43CAA

Crystallographic structure of the esterolytic and amidolytic 43c9 antibody with bound p-nitrophenol
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
DVVMTQTPSSLAMSVGQKVTMSCKSSQSLLNISNQKNYLAWYQQKPGQSPKLLVYFASTRESGVPDRFIGSGSGTDFTLTISSVQAEDQADYFCQQHYRAPRTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IMMUNOGLOBULIN (LIGHT CHAIN))
publication title Structural basis for amide hydrolysis catalyzed by the 43C9 antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 26
structure length 113
sequence length 113
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 1999-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 43caA00
1JPSL 3CH1A 5DJXB 2V7NB 5ELIA 3V4UH 3WFBL 5KSBF 2UVFA 3VXMB 5C6WH 1A6WL 1MFAL 3D3VD 4M93C 2FR4A 4CN4A 2D7MA 1YEJH 4U1JB 1PDKA 4Z7WB 4QHKI 3TPKA 1KF9B 4MDIB 4HDIB 3OHXB 2J6EL 1G7QB 1QRNA 4H1LB 5H37H 5IMOA 4YO0A 2X1XR 1BGXL 2XOTA 2R0WL 4I5BA 2X70A 2NY4D 1NQBA 2MKLC 2P8MA 1PSKL 5DHYA 4C4KO 1Z0NA 1BX2A 4G8IA 3SJVD 3O6MH 5MHSE 2AK1L 1JK8A 1FYTA 1PY4A 1FFQA 2F8OA 4QO1A 4TSAL 1X5KA 5DK3A 4QKXB 3UCRA 5TDOA 1AXSB 1MFNA 1LK2B 1Z5LA 4WHYG 5DQDL 2K9UA 1T80A 3HE7A 5I8CB 3PWJA 3QPQD 4ZXBC 3TNNA 1Q9WB 3VU2A 5CCKL 5C0CD 2B1HL 2EEDA 4JVWA 5TE6H 5C09A 2HFFA 3VXQB 1KGCD 3VGBA 3OMZA 1QSEB 2CIKA 3WV0A 4HHAA 2UVEA 4OFKA 3SGKC 1D9KB 5LVEA 4WFFD 5E8DH 4QRTB 1P9MC 2MOVA 4ZD3L 4W6WB 2YBRB 3S5LB 1WT5C 4KDWA 5IROA 4R97B 4M7JL 1RZJL 4JM2A 4ENED 4L4VA 4AT6B 1TQCC 1WEJH 3IDNA 3O0RL 2BVUA 2XYCA 5DA0B 5F96H 4UINL 4GRLC 3GSNA 3QHTC 2OK0L 3RI5K 2P5EE 3LAFA 1RVFL 4P99A 3QUXB 2QADD 1KIRB 2X4TB 4U6HB 2YA1A 4NQDE 1WWAX 1AGEB 2IMMA 5T5FL 5J9PB 3DRTA 3DJ9A 3LRGA 1F4XL 3X13B 4ONOA 1T04B 1NLDL 2PTTB 4MD0B 1WC7A 3ILPB 5I73B 5JXEC 5LAXA 1GOGA 4OF7A 4FABH 4YK4B 5JDSA 3TYFA 4BFGA 2IBGA 4PGCB 2HN7B 3SO5A 1WTLA 4NFDA 2C4FU 1A9EB 4LLDA 1WV7T 2VXUL 4YDIL 4MNHA 5MEOB 1ZAGA 3FT3B 1G7IB 4HK0B 3B3IB 1EPFA 3HNSL 1SVCP 2BDNH 5DJZB 3K4DA 5DDHB 3MO1A 3ZDYE 1YYMH 3RWIB 2JB6A 1BAFL 5CMAA 3MXWL 4J4PC 1G0XA 3OX8A 3LIZH 3MCKB 4BUGA 4M48L 4LOUD 1MCLA 1JPTH 5F7NC 5IOPA 4LIQE 5H2BB 4MCZB 4Y19B 4I9WD 4YHOL 4MDJB 4IJ3B 1QLRA 2DM4A 1WZKA 4O5LL 4XPGH 4XVUC 5ADPH 1A5FH 2YZ1A 3GMPB 4S1DC 4KK8D 4MQSB 4PJ8A 4YHKH 1LVEA 5CLTA 3CMOL 1EO5A 3MGTA 4JFFD 2X4NA 4HBCH 3WHE1 2HRPL 1HSAA 4P2QE 5EU6A 3MRJA 5FCUL 4ZQKB 2ZSWB 2HH0L 1FIEA 1IM9B 4PJAB 4YNYA 4G7YH 1MVFA 3GJEB 4M00A 4TRPH 1INDL 1RZKH 1ZEAL 2RFXA 3BSZL 5F7LB 5HJ3A 1F3JA 5JDJA 2CO6B 2DBLH 2DRUA 1SQ2N 3UJJH 4RAUB 4K8RD 5DSCA 3TVMA 2V2TA 1XR9B 1MJ7H 3QXAB 3QI9D 1AD0A 2VL5B 3FONB 1U42A 4S2SB 3FFDB 4R3SA 1T20B 2H2PD 1EO8H 3QAZC 3U46A 1U93B 3AY4A 2NY3B 5DHVA 35C8H 3QQ9C 1MI5E 1RFDL 1YEFL 