3N4SA 1ORDA 1CZEA 2BI9A 1IVRA 3FVXA 4JF0A 1Z3ZA 3CAIA 4IX8A 2X3LA 2QSRA 4JEVA 1AKCA 1VEFA 3G8MA 4OBUA 2VMVA 1QJ5A 3AOWA 2EGYA 3L8AA 4E3QA 2GMUA 2VMNA 4XJLA 1XI9A 2Z1ZA 2Z9WA 4ITGA 4PIWA 1CL2A 3PDXA 2QB3A 3BWNC 3GJUA 4WP0A 2CH1A 4BA4A 4WD2A 2E54A 2AY1A 1TPLA 4WYGA 1C7NA 3A2BA 4GE9A 3DRDA 3LVKA 1JS3A 1VJOA 1XEYA 2GSAA 2YKUA 3PGYA 2YKXA 4XEWA 1G7XA 5E4ZA 5AX8A 4ZWMA 2W7LA 3TATA 2X5DA 2W7KA 3BCAA 4ADDA 4PVFA 1OHWA 1D7RA 3FVSA 5M46A 4W1WA 1DTYA 3COGA 3RBLA 4XK1A 4IW7A 4ZM3A 3LVLB 1AIAA 4FL0A 3FFHA 3AEJC 4O6ZA 3QHXA 3MADA 3VK4A 2ZY2A 2VI8A 4Q31A 4ZM4A 4Q6RA 1ASAA 1ARTA 1CL1A 2HOXA 1SFFA 2HUUA 3PD6B 2HUFA 1ZODA 3A9XA 2ZUKA 4ZDPA 1ARGA 1S07A 1SVVA 1MLYA 1B5PA 2YOBA 4ZAHA 3KKIA 1ELQA 1X29A 3EUCA 2W7IA 2GB3A 3HMUA 1PMOA 4XJOA 3FCRA 1TOIA 2OQXA 3AOVA 3FQ8A 4R5ZA 1KMJA 3BWNA 4W5KA 4EU1A 1IX8A 2O1BA 3KGXA 4J8LA 2VMYA 1N8PA 4CXQA 2W8JA 5LH9A 3E2ZB 4RJ0A 1OHYA 2R2NA 3I5TA 4MQPA 3G0TA 3NYSA 2CANA 3MAFB 2BKWA 5G0AA 2AY7A 2D64A 5EQCA 4A0HA 3JWAA 4B98A 4RKDA 1ARSA 3FQAA 3NDNA 1GBNA 1AHXA 1AMRA 3AENB 2QB2A 1GC2A 3PD6A 4RITA 2CJHA 2E7JA 3A9YA 3ZRQA 3RBFA 1UU1A 1ELUA 1IAXA 4ADBA 4AO9A 4KYOA 5HXXA 3FZ8A 1O62A 1QIRA 4A0GA 2BI2A 1CQ7A 1TOEA 4Y0HA 1SZUA 2YKYA 3NRAA 2ZYJA 4H51A 1MDOA 2VGUA 2Z9UA 3E2ZA 3TFUA 3UE8A 3WKRA 1ARHA 1AMAA 1ASDA 1EQBA 2VMZA 3DXWA 3JTXA 5LHAA 3FZ7A 4UHMA 1CS1A 1FG3A 2VGWA 2FNUA 3N5MA 4A6TA 4KAMA 4Q75A 4UHOA 4F5HA 1RV3A 2O7CA 3LVJA 3AENA 1W7NA 5F8VA 3FDBA 3MKJA 1AX4A 1O61A 1BQAA 1WYUA 2D65A 2JJFA 4MSOA 4EB5A 3FD0A 3GETA 1P3WA 1TOGA 5FT5A 3MC6C 1WYVB 1BS0A 3LVMA 3EI8A 4TMRA 3VOMA 4NOGA 2E7IA 1QGNA 2ORDA 3T32A 4M2MA 3ZRRA 1B8GA 3E77A 1AIBA 1BJOB 3IF2A 4OT8A 1MAQA 1IX6A 1DFOA 2V1PA 3E2YA 2BIGA 1Y4IA 3E2FA 4RJYA 2HOZA 1W23A 4DQ6A 3ZZKA 2DGMA 5FT4A 1YAAA 2WKAA 4RAEA 1CQ8A 5JAYA 1ASBA 1V2DA 4MKKA 5G09A 4Y0DA 2QBTA 3BCXA 3FKDA 4F5IA 2VGSA 3ISLA 4Q76A 5E3KA 3NUIA 3ASAA 3F0HA 3PDBB 3QI6A 4WB0B 4ADEA 2FKIA 4BHDA 3LWSA 2XH1A 4W1XA 3DR7A 3RI6A 1M0QA 1DGDA 4GDYA 2VMXA 1GC4A 3RUYA 4OTLA 4A6UA 2G7JA 4LC3A 4K2IA 2EH6A 2D63A 3CBFA 1AAWA 1GC3A 4K2BA 1BJOA 1MAPA 2WK7A 2CJGA 2HORA 1I43A 1TOJA 3B46A 3WKSA 3EZ1A 3MC6A 1H1CA 1AKAA 2BIAA 4WB0A 2DOUA 1GEWA 1YJSA 5J8QA 1DJEA 2AY6A 1CQ6A 3H7FA 3USFA 2WK9A 4A00A 1O69A 5EAVA 2EO5A 5D95A 3PDBA 2VLFA 2AY4A 3AEOA 1PFFA 3CQ4A
chains in the Genus database with same CATH topology
4F5GA 4R5FA 4XJPA 4IYOB 5DB5A 1LW4A 4RKCA 4A72A 3GR9A 1C4KA 3GZCA 1E5EA 3QGUA 3BB8A 4TN4A 5IWQA 1C0NA 3E6GA 3K7YA 2HZPA 4AOAA 2YCTA 1X28A 1BJWA 3KE3A 3KGWA 1C9CA 3HDOA 2R5EA 1V2EA 1V72A 4N0BA 2R5CA 2QMAA 1B9IA 2FN6A 3B1DA 3ZZJA 3BN1A 4A0FA 2KFPA 5EFSA 2VGVA 1J04A 1AKBA 2C81A 1GDEA 4IYOA 4IXZA 4MQQA 4LW2A 3WCOA 3EI9A 1S06A 1BT4A 1SF2A 4KXKA 2VMRA 1AHYA 3PAAA 3W1JA 4P3MA 1X0MA 1DGEA 2W7EA 3GWPA 4N0WA 2X5FA 4IXSA 2BWOA 2JJHA 3N4RA 1B4XA 3WX9A 1EG5A 1IAYA 2AY5A 3F6TA 2YCPA 1YOOA 3HQTA 2VMOA 3N75A 1RVUA 3QBOA 5DJ1A 1VP4A 4TV7A 4JEXA 5G2PA 2W7JA 2Q7WA 2PO3A 2W8UA 3LV2A 2PB0A 1LC7A 4B9BA 2VGZA 3QM2A 2W7HA 3L44A 4K2MA 2C7TA 3Q8NA 4WLJA 2VGTA 3II0A 1S08A 1AICA 3OP7A 4EB7A 3HVYA 2CINA 1ASLA 2VI9A 3B1CA 1W7MA 2ZP7A 3EZSA 1FG7A 5EAAA 3N7NA 1G7WA 1B9HA 4WYEA 2YCNA 1LKCA 1WYUB 1C7OA 1LS3A 3AEJA 4UOYA 5FT8A 3WGBA 5HHYA 1BJNA 2R0TA 3FDDA 4RIZA 1N2TA 1OXPA 4BQ0A 4E77A 2EZ1A 5KTBA 1YIYA 2BI1A 4U2HA 3UWCA 4ZDOA 3E9KA 4F5MA 4FFCA 3BWOA 2VMTA 3FRKA 2OATA 5F9SA 2EYQA 1G4XA 1D7SA 3H14A 2ZY5A 3EI5A 2A1VA 3DR4A 3QPGA 2W7DA 3AEMC 1OATA 4IXOA 2BWNA 2D5YA 3CQ5A 4WYDA 3JW9A 5M4DA 3DU4A 1AJSB 1TOKA 2VIAA 1GEXA 3TFTA 4ZWVA 4W1VA 2QA3A 3FVUA 2VYCA 1AY4A 2XBNA 3N0LA 3GZDC 4E3RA 2AY3A 3EIBA 1X2AA 1CJ0A 5BJ3A 2OGAA 2ZJGA 4CBRA 2G6WA 4GE7A 2CFBA 2WB6A 1MGVA 2DKBA 1YJZA 2W7MA 1M32A 3BV0A 1PMMA 1C7GA 1FC4A 1GD9A 2NMPA 2QLRA 3RCHB 2CTZA 2VMUA 3PIUA 4JF1A 3MEBA 7AATA 1V2FA 3GSBA 3AELA 2WK8A 4WXBA 1D7UA 1MDZA 4LNLA 1ASCA 3JWBA 1AJSA 4WXFA 1UKJA 4GEBA 4ZASA 4ZLVA 1AY8A 2Z1YA 2DGLA 4ZSYA 3AEMA 3ASBA 3JZLA 3MBBA 4WBTA 4MQRA 1LC5A 2HOYA 4AO4A 3R9AA 3BC8A 2TPLA 4H63Q 3WLXA 4M2JA 2FYFA 4HVKA 1I48A 2X8UA 4AZKA 2BHXA 3GZDA 5DX5A 3RCHA 2ZC0A 3W1HA 2O0RA 4ZSWA 2CSTA 1DJUA 5EIGB 4W91A 2BIEA 3TQXA 5EUNA 4HF8A 4F5JA 2EZ2A 2BI3A 2AEVA 4AH3A 1QZ9A 3WZFA 3I16A 4R8DA 1ASMA 5BJ4A 5HDMA 3IHJA 4WLHA 2VMSA 4QGRA 4ATPA 1H0CA 2W7FA 1I41A 3A9ZA 5DJ9A 2RFVA 2YKVA 2JGTA 4LW4A 1BJ4A 3PJ0A 2AY9A 4JE5A 4UHNA 3OKSA 3NU8A 4I8AA 5M49A 2FQ6A 1W3UA 1DKAA 2JJEA 1YIZA 3B1EA 4K05A 5G2QA 5EIGA 1BQDA 3LG0A 1T3IA 1YNUA 1WKHA 2FM1A 3PA9A 4LNMA 1GEYA 3F9TA 3GBXA 1B5OA 2YRRA 1G4VA 3AEPA 2HUIA 2VMPA 3NNKA 4WYAA 2DGKA 4Y0IA 1KKPA 3HL2A 1GCKA 3P6KA 