43CAA

Crystallographic structure of the esterolytic and amidolytic 43c9 antibody with bound p-nitrophenol
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
DVVMTQTPSSLAMSVGQKVTMSCKSSQSLLNISNQKNYLAWYQQKPGQSPKLLVYFASTRESGVPDRFIGSGSGTDFTLTISSVQAEDQADYFCQQHYRAPRTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IMMUNOGLOBULIN (LIGHT CHAIN))
publication title Structural basis for amide hydrolysis catalyzed by the 43C9 antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 26
structure length 113
sequence length 113
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 1999-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 43caA00
2GT9A 4GKSB 5DHVH 1NMBH 4DKEH 1I8KA 3VCLB 4QGYA 1MF2H 4L3EB 5JW4M 3BEVB 5CEXB 1MFEH 1Q0YL 3U7WH 3C08L 4R4ND 2QQKH 1FZOA 3NCCB 2ZUSA 4M6ML 3KLHD 4ORGA 5TE4L 1F11A 5AZEL 3AMLA 2X1PA 3KYMA 1FLRH 4PJHF 5EN2B 3VFPB 4CL7A 3S3PA 3IS1X 2VR5A 5I1AB 5E08L 3MA7A 1HCFX 4LLDB 4R0LA 3JV4A 5DJ6B 5HGAB 5D7IB 2F58L 4KTYA 4D0BA 5JZ7C 3H9ZA 1TPXB 2YK1L 5DD0H 5F6IB 1DE4A 3MV01 5EUOE 3T0DA 1MQ8A 2P42B 3F7VA 5SV4A 2YMXL 2XFXB 4C58B 3WJJC 4ZFFB 4XNQA 3TBYB 3RVVC 5JOEA 2GCYA 5JO5A 5JTWA 5F9WB 2NMSA 2LQRA 5JHLH 5MI0C 1CXEA 4P2OD 3WFDL 4X4XA 1IM3B 1T89A 4E0RA 4OIAA 5I1GL 1U3HB 3Q3GA 4RGNC 5GZOC 1RJLB 3U2SB 1OD9A 4YDKL 1TLKA 4NQSA 1U6AL 2W65A 4XP5L 3T2NL 2A9NH 1WBZB 1C5DB 5CZVH 5GISH 4IS6A 3W82A 4NYLB 1KCVH 1OF2B 3VWJA 1CFNA 1D5MB 1VB9A 3EYFB 2GSIA 3OGCB 2EO1A 2Q1EA 3OR6B 1R3LA 5I1KH 1LO4H 1D5IH 3TLRA 4XBEL 4XPHL 4F80A 3RAJH 3MLYH 3F12B 2A6KA 1Z5LB 2BCKB 4FS0A 3FT4A 3UPCA 3MV11 1RVFH 1TCMA 5CGTA 5TH2A 3QHZL 1YY8B 4CVXB 1LP9E 4K71B 1MCSA 4PIRF 1OTUD 3B9AA 3BPLB 1CLZL 1KB5H 5H94B 1NGYA 5GSRA 3DX9A 4KHTH 2X4QB 4QXTB 1T7YA 3S35L 4AYFA 3F58L 2CLVB 4Y0GA 5FHAL 2ERJC 5AYUH 1PZ5A 4HKZA 1G9EA 3JVGC 5GZND 3O8XB 4LDLB 1YEFL 2QBWA 5DD1H 4TSCH 1ONQA 3Q5YA 3VMPA 5IHUH 3O9WB 5EB9A 4F8TA 4F37F 1HH9A 4HJGA 3LZFL 1IC5L 1TVBA 1ED3B 3NCBB 3MRCA 4TVPH 1CICB 3SGKA 1SMAA 4OD3L 1V3LA 5BQ7A 3D3VB 4X6DA 1QR1B 2Y4SA 4P5TB 5M95B 2F53D 4ELMB 1J1PL 3TV3L 2J1KA 1DL7H 1A6ZB 5TGBB 1HEZA 4JPVL 4PGEB 3DMMC 2PYEA 1FG9C 4NC1E 4Y2OA 4R7NA 4IRJD 5KTEL 1BD2B 2YN5A 1B9ZA 2AKRA 1Q94B 1J8KA 1IEBA 4OGXH 1UWGL 4JFXB 3GIVA 4OF5A 4OIIL 1II4E 1SJHB 1RZIA 2QHRL 3QFJE 4LKCB 3SCMA 2JCCA 3D85A 3RTQC 4PJ7E 1EFXB 3RHWK 4HKXB 2WBJB 1S7WB 3GMRA 1DLHB 4V1DB 2R1XB 4MS8D 3QZWB 3HPJB 3QUMB 3BJLA 2FL5A 4AEHH 3JUZA 4YXLL 4LCUB 1OAQH 5IFJB 5FCUL 1GC1L 1MCNA 3W11C 2CIIB 1QSFA 3ZE1F 4QHMB 4ODWB 4GKZA 1GIGL 1DDHA 2V5TA 5GGVH 3V5HB 1ZSDA 2ICWJ 5ITBL 5MERA 4BM7A 4I3SH 3VGHA 4GKSA 35C8L 3GM8A 1XIWD 2RHEA 4WJ5B 3VCLA 1N3NB 4KJWC 4L3EA 3BEVA 5CEXA 4YJZL 4EN3B 3MLWH 4LU5L 4N1CA 1U8HB 1RU9H 1M7IB 2KUTA 5C8JB 4ZD3H 1NC2D 3MV9D 1C5CH 1T0MA 5EN2A 3TWCL 3VFPA 4N0UA 5I1AA 5CD3A 2DDQL 4WTZG 5F88B 3U9UB 4PJGB 4OTXL 2IQ9H 1UXWB 4LLDA 5KG9B 1ND0B 5DJ6A 5HGAA 5D7IA 5ADOL 1MCOL 3WN5B 3VMNA 1JYXA 2YPLE 4X7FC 2ZSWB 2XFXA 3V4UL 4ZFFA 5L8LB 4PJ8C 3TBYA 3VXMB 1PG7W 2MHAA 3NAAH 5F6HI 4P2YA 2FO4B 2FATL 4XPGH 3HE6C 2R2CA 5E8DL 4PLKD 1IM3A 4POZC 1U3HA 1NFDE 1QACA 1RJLA 3B9KB 3U2SA 1JF1B 3NFSL 3FB7B 4I0PC 4Z7OE 2G5RA 1WBZA 3U36B 1C5DA 1HHJB 1F58L 4NYLA 3NMEA 1OF2A 4JFDB 3K74B 1D5MA 3EYFA 1QOKA 3OGCA 2QQLH 4YX2L 4X7CC 5T33H 2MFNA 2VZ3A 4KROD 2D31B 4HT1H 1SVCP 3AS0A 1F6AB 3FZUC 3V9FA 4FQIH 5D96C 3VGEA 2WINB 1R3IH 4XPFH 3F12A 1FBIL 1UB6B 1Z5LA 3CX2A 4PJHB 5ANME 2MCPL 2F19H 3BRGC 1TETH 4GG6F 3N1FC 3LQAH 2BY0A 4OM0L 1LK3L 4NZUH 2NXZD 1YY8A 2EDTA 4CVXA 4N9OB 4I3RH 1AE6L 5H94A 2X09A 5C2BL 4J3OC 5J89A 1AR1C 1IAKB 2X4QA 4QXTA 4BFGA 2CLVA 2R0KH 2W9DL 3B43A 4G6JH 2NY6D 4BK4A 2DI7A 2P5ED 5C0CB 1A1MB 3O8XA 3QRFM 1BBJB 3N1MC 3B83A 1NGQH 5F1NB 3O9WA 2P47B 5EIIB 1DSFH 43C9B 3KLDA 1ED3A 4U0RB 5DVKA 5F1KC 4R0LC 3MFFB 2CUMA 4F33B 3QJHB 4NQEB 1CICA 4HULB 2BX5A 1OD7A 1JCKA 3D3VA 1QR1A 4LEXH 4P5TA 1TXKA 3TJEL 5D93C 5EBMB 1MY7A 1NEZB 2R23B 4PRPE 1A6ZA 1D7FA 4QRPD 5TGBA 1IC7L 4PGEA 4WWKD 1KEML 4QNPE 4R97C 5KSAB 4UT9H 2YC1B 2F74B 2VXTL 1BD2A 1Q94A 5CILL 2VNCA 4OFYD 4ZTPL 1BFTA 3S6CA 1BWMA 4JFXA 1BJ1J 2CO7B 3QCUL 1T89C 3S96B 1SJHA 3S4SG 1KYOK 4LKCA 3LD8C 4NFCA 2DD8H 1QBMH 4PB0H 4DAGH 2OBGA 4LLMB 4FG6C 1EFXA 1FHGA 4HKXA 5IBLD 2WBJA 1S7WA 3MJGX 3PP4H 1DLHA 2CRYA 4V1DA 4ZUTB 2R1XA 3UDWA 2GK2A 3QZWA 3HPJA 4RDQG 3GUTB 3QUMA 2D03H 4LCUA 1I9RH 1SY6H 5IFJA 2SEBB 4HF5H 1F4YL 1I3RB 2CIIA 4IMKC 3GI8L 4UDTB 3X13B 12E8H 4JEGB 3LPGA 4G6KL 4QHMA 4XP1H 4RBPH 4ODWA 1F6FB 2C1PB 1I3VA 5DWUL 1HZHH 3KAAA 1DANT 2D2OA 4ZMAT 3CFCL 3V5HA 4L8CB 3MXVL 2RB8A 2XI9A 4JVUA 4WJ5A 1AGBB 1N3NA 5KOMC 4YGAB 1U8HA 2RFXB 2FCBA 2PO6D 3O2VH 4GFTB 1M7IA 3VH8B 1MIEH 4O2FB 5C8JA 3S8WA 1OQXA 3UAJC 3MYZA 5F88A 3U9UA 2E8YA 1EHAA 3DYOA 4PJGA 1XMWA 4XRCB 1UXWA 3RPKA 3SDDC 4BJLA 5KG9A 2ADGB 1ND0A 3ARDB 2LVCA 1P7QB 4G6ML 1UZ6E 1ZHBB 3WN5A 2APTA 3O2DA 4HZLB 4BZ1L 5EZLB 4S1SH 2ZSWA 2AQ2A 3RI5F 4ZXBD 5CEZE 5L6YL 3QUXC 3LRGA 4A6YH 2IH1B 3VXMA 1YNKL 3A6OA 1G1YA 3U30C 2FO4A 2IFFH 1PX3A 5HGDB 4K8RL 5GGRB 1VA9A 3V8CA 3C8KB 4Y88A 4JM2C 2DQUL 3B9KA 1FO0L 4I77H 1JF1A 3MV8D 1DVFB 3FB7A 3BFOA 4J7RA 3TVMD 3U36A 