2Q76A 3U0WH 2VLKD 2VXVH 4J3XA 4HWBL 3G6JF 1VFUA 5FYLH 5L2KD 4K23H 4CJ1A 1NDGB 1BP3B 3DMMB 3V5DA 4M3KB 3CMGA 4OJFL 3X3FH 1U8LB 2ORBH 3WL9A 2BSSB 2CRIA 5L6YH 1BD2A 4Z95H 1QVOB 2F58L 4QHMA 4HX1A 5IVXB 2BOBB 2Z31B 1BBJB 4JM4H 5JZ7C 1KC5H 4LCWD 1INEL 2CIIA 2E9WA 4JG1L 4MNGB 5ECJE 5GGRB 4GRWF 2HP4A 1J0YA 3VFVB 2GJ6D 1IGIH 4LCYA 5E4EB 3LPWA 2P7TA 3CFDA 3HB3D 3SQOH 1H5BB 4LK4A 4LPVA 2WZPD 4TPRL 2IPKA 1A7RL 2NY0D 3QXVA 1EVTC 1S3KH 5BQ7B 3V7AE 3QWRA 5TPWH 2YHGA 5ESVB 3OZ9L 2QQNH 4B7LA 1U36A 3B9EA 1UKTA 2LE9A 1WCBB 5EIIA 3H42H 1IEBB 1NFDE 2W38A 4PRBB 3D3VB 1HYSD 1NGYA 5IJVB 3QUYB 2AV7A 3EYFB 4ODVH 1VKXA 3BEVA 3SGJC 1M05B 2GSIB 2IAMC 5IMKA 4LAQH 3A6BL 1UACH 5KS9E 4PJ5D 2P48B 3ZE2F 4P48A 2NXZC 2OQJB 4NQCA 5KSUA 1LO4L 3CU1A 4WGVB 2ENYA 1MF2L 4DVBB 4OUUB 5C0EB 4ODXB 2NY4B 1KT2B 1F6AA 1OAZH 1RJYA 3RDTB 3SJVB 3L3GA 1ZTXH 4JDZA 1T1XA 4KFZC 3CK0L 4QXWA 1RZ8B 1I1YB 4UUJA 3P4MB 4X5WA 2EYSB 4O58H 4PD4J 2ZUTA 4RWYL 4LSRH 5GGRY 3NFNB 3GM0A 3O2VL 4LRIA 4NT6A 3V0AC 1NCWL 4K2UL 5TE7L 4I77H 1LE5A 2A9ML 5IR1A 4P0DA 1R3IH 1P1ZB 5C0CB 2R15A 4EN3D 2Y07H 2JJTA 4N8VG 5LQBH 1L6ZA 3EFDH 4Y8AA 4CVWA 4LEOA 4P9HC 2AXFA 3ZLQC 1MAKA 2EEBA 3QI9C 4ODHH 1Q8MA 3FN0H 1VFAB 4HKJB 5E99H 3IFPB 4Q6IC 1YECH 2M2DA 5JOEA 5D2NB 4UOW1 2FD6L 1A6PA 3BWAB 2QEJA 3ARFB 5EO0B 1IGCH 3MROA 4K3EH 4MQ7B 4RMUA 4F37K 1I7TB 4LLWA 4FP8H 1GZQB 4RGNC 4H20H 3X3GH 4YHML 4OV5A 1EFXB 3CX5K 5MHSD 1JGLL 5ALBH 4YHYC 4LRNH 4MJ6A 3W2DL 3QXDB 1XGTB 2J4WL 1XF5A 3TZVB 2MHAB 5F7UA 4GS7C 5DQ9B 4WNQB 4M5YL 2X10A 5I71B 2EDJA 5IG7B 1X5JA 4KJPD 2VLJE 2CUIA 4V1DA 4JN1L 5DGRA 1IKNC 3D0LA 3I50H 3GZKA 2EDNA 1UM6H 4PJ9C 2CUMA 5DQJB 1DDHA 5D1QB 5HI5C 4O2CA 2D7TL 4HFWB 1CFQA 3DURB 4K7PH 1DQDH 4MA8H 3ARTA 1FO0A 5CBEB 2BXZA 1I8IB 2IBBA 1A7PH 1VHPA 1DVFB 2ED8A 4M1GH 4HUWB 1F45A 5J12C 3WXWL 1H3PL 4FTVA 1G7MB 4DGIH 1WZMA 5DD0L 5KG9A 5D4QA 3F12B 2P5ED 5EBGA 1ACYH 2VXTL 4O4YL 2XNAA 3GSNH 4RX4A 4ZFFB 5I1DA 3CU7A 1LWRA 3H9HB 3IU4H 5C8JA 1AGFB 3IFOA 2Z91B 3DYPA 4G3YH 4NQDD 1RIUL 4PJXE 3WMSA 1NEZA 3QWOA 1JFQH 3N0PB 4F57L 3NA9L 3HS0B 4C54A 1J1OL 5FO9A 2QHLA 1FDLL 4K7FA 5DMIH 4XXDA 3FMGH 2DQFA 1MCHA 2DQTL 5DXWA 2CMRH 4XPFH 4NRXA 4QOKE 2VLLB 4XPAH 1G0YR 1YUHA 1ZWIA 4QYOB 1A4KA 1CXLA 1UCTA 4KJYA 4CNIA 1MRFL 3WJJA 1QR1B 4Y5VA 4BSWB 2OTWB 3HLAB 4X99B 4AIZA 4UIKH 2I07A 1RHHB 5IM7B 1A4JB 4XCYA 3ES6A 1KIQB 3HAEG 4J6RL 3RA7H 1JZ4A 5SWSA 4JGJA 3TYGH 2BVOA 4PBVC 1AGBA 4PJDB 3RWCB 1R5IA 5BZWB 1CD9B 3VXUB 4F58H 4J8RA 3SDXA 5HYSG 3O6FD 1AXTH 1KJMB 4IRSD 5T3ZH 2Y36H 4LPYA 2HTKC 3D69B 5KW9H 3FO1B 4ZPVA 3KLSA 4ZUTB 1MRDH 1T5WB 4E0RB 1RULH 5AUMB 2VLKB 4X7EC 3UTZA 2IC2A 5I1JH 4KHTL 4PJEB 1YPZF 3WUWA 2FX8L 3BVNA 3K1KC 