1PG8A 4EFFA 4GRXA 1WSTA 2VLHA 3ECDA 3NUBA 5D5SA 4F5KA 1SZSA 2R5CB 4JE5D 1OHVA 3ACZA 3ATHA 1N31A 1SZKA 1AJRA 1TASA 4JEYA 4A0RA 4AZJA 1ASNA 2HP2A 3EIAA 4CBSA 2FNIA 4L0OA 3WGCA 3ELPA 2GMSA 2C44A 2W8TA 3DODA 1AMSA 2V0YA 3JU7A 1WYTB 2CH2A 5C6UA 4OYTA 4PFNA 1JS6A 1Z7DA 2ZY3A 4DBCA 1LK9A 1BW0A 3QN6A 3G7QA 3DYDA 3LY1A 2OKJA 1IBJA 1AY5A 1QISA 2BYJA 3N4XA 5E5IA 4JEWA 1LC8A 1IX7A 4MGRA 2D7ZA 3R4TA 1I29A 3FSLA 2OKKA 4XJMA 2VMQA 2Z20A 2F8JA 3RQ1A 3VAXA 4PFFA 1AMQA 4ADCA 1M0NA 3NU7A 2AY8A 4GSAA 4LNJA 1WYTA 3FFRA 2GQNA 3HBXA 1YJYA 1ZC9A 3BS8A 4MKJA 1KMKA 1DJ9A 3K40A 3I4JA 1MLZA 3DXVA 1TARA 4WYCA 1ECXA 1KL1A 1O4SA 1QJ3A 3W1IA 4F4EA 2DR1A 4OC9A 2OGEA 4M2KA 3WY7A 1UU0A 1S09A 1QITA 3NTJA 4W8IA 2JJGA 2Z61A 8AATA 1D2FA 4BA5A 4F5FA 1AAMA 3P1TA 4EMYA 3ZRPA 3VK3A 1EJIA 1ASFA 1AHFA 1RV4A 1RVYA 4DGTA 4OCAA 2YRIA 3BCBA 4MY5A 1OXOA 3A8UX 4U1TA 2JISA 2EPJA 3EI6A 1D7VA 3UAKA 3MAFA 4P7YA 4A6RA 1M0PA 1BKGA 1M4NA 2W8VA 2Z9XA 4OMAA 1J32A 2YHKA 4CXRA 2CJDA 1ARIA 3M5UA 4WXGA 2E7UA 5FT6A 3WCNA 2BWPA 1JG8A 4OBVA 3VP6A 2AY2A 3H9XA 4GE4A 4XQ2A 3EI7A 1IJIA 1LW5A 2W7GA 1MDXA 5EUEA 1UU2A 1M0OA 3DZZA 1ZOBA 4RLGA 3DC1A 3HT4A 1S0AA 2DKJA 2ZSMA 3B8XA 3TCMA 4XAUA 1SPAA 4J5UA 3ELEA 3D6KA 4ZDLA 1E5FA 3AV7A 4F5LA 2AEUA 4ISYA 5G4JA 2VMWA 3K28A 2D61A 3NX3A 2Z9VA 3MAUA 1M7YA 2HP1A 4BMKA 2D7YA 3NYUA 3CQ6A 2ZY4A 2BI5A 2JG2A 2VIBA 1JF9A 2CY8A 4JEZA 2Z67A 5EUDA 1WKGA 1U08A 2W8WA 1IUGA 1W7LA 1GC0A 2AATA 2D66A 3FQ7A 1WYVA 4IY7A 2PB2A 5TF5A 3HLMA 4ITXA 2BYLA 4RM1A 5M4BA 1TATA 1KKJA 1AHEA 2ZSLA 4WYFA 3PPLA 1AHGA 2C0RA 2CB1A 4R2NA 3AATA 3NYTA 3FZ6A 4ATQA 1M6SA 9AATA 1CZCA 4UQVA 1ASEA 5G4IA 3VK2A 4E1OA 3FTBA 4CVQA 1KL2A 5K8BA 1ASGA 5I92A 3N4SA 1ORDA 1CZEA 2BI9A 1IVRA 3FVXA 4JF0A 1Z3ZA 3CAIA 4IX8A 2X3LA 2QSRA 4JEVA 1AKCA 1VEFA 3G8MA 4OBUA 2VMVA 1QJ5A 3AOWA 2EGYA 3L8AA 4E3QA 2GMUA 2VMNA 4XJLA 1XI9A 2Z1ZA 2Z9WA 4ITGA 4PIWA 1CL2A 3PDXA 2QB3A 3BWNC 3GJUA 4WP0A 2CH1A 4BA4A 4WD2A 2E54A 2AY1A 1TPLA 4WYGA 1C7NA 3A2BA 4GE9A 3DRDA 3LVKA 1JS3A 1VJOA 1XEYA 2GSAA 2YKUA 3PGYA 2YKXA 4XEWA 1G7XA 5E4ZA 5AX8A 4ZWMA 2W7LA 3TATA 2X5DA 2W7KA 3BCAA 4ADDA 4PVFA 1OHWA 1D7RA 3FVSA 5M46A 4W1WA 1DTYA 3COGA 3RBLA 4XK1A 4IW7A 4ZM3A 3LVLB 1AIAA 4FL0A 3FFHA 3AEJC 4O6ZA 3QHXA 3MADA 3VK4A 2ZY2A 2VI8A 4Q31A 4ZM4A 4Q6RA 1ASAA 1ARTA 1CL1A 2HOXA 1SFFA 2HUUA 3PD6B 2HUFA 1ZODA 3A9XA 2ZUKA 4ZDPA 1ARGA 1S07A 1SVVA 1MLYA 1B5PA 2YOBA 4ZAHA 3KKIA 1ELQA 1X29A 3EUCA 2W7IA 2GB3A 3HMUA 1PMOA 4XJOA 3FCRA 1TOIA 2OQXA 3AOVA 3FQ8A 4R5ZA 1KMJA 3BWNA 4W5KA 4EU1A 1IX8A 2O1BA 3KGXA 4J8LA 2VMYA 1N8PA 4CXQA 2W8JA 5LH9A 3E2ZB 4RJ0A 1OHYA 2R2NA 3I5TA 4MQPA 3G0TA 3NYSA 2CANA 3MAFB 2BKWA 5G0AA 2AY7A 2D64A 5EQCA 4A0HA 3JWAA 4B98A 4RKDA 1ARSA 3FQAA 3NDNA 1GBNA 1AHXA 1AMRA 3AENB 2QB2A 1GC2A 3PD6A 4RITA 2CJHA 2E7JA 3A9YA 3ZRQA 3RBFA 1UU1A 1ELUA 1IAXA 4ADBA 4AO9A 4KYOA 5HXXA 3FZ8A 1O62A 1QIRA 4A0GA 2BI2A 1CQ7A 1TOEA 4Y0HA 1SZUA 2YKYA 3NRAA 2ZYJA 4H51A 1MDOA 2VGUA 2Z9UA 3E2ZA 3TFUA 3UE8A 3WKRA 1ARHA 1AMAA 1ASDA 1EQBA 2VMZA 3DXWA 3JTXA 5LHAA 3FZ7A 4UHMA 1CS1A 1FG3A 2VGWA 2FNUA 3N5MA 4A6TA 4KAMA 4Q75A 4UHOA 4F5HA 1RV3A 2O7CA 3LVJA 3AENA 1W7NA 5F8VA 3FDBA 3MKJA 1AX4A 1O61A 1BQAA 1WYUA 2D65A 2JJFA 4MSOA 4EB5A 3FD0A 3GETA 1P3WA 1TOGA 5FT5A 3MC6C 1WYVB 1BS0A 3LVMA 3EI8A 4TMRA 3VOMA 4NOGA 2E7IA 1QGNA 2ORDA 3T32A 4M2MA 3ZRRA 1B8GA 3E77A 1AIBA 1BJOB 3IF2A 4OT8A 1MAQA 1IX6A 1DFOA 2V1PA 3E2YA 2BIGA 1Y4IA 3E2FA 4RJYA 2HOZA 1W23A 4DQ6A 3ZZKA 2DGMA 5FT4A 1YAAA 2WKAA 4RAEA 1CQ8A 5JAYA 1ASBA 1V2DA 4MKKA 5G09A 4Y0DA 2QBTA 3BCXA 3FKDA 4F5IA 2VGSA 3ISLA 4Q76A 5E3KA 3NUIA 3ASAA 3F0HA 3PDBB 3QI6A 4WB0B 4ADEA 2FKIA 4BHDA 3LWSA 2XH1A 4W1XA 3DR7A 3RI6A 1M0QA 1DGDA 4GDYA 2VMXA 1GC4A 3RUYA 4OTLA 4A6UA 2G7JA 4LC3A 4K2IA 2EH6A 2D63A 3CBFA 1AAWA 1GC3A 4K2BA 1BJOA 1MAPA 2WK7A 2CJGA 2HORA 1I43A 1TOJA 3B46A 3WKSA 3EZ1A 3MC6A 1H1CA 1AKAA 2BIAA 4WB0A 2DOUA 1GEWA 1YJSA 5J8QA 1DJEA 2AY6A 1CQ6A 3H7FA 3USFA 2WK9A 4A00A 1O69A 5EAVA 2EO5A 5D95A 3PDBA 2VLFA 2AY4A 3AEOA 1PFFA 3CQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F5G A;  4R5F A;  4XJP A;  4IYO B;  5DB5 A;  1LW4 A;  4RKC A;  4A72 A;  3GR9 A;  1C4K A;  3GZC A;  1E5E A;  3QGU A;  3BB8 A;  4TN4 A;  5IWQ A;  1C0N A;  3E6G A;  3K7Y A;  2HZP A;  4AOA A;  2YCT A;  1X28 A;  1BJW A;  3KE3 A;  3KGW A;  1C9C A;  3HDO A;  2R5E A;  1V2E A;  1V72 A;  4N0B A;  2R5C A;  2QMA A;  1B9I A;  2FN6 A;  3B1D A;  3ZZJ A;  3BN1 A;  4A0F A;  5EFS A;  2VGV A;  1J04 A;  1AKB A;  2C81 A;  1GDE A;  4IYO A;  4IXZ A;  4MQQ A;  4LW2 A;  3WCO A;  3EI9 A;  1S06 A;  1BT4 A;  1SF2 A;  4KXK A;  