3OJVC 4JFZL 3ESVF 4JFDA 2VTFA 1C1EH 2V2XB 5IUSA 5HHQB 2D31A 1PLGL 2QEJA 1F6AA 1KLUB 2C3WA 4OFDA 2GUOB 4RMTA 3C5JB 5T3ZD 5C0FB 4WHDA 4XMKH 2C4FU 1UB6A 4PJHA 4JPKL 2N7BA 2XV6B 3OJMB 1G6RL 3QEUA 4FRWA 3ARED 4GW5B 4HGKC 3WDHA 4KI1A 4NQVB 1M6OB 4ZAKB 3FFCD 5KS9F 1EBPA 2CRIA 3CFIC 2WBKA 3WNLA 4FOMA 2QQNH 5A2IH 3C2AL 3A6CH 1MCJA 3QEHB 4XNZB 5EPMB 1IAKA 4FQLL 4F7MA 1I3UA 2VLRE 4DN4H 5I9QB 3IDYC 5C0CA 3MBXH 3TYGH 4D9QD 2XQYK 4TULH 1BBJA 1PX4A 3GMNB 4LAQL 1DBKL 4RCAA 5F1NA 5E6ID 3V6OE 3IFLH 1MFDL 4G42B 5EIIA 4DOHE 3MCKB 3H3BC 2VLMD 4JKLA 4G8GB 43C9A 5D71L 5D7JD 3MFFA 3KS0J 4F33A 2VDPL 3QJHA 4NQEA 3OKNB 4OIBA 1DQDH 5L0QC 1TPXC 3MXWH 4HCRL 1EEQA 4KTEL 1HINH 1OM3L 1DQQA 4M6AA 4ZUSB 5EBMA 1NEZA 2R23A 3SDCB 1BVLB 4HLZG 3GHBH 1A02N 4ZNEA 3U4AA 3IAQA 5KSAA 2YC1A 1WSST 3HS0B 2F74A 4R4BB 1HXMB 1ODAA 5F9WC 3IKCB 43CAB 4WHCA 3DVIA 3NABL 4MAYD 4MSWB 4YDJB 1JNLH 3IDNB 3S96A 4KZDH 5GRVK 4LLMA 5ECJE 4KDTC 5EO9A 3SJVD 1FN4B 4OQTA 1TNNA 3PHOB 4ZUTA 1KFAH 1PG7L 4GAJL 4F9LA 2P8PB 3UTSE 1F6LL 3GUTA 4DTGL 4PJ5B 4G8FB 2SEBA 4I2XE 4D0DB 3CJJA 1I3RA 1CDUA 4UDTA 2D0FA 1ETZB 3X13A 3MBEC 1U92B 3LSOB 3ARFD 2I9TB 2OXHA 3FT3B 1KJMB 1AIFB 4L8CA 2KKQA 2I9LB 3BPNB 1OP3K 1L9MA 3VD9A 1AGBA 3UZVB 1H3WM 4RGOH 2DTSA 4HFUH 1MJ8H 3OF6A 4CMHB 3ZE0E 1WAAE 1MWAH 2RFXA 4FP8H 1IBGH 3BPLC 4U33A 1MCHA 3FT2B 3VH8A 4O2FA 1WCBB 3NGBB 1NBZB 1RAMA 3IDJB 1JF6A 1OTTD 4CAGA 4XRCA 4APQD 2MSPA 2ADGA 3O8XC 3ARDA 4QTHB 5E95B 1P7QA 1ZHBA 4LSQH 2J12B 4LOUD 5EZLA 2PUQT 3O9WC 4LIQE 2V9TA 3F62A 4B5EA 4NP4L 3DVFA 4GXVH 4OZHF 3SGEH 5BRZB 4L8BB 3KXFD 4U49A 2A38A 4KZEL 1FCGA 3LKRB 3GSUB 3MODL 3MYJB 5HGDA 3PDGA 5KANG 4P5TC 5CZXC 5GGRA 2WM0A 5E9DB 3T1WA 1OAYL 1RUAL 3C8KA 2QQQA 4XTRC 4NN6C 4XWOD 5INCB 3FQUB 4EDWH 5TFSL 1DVFA 3BKYH 5LGKA 5CD5D 1P6AB 3IVKB 1M4KA 4LPTA 4K07A 3L1OH 4Q6IB 2HWZH 2V2XA 3GBML 3GFUA 4JG0L 1J0HA 3L3GB 3MJ9A 3DVGB 3LN4A 5HHQA 3ARGD 4WFEE 3E8UL 2VXVL 1KLUA 3CFJB 2GUOA 5D6DA 3C5JA 5C0FA 1G7JB 3F7QA 4ZS7H 3A6BH 3KHOA 3VU2A 4QWWD 4GW5A 4NQVA 1M6OA 4BELD 4ZAKA 4WW2C 4ONGH 2E9JA 4WI3A 4G7YL 3KLAB 4W6YB 3QEHA 5EPMA 1UCBL 3SQOL 5CJXA 5EBWB 2DQDH 4M7KH 5HVHC 1QFWI 1NMAL 3MRHB 1JPST 2DM4A 4EN3C 2AW2A 4PJAF 3CVIH 4HK3N 3U48A 3EDEA 3GMNA 1ZXQA 2H1PL 1CVSC 4G42A 3MCKA 4G8GA 4PJCF 4U1LB 4LCCC 1JZ6A 3OKNA 1KCSH 5D2NB 3QQ3B 5B39G 4X8JB 4NKIH 2M2DA 3VFTB 4CRPA 4JJ5B 4YUEL 4ZUSA 3SDCA 1CQYA 4NOFA 5FUZL 1BVLA 4WFHE 4ZOCA 5IOPB 3QUZB 1K4CB 3I6LE 3HS0A 4XVUC 2CKBH 1FVDB 4K55A 4L9LB 4XCCL 4R4BA 2HKFH 1HXMA 2QV2A 3IKCA 3QIUB 4U1HB 5CJOH 43CAA 4OF6A 4XBPB 4XP9H 1A7QL 1A5FH 5D1ZC 1CGYA 4MSWA 2OMNA 4YDJA 4YHMH 1EPFA 3IDNA 3RWIB 4P3CH 2OTUB 4X6DE 5KS9B 1E6OL 2WWKT 4OCWH 5KVGL 1FN4A 5D1XC 4N0FA 3PHOA 1KXVC 3PL6D 4NJ9L 2P8PA 3BAEL 4EOWL 3QDJD 4PJ5A 2PYEE 5FGCE 4XVTH 3V6BR 4M93C 3MLUL 4D0DA 2NXYD 1UGNA 3GI9L 1XZ0B 4XMPH 3JSSA 4PJEF 2MMXA 1NC4D 5C0GA 1MCDA 1ETZA 1TQBC 4HS8L 1U92A 3O81A 5J13C 3LSOA 1RHFA 2I9TA 1DLFH 3NOIA 3T08A 2C4FT 1WWAX 3BWUC 1KJMA 2JTDA 3FT3A 5HGGS 5IMOB 1AIFA 2JCCE 2ZUUA 3CU7A 2I9LA 1EAPA 3FJTA 5HI4C 2Z31C 1N0XH 2VDQL 4DGYL 3N9GL 5T3XL 3RX5A 4GUPB 2FECI 3FT2A 2R2EB 3VXNB 1KJ2H 1QSFE 1WCBA 1NBZA 1RPQA 3IDJA 3K2UL 1KCUH 1EGJL 2W59A 3QDMD 2N4IA 3SKOB 5A2KH 4D9RE 5HI5D 2ZCKL 3ESUF 4QTHA 4R26H 1PJ9A 2OSLB 2R29H 3KVQA 1RJZA 4JRXB 1FGVH 5M94B 4P48A 4L3EE 4C59B 4NKQB 4OZ4B 3QI9B 5BRZA 4L8BA 4P0DA 4PJ9B 2BNRD 4JGUA 1T2QL 3GIZL 1FORH 3LHPL 3LKRA 4HIJB 3GSUA 3MYJA 5F7HA 4N0UE 4PRNB 3LMJH 2W9EL 4BA8A 1YMMD 5E9DA 3HC0B 3K3QA 4I0CC 5IB2B 4JFHE 5I18L 5D7IE 4NWUH 5KSAC 5F7FA 4N90D 3LB6D 3FQUA 3VRJB 1I1AC 4Y19D 3IVKA 4PS4H 1KIUA 5FCSH 1KPUB 3P30H 3R8BB 3DVNB 4Q6IA 1X5XA 4OCYL 3L3GA 3AS2A 1MRDH 3DVGA 3GJFK 4HPYH 3BWAB 5D7KE 5J4MA 3L5XL 1WUNT 3QXUA 2AJVH 1P84J 3CFJA 3ULUF 2DLEA 4YXKH 1E4XH 4F9LC 4WTXA 3WLWD 1G7JA 4OD1H 5GS0C 3P9WB 1BJ1H 1G7PB 2XTJB 2V7HB 5INDA 3UC0L 5F7MC 3ZTNH 2W07A 3KLAA 3RBSA 3OJDB 2E7HA 5IB4B 3B5HA 4OZHB 5EBWA 3QXVA 3G6DH 1MHCB 3MRHA 1F4WL 2KBGA 3BH9B 3IFOB 5L8JB 3S37H 1JYWA 3FQWB 5LJYH 2QL1A 5I1EL 3PWPB 4FQ2H 5C6PB 5C0AB 5KSBF 3T0WA 1QTYT 2JK5B 5IQ9B 1BLNB 5J7CC 3GGWB 4Y5YC 2DJSA 5D2NA 3QQ3A 2BVUA 2DMBA 3VFTA 3NIGE 4G7VL 4JKWA 5JXED 1AFVL 5IOPA 5T3ZL 3QUZA 3WS6A 1K4CA 4P3DB 2NY1C 3IKKA 2VLJB 1FVDA 4L9LA 1F42A 2EC8A 3WNPA 4M8VA 3REWB 4WUUB 1ZVSA 3QIUA 4U1HA 4ETQA 1A7BA 4XBPA 4F7PB 2MQ3A 5C3LD 2X1OA 3RWIA 3I85A 2E9BA 2ZG2A 2OTUA 4MX7B 5DJ8B 3D3VE 1TITA 5KS9A 3FRPG 5CJQL 3KPQB 1I7RB 3WFCL 1IAII 2WUCL 4JHAH 4M5YH 2XQYG 4ODVL 2ZG3A 4N5ED 2CJUL 5T1LB 1F3RB 1DBJH 4X98B 5FHBH 1A3LL 4I9WE 1T83C 5E4EB 2WMPA 5CEZH 1XZ0A 1U93B 4O58L 4PJAB 3WUWG 5J1AB 1LO2L 4LVHC 2F5BL 1QHOA 4KMTH 2DLTA 1A0QL 1LK2B 5IMOA 4OLEA 1DCLA 4K3GA 4FXKB 4K7PY 4V1DE 1HK6A 5GRYA 5HGHB 5C0EB 5I1CL 4GUPA 1BZQK 4I13B 3A0OA 2YPVL 2A0LD 2VDOH 2R2EA 3VXNA 4J1UB 5C6WH 5FUCE 3JWDL 5DJ2B 1RFDL 1IKFL 3E2HB 1E28B 4HXBL 3SKOA 4ZO6A 4NM4L 1NKRA 2ZNXA 4HWBL 2OSLA 2DRUA 4JRXA 3GRWA 1MI5D 4OZ4A 3QI9A 3KR3H 5I73B 3RIFK 3TF7C 3KDMB 2DQEL 3S9DB 1JUFB 1LD9B 1YC7A 4PJ9A 1RZGB 2CDGB 4JRYB 1T7ZA 2BRRL 5I74B 5J11C 1ACYH 4HIJA 5JMOC 1U3YA 1QFUH 4PRNA 3DXAB 4BSWB 4PJGE 