4K55A 4FG6D 4X7SH 1XGRA 1P6AB 1MLCA 3V0VA 3GMLB 3BZDA 4P2QD 4ZS6D 5MERA 2R0KL 4XP4L 1NMCC 4RFOH 1MPAH 5K59E 3WLBA 2B4CH 3BH9B 1BQHB 4Y4HA 1T0MB 4YDJB 4X6BA 4H88H 1I85A 2V5YA 4XCEB 2Y1VA 2VR4A 4WI4A 5GZOD 2HT2C 3CFBA 4QGTA 4MLIA 5E94A 2JJVA 2A1WH 2R0LL 2HT3D 1OP3H 2O5YH 1RUKH 1RK0B 1OGTB 3HC3L 2OJEA 4JPVL 3REVB 2HFEB 2E9JA 1NGPH 3EYUH 4GRMB 5HHNB 3RGVA 3GUTB 5EZIH 2GJ6B 1KN2L 3QEQB 1KXQE 1F02I 1D5IL 4JPIB 3SDYL 1MI5D 4M4PA 4BUHA 5IMMB 1ZGLB 3MMEB 1MH5B 3CFIC 5MEQA 4KUCF 1CT8A 2NY0B 5DHVH 4ODSL 1Z3GH 1A6AA 2FATH 5IB2A 4KY1H 3VGEA 4Y2OA 2EECA 5CGTA 5F3HB 3EGSB 4F8QA 4YH6A 5F1NA 5IB4B 4GG6B 1RIHL 2SEBB 5C6PB 4ZTPL 3VXPB 5B8CC 1U9KA 5GS2H 3UBXI 2CD0A 4TQEL 2YPKB 5AZEL 4A6YB 2PYFB 2LTQB 15C8L 3S88H 5GS1A 1FG2B 5JW4M 1EHLH 5E08H 4L8SC 1CLYL 4DKEL 1TETH 2R1WB 2AS5M 3PNWB 3WFDL 4HUNB 4UV7L 2EKSB 4NHUB 3L1OL 2YK1H 2EDFA 3SY0A 4KGJA 5A2IH 3T2NL 1KYOK 5ICXB 3MLZH 5TQ2H 5CD5D 5TF1H 1M71A 1LO0H 2F53E 4P3DA 3RPIA 1U8HB 3IDGB 5I9QB 3KPLB 1XIWA 4IRZL 1IAKB 4HIXL 4IOFD 1IARB 4AL8L 3BDYH 3RX8A 5CBAA 4XPGL 2V7NA 3PWLB 3EOBA 5EU4A 5JPNB 1FFPB 5KN5A 4PJHB 2XY1A 2EYTB 3BZ4B 2O61A 4U3XA 2CLVA 4MD5B 4KKCD 4WU5A 4EN3B 3EDEA 2YUWA 4U1JA 5IBTH 4Z7WA 4HDIA 3OHXA 1G7LA 1FYHB 1G7QA 2IWGA 4H1LA 4L8BA 3MV11 4RWHA 1X5AA 4UT6H 1GAFL 5CP3A 1SEQL 3VI3E 5DVLA 5FM4A 4Q9QH 3O9WB 2DQIH 1NSNH 4WWKC 4NO5B 3IKCA 3AS3A 2QQLL 1A6TA 1IAIM 1JNLL 1IAOA 3LH2L 5D8JL 5FA3B 3S6CA 1FSKB 5KAQG 1C1EL 1F90L 1MJ7L 3OF6D 4NQEB 1JPST 3PHQA 5D72L 3L5HA 3ZE1F 3L5JA 3MV8B 2EIDA 5ADOH 4X80H 1CDGA 1Q9WA 4C83A 2F19H 1GOHA 3MJ9A 2NX5E 1AO7A 1OAKL 3QP3A 4OZ4B 4L3CB 4PRHB 4CUCA 1V3LA 1JF5A 1Q0YH 1MLBA 2H9GB 2YSSB 2Z8SA 5DEFA 1NCAL 1L7TH 2XRAH 3QDGB 1UXSB 1CICB 4WTZG 3IVKA 4S1QH 1JBJA 1D9KA 4YUEH 1OGAA 4QRTA 3VRIA 2YBRA 3EIFA 4YR6A 2YKLH 4F3FA 2XN9E 4NCC1 5D2LE 4PJ7E 1MFBL 2EDYA 5GGSY 5E2TH 4HJGB 3TM6A 2W59A 3PIQB 3WO4C 2N56A 1YN6A 2G5BB 1L9NA 3QUXA 1KCKA 4FQCL 3I3DA 1KIRA 5D6CB 4DAGL 1F2XK 5CWSB 1FFRA 3ARED 2VDRH 3KPMA 4LPCA 4JFQA 3GDBA 4N5UA 4PRAA 3IFLH 1RZGB 3JSSA 5EBMA 3WFCL 4MD0A 5CEZH 4KQ3L 3KAAA 4IRJB 2B8OT 1A47A 2VLJD 3U4AA 1H3XA 5L9DL 3PF2A 4PGCA 5F1OB 5F7EL 2PO6B 5JA9A 1TENA 2D03H 3GBNL 4G6ML 3HMWL 5MEOA 3FT3A 2Y5TA 3B3IA 5EPMB 3DV4A 4NZRH 4QHKJ 4N0UE 4XTRD 3QISA 4XZUB 1MAMH 5DJ8A 4ZUUB 1NAKL 1S5HB 3KPSA 1U8MB 4CVZB 3MBED 4NKQB 4KWUA 3H9SB 3DI2B 3EUUA 2AJVH 4MCZA 4Y19A 3PL6C 1CFNB 1UM4L 4J3OC 5E5MA 1J8KA 4ONHB 4XWOC 1MQKL 5D1ZD 3GK8H 4EUPB 4R4BB 4TOYH 2HMID 4R9HA 1Z0MA 1NGXA 1NBZB 2CGRL 4YX2L 3GMPA 3S3JA 4XT1C 5C0AE 1QSFB 4TTGA 2BRRH 2D7QA 1GSMA 2DQHL 1RAMA 1RMFH 4YBHA 3L95B 3W81A 4LSRL 2EH7L 2FLRT 4KQ4H 2ESVE 1WISA 1WAAF 4ACPA 5JHLL 5LGHL 3TC9A 4PRPA 