2VMR A;  1AHY A;  3PAA A;  3W1J A;  4P3M A;  1X0M A;  1DGE A;  2W7E A;  3GWP A;  4N0W A;  2X5F A;  4IXS A;  2BWO A;  2JJH A;  1B4X A;  3WX9 A;  1EG5 A;  1IAY A;  2AY5 A;  3F6T A;  2YCP A;  1YOO A;  3HQT A;  2VMO A;  3N75 A;  1RVU A;  3QBO A;  5DJ1 A;  1VP4 A;  4TV7 A;  4JEX A;  5G2P A;  2W7J A;  2Q7W A;  2PO3 A;  2W8U A;  3LV2 A;  2PB0 A;  1LC7 A;  4B9B A;  2VGZ A;  3QM2 A;  2W7H A;  3L44 A;  4K2M A;  2C7T A;  3Q8N A;  4WLJ A;  2VGT A;  3II0 A;  1S08 A;  1AIC A;  3OP7 A;  4EB7 A;  3HVY A;  2CIN A;  1ASL A;  2VI9 A;  3B1C A;  1W7M A;  2ZP7 A;  3EZS A;  1FG7 A;  5EAA A;  1G7W A;  1B9H A;  4WYE A;  2YCN A;  1LKC A;  1WYU B;  1C7O A;  1LS3 A;  3AEJ A;  4UOY A;  5FT8 A;  3WGB A;  5HHY A;  1BJN A;  2R0T A;  3FDD A;  4RIZ A;  1N2T A;  1OXP A;  4BQ0 A;  4E77 A;  2EZ1 A;  1YIY A;  2BI1 A;  4U2H A;  3UWC A;  4ZDO A;  3E9K A;  4F5M A;  4FFC A;  3BWO A;  2VMT A;  3FRK A;  2OAT A;  5F9S A;  1G4X A;  1D7S A;  3H14 A;  2ZY5 A;  3EI5 A;  3DR4 A;  3QPG A;  2W7D A;  3AEM C;  1OAT A;  4IXO A;  2BWN A;  2D5Y A;  3CQ5 A;  4WYD A;  3JW9 A;  5M4D A;  3DU4 A;  1AJS B;  1TOK A;  2VIA A;  1GEX A;  3TFT A;  4ZWV A;  4W1V A;  2QA3 A;  3FVU A;  2VYC A;  1AY4 A;  2XBN A;  3N0L A;  3GZD C;  4E3R A;  2AY3 A;  3EIB A;  1X2A A;  1CJ0 A;  5BJ3 A;  2OGA A;  2ZJG A;  4CBR A;  2G6W A;  4GE7 A;  2CFB A;  1MGV A;  2DKB A;  1YJZ A;  2W7M A;  1M32 A;  3BV0 A;  1PMM A;  1C7G A;  1FC4 A;  1GD9 A;  2NMP A;  2QLR A;  3RCH B;  2CTZ A;  2VMU A;  3PIU A;  4JF1 A;  3MEB A;  7AAT A;  1V2F A;  3GSB A;  3AEL A;  2WK8 A;  4WXB A;  1D7U A;  1MDZ A;  4LNL A;  1ASC A;  3JWB A;  1AJS A;  4WXF A;  1UKJ A;  4GEB A;  4ZAS A;  4ZLV A;  1AY8 A;  2Z1Y A;  2DGL A;  4ZSY A;  3AEM A;  3ASB A;  3JZL A;  3MBB A;  4WBT A;  4MQR A;  1LC5 A;  2HOY A;  4AO4 A;  3R9A A;  3BC8 A;  2TPL A;  3WLX A;  4M2J A;  2FYF A;  4HVK A;  1I48 A;  2X8U A;  4AZK A;  2BHX A;  3GZD A;  5DX5 A;  3RCH A;  2ZC0 A;  3W1H A;  2O0R A;  4ZSW A;  2CST A;  1DJU A;  5EIG B;  4W91 A;  2BIE A;  3TQX A;  5EUN A;  4HF8 A;  4F5J A;  2EZ2 A;  2BI3 A;  2AEV A;  4AH3 A;  1QZ9 A;  3WZF A;  3I16 A;  4R8D A;  1ASM A;  5BJ4 A;  5HDM A;  3IHJ A;  4WLH A;  2VMS A;  4QGR A;  4ATP A;  1H0C A;  2W7F A;  1I41 A;  3A9Z A;  5DJ9 A;  2RFV A;  2YKV A;  2JGT A;  4LW4 A;  1BJ4 A;  3PJ0 A;  2AY9 A;  4JE5 A;  4UHN A;  3OKS A;  3NU8 A;  4I8A A;  5M49 A;  2FQ6 A;  1W3U A;  1DKA A;  2JJE A;  1YIZ A;  3B1E A;  5G2Q A;  5EIG A;  1BQD A;  3LG0 A;  1T3I A;  1YNU A;  1WKH A;  2FM1 A;  3PA9 A;  4LNM A;  1GEY A;  3F9T A;  3GBX A;  1B5O A;  2YRR A;  1G4V A;  3AEP A;  2HUI A;  2VMP A;  3NNK A;  4WYA A;  2DGK A;  4Y0I A;  1KKP A;  3HL2 A;  1GCK A;  3P6K A;  1PG8 A;  4EFF A;  4GRX A;  1WST A;  2VLH A;  3ECD A;  3NUB A;  5D5S A;  4F5K A;  1SZS A;  2R5C B;  4JE5 D;  1OHV A;  3ACZ A;  3ATH A;  1N31 A;  1SZK A;  1AJR A;  1TAS A;  4JEY A;  4A0R A;  4AZJ A;  1ASN A;  2HP2 A;  3EIA A;  4CBS A;  2FNI A;  4L0O A;  3WGC A;  3ELP A;  2GMS A;  2C44 A;  2W8T A;  3DOD A;  1AMS A;  2V0Y A;  3JU7 A;  1WYT B;  2CH2 A;  5C6U A;  4OYT A;  4PFN A;  1JS6 A;  1Z7D A;  2ZY3 A;  4DBC A;  1LK9 A;  1BW0 A;  3QN6 A;  3G7Q A;  3DYD A;  3LY1 A;  2OKJ A;  1IBJ A;  1AY5 A;  1QIS A;  2BYJ A;  5E5I A;  4JEW A;  1LC8 A;  1IX7 A;  4MGR A;  2D7Z A;  3R4T A;  1I29 A;  3FSL A;  2OKK A;  4XJM A;  2VMQ A;  2Z20 A;  2F8J A;  3RQ1 A;  3VAX A;  4PFF A;  1AMQ A;  4ADC A;  1M0N A;  3NU7 A;  2AY8 A;  4GSA A;  4LNJ A;  1WYT A;  3FFR A;  2GQN A;  3HBX A;  1YJY A;  1ZC9 A;  3BS8 A;  4MKJ A;  1KMK A;  1DJ9 A;  3K40 A;  3I4J A;  1MLZ A;  3DXV A;  1TAR A;  4WYC A;  1ECX A;  1KL1 A;  1O4S A;  1QJ3 A;  3W1I A;  4F4E A;  2DR1 A;  4OC9 A;  2OGE A;  4M2K A;  3WY7 A;  1UU0 A;  1S09 A;  1QIT A;  3NTJ A;  4W8I A;  2JJG A;  2Z61 A;  8AAT A;  1D2F A;  4BA5 A;  4F5F A;  1AAM A;  3P1T A;  4EMY A;  3ZRP A;  3VK3 A;  1EJI A;  1ASF A;  1AHF A;  1RV4 A;  1RVY A;  4DGT A;  4OCA A;  2YRI A;  3BCB A;  4MY5 A;  1OXO A;  3A8U X;  4U1T A;  2JIS A;  2EPJ A;  3EI6 A;  1D7V A;  3UAK A;  3MAF A;  4P7Y A;  4A6R A;  1M0P A;  1BKG A;  1M4N A;  2W8V A;  2Z9X A;  4OMA A;  1J32 A;  2YHK A;  4CXR A;  2CJD A;  1ARI A;  3M5U A;  4WXG A;  2E7U A;  5FT6 A;  3WCN A;  2BWP A;  1JG8 A;  4OBV A;  3VP6 A;  2AY2 A;  4GE4 A;  4XQ2 A;  3EI7 A;  1IJI A;  1LW5 A;  2W7G A;  1MDX A;  5EUE A;  1UU2 A;  1M0O A;  3DZZ A;  1ZOB A;  4RLG A;  3DC1 A;  3HT4 A;  1S0A A;  2DKJ A;  2ZSM A;  3B8X A;  3TCM A;  4XAU A;  1SPA A;  4J5U A;  3ELE A;  3D6K A;  4ZDL A;  1E5F A;  3AV7 A;  4F5L A;  2AEU A;  