3HC0A 5JQ6H 1AGFB 1NGZB 2EDEA 4JN1H 4C57C 2GAZB 4M4RA 1IEAB 1N26A 3MV7D 1FVEB 3VRJA 3EYSL 3ZKQD 4KKAC 3LY6A 4O5LH 3T0VA 3KS0H 4OI8A 1Z0NA 5JIPA 1KPUA 4Y4KC 2DTML 3DVNA 2UZIH 3HLAB 5F9DC 3VXME 1WZ1L 3C8DA 1YPZE 5JZ7D 4HC1A 4U7SA 2JJVA 3ES6B 2HJFB 4K94L 4KC3B 1X5JA 3BWAA 5D7LB 3RU8H 1X6LA 4YWGH 4NZRL 3RVVD 3U9PH 1CVRA 2A1WH 2NY5L 1Y6NR 1F00I 2Y06L 2OJZL 2DQTL 2APWA 1HE7A 1G7PA 5D8JH 2NYYC 4LMQI 4XWGH 2OK0L 2V7HA 1NCCL 4JFDE 2CK2A 1KN4L 1X5ZA 4GRWF 4JFFD 5BO1L 4I4WB 3GDBA 4TTDD 3OJDA 5IB4A 3SBWA 4OZHA 4ZS6C 4FQXD 4HMEA 4JR9L 1MHCA 2AV1B 4TSAH 3BH9A 3IFOA 3HE7B 3FQWA 4PJHE 1AHWB 2OCFD 2WLZA 3PWPA 4POUB 3K1KC 5BV7H 4S1RL 5C0AA 5LXGL 3TA3C 4FXGB 5C09B 2JK5A 5IQ9A 5IEHB 1BLNA 2A77L 3UTPE 3U7YL 2J6EA 3L5WB 3GGWA 4YBQC 2B1HH 4C56D 4NO5B 4KAQL 5D9SB 1UM6L 3QUYD 3GMQB 4HBCL 4P4KC 2NX5D 4PTUB 2FB4H 5K9OB 5GGTL 4H8WL 2UWEB 4H1LB 4MXWL 4OF3A 2AJUL 1W72B 5DUPH 2CXKA 3NACL 3KPSD 3CX5J 3KJ6H 4P3DA 3TCXA 3GO1L 1B2WH 1PDKA 2VLJA 1MFCL 5DURD 3REWA 1QFWL 4WUUA 4KXZI 4JZOB 4F7PA 5JOPE 1JWSB 5IWLA 2BVOB 4XI5C 3PJSB 4NQEE 4FQPA 4MX7A 5DJ8A 1EJ6A 1FIGL 2QADB 3KPQA 5ALBL 1I7RA 3MGOB 5DA4A 1L7IL 4KRPC 3VG9B 4ZNEE 4X80L 4OGYH 2EKSB 3H42H 1G0XA 1FE8H 4M1GL 2R8SH 2LVEA 4X98A 1NCBH 1RIHL 1AKJB 4L29B 2VLKB 1U93A 4YE4L 4PJAA 4XNMB 2I5YH 5DF0A 5J1AA 2CSPA 2FBJL 5IBUG 4PR5B 1A6UL 3UJTL 1EJOH 4Q9QH 4FTVB 1LK2A 5BS0D 3ULVE 5F93C 4FXKA 3MRBB 1T04B 4JHZA 5SX4I 4TRPL 3T2QA 5MEPB 1DBBL 5HGHA 5C0EA 4OZIB 3OZ9H 4KUZL 3H7BB 4J1UA 4JY5L 4EI6B 3RTQD 5MEND 5DD5H 3MPCA 5IJVB 1MHPH 3EFFB 5DJ2A 2MPAH 2NR6C 1E28A 3H2WA 4ZPVB 4HUWB 3LH2L 1JYNA 3W11D 1V7NL 2VDRH 3QQ4B 4HS3B 1ZLWK 2Y25A 3KDMA 2P5WD 4MLSA 5L2KD 1JUFA 5I17B 1LD9A 1RZGA 2CDGA 2P8LB 4JRYA 3P11L 4M62L 2AK4D 4F37K 5ITFB 3DXAA 4BSWA 1ZHNB 2FECL 2UZXB 3T77B 1YUHB 4RFOH 5KVMC 1AGFA 1NGZA 3H9SD 4L1DA 1RUPL 3WS6C 3ZDXE 1WQVT 1IEAA 4N1EA 4Y4FB 5IJKC 4OBRA 2ADIB 2ORBH 2YUVA 3IJHB 1KELL 5BXFB 4Q97A 1X4XA 3PF2A 3HLAA 1ZVYA 1MH5B 2OR8A 1JPSH 1JFQL 5IK3B 3L5HA 1SJXA 1NKOA 3ES6A 2HJFA 2EH7L 5D7LA 2VDMH 2J3SA 4MNGE 5T5NG 3G6JF 4PJ8D 5E5MB 2Z92B 5ACLA 2WQ8A 3ZE1E 5CJ8A 1L4IA 4OZFB 2VQ1B 1J88A 5DHXB 3WXWL 2IQAB 3EDDA 3QQ9D 4POZD 3SGDH 2X4RB 2JJSC 2E27H 2R2HB 4KDVA 4P9MH 4I4WA 1TCRB 5HHMB 5GS1C 4K9EL 3SDYL 3MUGB 1AY1H 2CDEB 2YWZA 1AQDB 3IT8D 1QBLL 3OAZH 2AV1A 2NY4D 2O26U 3HE7A 5ISZD 3KWWB 5ICZB 1AHWA 5IGXL 5LVEA 2DICA 3C6LC 3QP3A 3EJYC 2EE6A 2AJ3B 5BZWB 4EIGB 4FXGA 5C09A 2CR6A 1PFCA 1RZJL 4R2GC 2N1KA 3L5WA 5EC2B 4HAGA 5FYJD 1X6NA 5CSBA 4NO5A 5D9SA 4PTUA 3GMQA 1L6XA 3KPTA 4D9LH 3NH7L 3S88L 2UWEA 4JO1L 4H1LA 1DBAL 2CQVA 5EA0H 3QI9C 1W72A 3Q6GL 1CWVA 3QIWD 4YPJA 4MA8H 5EWIL 2V17L 4JVWA 3FKUS 2O5ZL 3INUL 1A14L 3DX6B 1MCLA 4XP6H 3WIHL 4JZOA 1JWSA 2VXQL 2Y07L 1JHKH 4X7DC 3JUYA 2BVOA 3PJSA 3CZFB 4KK9D 1DN2A 3STLB 3U4EB 2DQGH 2H2PC 2RGSA 2EDOA 3MGOA 5B3JF 4PJBF 4GRWB 1N4XL 7CGTA 1RZFL 1EBAA 4P59L 2ATKB 3RGVD 3IFNH 1GXEA 4LFHD 4U3HA 4OBSA 4H20L 3HNTH 3QYCA 4Q0XH 2BJML 2CIKB 1AKJA 4L29A 4TSBH 2VLKA 4Y8AA 5I76B 1UCTA 2R2BB 1ZT7B 2D9CA 4XNMA 2EDRA 3PGFH 3O2WL 1ZHLB 4PR5A 4XNYL 3LS4H 4FTVA 2ZCLH 1NCDH 1FO0B 4JG1L 4AL8H 1DQMH 3CGTA 3MRBA 1DFBH 3O6FD 4MMZC 1RUQL 2XTJC 4JKMA 5MEPA 4P99A 3MJ8B 4PJ5E 4OZIA 1TVDA 3MCLL 4UV7L 1IAIL 1PY9A 5LCVH 3H7BA 5D72H 4EI6A 4CU8A 1VDGA 4FG6D 1G9MC 5IJVA 3EFFA 1L0XA 4HJ0D 3S98A 3FFDB 1C8PA 4J3WA 1JNHB 5ADPL 1Y18B 4ZPVA 1MFAH 4HUWA 2ZOLB 4R8WL 4IMLB 1X5HA 4KDWA 3QQ4A 4HMDA 3QXAB 2H2SC 4HS3A 4Z77B 2UVEA 3VG0L 5TQ0L 5I17A 5IIEB 2P8LA 3UJIL 1HQ4B 3V7MA 2MNUA 2IAMD 3QNXB 5ITFA 3ZYIA 3DSFL 3T77A 3UBXB 5IW6B 1YUHA 4P2OB 1GGBL 2QSVA 1NQBA 3BGFC 2ZZUT 5GGVY 5IMKB 4HHAB 2DQJL 4Y4FA 2B0SH 3JV5A 1OAKL 1EERB 1YNLL 2ADIA 1C16B 3BKCH 4GXUM 3IJHA 4OB5L 5BXFA 1OAUL 5BRZE 1Y0LB 1BEYL 1MH5A 2BMKB 5IK3A 2Q3ZA 5F3HB 1J5OH 5KZCD 1TJGH 5F7LB 3DPBA 1G6VK 1JTOA 2X4SB 4GQPH 3KPRD 4WNQB 5E9DE 3S5LB 1DBML 1JNJA 3WSQL 4GS7B 2RQ8A 3QZWG 4Q2ZB 5E5MA 2Z92A 5DD3H 1EVUA 2PKDA 5DUMH 1BIHA 1JF5A 4XPBH 2DB8A 3D6GA 2I26N 4OZFA 4F15C 2VQ1A 1CFVL 1VGKB 3TC9A 2IQAA 1ZMYA 2X4RA 1ZGLP 5JMRA 32C2B 2R2HA 1RURL 3ARVA 1Q72L 1PQZB 5J12C 2J5LC 3WIFB 1TCRA 3HB3D 4B41A 4LSPH 3QEQD 5EO0B 3MUGA 2CDEA 1NBYB 1AQDA 2COQA 1TZHB 3X3GH 1N5YL 4IDJH 4LCIL 3BVNB 5ICZA 4WUKL 3OPZH 3CK0H 5EOCL 1FAKT 1GGUA 3RY4A 3OB0K 1IJ9A 4OUOA 4XVSH 3SKJL 1OY3B 2VQUA 4MD5B 2AJ3A 1J18A 5BZWA 4M1CC 5H8DA 1ROWA 3W81A 5C08D 1I1YB 5EC2A 3BGAA 1CFSB 2J7LA 4M7LT 4U1GC 3NCJL 3U46B 2IG2L 1PYWB 2EC9U 1GGCL 1OTSC 5A2FA 1INDL 2ZCHL 4K7PL 3E6FB 5I74C 3DX6A 1KEGH 4F7CB 3BHBB 2ARJQ 3CNKA 5KOVC 1JHLL 3QUMH 1XH3B 4IRJB 1HNGA 1HKFA 1LE9B 4AG4L 3RI5K 3MZTA 4D2NA 3GHEL 1U8NB 4PJXF 4JKKA 5HDQL 3CZFA 3STLA 3LVEA 5D2NE 1WISA 4TQEL 3U4EA 4OLZH 2EIEA 3IDGB 4MA3B 5L9DH 3SKNB 4LRNH 4ODHL 3C09C 2ATKA 4OLVL 5HI3C 3VFMB 2CIKA 5I76A 3VXTB 2R2BA 1ZT7A 1CXKA 1ZHLA 4YBLB 1K6QH 5ABDE 4HPOH 5KS9E 1FO0A 2AV7B 4GRLD 5AZ2H 4BZ2H 4TUKL 2VZTA 3SDXB 3RKDC 3X11B 1CS6A 1XIWB 5F97E 3MJ8A 2HVJB 4Y4HC 3O2DH 3CFEB 3SE8L 4WWID 4DK3A 2NY7L 5K9JL 1IGYB 1NC2B 3MV9B 3FFDA 5JW5A 1JNHA 2ZSVB 3QDGA 5HY9B 2EE9A 5JUEH 1Y18A 4U6VL 1LDPL 3BUTA 2ZOLA 1AHWC 3PQYD 3O6LH 