5GS3A 1FVDB 4YHPA 1R3JA 4ZQKA 5DD6A 4QOKD 1UWXH 5BV7H 5HSFA 3E8UH 3GJEA 1HDMA 3ZKXC 2CRMA 5BVJB 3QIBD 5I15H 5E9DE 1ZLSL 5J1AB 4M6NL 1WFTA 1PW3A 1DANT 1JPGB 2AI0L 4Z5RA 5ALCL 4RAUA 4LMQE 5HVWA 3C08H 2V6HA 4WENB 1XR9A 2X44D 3QXTA 4CVXB 5AD0B 3QXAA 5CILH 1CD0A 2VL5A 1RURL 3FONA 4S2SA 2G2RB 1ES0A 2EDBA 1E4XI 1T20A 3SE8L 2AK4E 4NO2B 1LE9A 4NYLB 1HI6B 5EU3B 3G9AB 2VE6A 1EBPA 4L5FL 3S35X 2BSTA 1ITCA 3LEXA 3DMMA 5JW3H 4UAOC 1GL4B 1GC1H 2HG5B 4R90L 4I0PB 5D93C 2E7HA 2QTEA 5FA4B 1QVOA 1UFUA 3S4SB 1TLKA 1S78C 3D6GA 1LDPL 1DL7L 3UEZA 4ELKB 2D7NA 4KZEL 5IJKC 3K81A 4HWNA 1GPOL 1X5LA 5DJCB 4JFDE 4N5EC 5I1CH 1J1PH 3NCJH 1I1AA 1J9CT 5DYOB 5MP6H 5T1LB 4OLWH 2DLGA 4M6ML 3RL2A 4RMTA 1A6UL 1K6QH 3MACH 1HILB 3D2UA 3DYMA 2E9BA 3MCG1 3OWEA 3RWEA 1R5VB 1QSZA 1MCWM 4AENB 4NHCH 1H5BA 5C7XL 5SV4A 3C5SA 4MAUL 3QXUA 4N8VA 2NXYD 2H6PB 3ULVL 1IKFL 5L7XH 3RWJB 4ZODA 3KLAB 5BQ7A 1L7IL 5ESVA 3HCVA 4LKCA 3LQAL 5L8KB 3VXRA 4M43H 2Q3ZA 5A2JH 1XAUA 1SBSH 2AJXL 4L8CA 5INDB 2ADIB 4E42B 4L9DA 3D3VA 4PRBA 3RJQB 3U36B 1P5UA 3UBXB 5E1AB 2VAJA 2OCFD 3D25B 3RIAK 5IJVA 4I13B 4MA1B 1NFDB 4KRNA 4RA0C 3SCMD 4OCYH 4JFEB 4X6FB 1M05A 5EO1B 1AI1H 3QDHA 5BVPL 1FIGH 1N7MH 1BJ8A 3MNZB 4B5EA 4WIQA 3HMXH 4U2ZA 5GHWH 5HGDB 4XWGH 4NNPH 3MRRA 3ILQC 3I02B 3L3JB 3SJVA 4FQ1H 4CADA 3G04B 2F53D 1BQLL 4PJCE 5A40E 4PJFF 3NFNA 2HLAB 3VWKC 1XCTB 1HIMH 1K8IB 5IFAH 3UP1A 3QIUB 3R0MA 3VA2C 1YEIH 5KJRH 4WEBL 3K7UA 1A2YA 1DUYB 1X5FA 4UT9H 5DLML 5F8QC 5C0CA 4S1SL 2K1MA 3GMMB 3HR5B 1J0KA 3VFOB 4L4JA 3R1GL 3OB0H 3SBWC 3QJHB 3IFPA 3IDUA 3QNXB 5D2NA 1KLGB 3T77A 3BWAA 1QOKA 1QFWH 1LEGA 3DI3B 4MQ7A 3PJSB 3RY6A 4H1LH 4XI5C 3OAZH 4QXUH 1GZQA 1Y0LB 1AE6L 3ARDD 4POYA 5A2KH 1KENH 3NN8B 4TUOB 4OZHA 3EZ8A 3RAJL 4APQC 2V9QA 2ID5A 3QXDA 3V4VL 3BW9A 3DSNA 2LU4A 3B5GA 2MHAA 3ZO0A 3WHXB 4WNQA 4HUVA 4P46C 4Z18A 3V5KB 4LP5A 3O4OB 1QZ1A 2XIDA 3DX9B 3EYUL 3CFKB 1LGVA 3F7VA 4RMSA 4EKXA 4M9OA 3BOVA 3VWJB 5I1IH 1AHWB 3Q3GA 1KTDB 2DWEB 3HN3A 2NX5D 3T1FB 1VADB 4FQ2H 1UC6A 2VH5H 5DQJA 5B21A 2Q8BH 3DURA 1KELL 4Y2DB 4YDLC 5ANMA 3WNPA 3BP4B 2KBGA 4GW5A 1MCBA 2XQYG 1IM3B 3QRGH 4QTIH 5HYQB 5CBEA 5L8LB 4YDKL 1AGDA 1RIVL 2C3XA 1T83C 2XN9D 3EJYD 1IGYB 3CXHK 4G9FE 4NM4H 5E8EA 1KCVL 3GIZH 5IEHB 4N8PA 1JGDA 1B0GB 1N5AB 4ZFFA 4I2XA 5D6DC 2DD8H 2Y23A 5K9JH 3H9HA 4MNQE 5MI0B 4PLJD 3RVWC 1Q94B 5CEXA 4POZC 1UB5B 4XMKH 4NRYB 3RVUC 3LB6D 4AEIH 4FS0A 4WUUB 4QF1A 4JQXA 2DS4A 4OLVL 5CFHA 3HS0A 4IBLT 1UWGH 3KYKH 1OQOA 1QHPA 1CI5A 4MXQD 3PHOA 4W6YB 4KKAC 4Z0BH 1XGPA 2DQDL 1BFTA 4JFFA 1Q38A 3IJYA 1ZA3B 1VENA 4ETYA 4QYOA 4ZAKD 4HMDA 1CGUA 1KB9K 4X99A 2DB8A 1DLFL 2PW2B 1RHHA 4KMTL 1A4JA 1DQQA 4X7CC 3RTQB 4DUWA 1A6VH 2R0ZL 