4ISY A;  5G4J A;  2VMW A;  3K28 A;  2D61 A;  3NX3 A;  2Z9V A;  3MAU A;  1M7Y A;  2HP1 A;  4BMK A;  2D7Y A;  3NYU A;  3CQ6 A;  2ZY4 A;  2BI5 A;  2JG2 A;  2VIB A;  1JF9 A;  2CY8 A;  4JEZ A;  2Z67 A;  5EUD A;  1WKG A;  1U08 A;  2W8W A;  1IUG A;  1W7L A;  1GC0 A;  2AAT A;  2D66 A;  3FQ7 A;  1WYV A;  4IY7 A;  2PB2 A;  5TF5 A;  3HLM A;  4ITX A;  2BYL A;  4RM1 A;  5M4B A;  1TAT A;  1KKJ A;  1AHE A;  2ZSL A;  4WYF A;  3PPL A;  1AHG A;  2C0R A;  2CB1 A;  4R2N A;  3AAT A;  3NYT A;  3FZ6 A;  4ATQ A;  1M6S A;  9AAT A;  1CZC A;  4UQV A;  1ASE A;  5G4I A;  3VK2 A;  4E1O A;  3FTB A;  4CVQ A;  1KL2 A;  5K8B A;  1ASG A;  5I92 A;  1ORD A;  1CZE A;  2BI9 A;  1IVR A;  3FVX A;  4JF0 A;  1Z3Z A;  3CAI A;  4IX8 A;  2X3L A;  4JEV A;  1AKC A;  1VEF A;  3G8M A;  4OBU A;  2VMV A;  1QJ5 A;  3AOW A;  2EGY A;  3L8A A;  4E3Q A;  2GMU A;  2VMN A;  4XJL A;  1XI9 A;  2Z1Z A;  2Z9W A;  4ITG A;  4PIW A;  1CL2 A;  3PDX A;  2QB3 A;  3BWN C;  3GJU A;  4WP0 A;  2CH1 A;  4BA4 A;  4WD2 A;  2E54 A;  2AY1 A;  1TPL A;  4WYG A;  1C7N A;  3A2B A;  4GE9 A;  3DRD A;  3LVK A;  1JS3 A;  1VJO A;  1XEY A;  2GSA A;  2YKU A;  3PGY A;  2YKX A;  4XEW A;  1G7X A;  5E4Z A;  5AX8 A;  4ZWM A;  2W7L A;  3TAT A;  2X5D A;  2W7K A;  3BCA A;  4ADD A;  4PVF A;  1OHW A;  1D7R A;  3FVS A;  5M46 A;  4W1W A;  1DTY A;  3COG A;  3RBL A;  4XK1 A;  4IW7 A;  4ZM3 A;  3LVL B;  1AIA A;  4FL0 A;  3FFH A;  3AEJ C;  4O6Z A;  3QHX A;  3MAD A;  3VK4 A;  2ZY2 A;  2VI8 A;  4Q31 A;  4ZM4 A;  4Q6R A;  1ASA A;  1ART A;  1CL1 A;  2HOX A;  1SFF A;  2HUU A;  3PD6 B;  2HUF A;  1ZOD A;  3A9X A;  2ZUK A;  4ZDP A;  1ARG A;  1S07 A;  1SVV A;  1MLY A;  1B5P A;  2YOB A;  4ZAH A;  3KKI A;  1ELQ A;  1X29 A;  3EUC A;  2W7I A;  2GB3 A;  3HMU A;  1PMO A;  4XJO A;  3FCR A;  1TOI A;  2OQX A;  3AOV A;  3FQ8 A;  4R5Z A;  1KMJ A;  3BWN A;  4W5K A;  4EU1 A;  1IX8 A;  2O1B A;  3KGX A;  4J8L A;  2VMY A;  1N8P A;  4CXQ A;  2W8J A;  5LH9 A;  3E2Z B;  4RJ0 A;  1OHY A;  2R2N A;  3I5T A;  4MQP A;  3G0T A;  3NYS A;  2CAN A;  3MAF B;  2BKW A;  5G0A A;  2AY7 A;  2D64 A;  5EQC A;  4A0H A;  3JWA A;  4B98 A;  4RKD A;  1ARS A;  3FQA A;  3NDN A;  1GBN A;  1AHX A;  1AMR A;  3AEN B;  2QB2 A;  1GC2 A;  3PD6 A;  4RIT A;  2CJH A;  2E7J A;  3A9Y A;  3ZRQ A;  3RBF A;  1UU1 A;  1ELU A;  1IAX A;  4ADB A;  4AO9 A;  4KYO A;  5HXX A;  3FZ8 A;  1O62 A;  1QIR A;  4A0G A;  2BI2 A;  1CQ7 A;  1TOE A;  4Y0H A;  1SZU A;  2YKY A;  3NRA A;  2ZYJ A;  4H51 A;  1MDO A;  2VGU A;  2Z9U A;  3E2Z A;  3TFU A;  3UE8 A;  3WKR A;  1ARH A;  1AMA A;  1ASD A;  1EQB A;  2VMZ A;  3DXW A;  3JTX A;  5LHA A;  3FZ7 A;  4UHM A;  1CS1 A;  1FG3 A;  2VGW A;  2FNU A;  3N5M A;  4A6T A;  4KAM A;  4Q75 A;  4UHO A;  4F5H A;  1RV3 A;  2O7C A;  3LVJ A;  3AEN A;  1W7N A;  5F8V A;  3FDB A;  3MKJ A;  1AX4 A;  1O61 A;  1BQA A;  1WYU A;  2D65 A;  2JJF A;  4MSO A;  4EB5 A;  3FD0 A;  3GET A;  1P3W A;  1TOG A;  5FT5 A;  3MC6 C;  1WYV B;  1BS0 A;  3LVM A;  3EI8 A;  4TMR A;  3VOM A;  4NOG A;  2E7I A;  1QGN A;  2ORD A;  3T32 A;  4M2M A;  3ZRR A;  1B8G A;  3E77 A;  1AIB A;  1BJO B;  3IF2 A;  4OT8 A;  1MAQ A;  1IX6 A;  1DFO A;  2V1P A;  3E2Y A;  2BIG A;  1Y4I A;  3E2F A;  4RJY A;  2HOZ A;  1W23 A;  4DQ6 A;  3ZZK A;  2DGM A;  5FT4 A;  1YAA A;  2WKA A;  4RAE A;  1CQ8 A;  5JAY A;  1ASB A;  1V2D A;  4MKK A;  5G09 A;  4Y0D A;  2QBT A;  3BCX A;  3FKD A;  4F5I A;  2VGS A;  3ISL A;  4Q76 A;  5E3K A;  3NUI A;  3ASA A;  3F0H A;  3PDB B;  3QI6 A;  4WB0 B;  4ADE A;  4BHD A;  3LWS A;  2XH1 A;  4W1X A;  3DR7 A;  3RI6 A;  1M0Q A;  1DGD A;  4GDY A;  2VMX A;  1GC4 A;  3RUY A;  4OTL A;  4A6U A;  4LC3 A;  4K2I A;  2EH6 A;  2D63 A;  3CBF A;  1AAW A;  1GC3 A;  4K2B A;  1BJO A;  1MAP A;  2WK7 A;  2CJG A;  2HOR A;  1I43 A;  1TOJ A;  3B46 A;  3WKS A;  3EZ1 A;  3MC6 A;  1H1C A;  1AKA A;  2BIA A;  4WB0 A;  2DOU A;  1GEW A;  1YJS A;  5J8Q A;  1DJE A;  2AY6 A;  1CQ6 A;  3H7F A;  3USF A;  2WK9 A;  4A00 A;  1O69 A;  5EAV A;  2EO5 A;  5D95 A;  3PDB A;  2VLF A;  2AY4 A;  3AEO A;  1PFF A;  3CQ4 A; 
#chains in the Genus database with same CATH topology