4IMLA 1Q1JH 5JW4N 2GSGB 1IQWH 4LASL 3CMOH 2EIDA 3QXAA 3V0VB 1YEEL 3IJYB 4NGHL 4Z77A 5DMIL 1J1XH 1X5IA 4AQ1B 5IIEA 3OQ3B 25C8L 5HHXH 1HQ4A 4PJBB 4JO2H 2BC4B 1YEIL 1UM5L 3QNXA 3V4VH 2J8UF 5ELIA 5IW6A 3UBXA 1Q0XH 1NEZG 4P2OA 5TPWH 1S8DB 5IMKA 4GSDH 4QY8B 4HHAA 1VFBB 5E6ZA 2H26B 5J6HB 1C16A 4X0KB 3EO9H 3NZHL 3KYAA 3FQRB 5HHOD 1ZV5A 3UYRL 1Y0LA 4J3SA 4P46C 2R0ZL 2BMKA 4EUPB 2VZUA 5F3HA 3U4BH 2R4SH 2QADC 3U1SL 2X4SA 1NPUA 4E41D 4WNQA 3VGFA 2RCSL 3S5LA 4Z7WF 2UZYB 4TTGA 4KROB 4NOBA 4Q2ZA 5BZDB 2R1YB 4HQQH 4MJ4A 4MNHB 1NCAH 3I50H 1QYGH 1CLOH 1VGKA 4OQ1A 5C0RL 5I2IB 5DC4B 3ZHDA 1KENH 1PKQB 4DVBB 4XAWH 32C2A 2NXZB 1NCWL 5B38B 3DNKA 2PR4L 1UYWH 3WIFA 4XC1L 4JDTH 1RIVH 5EO0A 5DI8B 4DGVH 1NBYA 4QXWA 4GKOA 1TZHA 2P8MB 3N1GC 4AEFA 2DLFL 3BVNA 2EXWD 1UWEH 4WI6A 4XPTH 3ZT6A 1D9KD 4UZGA 4X5LA 4MD5A 4DFIA 3R06A 4R3SB 1EEUA 1F4HA 4GT7A 4JO4H 1FP5A 5C0JB 4LLWB 1I1YA 2E6JA 4M6OL 1CG9B 1CFSA 3QWQB 4OZHE 2FEDD 4NPYB 3U46A 1PYWA 3ZZ1A 1RY7B 2R4RL 4LRIA 1I1FB 2B8OT 1JZ4A 4LSRH 3FO9B 3IDXH 3E6FA 4MDIB 3ULVH 2J8HA 4F7CA 3BHBA 5D7SH 5MEQB 5C0AE 1XH3A 4IRJA 1TQCB 4UB0L 4HEPG 1LE9A 3P4MB 3WEXA 4PP1C 3IDUA 2GFBB 1U8NA 4QT5B 2VITB 1A6WH 4W4OA 1BGXL 2WAHA 1F45A 3R1GH 3IDGA 2W0FB 1K5NB 3BSZH 4MA3A 3SKNA 1JP5A 3S34L 2YRLA 2X89A 3E3QE 1YMHB 3VFMA 3BDYH 5KW9L 4WUUE 4DWHA 1ZS8A 1ZVHA 3VGDA 3BQUA 3VXTA 3QHTC 2E7CA 4LPCA 3B2UC 1T03H 2XRAL 4BSVB 4KTDL 4QXGL 4R9HA 5FYJL 2AV7A 1FH5H 3RVWD 5HTSA 1CLYL 1E4WL 1U91B 2QHLA 3X11A 1A6VL 4PPTA 1XIWA 3P4NA 2RIKA 1NMBL 2DM2A 1BOYA 1MFEL 4QTIL 3U7WL 3CFEA 2VDLL 4OT1H 2PO6B 5DJZB 1YEKH 5D1XD 1IGYA 3EYQD 4PJAE 3IXAB 2DIBA 2VAJA 2O5XH 3MV9A 4NZJA 2ZSVA 4QRRD 4UU9B 5HY9A 1S9VB 2ADFH 1MLCB 1T0NB 3AVEA 4LPXA 1YYLL 2GSGA 3T0ED 1R24B 4JY6B 3V0VA 3IJYA 3ZYOA 3M07A 4K23H 4NFBA 4ZXBB 1WIPA 3AS3A 4MHHI 4PJBA 3ALWA 5KVDH 2BC4A 3T0XA 2EC9T 4MD0B 3KPLB 2Z31D 4X4ZA 1CXHA 3MJ9H 5JHLL 3MA9H 4S1DD 1S8DA 4UI2A 5DQDH 2BRQA 2NY0C 4QY8A 1VFBA 5J6HA 2H26A 5TDPA 1HYRC 4JREB 5HYSG 4X0KA 1FG2B 3FQRA 3HC4L 4Q9RH 2A9NL 3P77B 3QBTB 5GISL 4JRYE 2NLJB 3V8OA 3IRZA 2NNAB 4NKOB 4EUPA 1ZTXL 5SWZD 3EGSA 5E2WL 3DXAE 4RMQA 4K3JH 2XXCB 1D5IL 5E7FA 5BZDA 1YECH 2R1YA 4WHYG 2AS5M 4XPAH 5I1DA 4KWUA 3BZFB 5D2LF 3MLYL 4WO4C 3TT1H 3ARQA 5I2IA 3EKCA 1T22B 3LEVL 4K8RC 4F3FB 1RVFL 1PKQA 5T1KD 3FFCB 4DVBA 3N06B 5B38A 1INEH 4UT6L 4GH7B 5D7LE 1LHZA 5DI8A 2OP4H 1FV1B 5I75B 2P8MA 2D7QA 1KIPB 4M43L 2J8UB 4IOFC 4S2SB 5DD1L 4TSCL 4R3SA 1CE6B 1NFIB 4RX4D 1BZ9B 5E6IB 5JR1L 2Q7NA 5C0JA 3BKML 4LLWA 3S35X 3H7LA 4U7MA 1CG9A 5L88L 5D7JB 1QBBA 5GS0D 1JGDB 4NPYA 1I8MB 4YHLH 2IMMA 4LNRB 1NJ9B 4OCXL 3MX0A 4AH2B 1I1FA 3RIAF 3IGAB 5DRWB 3VI4F 2AVGA 3FO9A 4MDIA 4ODTL 2IAND 4NN7C 5MEQA 4Z78B 3WIIH 1XGRB 5IT2L 5C09E 1LP9F 3P4MA 2QKIB 5F3BB 1QRKA 4OFYA 1EGJA 2GFBA 4MAYB 4P2OC 1DZBA 1IGCH 2VITA 4M1DL 4QT5A 5FYLH 4CBPA 3U0TB 3SKMB 3EHBD 2BOCB 1WC7B 1KC5H 5DK0B 1U0QA 2W0FA 2UWEE 1K5NA 4OAWB 5IKCB 4MJ5B 4UMGA 4M6NL 5FGSA 2D7TL 1YMHA 2MCG1 3ULUE 4AEHL 1RI8A 4NN5C 5DO2C 5J1SC 5KVEH 4GS7C 4U31A 2VABA 4BSVA 3WFEH 2IPTL 3ARFB 3NIFF 4ALAH 5GGVL 2P48B 4X6EB 4ODBD 4I3SL 3VGAC 1NGPL 1OP5H 3CXHJ 1K2DA 1Z3GH 3RZCD 9CGTA 1MELA 4XNXH 1RU9L 1OTUC 2VLKE 4G9DB 2PO6A 5DJZA 1F8TH 3IXAA 4LQFH 2AEQH 5DQ9B 4A6YB 1C5CL 4N8VB 4Y16B 4TVSa 3TIEB 4UU9A 1S9VA 2XQBH 5DC9B 1MHEB 5KSBE 4APQB 4Z7NF 2IQ9L 1MLCA 1T0NA 4UBDD 3VXRE 2B20A 1FDLH 1R24A 3TPUB 2WUBL 4JY6A 4F2MB 3O3DB 4Z18A 4HLJA 4ZO9A 4ZXBA 1H3GA 4G3YL 3OAUH 3VXOB 1AQKH 4QO1A 4R7DB 4MD0A 3KPLA 15C8L 2VB5A 4LRIC 3V5KB 4ZYKB 2LTQB 4XPGL 3QFJD 1ZK9A 1G9NH 3UTZB 1TMCB 4HUXA 4GW4B 4UTBH 1FG2A 4IRJC 4N0YH 3DI2B 4AENB 4UIKH 4WCYH 3P77A 1EO8L 1ORSB 2NNAA 4NKOA 1J7VR 3QG6B 4YHOH 1IT9H 2QQLL 5T33L 4DK6A 3ARGB 1Q9LB 5DVMA 1EHLL 4MZ3A 4HT1L 3DV6B 2LE9A 1KCRH 1N64H 3T4YB 4MS8C 4FQIL 1I8IB 3DWTA 5E7BA 4XPFL 3BZFA 5HYJD 4M7LH 4D94A 1EHXA 1GJIA 4KKNA 1T22A 1TETL 1WJ3A 4F3FA 4HUMB 3FFCA 4NZUL 1QRNA 1C12B 2ENYA 2DI8A 4KKLC 4XP4L 4I3RL 2CMRL 3MUJA 1EH9A 4IBLT 4KKAD 1J86A 2L7JA 2F8VA 4KJPD 5AUMB 1FV1A 4L4VE 1KIPA 1RZKH 3SGJA 2J8UA 1V7ML 2CH8A 4OFPA 3RUGF 2FR4B 1E6JL 3Q2CA 1NGQL 4QF1B 1A7NH 1NFIA 5E6IA 1BZ9A 2I24N 4G9FB 4JKPL 3GM0A 1L9NA 5EBLB 5D7JA 2J2ZA 2VDNH 5HHME 1JGDA 2IEPA 1I8MA 4LNRA 4IRZL 2CGRH 4LEXL 3RVUD 1M71B 4AH2A 1KGCE 3HKFA 3IGAA 4CNIB 2AGJH 3MACH 5DRWA 2CLZB 4AZ8A 4MGXA 1EZVX 3JZ7A 4GQ9L 4GLRH 4Z78A 3TYFB 5JDSB 1FNSH 4ZS6D 1XGRA 5D5MB 3PV7A 2QKIA 5EU4B 5F3BA 4NBXB 4OM1H 4MAYA 4Z8FL 4QHNB 3U0TA 3SKMA 3F65A 5DJAB 2BOCA 5DK0A 2YA1A 4HWBA 2L4OA 1QBML 1IGJA 4NUGL 4PB0L 3OJ2C 2VH5H 4DAGL 4NDMB 4OAWA 3GNML 4PJDF 5IKCA 3K46A 1J8HE 4MJ5A 4F7TB 4IJ3C 3PL6B 2XA8H 3QDJB 4G80B 5EC1B 5DZLA 4OI9A 2D03L 4IDLA 2MQ0A 4YHIB 4HF5L 4YQXH 3S97C 2NXYB 2EEAA 4KROC 5C9KA 5EFIB 3ISWA 1CR9L 12E8L 4L3AA 2BFVH 4XP1L 1HXYB 3PXJA 1BP3B 1HZHL 3ARFA 4X6EA 4FMKA 2AJXL 3ME0A 4GRWE 2P43B 1ADQL 5KN5B 4LDOB 5DMKB 4XI5D 1Z9MA 3DARA 4HSQA 2NXZC 4N9GB 4IIQC 1OB1B 4G9DA 5DGRA 3O2VL 3WO3B 1FYTD 2ILLA 1BZ7B 1D6VL 5DQ9A 4A6YA 4N8VA 4Y16A 3JV0A 3MNWB 2NY6C 5KJRH 2HRPH 5FKAB 3ZYJA 1MHEA 3QDMB 4ZUWB 4APQA 1FNEB 1BJ8A 1I85C 4NO0D 2XTLA 4PRPD 1QFOA 