3KYNA 3VJ6B 3RWCA 4YQXH 4HH8A 4WV1C 1PLGL 25C8L 4MS8C 5FHAH 4QRRE 3T3ME 4XNUH 2PYEB 2ZP0T 3D69A 4G9DB 2VDKL 3FO1A 5B22A 2VQUA 4ZUTA 4LLVA 1FH5L 1HQRA 3JWNC 1T5WA 4XXCA 2ZCHL 4EDXB 3H3PH 1MWAB 1CZ8H 1I9JL 1QR4A 2QQKH 1TFHA 3FTGA 5C0AD 2VLKA 3V6BR 4YHLL 4I18B 1TTFA 2CKBB 5L2KA 1QFUL 3STBA 1F8TH 2ESVD 3ESVF 4NM8L 2A73A 4ONGL 4BJLA 2DMCA 4Q74A 4L9LB 3I3BA 4Z7OF 3GMLA 3BKCL 2R39A 4G43A 2X42A 3PDGA 4W4OC 3BH9A 2W9DH 3BJ91 5IF0B 1T0MA 4YDJA 3RKDC 1ZLUK 2R29L 3CC5B 4LCWA 5E9DD 3MUZ1 4MAYD 1FORH 3TO4B 4P49A 3X11A 1RK0A 4PTTB 1HNFA 1WZLA 1YEHH 5T33L 1OGTA 2WINB 4HT1H 3BISA 5GGVL 5HHNA 3GUTA 2H26B 1SJVA 2UWEA 3GI8H 4FQXB 2GJ6A 2AK4D 4KJQD 3P73A 3TBYB 3QEQA 5H35A 3C60B 4HD9A 2YUVA 1IT9L 2FL5B 2UY6A 1BPVA 5KTEH 2DI9A 1YEEL 1A1MA 3P0GB 5HGHB 4QNPE 1BVLA 1LHZA 1UEYA 2NY7H 3IJSB 2MWCA 3LCYA 5F3HA 1UJ3B 5IWLA 3IFLL 4LSQH 2ITDA 5DEGA 3RUGE 5CJBA 1RUAH 3SDCB 5TDPA 2R1YB 5IV2A 2XKNA 4HWEL 1FG2A 1Y6KR 3RVVD 3JWOH 4GAJH 5I18L 2R1WA 5KVGH 4JFDD 2JTDA 1I9RH 3KWWA 4Q6YA 1EK3A 3NH7H 4YHIB 5AAWA 4BKLB 2EKSA 4EVNB 3O8XC 3UYRL 4PJ5A 4NQSB 2FH8A 4TSCL 2DM7A 3PWPB 2PR4L 4U1NB 3VFMA 3RNQA 5E2WL 1FO0L 1S7VB 1LNUB 3TFKD 1VCAA 4YWGH 3ULUH 1ND0A 3RWHB 3Q5OA 5FUOL 4WTZA 4DEPB 4XP9H 3OG4B 2PUQT 4F9LC 3QHFL 4KXZH 2YRLA 5DK0A 4OZIE 2FJHB 4JJ5A 5KZCD 3PWLA 1FFPA 3DARA 4PJHA 2BVYA 5KSAD 1ZT4B 2OMBA 3W9DB 4PLOB 1HHGA 3RX7A 4EN3A 1BEYH 2RGSA 3U7WH 4YAQA 1D3CA 3GMOB 2EXYC 2ZNXA 1AP2A 5AYUL 2HJKB 3MJ6A 4BH8B 3MLXL 2Q6WB 1T66C 1ADQL 2E7BA 1WZ1H 1A14H 4WEUD 1M7XA 5FUCE 4YFEA 1ZLVH 5BS0B 5FGSA 5KVDL 2X7LB 1ZS8B 2IMNA 1T22B 3B9KB 4Q2ZB 1DEEB 3EOTL 3EYVB 4L3EE 4Y88A 2JELH 1YEKH 3IFNH 5D7JB 4UBDC 3MV8A 4JY5L 1J05B 4OM1L 3S36X 1YJDC 4PJAF 3EFFA 4ZFGH 5IHZA 4P2OD 2AEPH 3V6OE 1GIGH 2J5LB 3NIDF 4L3CA 1Q9LB 4M93B 4ELME 4OZGB 1H0DA 3EZJB 4UU9A 2NX5B 2KPNA 2F74B 3QDGA 4GUPA 4N8CH 4H0HB 1X44A 1BIHA 4JVPA 2YN5A 3OKOB 1IGJB 2C3VA 4PS4H 1SJEA 3KPNB 2XQYK 4G8GE 5JQHC 1HZHL 5BW7A 4LASL 3TESA 3MLUL 2FHFA 3WO3B 4KTDL 4DVRH 4P5TD 4I0CC 1T1ZA 4KK9D 1N0XL 3LS4H 1U95B 1J1PL 2YS4A 5EUOE 2G5BA 5IK3A 1S9XA 1C7TA 2KZ1B 2P5EA 2ZZUT 4ODTH 4DZBB 3QFJB 3MACL 1DCLA 3RZCD 3RFZC 4UTAH 4J1UB 4XC1H 1IGML 4GBXC 5D7SH 3BKJL 4NQDA 3L5WB 1KN4H 1RZGA 1ETZB 1JF1A 1FE8H 5IHUH 3KHQA 1S9KC 5DTFB 1PYWB 2AQ1A 4OCLC 4XHJC 4OKDA 3ZHLA 4R2GC 3CLFL 4BSVB 2GI7A 4IM8A 3DX8A 3VH8B 5GGTA 1IQDA 4JRYB 4NFCA 3NOIA 1TZGL 1IC5H 2XZAH 3H9YA 5E2UH 3MLRH 1OAQH 3O6LL 2DOCA 5EPMA 3ULUF 2DYPD 2R2BB 1TQCB 1W8OA 2QSCH 3FB5A 1KCRH 2VDLL 2Z35B 3MLYL 5ABDE 4KZDH 4ZUUA 4G9FD 1U8MA 2HTLC 4CVZA 1RZFH 2ZG2A 3WD5H 3O2WH 1FFOA 2FX9H 4JO1H 2NZIA 4L4TB 4HQQL 4HUXB 3O6FA 4ONHA 4IRSA 1DQLL 4JREB 5H8DA 4MNQD 3RRQA 3TA3C 