 4F5G A;  4R5F A;  4XJP A;  4IYO B;  5DB5 A;  1LW4 A;  4RKC A;  4A72 A;  3GR9 A;  1C4K A;  3GZC A;  1E5E A;  3QGU A;  3BB8 A;  4TN4 A;  5IWQ A;  1C0N A;  3E6G A;  3K7Y A;  2HZP A;  4AOA A;  2YCT A;  1X28 A;  1BJW A;  3KE3 A;  3KGW A;  1C9C A;  3HDO A;  2R5E A;  1V2E A;  1V72 A;  4N0B A;  2R5C A;  2QMA A;  1B9I A;  2FN6 A;  3B1D A;  3ZZJ A;  3BN1 A;  4A0F A;  2KFP A;  5EFS A;  2VGV A;  1J04 A;  1AKB A;  2C81 A;  1GDE A;  4IYO A;  4IXZ A;  4MQQ A;  4LW2 A;  3WCO A;  3EI9 A;  1S06 A;  1BT4 A;  1SF2 A;  4KXK A;  2VMR A;  1AHY A;  3PAA A;  3W1J A;  4P3M A;  1X0M A;  1DGE A;  2W7E A;  3GWP A;  4N0W A;  2X5F A;  4IXS A;  2BWO A;  2JJH A;  3N4R A;  1B4X A;  3WX9 A;  1EG5 A;  1IAY A;  2AY5 A;  3F6T A;  2YCP A;  1YOO A;  3HQT A;  2VMO A;  3N75 A;  1RVU A;  3QBO A;  5DJ1 A;  1VP4 A;  4TV7 A;  4JEX A;  5G2P A;  2W7J A;  2Q7W A;  2PO3 A;  2W8U A;  3LV2 A;  2PB0 A;  1LC7 A;  4B9B A;  2VGZ A;  3QM2 A;  2W7H A;  3L44 A;  4K2M A;  2C7T A;  3Q8N A;  4WLJ A;  2VGT A;  3II0 A;  1S08 A;  1AIC A;  3OP7 A;  4EB7 A;  3HVY A;  2CIN A;  1ASL A;  2VI9 A;  3B1C A;  1W7M A;  2ZP7 A;  3EZS A;  1FG7 A;  5EAA A;  3N7N A;  1G7W A;  1B9H A;  4WYE A;  2YCN A;  1LKC A;  1WYU B;  1C7O A;  1LS3 A;  3AEJ A;  4UOY A;  5FT8 A;  3WGB A;  5HHY A;  1BJN A;  2R0T A;  3FDD A;  4RIZ A;  1N2T A;  1OXP A;  4BQ0 A;  4E77 A;  2EZ1 A;  5KTB A;  1YIY A;  2BI1 A;  4U2H A;  3UWC A;  4ZDO A;  3E9K A;  4F5M A;  4FFC A;  3BWO A;  2VMT A;  3FRK A;  2OAT A;  5F9S A;  2EYQ A;  1G4X A;  1D7S A;  3H14 A;  2ZY5 A;  3EI5 A;  2A1V A;  3DR4 A;  3QPG A;  2W7D A;  3AEM C;  1OAT A;  4IXO A;  2BWN A;  2D5Y A;  3CQ5 A;  4WYD A;  3JW9 A;  5M4D A;  3DU4 A;  1AJS B;  1TOK A;  2VIA A;  1GEX A;  3TFT A;  4ZWV A;  4W1V A;  2QA3 A;  3FVU A;  2VYC A;  1AY4 A;  2XBN A;  3N0L A;  3GZD C;  4E3R A;  2AY3 A;  3EIB A;  1X2A A;  1CJ0 A;  5BJ3 A;  2OGA A;  2ZJG A;  4CBR A;  2G6W A;  4GE7 A;  2CFB A;  2WB6 A;  1MGV A;  2DKB A;  1YJZ A;  2W7M A;  1M32 A;  3BV0 A;  1PMM A;  1C7G A;  1FC4 A;  1GD9 A;  2NMP A;  2QLR A;  3RCH B;  2CTZ A;  2VMU A;  3PIU A;  4JF1 A;  3MEB A;  7AAT A;  1V2F A;  3GSB A;  3AEL A;  2WK8 A;  4WXB A;  1D7U A;  1MDZ A;  4LNL A;  1ASC A;  3JWB A;  1AJS A;  4WXF A;  1UKJ A;  4GEB A;  4ZAS A;  4ZLV A;  1AY8 A;  2Z1Y A;  2DGL A;  4ZSY A;  3AEM A;  3ASB A;  3JZL A;  3MBB A;  4WBT A;  4MQR A;  1LC5 A;  2HOY A;  4AO4 A;  3R9A A;  3BC8 A;  2TPL A;  4H63 Q;  3WLX A;  4M2J A;  2FYF A;  4HVK A;  1I48 A;  2X8U A;  4AZK A;  2BHX A;  3GZD A;  5DX5 A;  3RCH A;  2ZC0 A;  3W1H A;  2O0R A;  4ZSW A;  2CST A;  1DJU A;  5EIG B;  4W91 A;  2BIE A;  3TQX A;  5EUN A;  4HF8 A;  4F5J A;  2EZ2 A;  2BI3 A;  2AEV A;  4AH3 A;  1QZ9 A;  3WZF A;  3I16 A;  4R8D A;  1ASM A;  5BJ4 A;  5HDM A;  3IHJ A;  4WLH A;  2VMS A;  4QGR A;  4ATP A;  1H0C A;  2W7F A;  1I41 A;  3A9Z A;  5DJ9 A;  2RFV A;  2YKV A;  2JGT A;  4LW4 A;  1BJ4 A;  3PJ0 A;  2AY9 A;  4JE5 A;  4UHN A;  3OKS A;  3NU8 A;  4I8A A;  5M49 A;  2FQ6 A;  1W3U A;  1DKA A;  2JJE A;  1YIZ A;  3B1E A;  4K05 A;  5G2Q A;  5EIG A;  1BQD A;  3LG0 A;  1T3I A;  1YNU A;  1WKH A;  2FM1 A;  3PA9 A;  4LNM A;  1GEY A;  3F9T A;  3GBX A;  1B5O A;  2YRR A;  1G4V A;  3AEP A;  2HUI A;  2VMP A;  3NNK A;  4WYA A;  2DGK A;  4Y0I A;  1KKP A;  3HL2 A;  1GCK A;  3P6K A;  1PG8 A;  4EFF A;  4GRX A;  1WST A;  2VLH A;  3ECD A;  3NUB A;  5D5S A;  4F5K A;  1SZS A;  2R5C B;  4JE5 D;  1OHV A;  3ACZ A;  3ATH A;  1N31 A;  1SZK A;  1AJR A;  1TAS A;  4JEY A;  4A0R A;  4AZJ A;  1ASN A;  2HP2 A;  3EIA A;  4CBS A;  2FNI A;  4L0O A;  3WGC A;  3ELP A;  2GMS A;  2C44 A;  2W8T A;  3DOD A;  1AMS A;  2V0Y A;  3JU7 A;  1WYT B;  2CH2 A;  5C6U A;  4OYT A;  4PFN A;  1JS6 A;  1Z7D A;  2ZY3 A;  4DBC A;  1LK9 A;  1BW0 A;  3QN6 A;  3G7Q A;  3DYD A;  3LY1 A;  2OKJ A;  1IBJ A;  1AY5 A;  1QIS A;  2BYJ A;  3N4X A;  5E5I A;  4JEW A;  1LC8 A;  1IX7 A;  4MGR A;  2D7Z A;  3R4T A;  1I29 A;  3FSL A;  2OKK A;  4XJM A;  2VMQ A;  2Z20 A;  2F8J A;  3RQ1 A;  3VAX A;  4PFF A;  1AMQ A;  4ADC A;  1M0N A;  3NU7 A;  2AY8 A;  4GSA A;  4LNJ A;  1WYT A;  3FFR A;  2GQN A;  3HBX A;  1YJY A;  1ZC9 A;  3BS8 A;  4MKJ A;  1KAF A;  1KMK A;  1DJ9 A;  3K40 A;  3I4J A;  1MLZ A;  3DXV A;  1TAR A;  4WYC A;  1ECX A;  1KL1 A;  1O4S A;  1QJ3 A;  3W1I A;  4F4E A;  2DR1 A;  4OC9 A;  2OGE A;  4M2K A;  3WY7 A;  1UU0 A;  1S09 A;  1QIT A;  3NTJ A;  4W8I A;  2JJG A;  2Z61 A;  8AAT A;  1D2F A;  4BA5 A;  4F5F A;  1AAM A;  3P1T A;  4EMY A;  3ZRP A;  3VK3 A;  1EJI A;  1ASF A;  1AHF A;  1RV4 A;  1RVY A;  4DGT A;  4OCA A;  2YRI A;  3BCB A;  4MY5 A;  1OXO A;  3A8U X;  4U1T A;  2JIS A;  2EPJ A;  3EI6 A;  1D7V A;  3UAK A;  3MAF A;  4P7Y A;  4A6R A;  1M0P A;  1BKG A;  1M4N A;  2W8V A;  2Z9X A;  4OMA A;  1J32 A;  2YHK A;  4CXR A;  2CJD A;  1ARI A;  3M5U A;  4WXG A;  2E7U A;  5FT6 A;  3WCN A;  2BWP A;  1JG8 A;  4OBV A;  3VP6 A;  2AY2 A;  3H9X A;  4GE4 A;  4XQ2 A;  3EI7 A;  1IJI A;  1LW5 A;  2W7G A;  1MDX A;  5EUE A;  1UU2 A;  1M0O