4F2MA 4S1SL 1JGEB 4PD4J 2LFGA 4D3CL 3VXOA 1A1OB 1XEDA 1SVZA 5B21A 3UTTD 2BNRB 4R7DA 1E4XI 3V5KA 3C60D 4ZYKA 5IMLB 2IFFL 4HC1H 1VENA 1E4KA 4V2BA 3QDGE 4TYUA 2VMFA 3AM8A 3UTZA 1T80A 4GW4A 3DYMA 4WWKC 4I77L 4ODSH 3TP4A 4RFEB 4AENA 4F9PC 3FOLB 2NR6D 4Y19B 5CWSB 1RJYB 4YC2B 4I1NB 1AXIB 1XT5A 3QA3B 2X4NB 3TNNB 3QG6A 3FB8B 4H5SB 2Q20A 1ZLVH 1C1EL 3PIQB 3FRUB 3D48R 3JWOL 3ARGA 2GTZB 1Q9LA 4EI5C 2J4WL 3OHXB 1JPTH 3DV6A 5LAXB 5IBLC 1G9MH 3T4YA 4U1KB 3BE1H 1I8IA 2QSQA 4MA7H 1I9JH 3BKJL 3GKWH 4XMKL 4GBXD 3VGGA 5JA8B 4W81A 2HAZA 2J88H 4NNPH 4Q74A 2VXSH 2P1YA 3A67L 3K7UA 3H3KA 3UJJH 1C12A 1V05A 2F54E 3SE3A 2QQNL 2X1QA 3W5MA 3O3AB 1RULL 4L4TE 2J6EH 3VFGH 1ERNA 5AUMA 1HOCB 3QWRA 5IFHL 3UO1H 4YLQT 1CTNA 3MBXL 3MREB 4G8EB 1GHFL 3TYGL 2FYYB 1CQKA 1NDGA 1Q0YH 3P73B 4Z9KB 2FR4A 3C08H 2PO6C 4QF1A 5CEZD 3IFLL 2XKNA 4NHCL 4QEGA 4M6MH 1JGUL 4G9FA 5EBLA 2VRAA 2D3VA 1J0IA 3IU4L 1DQDL 3OAYK 3DGGB 2JJUA 1M71A 2F58H 2YK1H 2CLZA 4ZXBC 5AEAA 2PW2B 5FYKE 2Z4QB 5LWYL 3CU1A 5JDSA 3TYFA 5IVXF 3GKZA 3CIQA 1UZ8B 5EU4A 3DIFB 5D2LA 5C0DB 4QHNA 3GSQA 2EZ0C 2X4OB 5DJAA 3C6LD 3WFDH 5DGQA 3FQNB 3NTCH 4DEPB 2M8XA 4KZDL 3BT2L 4NDMA 5K9KB 5I1GH 1UXSB 5JA9A 4J3VA 1Q9WB 4F7TA 5I1HL 4XB7A 3TVMC 4R2GD 5IQ7L 4YDKH 1KFAL 3PL6A 3STBA 2W1NA 1U6AH 4XP5H 3BP5B 4TN9A 5DEGB 2BERA 3QDJA 4G80A 3T2NH 5EC1A 3BPOB 4YHIA 4DN3H 2QSCH 4H0HB 4HWZB 1NUGA 1MWAA 1XAUA 5EFIA 3RUGB 1Q9OB 2YD4A 3JTSB 4MQXD 1HXYA 1JBJA 4WFFD 1X3DA 3G5XB 4KUCF 3AREC 3FN9A 2VLLB 5KN5A 4XVJL 5DMKA 4RGOL 1FSKB 2W92A 4HFUL 1MJ8L 2GJJA 2BVTA 2EECA 4N9GA 1FIEA 5L2JA 1IBGL 1OB1A 5E5UB 3QHZH 2Z35B 2Q7YB 1W0VB 1KJ3H 1BZ7A 3MNWA 1FC1A 3LS5L 5FKAA 2AABL 3QDMA 4ZUWA 1CGUA 1AXSB 3S35H 4ESKA 3F58H 1FNEA 3SGJC 5FHAH 4RA0C 3C5ZB 3RBGA 3I9GL 3KPMB 1MI5B 1JGEA 5DMYA 2GK0B 4MXQD 1TTGA 4GXVL 3VA6A 4Z7UB 4YXHH 4YHZL 1A1OA 2BNRA 3RY6A 3LZFH 3MV9E 5IMLA 1UEYA 3EDFA 1FZJB 1GGTA 5HHPB 2NZIA 2V9RA 3DECA 2YD2A 3DUHA 4L5FL 5E56A 4OCNC 5FO7B 4JPVH 4RFEA 3FOLA 4NQDD 5CWSA 4Y19A 3JWDC 2X42A 4I18C 2XZCL 1RJYA 4HW6A 4X8XA 5B3JE 1PGRB 2IF7A 4MAYC 4PYHA 4PJBE 5KTEH 3QA3A 2X4NA 1FVCB 3TNNA 2IBGA 3FB8A 4H5SA 3L1OL 3PIQA 1UWGH 1MVFA 1MEXL 3FRUA 3L5IA 4OIIH 4DKDC 2H2SD 5KAQF 2GTZA 3IAGC 2QHRH 3G6AB 3OHXA 5LAXA 4GMSL 2EICA 1JJUA 2DQIL 4U1KA 5J56B 1X5LA 5HYQB 1KPRB 5IEKB 4ZS7L 3R4DA 1TFHA 4RNRB 3ET9F 1CDCA 3A6BL 5TE7H 5MI0B 1SQ2N 4P5KB 2I07B 5FKPB 2ADJB 5FCUH 1GC1H 5KBNC 4RQQB 3T04D 2BXZA 3O6MH 3ZSTA 3O3UN 4JFFB 3O3AA 2FGWL 4G5ZL 1URLA 4QRUB 2X9WA 3HFML 1HOCA 4FQXB 5ITBH 4HV8B 2HP4A 4FFVC 3VD5A 3MREA 4H1LH 2FYYA 3P73A 1G7QB 4HGMA 4LU5H 1PKOA 2DAVA 1PKQE 1QLEL 1OTTC 1J1OL 2IGFH 1F3DJ 1LILA 4LGPB 1IILE 2QLVB 3TWCH 4JFYB 4B53A 5F72S 2FEEI 1B6UA 4C56B 1MREL 3QUYB 1KCSL 1QNZL 1V5JA 2X05A 2NX5B 2AJSL 3DGGA 1EX0A 4TVPE 5GRZA 4E5XB 2X9XA 5ADOH 1MCOH 4PGCB 3R0MA 5JXEA 3CC5B 2PW2A 4EXPX 3KPSB 1HDMB 4MB5A 4WV1C 2Z4QA 1DQJB 2CKBL 3V4UH 2HKFL 1UZ8A 4MCZB 5E8EB 5FAAA 3CDCA 5CJOL 3DIFA 2ERJB 1A5FL 3EO1B 5C0DA 3LDBC 5J0BA 2ZKHL 2X4OA 5D6CB 1UENA 1X5YA 4P3CL 3FQNA 4WFED 3BDXA 2APVA 2IBZX 1UXSA 4M1CD 4AY0A 2W9LA 4OCWL 1Q9WA 5CD5C 3VA2C 5F7EL 1I1CA 3NFSH 1OGAA 3BP5A 5DEGA 3MLVH 4HS6B 4XH2B 1F58H 5FUOH 2HH0H 4UILL 4HWZA 1OTSD 3PP3H 3VWJD 1KIQB 3ARGC 5SWQA 1TTFA 2DN7A 4PBXA 3RUGA 1Q9OA 3F6IA 3JTSA 2X5PA 3HAEB 4X4YB 3DMMB 4HKJB 1BQSA 1TVHB 4EXKA 1WWWX 2EYSB 3G5XA 5BS0B 3D9AL 4QWWC 2XPGB 2VLLA 5M7QA 2F8XC 2MCPH 3CVHL 2BXYA 1X7QB 4JDZB 4PGBB 3V79C 1WBYB 2Z35A 3PWLB 1K8DB 1W0VA 5DQJB 5AAMA 3RTQB 5DFVD 5AG9A 5GRXG 1C5BH 1AXSA 1Z9SA 2W9DH 5IM7B 1KCLA 4L8SB 3C5ZA 4JM2F 4GMTL 3VDCA 1XGUB 3GSVB 3KPMA 1MI5A 2VC2H 4WFHD 2GK0A 2M26A 4MCYB 4Z7UA 1VFOA 2CKNA 3DO7A 1T5XA 2E9IA 2P5WB 1FRGH 4ZODA 5L2KB 2FO1A 3UPAA 4PJDA 1CU4L 2P44B 4D0CB 3QPQC 1IRAY 4JQXA 4U1JB 1T1XB 2JIXB 1YC8A 1HH6B 1PEWA 3VFNB 2AK4B 1FZJA 2UUDH 5HHPA 3LMJL 4Y4HD 3ZTJH 1NH6A 3O4OB 3TJEH 3L95B 4NWUL 3OBAA 4KK5C 2DBLH 4HXAH 1A6PA 5FO7A 2YHGA 3SGDI 4DVRL 4PS4L 2VXTH 4OZFH 1FVCA 5CILH 1FNAA 5DRXB 3QCUH 3G6AA 1MJUL 4HUUB 1G84A 3F5WB 3BP6A 4PYGA 3D85D 3WJJA 4MDJB 5CKGA 1E4XL 1NLBL 1QVOB 1KPRA 2VE6B 4PJ8B 3TZVD 5HYQA 5IEKA 2NY2D 4RNRA 2NXYC 4HH9B 3LIZL 4P5KA 5FKPA 2ADJA 4KJYA 1F4YH 3PGDB 1V8HA 1AXTL 1JGLL 4RQQA 4LSTH 3GI8H 2HFGL 3MNVB 4JFFA 1YZZA 3GBNL 2WWKO 3CH8A 2GTWB 4I0PB 4QRUA 4DFHA 3CFCH 4FQXA 4D9RD 4TPRL 2FZ3B 4HV8A 4P46D 5T3ZE 2NY4B 5ISZB 4L3ED 3QXWA 5ICXA 1CF8L 2FDBP 5C0IB 1G7QA 3NCFB 3FFCE 1QRNE 1GVIA 2Q76B 5D96B 1N7ML 1HKLL 2AJYL 1J87A 3BW9B 2FIRT 4C56A 3QUYA 3K8KA 2NX5A 4E5XA 4G6MH 3BISA 4PGCA 2J8UE 3CC5A 4HIEB 3KPSA 1HDMA 4BZ1H 4GRWH 1QFPA 1DQJA 2QSTA 4XC3L 1S9KC 4MCZA 4PRBA 4Y1AE 5E8EA 4K9EC 5LKNA 2YRZA 1YNKH 3EO1A 3JVGA 4Q9BA 5D6CA 5D7KD 1A3RL 4AIXA 1H9VA 1S3KH 3LB6C 2DQUH 1MCFA 4XXCC 1FO0H 1JHTB 1YJDL 1GAFL 1NCNA 4PV9B 1RZJC 4Z7WE 1S7RB 4HS6A 4XH2A 1NUNB 1DBJL 2D0HA 4JFZH 3GK8H 5FHBL 3H9HB 1KIQA 5CEZL 4FA8A 2FH6A 3HAEA 5CFHA 5T5FH 1CDGA 4X4YA 3DMMA 4QCIB 1LO3H 4HKJA 4R97B 4XGZB 3WLWC 3VFRB 3HA0A 3ZL4H 2EYSA 2OR9H 4LPYA 2XPGA 4KU1A 4JPKH 5DVOA 1G6RH 1X7QA 4Y2DC 4JDZA 4PGBA 1WBYA 3PWLA 1K8DA 5DQJA 1UVQB 3RTQA 3GB7B 4RBPK 2CK0H 1FC2D 