4KGLA 3MRHA 4KPHH 5B38G 4MWFB 4YXHL 1QSFA 3B4NA 3GGWA 4O02L 3MUGB 4J3TA 5I66B 3L95A 3VD9A 2R4SL 3NVQA 3NCYS 4P4RA 5K33A 4JGMA 4S1RH 5C0AB 1A9BB 5DJ0B 4MMZC 2P5WB 4X6DE 3G6JE 1DP0A 4QHLB 4HCRH 2V2WA 3GSVB 1ACZA 2WMPA 3UC0L 1RUQH 1FVDA 4YLQT 2NYYC 2OR9L 4JFOB 4P2QA 4A2MA 3C9NB 2XWJB 4OI9A 5JXAL 3ET9F 1PKOA 3SDAC 5BVJA 3G5ZB 1OP5H 1BOGA 4LQ1A 2EDXA 3FQXA 1JYNA 1ZANH 3H0TB 4ZS7L 1CD1B 1ZSDA 5E9DB 3SDDC 5AD0A 1E4XL 1JNNL 1RZJC 5ACLA 2A9NH 4QRRD 1IEAA 2MSPA 3KYMB 1HQ4B 5IFHL 1HI6A 2L4OA 1NAMA 4OIIH 3ZYIA 3QIWC 1N8ZB 2P1YA 1JTTA 1MI5A 3F8UB 5E8OB 4MXWH 4NZUL 1F97A 1E6OH 4HJ0C 2C3HA 2HG5A 4XNMB 1PKQE 3QCTL 1AIFA 2DQUL 4Y5YC 5EA0H 1NDMB 5FA4A 5F9OL 3U0PB 1OPGH 4WI5A 4ELKA 1F11A 1MCNA 3MJ9L 4UI2A 2FJFA 1JTOA 2C3WA 2X9YA 3NBNA 5F1IB 5DYOA 4JFDB 3SE9H 1CLCA 4FQPA 1TJGL 1HILA 3LKRA 5DVMA 1JHTB 2YD4A 1FN4B 2ZCKL 3O4LB 3ZE2E 5GS0D 3OB8A 3BP5A 2DJSA 3QAZB 4LAJH 5JORA 4LSPL 1XEDA 3QZWG 1P69B 2FHBA 2H6PA 3ARUA 1NCDH 4OLUL 3W0WB 1U41A 5HPMA 4HZAA 2VDNH 2ICWA 3VFRA 2H45A 1YMHA 5CZVH 1RUPH 3NTCH 1P5VA 1GGTA 2IPUG 1FC2D 3QB7C 1MHEB 1OF2A 4I4WB 5INDA 1X5GA 4F7PA 2GFBB 5IB1B 4LSDA 3B6SA 3EYSH 4Q9BA 1C16A 5KSAB 5F9JA 3U36A 2NNAA 1F4WH 1HSBA 5E1AA 3UBXA 1NUFA 3D25A 4KKBC 1NFDA 3P77B 4OM0H 1JHLL 4JLRA 4A6YH 5EO1A 4X83A 3ARBD 2IQAB 3FZUD 1KFAL 3VFUA 3CFCH 3IGAB 4HWUA 4LKXA 5HGDA 4JAMA 5KS9A 1YY8A 2DJUA 1XF2A 3I02A 4HF5H 4OCRL 5FO8A 5FYLE 1NC2B 4DOHB 1KLUB 4LNVA 1JWMB 3DBXB 1OVZA 3G04A 5HYSB 1G9MH 1IILE 3PGDB 3OF6A 1K8IA 1AXIB 5CUSL 3QIUA 4JG0H 5SX4I 3BPCB 1R3LB 4OAWB 4PJCB 1BLNB 4RGOL 2X1WL 4J23A 5KSVB 4GOSA 1DUYA 1CLZH 3D85B 1AJ7L 3ZDZF 1CZ8L 4OD2B 2A6IB 1RV6X 3HI1B 3FQRB 2YXMA 3VFOA 3QG7H 3BE1H 2DL2A 3HNTL 2H32A 4OGYL 3HZMA 3GB7A 3EJZC 3JV0A 2DTSA 1MFEL 3BPLC 1QP1A 5EDXA 3QNXA 3CCHB 1XT5A 4NFBA 2IAMB 2CK0H 3GRWH 2BY0A 2XFXB 2NXZB 1YDPA 3CSYA 4AQOA 2W0FB 2IGFH 3UPCA 4CW1A 5DMYA 5DS8B 3NN8A 4TUOA 3P40A 1NBVH 1HE7A 3G5VB 5GIRB 3WFHA 4ZO9A 1AD9B 2D7PA 1RZ7H 1NGZA 1UB6B 3VXSB 1FAIL 4DGYH 3TO2B 3V5KA 4L3ED 1Q9OB 2AJ3B 3LKQA 3AREA 3CXDL 3U0TA 2IANE 1CDUA 2A74B 1C12B 3RZCB 4PJIF 2VKWA 4XVJH 2GW5A 3I2CL 3KJ6L 5FFLA 4KK5C 4KK6C 3WJLA 1DQMH 4HG4K 3TIDA 2DWEA 4KRMB 1VADA 3EYOA 4WUKH 2RBLA 3KNBA 4JHWL 4WY7L 2VLJA 4U4BA 4NSKB 4HJJH 2QHRH 3F7YA 4GMSH 4HS8L 5TGBA 4D0BA 4Y2DA 4JPWH 3C2AL 1L0QA 2JK5A 2W0KA 3ZTJG 4HAFA 5I1KL 4G8GD 4Y89A 3S37X 1IGYA 1F2QA 3MXVH 1WICA 4RGNB 3FL7A 1HXMA 4HIJB 1QTYT 5IBLC 3FO9A 3WN5C 4HIIB 5HDBF 4YHYB 3MBEA 1XZ0A 5CGYC 2BJML 4GS7B 4ETQB 2G60L 4YC2C 3B9DA 1FL6B 1UB5A 5A16A 2UZXB 1S7TB 1MCOH 1NCNA 5D1ZA 1QG3A 4AG4L 4WUUA 3PABB 3PG2A 3MUY1 4IDJL 1A3LL 1DBAL 2XZCH 5DC0A 2VMFA 2B0SH 3WBDA 1KEGL 5GSRA 1WBZA 1FPTH 