A;  3DZZ A;  1ZOB A;  4RLG A;  3DC1 A;  3HT4 A;  1S0A A;  2DKJ A;  2ZSM A;  3B8X A;  3TCM A;  4XAU A;  1SPA A;  4J5U A;  3ELE A;  3D6K A;  4ZDL A;  1E5F A;  3AV7 A;  4F5L A;  2AEU A;  4ISY A;  5G4J A;  2VMW A;  3K28 A;  2D61 A;  3NX3 A;  2Z9V A;  3MAU A;  1M7Y A;  2HP1 A;  4BMK A;  2D7Y A;  3NYU A;  3CQ6 A;  2ZY4 A;  2BI5 A;  2JG2 A;  2VIB A;  1JF9 A;  2CY8 A;  4JEZ A;  2Z67 A;  5EUD A;  1WKG A;  1U08 A;  2W8W A;  1IUG A;  1W7L A;  1GC0 A;  2AAT A;  2D66 A;  3FQ7 A;  1WYV A;  4IY7 A;  2PB2 A;  5TF5 A;  3HLM A;  4ITX A;  2BYL A;  4RM1 A;  5M4B A;  1TAT A;  1KKJ A;  1AHE A;  2ZSL A;  4WYF A;  3PPL A;  1AHG A;  2C0R A;  2CB1 A;  4R2N A;  3AAT A;  3NYT A;  3FZ6 A;  4ATQ A;  1M6S A;  9AAT A;  1CZC A;  4UQV A;  1ASE A;  5G4I A;  3VK2 A;  4E1O A;  3FTB A;  4CVQ A;  1KL2 A;  5K8B A;  1ASG A;  5I92 A;  3N4S A;  1ORD A;  1CZE A;  2BI9 A;  1IVR A;  3FVX A;  4JF0 A;  1Z3Z A;  3CAI A;  4IX8 A;  2X3L A;  2QSR A;  4JEV A;  1AKC A;  1VEF A;  3G8M A;  4OBU A;  2VMV A;  1QJ5 A;  3AOW A;  2EGY A;  3L8A A;  4E3Q A;  2GMU A;  2VMN A;  4XJL A;  1XI9 A;  2Z1Z A;  2Z9W A;  4ITG A;  4PIW A;  1CL2 A;  3PDX A;  2QB3 A;  3BWN C;  3GJU A;  4WP0 A;  2CH1 A;  4BA4 A;  4WD2 A;  2E54 A;  2AY1 A;  1TPL A;  4WYG A;  1C7N A;  3A2B A;  4GE9 A;  3DRD A;  3LVK A;  1JS3 A;  1VJO A;  1XEY A;  2GSA A;  2YKU A;  3PGY A;  2YKX A;  4XEW A;  1G7X A;  5E4Z A;  5AX8 A;  4ZWM A;  2W7L A;  3TAT A;  2X5D A;  2W7K A;  3BCA A;  4ADD A;  4PVF A;  1OHW A;  1D7R A;  3FVS A;  5M46 A;  4W1W A;  1DTY A;  3COG A;  3RBL A;  4XK1 A;  4IW7 A;  4ZM3 A;  3LVL B;  1AIA A;  4FL0 A;  3FFH A;  3AEJ C;  4O6Z A;  3QHX A;  3MAD A;  3VK4 A;  2ZY2 A;  2VI8 A;  4Q31 A;  4ZM4 A;  4Q6R A;  1ASA A;  1ART A;  1CL1 A;  2HOX A;  1SFF A;  2HUU A;  3PD6 B;  2HUF A;  1ZOD A;  3A9X A;  2ZUK A;  4ZDP A;  1ARG A;  1S07 A;  1SVV A;  1MLY A;  1B5P A;  2YOB A;  4ZAH A;  3KKI A;  1ELQ A;  1X29 A;  3EUC A;  2W7I A;  2GB3 A;  3HMU A;  1PMO A;  4XJO A;  3FCR A;  1TOI A;  2OQX A;  3AOV A;  3FQ8 A;  4R5Z A;  1KMJ A;  3BWN A;  4W5K A;  4EU1 A;  1IX8 A;  2O1B A;  3KGX A;  4J8L A;  2VMY A;  1N8P A;  4CXQ A;  2W8J A;  5LH9 A;  3E2Z B;  4RJ0 A;  1OHY A;  2R2N A;  3I5T A;  4MQP A;  3G0T A;  3NYS A;  2CAN A;  3MAF B;  2BKW A;  5G0A A;  2AY7 A;  2D64 A;  5EQC A;  4A0H A;  3JWA A;  4B98 A;  4RKD A;  1ARS A;  3FQA A;  3NDN A;  1GBN A;  1AHX A;  1AMR A;  3AEN B;  2QB2 A;  1GC2 A;  3PD6 A;  4RIT A;  2CJH A;  2E7J A;  3A9Y A;  3ZRQ A;  3RBF A;  1UU1 A;  1ELU A;  1IAX A;  4ADB A;  4AO9 A;  4KYO A;  5HXX A;  3FZ8 A;  1O62 A;  1QIR A;  4A0G A;  2BI2 A;  1CQ7 A;  1TOE A;  4Y0H A;  1SZU A;  2YKY A;  3NRA A;  2ZYJ A;  4H51 A;  1MDO A;  2VGU A;  2Z9U A;  3E2Z A;  3TFU A;  3UE8 A;  3WKR A;  1ARH A;  1AMA A;  1ASD A;  1EQB A;  2VMZ A;  3DXW A;  3JTX A;  5LHA A;  3FZ7 A;  4UHM A;  1CS1 A;  1FG3 A;  2VGW A;  2FNU A;  3N5M A;  4A6T A;  4KAM A;  4Q75 A;  4UHO A;  4F5H A;  1RV3 A;  2O7C A;  3LVJ A;  3AEN A;  1W7N A;  5F8V A;  3FDB A;  3MKJ A;  1AX4 A;  1O61 A;  1BQA A;  1WYU A;  2D65 A;  2JJF A;  4MSO A;  4EB5 A;  3FD0 A;  3GET A;  1P3W A;  1TOG A;  5FT5 A;  3MC6 C;  1WYV B;  1BS0 A;  3LVM A;  3EI8 A;  4TMR A;  3VOM A;  4NOG A;  2E7I A;  1QGN A;  2ORD A;  3T32 A;  4M2M A;  3ZRR A;  1B8G A;  3E77 A;  1AIB A;  1BJO B;  3IF2 A;  4OT8 A;  1MAQ A;  1IX6 A;  1DFO A;  2V1P A;  3E2Y A;  2BIG A;  1Y4I A;  3E2F A;  4RJY A;  2HOZ A;  1W23 A;  4DQ6 A;  3ZZK A;  2DGM A;  5FT4 A;  1YAA A;  2WKA A;  4RAE A;  1CQ8 A;  5JAY A;  1ASB A;  1V2D A;  4MKK A;  5G09 A;  4Y0D A;  2QBT A;  3BCX A;  3FKD A;  4F5I A;  2VGS A;  3ISL A;  4Q76 A;  5E3K A;  3NUI A;  3ASA A;  3F0H A;  3PDB B;  3QI6 A;  4WB0 B;  4ADE A;  2FKI A;  4BHD A;  3LWS A;  2XH1 A;  4W1X A;  3DR7 A;  3RI6 A;  1M0Q A;  1DGD A;  4GDY A;  2VMX A;  1GC4 A;  3RUY A;  4OTL A;  4A6U A;  2G7J A;  4LC3 A;  4K2I A;  2EH6 A;  2D63 A;  3CBF A;  1AAW A;  1GC3 A;  4K2B A;  1BJO A;  1MAP A;  2WK7 A;  2CJG A;  2HOR A;  1I43 A;  1TOJ A;  3B46 A;  3WKS A;  3EZ1 A;  3MC6 A;  1H1C A;  1AKA A;  2BIA A;  4WB0 A;  2DOU A;  1GEW A;  1YJS A;  5J8Q A;  1DJE A;  2AY6 A;  1CQ6 A;  3H7F A;  3USF A;  2WK9 A;  4A00 A;  1O69 A;  5EAV A;  2EO5 A;  5D95 A;  3PDB A;  2VLF A;  2AY4 A;  3AEO A;  1PFF A;  3CQ4 A; 
#chains in the Genus database with same CATH homology