5IVXA 2HYMA 3IDMB 2GYSA 4FQLH 5IM7A 3C9NB 4L8SA 4ELMF 1XGUA 3GSVA 4LAQH 1DBKH 4MCYA 4RWYL 4KQ4H 1RMFL 2P5WA 5L2KA 4J6RL 2OTWB 1IE5A 4D0CA 4U1JA 1T1XA 2JIXA 4WEBH 5CBAB 1HH6A 3VFNA 2AK4A 4PTTB 1T4KB 5JQ6L 4KTEH 5F89B 3L95A 2C26A 2GY5A 2EDFA 3BESR 1IL1B 5MHSE 4O5LL 1NLDL 1P6FA 3SDDB 5DFTA 4I9WD 2FX9L 5DRXA 5EU3B 4DEPC 1FPTL 3MRFB 1T1ZB 3MR9B 3U0WH 1RUKL 5KZCB 5JW4Q 2VDKL 2WZPD 2ED9A 2X2YA 3EFDL 3KPRB 5IBTL 4HUUA 1MY5A 4G6FD 2AI0H 1TJHL 3QUXB 4MDJA 4PJ8A 1QVOA 2VE6A 2AXJA 2DMKA 4PRIB 4V1DD 1PG7H 3U30B 4UNUA 2A1WL 2R69L 4DTGH 3CCHB 4HH9A 1OT2A 5GRVL 5D8JL 5I30H 2A83B 1BPVA 3HI1B 4JM2B 3MNVA 4FNLH 5EULV 2X40A 1ITBB 4EBQH 3WCYA 4I0PA 3QEQB 2NY3D 4M7ZC 2PXYD 2FZ3A 1EVTC 1XF4B 1FSKC 1UKSA 4RDQF 5ISZA 2Y1VA 3H9YA 4ZFGL 5C0IA 1MCRA 1FFPA 4JAMB 1P4IL 3SDAD 3S7GA 4GW1B 5E2UL 1NMCC 3DTXB 2Q76A 1MIMH 1TJIH 5ESAB 5C08B 1IZKA 3BW9A 4WO4D 4RMRA 3M1BB 5DR5L 2V9QA 5HHNB 4HIEA 5DUPL 2X70B 3KJ6L 5B3NA 2YD6A 3ORJA 5I1JH 4MYWB 4RMSA 3STZB 4G9FE 3VXMD 1JWMB 3IDYB 4KZEH 5IROC 3MODH 4IOFD 1BM3L 4QXUL 1OAYH 1RUAH 5AAWA 4OI7A 4O9HH 2WK2A 3TBVB 3B9KD 2VQTA 1JHTA 1GGIH 4PV9A 2FEEL 2ZOKB 5TFSH 1S7RA 4OGYL 3H42L 3QPXL 1VFUA 2R8SL 2HT4C 4ZTOH 5EZOH 5I1IL 4LIQL 1C7SA 5L0QB 4WW1B 2XICA 3BX7C 1YEDB 2GJZB 3GBMH 5D2LE 2ZUXA 3KG5A 3WUZA 2I5YL 4FMFA 5CBEB 3X17A 2VZ1A 1WV7T 1YEHH 4QCIA 4H88H 5EIVA 1T66D 4XGZA 2V2WB 2VXVH 1KN2H 3VFRA 2NZ9D 3HI6L 3L3KB 4GRLB 1ACZA 4PBWD 3MZGB 4KQ3L 3AXLB 1H5BB 3QDJE 2X6MA 2GKIA 3OZ9L 4H26A 4ZO8A 2W0KA 2UV3A 4TTDC 2E7MA 1UVQA 3GSNL 1S9WB 4G7YH 5DD5L 1WT5C 3GB7A 3TT3H 1MHPL 4FQXC 1ZA3B 3AFLA 4OLYL 5CINL 3IDMA 4AEEA 4JQVC 2YD9A 4CMMB 4MLIA 4YAQB 5DO2D 3EYVB 3PQYB 1NMAH 2CUHA 4IMKA 2VDRL 1OLLA 3ARRA 3MBEB 1RD6A 5JHDD 1QSVA 2E7LC 3MJ7B 1UG9A 4GRMB 1FNHA 2OTWA 3KPNB 4TOYL 1UA6L 1R3JB 5CBAA 3VI4E 5JOPD 3QUYC 4EUPH 3VFUB 4PTTA 1T4KA 4RFOL 3W9DB 2A6DB 2G60L 2C3HA 3ULVF 5F89A 4GAYB 1QKZL 3EJZC 4YHKL 2HFTA 3NFNB 4L9DA 5BVJB 4J4PC 5FUZH 4YR6B 5EU7E 4DJMA 1F3DH 1IL1A 3RIAK 1ZT4B 4U1MB 5TE6L 5HHOB 4XCCH 3SDDA 4LVOC 5CMAB 2HLFC 4NRZB 1VPOH 4LPWA 4MJ2A 1IGIH 5EU3A 3MRFA 1T1ZA 2VN7A 3MR9A 4FFYH 4Q9CA 4E41B 3KPRA 3Q1SL 3PDDA 1E6OH 3QUXA 5GGRY 1T6VN 4GXUN 4HMCA 5KVGH 4PRIA 3F7YB 1OAZH 1CFQB 4Y19E 3CCHA 4JFED 5L8KB 3NIFE 2A83A 1A3QA 1WK0A 3HI1A 3GI9H 3B2VL 4JM2A 4NN6B 1U8IB 5HDOA 4P9ML 1O7SA 4OKVB 1OPGH 3QEQA 5I0DA 4ISVB 3ZDXF 2ITCB 2ESVB 4NRYB 1AY1L 1XF4A 4JPWL 3ZSSA 5EOQH 3P9MB 5C0BE 1D9KB 2VDQH 3MLRH 1VERA 4TNVF 3N9GH 5DTFB 4Z7NE 4JAMA 1I7ZB 3G5YA 4GW1A 4JB9H 3DTXA 1SJEB 2VOTA 5SV3A 5ESAA 5C08A 1AO7B 5SWSB 4L8SC 1LEKB 1EGJH 4NO3B 3TESA 3M1BA 4X9FA 5SX5H 3T65B 1B6DA 4D9LL 3AAZB 4NC0B 3ARDD 5HHNA 4WW2B 1F97A 2FJHB 2FHCA 3BN3B 5GGSB 2X70A 4MA8L 4KKLD 4DW2L 1NAKL 1YQVL 2ZWLT 3OV6A 4IRSC 3OKEB 4XP6L 3FB6B 3STZA 1UM4L 1Y6MR 4WY7L 2YA0A 4ONOA 1JWMA 5C07D 3LHPH 5HVHB 5IB3B 5HDBF 1CDHA 1EUTA 3O4OC 2W9EH 2QR0B 4DCQB 3HMXL 2DQGL 3CPLB 1JRHH 3TBVA 1A6AB 3ZKNC 1JZ8A 2GJ6D 2BVEA 3RVTD 2ZOKA 4JDVB 4K7FB 1DVFD 4LCCB 4RWHA 4X9BA 4HH8A 3E0GA 3IFNL 4WW1A 3I3DA 1YEDA 3CFKB 2GJZA 4YNYB 3FHAA 3GSWB 4OCYH 4L1HA 5CBEA 2IADB 1I9IH 4AMKH 2WIIB 1F3JB 3L5XH 2V2WA 2ZP0T 3LS4L 3L3KA 4GRLA 4YEEA 1ZGLM 1DQML 3FN0L 3WS3B 1DFBL 4PRHB 5D1ZB 1B4JH 3MOAL 1OGAE 3AXLA 1H5BA 2BHYA 3SY0B 3QQ9C 5FK9B 4ZAKD 5LCVL 1OVZA 5DJYB 4KDTA 3RWJB 3UC0H 3RUGE 1S9WA 5D1XB 1ZA3A 4OCMC 4KHXH 4S1QL 1MFBL 4QRRB 1H0DB 5B8CC 2NY4C 5D1QD 1UH2A 3QUKB 4CMMA 4M93B 1XF3B 4X9GA 4YAQA 3MO1B 3HZVB 3EYVA 3PQYA 3OR6A 1F4WH 4WTZA 3T0EB 2KDGA 3BD3A 5IG7B 1TQBB 3MBEA 1VEOA 3WKML 5I1EH 4JQIL 5J13B 1AR2A 4UUJB 5IW3A 1AJ7H 1MCWW 3MJ7A 4GRMA 3KPNA 2DI9A 4P2QD 3SKUD 5GRJH 2BCKA 1R3JA 2CR3A 2VWEE 4NNYB 3TBWB 5FYJU 3VFUA 1VKXB 3VFSB 6CGTA 2Z31B 1U8JB 3W9DA 3QIWC 3IETB 2A6DA 5C2UB 3MNZB 5FF6B 4GAYA 4YEFA 3EDJA 4G7VH 3NFNA 3VXSE 5BVJA 3DV4B 1VADB 3DBXB 1MI5E 5T3ZH 1N5AB 1MRFH 5DVLA 1HWHB 4YGVB 4U1MA 4M9OA 5HHOA 4Z7UE 1BAFH 4FQHB 3TEUA 1EMTL 4M4PA 4PJDE 5CMAA 2YBRB 4NRZA 4NBZB 4KK9C 1CIDA 3U0PB 3L3HB 5SWZB 3RNQB 3BPCB 4OF0A 4NM8H 4RA3A 4E41A 3T0BA 2OL3L 3MUHL 1O7VA 2ARJB 1EIBA 5CJQH 3WFCH 1KF9B 2YXMA 5DD3L 2XA3A 3F7YA 5DUML 3RGVC 4RGMC 4ODVH 1XF2B 1CFQA 4XPBL 5F1IB 2CJUH 5K9QG 4WU7B 4NIKB 1N6QL 4ELMA 4KPHH 1A3LH 4KKCD 5JDJA 5T3XD 1JV5B 4YZFF 2FGZA 2CD0A 1CXFA 5FDYA 1U8IA 4LMQE 2OJEB 2BHZA 4DQOL 4OKVA 2F5BH 1I1AB 5LQBL 4LSPL 4ISVA 1A0QH 2ESVA 2ITCA 3O6FC 4NRYA 1S7TB 1BQHG 3X3GL 3P9MA 5F9JB 5IHBA 1D9KA 2JLLA 5J1TC 3CK0L 5DTFA 4JGJA 6FABH 5EUOB 4EI5D 1I7ZA 2EE2A 2VUOA 2YPVH 3FO0H 4HJ0C 2ZPKL 1SJEA 4J3UA 1JMZA 4RGNE 4YFDB 4K3EH 3D0LB 1AO7A 5SWSA 2WANA 2AQ1A 1RFDH 1LEKA 4NO3A 3BDBA 5HYIA 4NHUB 1IKFH 1FZMB 3T65A 4HXBH 2DLGA 3P0VL 1JTPA 4NM4H 3AAZA 2V5MA 4O02H 1ADQA 4HWBH 2FJHA 3OWEA 4WW2A 5GGSA 1I7UB 4A2LA 1MAKA 3RQ3A 5EU6E 1EHNA 4BUHA 2IANB 5BRZD 2DQEH 1KEGL 3OKEA 2UVFA 3FB6A 2IAMC 3QUML 1RV6X 4RAUB 2BRRH 2OI9C 4JN2B 1F4XH 5GS2D 5C86A 5IB3A 3O41B 2DQHH 4EN3A 2BOBB 4MHHG 4C56E 2EDYA 2QR0A 1ITCA 4DCQA 4WFGD 5E9DD 2VSDA 3ZYZA 3CPLA 3TH2T 1A6AA 4S10A 5AWNH 3S37X 4JDVA 4K7FA 3T09A 2WSKA 4MB4A 2EIBA 4LCCA 4Y5YB 4P9HH 5E2TL 1WBXB 3BZ4B 1IC4H 3CFKA 4YNYA 