2VQ1A 4PJ9B 1HINH 2QKIB 1CLOH 2VLRE 4CDHA 1QRNE 3ARGD 4FFWC 1YPZE 3IAQA 5I1EH 3T2OA 2CJUH 2HJLB 4QOKA 1TITA 5D1XC 2X1OA 5AZ2L 4XNYH 5EZLB 3EYQC 1HHJB 3KLHC 1U3HD 2NLJB 3PWNB 4C59B 2DQGH 5J12B 4ZNEE 3QIBA 1KJVA 2OTUA 1MY5A 4ZNCD 4Z7UB 3BGFC 2CDFA 3C5ZC 5JR1H 4LLAA 3EDFA 2GSGA 3IB4A 3ULVF 1F6LL 3QA3B 1NCCH 5HHXL 3HE6C 1TVDA 1T2JA 4ZG1A 2Q8AH 5DJDB 3P30H 3CVHB 4EDXA 1MWAA 3AXLA 1IGTA 4UILL 4X5XB 2GY5A 1ZVYA 4LSSH 1V5JA 4EUPH 4P4KC 3TBSA 5GGUB 4ZDHB 5A2LH 2EXWD 4I3SH 4K9EH 1QQDB 1ZLUH 1DBBH 5C08E 1GYAA 1TVBA 5DO2C 4PB0H 5KVEL 5F1KC 3QEGL 4CMHC 1N59A 5IF0A 4NUJA 3LKPB 1AC6A 5C6TH 3SGDI 3MLPA 4UTBH 4HBQA 3VRLE 1KBGH 1YY9C 3T4YB 3W11D 2CH8A 3WXVH 3HC4H 5T5NF 3NCYP 4OLXH 4PTTA 3ZT7A 3M17A 4QRQA 1RJLB 5I17B 1NEUA 2UYLB 1CTOA 4TNVK 2WINA 1BBDL 3HZKB 43CAA 4YGVB 1G7HB 2B2XH 4MSWB 3GMQB 4YXLH 2AEQL 3L3IB 4PGBB 3EO1A 2BSRA 4Y1AE 5HGHA 4TNWF 4TSBH 4P2CG 1X4YA 3UAJC 5I75B 5J13B 1T3FB 12E8H 3IJSA 3DUSB 3WEXB 2IPUK 1R3HB 1XGUA 3GSUA 4Y4KC 3TP4A 3ZDXE 1ZHKA 3O11B 3MA9H 4ALAH 5MENE 1JUFB 4LHUG 3SDCA 3IS0X 4KC3B 2R1YA 4XNXH 4UT7H 2MPAH 5KSBB 5T3ZE 3SCMA 1M4KA 2X4PB 5EOCL 3S35L 1FNFA 3L3DA 4OQTL 2HAZA 5FGRA 2G5RA 3GSXB 4WCYH 2QSVA 4LPXA 1OTUD 4NQSA 5IW1A 3F7RA 4U1NA 1KCRL 3U2SB 4U6VL 3MSPA 4MXVF 3RL1A 1LNUA 4KAQL 4AK1A 4HLZH 1VACA 3IJHB 3OKMA 4KV5F 2F53A 1KCSL 4OT1L 2X1PA 4QRUB 4JDTH 3CJJA 2IG2H 2MQ0A 1UH3A 1YQVL 3Q1SL 2FJHA 1U3HC 4PY8J 5EU6E 2V2XB 5B8CB 1CL7I 2X4RA 1ZT4A 5BXFB 3ZE0F 1Q72L 3W9DA 5SWQB 4F7EB 4NCC2 4ZUSA 1O7SA 5A43C 3O45A 1DJSA 4L8SB 3GBLA 2HJKA 4JHAH 4BH8A 5GSVA 4KI5F 1JGUH 3RWDA 1CIUA 1IRAY 2BNRB 2DICA 4XPBL 1HHIB 3ARDA 5E2VL 5FGBC 3WNMA 2X7LA 1J5OL 1X6NA 5FYLD 3VDAA 4WW1B 1ZS8A 1T22A 4Q2ZA 3WFEL 7CGTA 1JYWA 3EYVA 4OF0A 3MZGB 3K2MC 1S9YB 5T1KB 3KHOA 3VRJB 2DWDB 4L3EB 4K8RL 2EICA 3IF1B 4P9HL 4WW2C 3TN0C 4P59L 1B2WH 1JRHL 4P5MB 3PWVA 4OZGA 5JUEH 1EAPA 2NX5A 3RBGA 1TDQA 4BM7A 1QBLL 1NCBH 1IGJA 4WI7A 1A7NL 1T4KA 1K5NA 5KANG 4DTGH 3LKOA 4AQ1B 3OKDB 3GMNA 4G8GB 4UOJA 3BAEL 5JOFB 3FT2A 3B2UD 5B38A 3E6HB 3LPGA 2XN9A 5D2LA 3BN9D 5EOQL 4PJ7A 4WWKB 1JZ3A 3D0VA 3C6LC 3RVTD 4K3GA 4U1HB 5F70A 5SV3A 2AJUL 4XAKE 3OR6B 4XCFH 1C5BH 1IAIL 3WSQL 3CZFB 4EQ2A 2LVEA 4XVSL 4I48A 3OJVC 4J1UA 1I8MB 4AH2A 2E6PA 3P11H 2IAND 3L5WA 4UB0L 4HXBH 3I6LE 3BMVA 1V7NH 2KUTA 5DD3L 5FECB 3QCUL 2OS7A 1QFOA 3HUJE 4BK4A 2DIBA 5F6HI 3VH8A 1I1RA 1WAAE 1G6VK 3FFCB 4ZAKA 5C2BH 2ZPKL 1D5ZB 5CHNB 4Z7NF 1WIUA 3T8XB 2BERA 2Z35A 3VFNA 3D39E 2XY2A 1Y6MR 4N0UA 4WI3A 1HOCB 1UT9A 3WO4B 1K9TA 2FH6A 2VWEC 3CDGA 4OZFB 5EC2A 3P0VH 2VDML 4HMCA 4QT5A 1MJ8H 1T89C 3KR3H 4HKXB 2IBZX 1XCQB 3QULB 5JQ6L 3JVGC 4UQ2B 4Q97A 3A6CL 4YPGB 3NA4A 1UH4A 2WWMD 2VXSH 3C87A 