 4F5G A;  4R5F A;  4XJP A;  4IYO B;  5DB5 A;  1LW4 A;  4RKC A;  4A72 A;  3GR9 A;  1C4K A;  3GZC A;  1E5E A;  3QGU A;  3BB8 A;  4TN4 A;  5IWQ A;  1C0N A;  3E6G A;  3K7Y A;  2HZP A;  4AOA A;  2YCT A;  1X28 A;  1BJW A;  3KE3 A;  3KGW A;  1C9C A;  3HDO A;  2R5E A;  1V2E A;  1V72 A;  4N0B A;  2R5C A;  2QMA A;  1B9I A;  2FN6 A;  3B1D A;  3ZZJ A;  3BN1 A;  4A0F A;  2KFP A;  5EFS A;  2VGV A;  1J04 A;  1AKB A;  2C81 A;  1GDE A;  4IYO A;  4IXZ A;  4MQQ A;  4LW2 A;  3WCO A;  3EI9 A;  1S06 A;  1BT4 A;  1SF2 A;  4KXK A;  2VMR A;  1AHY A;  3PAA A;  3W1J A;  4P3M A;  1X0M A;  1DGE A;  2W7E A;  3GWP A;  4N0W A;  2X5F A;  4IXS A;  2BWO A;  2JJH A;  3N4R A;  1B4X A;  3WX9 A;  1EG5 A;  1IAY A;  2AY5 A;  3F6T A;  2YCP A;  1YOO A;  3HQT A;  2VMO A;  3N75 A;  1RVU A;  3QBO A;  5DJ1 A;  1VP4 A;  4TV7 A;  4JEX A;  5G2P A;  2W7J A;  2Q7W A;  2PO3 A;  2W8U A;  3LV2 A;  2PB0 A;  1LC7 A;  4B9B A;  2VGZ A;  3QM2 A;  2W7H A;  3L44 A;  4K2M A;  2C7T A;  3Q8N A;  4WLJ A;  2VGT A;  3II0 A;  1S08 A;  1AIC A;  3OP7 A;  4EB7 A;  3HVY A;  2CIN A;  1ASL A;  2VI9 A;  3B1C A;  1W7M A;  2ZP7 A;  3EZS A;  1FG7 A;  5EAA A;  3N7N A;  1G7W A;  1B9H A;  4WYE A;  2YCN A;  1LKC A;  1WYU B;  1C7O A;  1LS3 A;  3AEJ A;  4UOY A;  5FT8 A;  3WGB A;  5HHY A;  1BJN A;  2R0T A;  3FDD A;  4RIZ A;  1N2T A;  1OXP A;  4BQ0 A;  4E77 A;  2EZ1 A;  5KTB A;  1YIY A;  2BI1 A;  4U2H A;  3UWC A;  4ZDO A;  3E9K A;  4F5M A;  4FFC A;  3BWO A;  2VMT A;  3FRK A;  2OAT A;  5F9S A;  2EYQ A;  1G4X A;  1D7S A;  3H14 A;  2ZY5 A;  3EI5 A;  2A1V A;  3DR4 A;  3QPG A;  2W7D A;  3AEM C;  1OAT A;  4IXO A;  2BWN A;  2D5Y A;  3CQ5 A;  4WYD A;  3JW9 A;  5M4D A;  3DU4 A;  1AJS B;  1TOK A;  2VIA A;  1GEX A;  3TFT A;  4ZWV A;  4W1V A;  2QA3 A;  3FVU A;  2VYC A;  1AY4 A;  2XBN A;  3N0L A;  3GZD C;  4E3R A;  2AY3 A;  3EIB A;  1X2A A;  1CJ0 A;  5BJ3 A;  2OGA A;  2ZJG A;  4CBR A;  2G6W A;  4GE7 A;  2CFB A;  2WB6 A;  1MGV A;  2DKB A;  1YJZ A;  2W7M A;  1M32 A;  3BV0 A;  1PMM A;  1C7G A;  1FC4 A;  1GD9 A;  2NMP A;  2QLR A;  3RCH B;  2CTZ A;  2VMU A;  3PIU A;  4JF1 A;  3MEB A;  7AAT A;  1V2F A;  3GSB A;  3AEL A;  2WK8 A;  4WXB A;  1D7U A;  1MDZ A;  4LNL A;  1ASC A;  3JWB A;  1AJS A;  4WXF A;  1UKJ A;  4GEB A;  4ZAS A;  4ZLV A;  1AY8 A;  2Z1Y A;  2DGL A;  4ZSY A;  3AEM A;  3ASB A;  3JZL A;  3MBB A;  4WBT A;  4MQR A;  1LC5 A;  2HOY A;  4AO4 A;  3R9A A;  3BC8 A;  2TPL A;  4H63 Q;  3WLX A;  4M2J A;  2FYF A;  4HVK A;  1I48 A;  2X8U A;  4AZK A;  2BHX A;  3GZD A;  5DX5 A;  3RCH A;  2ZC0 A;  3W1H A;  2O0R A;  4ZSW A;  2CST A;  1DJU A;  5EIG B;  4W91 A;  2BIE A;  3TQX A;  5EUN A;  4HF8 A;  4F5J A;  2EZ2 A;  2BI3 A;  2AEV A;  4AH3 A;  1QZ9 A;  3WZF A;  3I16 A;  4R8D A;  1ASM A;  5BJ4 A;  5HDM A;  3IHJ A;  4WLH A;  2VMS A;  4QGR A;  4ATP A;  1H0C A;  2W7F A;  1I41 A;  3A9Z A;  5DJ9 A;  2RFV A;  2YKV A;  2JGT A;  4LW4 A;  1BJ4 A;  3PJ0 A;  2AY9 A;  4JE5 A;  4UHN A;  3OKS A;  3NU8 A;  4I8A A;  5M49 A;  2FQ6 A;  1W3U A;  1DKA A;  2JJE A;  1YIZ A;  3B1E A;  4K05 A;  5G2Q A;  5EIG A;  1BQD A;  3LG0 A;  1T3I A;  1YNU A;  1WKH A;  2FM1 A;  3PA9 A;  4LNM A;  1GEY A;  3F9T A;  3GBX A;  1B5O A;  2YRR A;  1G4V A;  3AEP A;  2HUI A;  2VMP A;  3NNK A;  4WYA A;  2DGK A;  4Y0I A;  1KKP A;  3HL2 A;  1GCK A;  3P6K A;  1PG8 A;  4EFF A;  4GRX A;  1WST A;  2VLH A;  3ECD A;  3NUB A;  5D5S A;  4F5K A;  1SZS A;  2R5C B;  4JE5 D;  1OHV A;  3ACZ A;  3ATH A;  1N31 A;  1SZK A;  1AJR A;  1TAS A;  4JEY A;  4A0R A;  4AZJ A;  1ASN A;  2HP2 A;  3EIA A;  4CBS A;  2FNI A;  4L0O A;  3WGC A;  3ELP A;  2GMS A;  2C44 A;  2W8T A;  3DOD A;  1AMS A;  2V0Y A;  3JU7 A;  1WYT B;  2CH2 A;  5C6U A;  4OYT A;  4PFN A;  1JS6 A;  1Z7D A;  2ZY3 A;  4DBC A;  1LK9 A;  1BW0 A;  3QN6 A;  3G7Q A;  3DYD A;  3LY1 A;  2OKJ A;  1IBJ A;  1AY5 A;  1QIS A;  2BYJ A;  3N4X A;  5E5I A;  4JEW A;  1LC8 A;  1IX7 A;  4MGR A;  2D7Z A;  3R4T A;  1I29 A;  3FSL A;  2OKK A;  4XJM A;  2VMQ A;  2Z20 A;  2F8J A;  3RQ1 A;  3VAX A;  4PFF A;  1AMQ A;  4ADC A;  1M0N A;  3NU7 A;  2AY8 A;  4GSA A;  4LNJ A;  1WYT A;  3FFR A;  2GQN A;  3HBX A;  1YJY A;  1ZC9 A;  3BS8 A;  4MKJ A;  1KMK A;  1DJ9 A;  3K40 A;  3I4J A;  1MLZ A;  3DXV A;  1TAR A;  4WYC A;  1ECX A;  1KL1 A;  1O4S A;  1QJ3 A;  3W1I A;  4F4E A;  2DR1 A;  4OC9 A;  2OGE A;  4M2K A;  3WY7 A;  1UU0 A;  1S09 A;  1QIT A;  3NTJ A;  4W8I A;  2JJG A;  2Z61 A;  8AAT A;  1D2F A;  4BA5 A;  4F5F A;  1AAM A;  3P1T A;  4EMY A;  3ZRP A;  3VK3 A;  1EJI A;  1ASF A;  1AHF A;  1RV4 A;  1RVY A;  4DGT A;  4OCA A;  2YRI A;  3BCB A;  4MY5 A;  1OXO A;  3A8U X;  4U1T A;  2JIS A;  2EPJ A;  3EI6 A;  1D7V A;  3UAK A;  3MAF A;  4P7Y A;  4A6R A;  1M0P A;  1BKG A;  1M4N A;  2W8V A;  2Z9X A;  4OMA A;  1J32 A;  2YHK A;  