3GSWA 5ALCH 3VW3L 4DZ8B 3RY5A 1WICA 4K94H 2IADA 3BXNB 2WIIA 1F3JA 3F6LA 3X14B 2F9BT 2NY1B 3BYTA 3FMGL 4X6CB 5AZ2L 4M03A 3BIKB 1NUFA 2YR3A 4Z7VF 3WS3A 1XGPB 4PRHA 5D1ZA 2NY5H 4A2MA 5BCAA 2OJZH 2DQTH 2EZ0D 3D39D 5E99L 2NTSP 3SY0A 5FK9A 3RZCB 3O2DL 1LEGB 5DJYA 3RWJA 1KN4H 1YEGL 4DGIH 2FJFB 1CFBA 2BNQD 3HB3C 1K85A 5D1XA 5BO1H 1CGSL 3NIDF 4I5BB 1HHJA 3JXAA 4QRRA 1H0DA 3QUKA 1I7TB 4JR9H 4LEOB 1XF3A 4J3TA 3MO1A 3HZVA 5LBSH 5CSGA 3O6LL 1Q1JL 1UH3A 3T0EA 1IQWL 4WEMB 3CMOL 1IQDB 5IG7A 3BRFA 3LPWA 5DLML 4UUJA 1J1XL 4AEIH 4LVHB 1YYMH 2WINA 5LXGH 5HHXL 2A77H 4NNYA 3U7YH 3TBWA 2EYRB 3PHSA 1VKXA 3VFSA 1RSFA 2Z31A 5IVXE 2CO6B 1U8JA 2X4TB 3IETA 3QFJB 3MNZA 5FF6A 3REVB 4H8WH 4MXWH 4GSDL 3DV4A 4OJFH 1SHMA 1VADA 3NACH 3DBXA 1N5AA 3WFBL 3PWNB 1IGML 3GO1H 3EOTH 4YGVA 1MFCH 2P5WE 4FQHA 3BD5A 1A1MA 2YBRA 3NA9H 3QIUD 4ACPA 3V5DB 3U0PA 4KKBC 3L3HA 5SWZA 3RNQA 3BPCA 5GJSH 5H37H 2C3GA 3VD3A 1W0YT 4X5XB 1FIGH 4OV5B 2ARJA 1J05B 1MPAH 4UNTA 4LAJH 5ALBH 4PY7B 1F13A 3X3FH 1L7IH 4UINH 4HWUA 3I3BA 1MCCA 1NCAL 5J11B 1QYGL 1XF2A 4X80H 5F1IA 5HYJB 1SEBB 4M1GH 1E0OB 4WU7A 3VFWB 3UTQB 1XGYH 1S7UB 5CEYB 5JLZB 1JV5A 1KENL 1QPXA 3OKMB 4XAWL 4YE4H 4B0MM 2OJEA 4XHJD 5E2VL 3F7RA 3D2UD 4FQ1L 2FBJH 1QZ1A 4GRLC 1I1AA 3UJTH 1RIVL 1IGFL 4N8CL 2HG5B 2LABA 1S7TA 1A7OH 4Y4KB 4GLRI 4WHTB 1H5BC 5F9JA 5I8KL 1B0RB 3ARTA 1UWEL 2YD8A 4GG8B 5EUOA 1BFVH 4KUZH 2A9ML 4RX4A 1ZHKB 4Y8DC 5IHLB 4M02A 4QRSB 3D0LA 5A43C 1H3UA 4NHUA 1FZMA 3LEYH 2X9YA 3LH2H 3QXTA 1I7UA 3LQAC 1NFDB 3CVHB 2C1PA 3TGXA 1KG0B 5B39B 1NGWB 3IDXL 4OQTL 2IANA 5D7SL 1T3FB 3CLEL 4JJHA 4PJ9D 4RAUA 3UYPA 3P11H 4JN2A 4FFVD 1X9QA 3O41A 3W0WB 4B7LA 4NWTL 4M62H 3QO0B 4XBGB 2BOBA 4V2CB 1SBSH 3HMWH 5CJ5A 3R1GL 4FHBD 1GL4B 3QAZC 3TA3B 1VESA 2OZ4A 1ZLSL 4Y5YA 4P4KB 1WBXA 3BDYL 3BZ4A 1QSZA 3NZ8B 2CLRB 4HZLA 4DZ8A 1T6WA 5DHYB 5DDHB 4P2RB 3BXNA 1X5FA 4BH8B 3OXSB 2LAGB 2P49B 3X14A 2IH1A 3KLSA 4YFLF 1IKNC 4X6CA 1PD6A 5IV2B 3BIKA 4KI5C 1U8KB 1JVKA 1XGPA 4JANB 3DSNA 3OKKB 3ZDZF 3UCRA 5D4QA 4QRQB 1LEGA 3VWKD 4NT6B 3RDTC 2FJFA 3MLZL 3O0RH 4JFOB 1YEKL 4KRPB 1FYTB 3GJEB 1GOFA 4I5BA 1UWXH 5DD6B 1JPFB 2I25N 4P49A 4K9EH 5A2LH 1I7TA 4LEOA 2EXWC 1CD1B 1QBLH 1D9KC 1T83A 4LGRB 3TJHD 4NO0B 3WJLA 1IQDA 4PRPB 2W0LA 3ARBC 4NJAH 5TF1L 3T3MF 5C3TA 5C0ND 3ZT7A 4XT1C 2DMCA 1QUNA 1DQLH 3UTTB 5DT1H 3N1PC 2FEDC 4X7SL 5I71C 4JZNB 3C60B 5EZIH 3ABZA 2XKSA 2X4TA 4PREB 3MA9L 3QFJA 3NH7H 5CJBA 3REVA 4XMLH 3S88H 5DS8B 1DBAH 5EWIH 2V17H 3PWNA 1CK0L 1WWCA 3INUH 1A14H 1S9XB 4ODXB 2B2XL 3WIHH 4Q9RL 2R0WH 2D7OA 4QGTA 4Z7VB 3V5DA 4CKVX 1OP9A 1CDIA 2MKLC 1GRWA 1EFQA 4X5XA 4PLJD 4OV5A 1J05A 4PY7A 2Y36L 1YECL 3QPQD 1ZGLB 1N4XH 1WZMA 1RZFH 3AC0A 4CU7A 5HYJA 1SEQH 3TT1L 1IM9D 1SEBA 4P59H 2MJWA 3LOWA 3VFWA 3UTQA 1S7UA 5FA4B 5CEYA 2GI7A 3L6FB 4BFIB 5JXAL 3OKMA 4KK5D 4MNQB 3O2WH 4XNYH 3KPRE 4R90L 3RVWC 3HNVL 5GGQL 3TO4C 2HG5A 3EUUA 4Y4KA 1LO0L 5DRNB 2AEPL 5ILTL 4JG1H 4WHTA 3WKNA 4PRIE 4PUBL 1B0RA 1RUQH 3KYOB 2HJKB 2PTUA 3EZ8A 4GG8A 2R15A 2IWGA 1IAIH 3JWOC 3EYQC 1HILB 5FB8B 1MNUL 4G8FA 5I15H 5ADPH 3T0EC 4YHLL 3OAZK 1N8ZB 4FXLA 1GYAA 3GMLB 3FHQA 1NFDA 1ZANL 3CVHA 5E70A 1KG0A 3SE4C 3UX9B 5B39A 4LPVA 1NGWA 1S7QB 5MERB 5TQ0H 1T3FA 5GS1B 1VSCA 1V3KA 2YZ8A 5DJDB 4JRYD 5ERWB 4K2UL 5IW1B 3MLSH 3IF1B 1QA9B 3W0WA 3QO0A 4S1DC 4XBGA 5F96L 3C6LB 3X12B 4AQOA 5C7XL 2E3VA 1KC5L 4PB9L 3TA3A 2DQJH 5BOZG 1OAKH 1FFRA 4FZEL 2EDJA 4PJIB 4R2GB 3IFPB 4FN0A 3B9EA 2ZUQC 4W6XB 4W6WB 4P4KA 3NZ8A 2VERN 2CLRA 1F2QA 5CUSL 1MJJB 3U6RB 4PGDB 5DHYA 5DDHA 4P2RA 4BH8A 3OXSA 4JHWL 4LARH 1R0AH 7FABL 1K9TA 4O51B 4WRLA 2BDNH 2XT1B 5IB5B 5IV2A 4ALAL 3WUWB 1U8KA 2KQMA 4JANA 2DYPD 3OKKA 1CFVH 5BOPA 3C6SB 3AB0C 1OW0A 2VXUL 5INCA 4XNXL 3ARYA 2DLHA 3GBLA 4NT6A 4P5MB 2VZOA 2BSED 4JFOA 1RURH 1F8TL 1FYTA 3GJEA 5DD6A 4ZUVB 3UZQA 2UWEF 1CD1A 1GCFA 1N5YH 4LCIH 4NO0A 4PRPA 2WP3O 1JZ5A 5F9AC 1RK1B 2L7UA 3LPFA 1WFTA 3SKJH 4JGMA 1S7XB 1OARL 1P84K 4YHPB 3TFKC 3OAUL 2DM3A 4F57L 1AQKL 5C09D 4ZFOB 3DRQB 3UTTA 4OLXL 3PUCA 4R6UA 3KPOB 3QO1B 4JZNA 3C60A 5FDWB 4PREA 3I84A 5DYOB 3NCJH 2IG2H 4Y2DD 1G9NL 5DS8A 1GGCH 3CDFA 2OLDA 3HRZB 1INDH 4LHUG 1MCPL 1WTGT 4F8QA 4CGTA 4NQDB 5FOBB 4NQUA 1S9XA 4ODXA 1CL7H 1JHLH 1F90L 3ULUD 5IMMB 1AI1L 4Z7VA 2VJXA 4N5UA 5CGYD 3EHBC 3GHEH 3VFVB 1IT9L 1MAJA 4MJ6B 4ZSOB 1RUML 3IS0X 1CBVL 1G7IB 4OZGF 3RX8A 3KGRA 1N64L 2HTLC 4CU6A 4U1LA 1ZGLA 2D7NA 1XF5B 4ODHH 4OZIF 1CGVA 4X8JA 4OLVH 4JJ5A 4JO3L 5FA4A 1CZ8L 4HIHB 4OGAC 1A4JB 3L6FA 4BFIA 3BGFB 2GIYA 1YQ2A 1EZVY 4MNQA 5ETUB 5IJKA 4E41E 1SJVA 5DRNA 3VXRD 4TUKH 4KRMB 1RZKL 3RZCC 3KYOA 2HJKA 2DS4A 4JM4L 4UT7L 4TUJB 2NY7H 4ELME 5EORH 1A7NL 4TUOB 5K9JH 1HILA 5FB8A 1JI2A 4L3CB 3QT2A 3Q5TA 1BD2E 2VDNL 4NCC2 4PFEA 4UBDC 1G7MB 4F15B 4U6VH 4R96B 1Q38A 3WJLC 2ESVE 3MA7B 1N8ZA 3GMLA 1BBDL 4Z95L 2XOTA 3HR5B 2E6QA 2JJSA 3MACL 4NC1C 1S7QA 2Y9RT 5DMIH 3HI5H 5J12B 4I48B 2J5LB 4GAFB 5GS1A 1FNSL 3GSNB 3OG6B 5ERWA 5SX4H 5IW1A 4JCLA 4UTAL 1QA9A 3OG4B 1AO7E 5SWSE 3N0PB 4FQJH 3HAEH 3N85H 3C6LA 3QSKB 3X12A 2EDBA 2ZNWA 3VRLF 2O61B 1XF1A 2B4CL 4Y4FD 2HA1A 3PWJB 3V0WL 3WO4B 3BIBX 4PJIA 3FRPA 3IFPA 4HKBB 5JW3L 2YOCA 