4CXR A;  2CJD A;  1ARI A;  3M5U A;  4WXG A;  2E7U A;  5FT6 A;  3WCN A;  2BWP A;  1JG8 A;  4OBV A;  3VP6 A;  2AY2 A;  3H9X A;  4GE4 A;  4XQ2 A;  3EI7 A;  1IJI A;  1LW5 A;  2W7G A;  1MDX A;  5EUE A;  1UU2 A;  1M0O A;  3DZZ A;  1ZOB A;  4RLG A;  3DC1 A;  3HT4 A;  1S0A A;  2DKJ A;  2ZSM A;  3B8X A;  3TCM A;  4XAU A;  1SPA A;  4J5U A;  3ELE A;  3D6K A;  4ZDL A;  1E5F A;  3AV7 A;  4F5L A;  2AEU A;  4ISY A;  5G4J A;  2VMW A;  3K28 A;  2D61 A;  3NX3 A;  2Z9V A;  3MAU A;  1M7Y A;  2HP1 A;  4BMK A;  2D7Y A;  3NYU A;  3CQ6 A;  2ZY4 A;  2BI5 A;  2JG2 A;  2VIB A;  1JF9 A;  2CY8 A;  4JEZ A;  2Z67 A;  5EUD A;  1WKG A;  1U08 A;  2W8W A;  1IUG A;  1W7L A;  1GC0 A;  2AAT A;  2D66 A;  3FQ7 A;  1WYV A;  4IY7 A;  2PB2 A;  5TF5 A;  3HLM A;  4ITX A;  2BYL A;  4RM1 A;  5M4B A;  1TAT A;  1KKJ A;  1AHE A;  2ZSL A;  4WYF A;  3PPL A;  1AHG A;  2C0R A;  2CB1 A;  4R2N A;  3AAT A;  3NYT A;  3FZ6 A;  4ATQ A;  1M6S A;  9AAT A;  1CZC A;  4UQV A;  1ASE A;  5G4I A;  3VK2 A;  4E1O A;  3FTB A;  4CVQ A;  1KL2 A;  5K8B A;  1ASG A;  5I92 A;  3N4S A;  1ORD A;  1CZE A;  2BI9 A;  1IVR A;  3FVX A;  4JF0 A;  1Z3Z A;  3CAI A;  4IX8 A;  2X3L A;  2QSR A;  4JEV A;  1AKC A;  1VEF A;  3G8M A;  4OBU A;  2VMV A;  1QJ5 A;  3AOW A;  2EGY A;  3L8A A;  4E3Q A;  2GMU A;  2VMN A;  4XJL A;  1XI9 A;  2Z1Z A;  2Z9W A;  4ITG A;  4PIW A;  1CL2 A;  3PDX A;  2QB3 A;  3BWN C;  3GJU A;  4WP0 A;  2CH1 A;  4BA4 A;  4WD2 A;  2E54 A;  2AY1 A;  1TPL A;  4WYG A;  1C7N A;  3A2B A;  4GE9 A;  3DRD A;  3LVK A;  1JS3 A;  1VJO A;  1XEY A;  2GSA A;  2YKU A;  3PGY A;  2YKX A;  4XEW A;  1G7X A;  5E4Z A;  5AX8 A;  4ZWM A;  2W7L A;  3TAT A;  2X5D A;  2W7K A;  3BCA A;  4ADD A;  4PVF A;  1OHW A;  1D7R A;  3FVS A;  5M46 A;  4W1W A;  1DTY A;  3COG A;  3RBL A;  4XK1 A;  4IW7 A;  4ZM3 A;  3LVL B;  1AIA A;  4FL0 A;  3FFH A;  3AEJ C;  4O6Z A;  3QHX A;  3MAD A;  3VK4 A;  2ZY2 A;  2VI8 A;  4Q31 A;  4ZM4 A;  4Q6R A;  1ASA A;  1ART A;  1CL1 A;  2HOX A;  1SFF A;  2HUU A;  3PD6 B;  2HUF A;  1ZOD A;  3A9X A;  2ZUK A;  4ZDP A;  1ARG A;  1S07 A;  1SVV A;  1MLY A;  1B5P A;  2YOB A;  4ZAH A;  3KKI A;  1ELQ A;  1X29 A;  3EUC A;  2W7I A;  2GB3 A;  3HMU A;  1PMO A;  4XJO A;  3FCR A;  1TOI A;  2OQX A;  3AOV A;  3FQ8 A;  4R5Z A;  1KMJ A;  3BWN A;  4W5K A;  4EU1 A;  1IX8 A;  2O1B A;  3KGX A;  4J8L A;  2VMY A;  1N8P A;  4CXQ A;  2W8J A;  5LH9 A;  3E2Z B;  4RJ0 A;  1OHY A;  2R2N A;  3I5T A;  4MQP A;  3G0T A;  3NYS A;  2CAN A;  3MAF B;  2BKW A;  5G0A A;  2AY7 A;  2D64 A;  5EQC A;  4A0H A;  3JWA A;  4B98 A;  4RKD A;  1ARS A;  3FQA A;  3NDN A;  1GBN A;  1AHX A;  1AMR A;  3AEN B;  2QB2 A;  1GC2 A;  3PD6 A;  4RIT A;  2CJH A;  2E7J A;  3A9Y A;  3ZRQ A;  3RBF A;  1UU1 A;  1ELU A;  1IAX A;  4ADB A;  4AO9 A;  4KYO A;  5HXX A;  3FZ8 A;  1O62 A;  1QIR A;  4A0G A;  2BI2 A;  1CQ7 A;  1TOE A;  4Y0H A;  1SZU A;  2YKY A;  3NRA A;  2ZYJ A;  4H51 A;  1MDO A;  2VGU A;  2Z9U A;  3E2Z A;  3TFU A;  3UE8 A;  3WKR A;  1ARH A;  1AMA A;  1ASD A;  1EQB A;  2VMZ A;  3DXW A;  3JTX A;  5LHA A;  3FZ7 A;  4UHM A;  1CS1 A;  1FG3 A;  2VGW A;  2FNU A;  3N5M A;  4A6T A;  4KAM A;  4Q75 A;  4UHO A;  4F5H A;  1RV3 A;  2O7C A;  3LVJ A;  3AEN A;  1W7N A;  5F8V A;  3FDB A;  3MKJ A;  1AX4 A;  1O61 A;  1BQA A;  1WYU A;  2D65 A;  2JJF A;  4MSO A;  4EB5 A;  3FD0 A;  3GET A;  1P3W A;  1TOG A;  5FT5 A;  3MC6 C;  1WYV B;  1BS0 A;  3LVM A;  3EI8 A;  4TMR A;  3VOM A;  4NOG A;  2E7I A;  1QGN A;  2ORD A;  3T32 A;  4M2M A;  3ZRR A;  1B8G A;  3E77 A;  1AIB A;  1BJO B;  3IF2 A;  4OT8 A;  1MAQ A;  1IX6 A;  1DFO A;  2V1P A;  3E2Y A;  2BIG A;  1Y4I A;  3E2F A;  4RJY A;  2HOZ A;  1W23 A;  4DQ6 A;  3ZZK A;  2DGM A;  5FT4 A;  1YAA A;  2WKA A;  4RAE A;  1CQ8 A;  5JAY A;  1ASB A;  1V2D A;  4MKK A;  5G09 A;  4Y0D A;  2QBT A;  3BCX A;  3FKD A;  4F5I A;  2VGS A;  3ISL A;  4Q76 A;  5E3K A;  3NUI A;  3ASA A;  3F0H A;  3PDB B;  3QI6 A;  4WB0 B;  4ADE A;  2FKI A;  4BHD A;  3LWS A;  2XH1 A;  4W1X A;  3DR7 A;  3RI6 A;  1M0Q A;  1DGD A;  4GDY A;  2VMX A;  1GC4 A;  3RUY A;  4OTL A;  4A6U A;  2G7J A;  4LC3 A;  4K2I A;  2EH6 A;  2D63 A;  3CBF A;  1AAW A;  1GC3 A;  4K2B A;  1BJO A;  1MAP A;  2WK7 A;  2CJG A;  2HOR A;  1I43 A;  1TOJ A;  3B46 A;  3WKS A;  3EZ1 A;  3MC6 A;  1H1C A;  1AKA A;  2BIA A;  4WB0 A;  2DOU A;  1GEW A;  1YJS A;  5J8Q A;  1DJE A;  2AY6 A;  1CQ6 A;  3H7F A;  3USF A;  2WK9 A;  4A00 A;  1O69 A;  5EAV A;  2EO5 A;  5D95 A;  3PDB A;  2VLF A;  2AY4 A;  3AEO A;  1PFF A;  3CQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...