4U2ZA 3UYRH 3LKPB 4ZUUB 2XY2A 3VXUD 1BHGA 2DQCL 4U1GB 1MJJA 2AP2A 3U6RA 4OLUH 4PGDA 3CD4A 4HX1B 2EXYC 5E2JA 3U1SH 2DKUA 3ZKSD 2RCSH 4O51A 5IB5A 4XAKD 5DZOA 3WUWA 2JE8A 4L4VD 5IBUB 4FZ8L 1P5UA 4QOKB 2X4UB 3VD4A 5IB2A 5C0RH 1ZWIB 3C6SA 4O2CB 3GRWL 2GITB 4Y5VB 2H9GB 4P5MA 5HD8D 1NCWH 2PR4H 4ZUVA 1DN0B 4KJPC 4XC1H 3C09B 3L3OB 5HHMD 4UQ2B 4WDIB 5KJRL 2HRPL 2HT4D 5GSRB 1F4AA 1HIML 4KY1H 1KGCD 4K3DL 4PRHE 1OSPH 5MP6H 4OFIA 1RK1A 1S7XA 2EDDA 2HRLA 4YHPA 2OX5A 4ZFOA 3DRQA 3NCYP 3NCMA 3HPLB 3QO1A 4WGWB 5FDWA 2R39A 4HC1L 4QRRE 1IC1A 1D3CA 3RVUC 2K1MA 4S0SD 4Y4HB 2R4RH 5KAQG 3ZKMC 3HRZA 1J8HD 4C4KO 4X7EC 4ODSL 4NQDA 2YUZA 5IMMA 1WEJL 3VFVA 5I8OL 5A3IC 1WFNA 1KCKA 4MJ6A 4ZSOA 1FFOB 5F7UA 1G7IA 1CIUA 3H3PL 1JPTL 3BN9D 3EAKA 5CSZB 1JIBA 1MAMH 4LBEB 3BE1L 1XF5A 3GKWL 4Z7QF 3TZVB 2NY2B 4LNVA 5JIIA 2HTKC 5F7NC 2UYLB 1RJCA 5C0CE 1WAAA 5KW9H 4HIHA 1A4JA 1DUZB 5MEOB 4FQCH 3UJJL 1CGXA 3EJZD 1FGNL 5ACMA 5SWZE 4J4PD 5ETUA 2YWYA 5I1LB 2VKWA 1R6VA 1UJTA 3CX5K 1NSNL 4KTDH 4QXGH 3SO5A 2OQJB 1U8OB 3QJFB 3CLFH 2HLFD 1E4WH 4AK1A 4P46B 1A6VH 4LLAA 1OW0C 4TNWF 5F70A 4TUJA 4QTIH 2P46B 2VDLH 1KXTB 4QRTB 4IOIB 3TO2B 4TUOA 1DEDA 3OSKA 4L3CA 1UC6A 5T1LA 4MMXC 2DWDB 2DBJA 5DJCB 1T0MB 3D69B 1B88A 1G7MA 1S5IH 3D5OF 3IAPA 3QDGD 4N0UB 4R96A 5CD3B 4JZJC 3B8SA 1QR4A 1T2JA 3GJFB 2XWBB 3HR5A 1YYLH 4I48A 4OZGB 3ZMRA 5J3HD 4PLNC 1AGCB 1S78D 3GSNA 1CT8B 3C60C 3V2AR 5DEZA 2MHAB 3O4LD 3NTCL 2O61A 3ZDYF 3HNSL 3PWJA 3LKQB 3S36X 3R8QA 1JN6B 3FO1B 1HSBB 1U8MB 4HKBA 3HC4H 2IANE 3O6KH 1JE6A 3LKPA 4ZUUA 2GW5A 4U1SB 3UROR 1QBAA 2EEDA 1ZTXH 2QSCL 3VI3F 4BKLB 4DN3L 4HX1A 3UBXI 4DZBB 1PSKL 1BJMA 2Q8BL 5E2WH 2F54D 4XNUL 4MZ2A 3OMZA 4L4TD 1E4JA 4IRSD 4GKNB 4GBXC 3HTLX 3UP1A 1A21A 2Y6SD 5DJXB 1TIUA 1DANU 2B5IC 4QOKA 2X4UA 3LKOB 3IJSB 2XY1A 1ZWIA 2GAZA 4O2CA 2GITA 4Y5VA 3LEVH 5DMGC 2H9GA 3RL2B 1KJVB 5C6TL 1FVEA 3MRGB 2YXFA 3ZKND 1KJ3L 2OL3B 5EG6C 1DN0A 4UT6H 3L3OA 1YJDC 4UQ2A 4WDIA 3ULSB 3QRGL 4X6CE 2BNUB 2HVKB 1INQB 1N0LA 4LCYB 1KBGL 4M43H 1LQSR 4KGJA 1J10A 4Z6AT 3ALXA 1M7XA 2H41A 5FYKD 5LGHH 2IPUK 2FBOJ 4YXHL 2YD7A 5JR1H 2K7QA 4ONFL 4TNVK 1IEHA 3BKMH 3HPLA 4YFEA 5L88H 3C2SA 1ES0B 1FAIL 4NCDA 5GRUL 3QXDB 2DQFB 4ZO7A 3H6JA 5I0ZA 4Y4HA 3RVXC 1SM3L 3FB5B 1FZKB 2Z8RA 4OCXH 4RRPA 5HDBE 5CCKL 1REIA 4ODTH 2BSSB 2DL9A 2O5YL 4YHYC 1NL0H 1HYSD 3IRPX 3QDAA 4LSVL 3Q5OA 5IT2H 4EIZC 4NUJB 3T0AA 2KL6A 5CP7B 4M1DH 2B1AH 1FFOA 4BH7B 2ZUTA 5IEHA 1BOGB 3FQXB 3SDXF 5CSZA 4G6FB 4LBEA 3P0YH 3AGVA 3W39B 4M6NH 4IOSD 3TZVA 3MUZ1 3EJJX 2X89D 5K9OA 4GAGL 1SBBA 4JY4B 2D7TH 2UYLA 5TE7L 1S7VB 1DUZA 5MEOA 4MQXC 3BQUD 5DMJB 2NY0B 4CVUA 4MQSB 5I1LA 3O6ML 4ZOEA 3HMXA 1W8OA 4M5ZL 2AXFB 3O11B 2IPTH 4G8GE 4J8RB 2OQJA 1U8OA 3QJFA 2NY3B 2PXYB 2AERT 4HFWB 4P46A 3THMH 1RZ7L 1NGPH 1MQKL 5HYJE 2FSEB 3V6OC 1W72L 2FD6L 2R0LL 2IBZY 5DJ0B 4ETYA 4QRTA 2IC2A 2LU4A 3SDAB 4IOIA 3TO2A 3RWHB 2EKSA 3ULUL 1LGVA 2IGFL 2DWDA 1NCUA 5DJCA 4B50A 3D69A 4WO4B 4KK8D 3GJFA 4RFNB 2WLYA 2XWBA 5IF0B 4HIIB 2ICCA 2WUBH 4MXQC 4OZGA 4JE4B 4NSKB 4OLWH 1AGCA 4G3YH 3EBAA 1T04A 1CT8A 2FHBA 1YPZB 15C8H 4LSSL 2PTTB 5FYLE 3WV0A 1X5AA 5DSCB 1IFHH 2EDLA 1KNOB 4U0QB 4W70A 5BV7C 1CE1H 3LKQA 1J9CT 1JN6A 3FO1A 4U1NB 1HSBA 2YD5A 1U8MA 2MWCA 3MLVL 5E0QA 1EO8H 4U1SA 1G6RB 1WZLA 2HH0L 5FUOL 3RFZC 4BKLA 2H3NB 4DZBA 3W0WE 4Q58C 4DKFL 3W5NA 1EHLH 4M8QB 4J3XA 4GKNA 4NN7B 4YZFE 1Z9LA 1PW3A 4OCSH 1QFHA 5DJXA 1ZHNA 4HK0B 4Z0BH 3LKOA 1MCQA 3CZJA 3IJSA 1H8SA 4ZG1A 4LCWD 3QEUB 1T7VA 5GIRB 5IESH 3RL2A 1KJVA 3MRGA 4QHLB 2OL3A 4P2RE 4XP4H 5B4MC 2CMRH 1T21B 3ULSA 2BNUA 1C5BL 1S7SB 2HVKA 1INQA 4F7MB 3M8OH 4TVPD 4LCYA 4M7JH 4NN5B 3NPSC 1OP5K 1V7MH 3QG7L 3D87B 2VC2L 1E6JH 5JHDB 1FRGL 4M61B 4BQ9A 4CW1B 4JKPH 1QSED 4KMQA 1FYTE 3VGAB 2ZUWA 1ES0A 3IXTB 5HHVL 2XZQL 3QXDA 2DQFA 1ZEAH 4IRZH 1OCWL 3IYLW 4X7TB 4XX1E 3FB5A 1FZKA 3DROB 1JNNH 2ZJSL 1DQQB 2DBLL 4HXAL 3DYPA 2BSSA 4GQ9H 3RX7A 2WWMD 2NTFB 3KWWA 4M48L 3UTTE 2GEEA 4NUJA 5CP7A 1KYOJ 4Z8FH 5FECB 2BY1A 1A22B 4QLRA 5DZNA 4BH7A 3ARSA 1HQRB 2VL5B 1BOGA 3FQXA 4NUGH 3WO4C 3GNMH 3TNMB 5EO9B 2Y72A 3W39A 1F02I 3WHE0 4HJJL 1I4FB 2RBLA 5IHZB 4JY4A 1S7VA 4JFEB 3VWJC 2F53B 2YPKB 3RPIB 4Z7VE 4NQCD 4LSTL 3MLTB 4X99B 3MLXH 1CR9H 3BZDA 2AXFA 3O11A 4J8RA 3W2DL 2PXYA 4L4JA 3RL1B 4HFWA 2AJXH 1A7RH 5HVGB 1NGXB 3WD5L 4KKBD 2R56H 3NIDE 1ADQH 4Y5VC 1B4RA 2FSEA 2XN9D 3MRJB 4NZTH 1LEIB 1P7HL 5DJ0A 2KZWA 2VR4A 3SDAA 5DFVC 5E8NB 3RWFB 3RWHA 2WQRA 1GZPB 4MNQE 1D6VH 1JRHI 3TBTB 4CDGC 3HG1D 4WO4A 4I0KA 1PVHA 4HK3J 3V52L 3Q48A 5IF0A 4HIIA 1CN4A 3HRPA 1WFUA 2ITDB 4NSKA 4U05A 4D3CH 4O4YH 1VHPA 4G43B 3RWCB 4KVCH 1QFWM 1YPZA 4ZDHB 5C07B 3SGKC 3SE9L 4LLVB 2XXMB 2PTTA 3QCVL 5DSCA 1S3KL 3CXDL 1KNOA 2AEWA 4MNGB 1U9KA 4XCFL 5GXBB 4U1NA 2GJ6B 5I8EB 3VE0B 1DR9A 2DWEB 3B6SB 3MROB 1G6RA 1RZ8B 4ZOAA 2JB5H 3GK8L 2H3NA 2JB6B 4Y89A 3SO3B 5T5FL 1JTTA 1H3XA 3JWOH 3LN4B 3OXRB 4U1IB 3SCMC 3PWVB 3RKPA 2J4WH 4M8QA 1LO3L 1QEWB 3TZVC 3SOBH 1H15B 3EO0B 2NY2C 4MVBD 3ZL4L 4XZUB 2OR9L 3BKJH 4HK0A 2WV3A 3HZYB 4PJIE 4GO6B 1VFAB 4KK6C 3RZWA 5GS3A 3A67H 5GIRA 5FV2A 4JRXE 2I60L 2BY3A 3HR6A 2VIRB 1QRND 4PV8B 4QHLA 1HNFA 3V7AE <