3H7BB 5JMRA 3RHWK 1OTTC 3O3EB 4X9IA 2NQCA 3QUZC 3MV9E 2OZ4H 4JZNA 3MUGA 4GO6B 4M4RA 1FGNL 3DTXB 5I66A 5IT2L 4IIQA 4U1KB 5T1DH 4CRPA 2OL3B 1A9BA 2H8PB 5C0AA 4LSVH 3VGFA 3LOWA 4LGSB 4QHLA 3GSVA 5EZJB 1DANU 2ESVA 1OARH 3FQTA 2VLRD 4FOMA 3CGTA 1QRND 4JFOA 2DQEH 2H2SD 4PRIE 1OCWH 3MLTA 5J89A 2OJZH 4AZ8A 2CXKA 4GFTB 1U58B 5KVFH 3ARVA 5DMJB 4OCWL 4U1LB 4LCCA 5E9DA 5GJSH 1Q0XL 5H37G 3QH3A 4H25B 3UDWC 3PL6B 5F1SA 4Q58C 3KYMA 1HQ4A 2O5XL 3K80A 4HKZA 1HH6B 5ILTH 1DBJH 4GRWB 4RMWA 1RPQA 2AK4A 2FBJL 1N8ZA 4OGXL 3B43A 1QLFA 4PJBF 2V5SA 4G6FB 3PXJA 4NIKB 5FYKH 3O81A 1HCVA 1MWAH 4HLJA 1U6AH 4LARL 2ILLA 1W72B 3V79C 4KUCD 4XNMA 2CKBH 5BOZG 4Z8FL 1CXHA 3LEYL 5C08D 3RVTC 3GIVB 4Y16D 4YBLC 1NDMA 3SKOA 5D70L 1M6OA 5FOBB 5ENWB 3ZKXB 2IH3A 2Z8VC 2IFFH 3EKCA 3BP7B 5DMGD 4DN4L 1LK3H 3VFTB 4KKNA 4M1CC 1SY6L 3CH8A 3LZFH 4JFDA 3BIKB 2GKIA 1BZ7A 4Z77B 4YIQA 3S34H 2WK2A 2XWTB 1FN4A 3N1QC 2WLYA 4JQIL 4JFYA 4NO0B 1RUML 1HHKB 2PW1A 3OJMB 3SDXF 1DQJA 4JGUA 3DRQB 4V2CB 4F8TA 4U1SB 4Y1AD 3H2WA 5JIHA 4UAOB 3UJIH 2FHCA 3I3EA 5JIIA 5JTWA 3LSOB 4D94A 1QEWA 5KSAA 3DX7A 5MEND 4ZSOB 3ISWA 1FFNB 2HVJA 2V17L 4PY7A 3P77A 1GGBH 4FQQA 2GUOB 5T3ZD 4DN3L 1VA9A 4NP4L 1J8HE 3MYZA 3Q5YA 1P7QD 2WLZA 5GGTL 3FO0L 1YNTB 2AKRB 3FT4B 3MRFB 2NR6C 4OFDA 1ORQB 1NC2A 4U3CA 1JWMA 3DBXA 3HPJB 5HYJB 3PGDA 5J8OA 2YC1B 3VD7A 1FG9C 2EZ0D 1FLRH 4GAYB 1R3LA 4OAWA 4PJCA 4XP5L 3CSBA 3L5XH 5DUPL 3H9ZA 5GZNC 3T0EC 1FNSL 3FAWA 4U0RC 3D85A 4LIQL 5E5RB 5EU6D 4P2OA 4QRSA 2NZ9D 4OD2A 2A6IA 4HPYH 4WO4D 2VSDA 3HI1A 2MFNA 3RU8H 1A8JH 4R96B 1KUMA 2Q86A 4R4FL 2XKUA 5ACZA 2I9LA 5DMKA 2IAMA 1R5WA 4OFPA 4QHUA 5CJQH 5B3JF 2JCCE 1IBGL 3TVMD 3HE7C 2ZCLL 2W0FA 7FABL 4LLUA 4IEFB 1EUUA 3C6SB 1A7OH 1IFHH 1P84K 2NCMA 1MRCL 4U7KA 2VDQL 4P5TA 4L29B 5HGGS 5IGXH 3G5VA 4MHHG 3OKKB 3LRHA 3QDJE 4QY8B 3UMTA 3DHJA 3VXSA 3VWKB 3T0DA 2APXA 1Q9OA 2AJ3A 1AGCA 5IROC 3RZCA 5FO7A 4JM2C 5CJXA 5GS2D 2FYYB 3B5TA 5DJYA 1RJCA 4LCUA 5E8NB 4GKZB 2RCSL 3GNML 4NPYA 3E6FA 1ORSA 1AKJD 1T0NA 2BCKB 1MCPL 2AABH 1NFIA 4G7VH 3BGMB 4H26A 4NSKA 1NAML 3G6AB 2A6KB 4MLSA 4OB5H 3MRCB 3VCLA 4FFVD 3LQAC 4LVHB 4LSUL 3VDCA 4FA8A 3ABZA 1A1OB 3RX5A 2OP4L 1CGVA 3L3OB 3WYRA 1KIPA 4JKMA 1TCRB 1UVQB 3QHZH 1KB9J 2DYPA 5T1MA 4XPTL 4OCXL 2MPAL 1UWEH 3D9AL 4G9FA 3U4BH 4APQB 3CDYA 1JN6A 3M07A 4XAKD 4P23D 3TBTB 1NBQA 4WCYL 4TTDC 5HHQB 4P46B 5J3HD 5L8JB 4MJIE 2F54B 4MNQA 3UPRB 4MMXC 3FO2A 1VSCA 3MRDA 3LS5L 5CKAA 1RU9H 3VXME 3I6LD 1MHHA 1I3GH 1IJ9A 1F4YH 3ZL4H 1PQZB 2QKIA 4IMLA 2MTPA 2BXYA 4O9HL 4LPWA 3M8OL 4YDLB 2I60H 4NQTA 4Y0GA 2VLRB 4PRDA 5JW5B 2HJLA 3ROOB 3VE0B 4Z7OE 2VZVA 2HRLA 2OM5A 5CINL 5GGQL 2VAAB 4OCSH 3LN4A 4PJ8C 3DROA 3ZKMC 4YE4L 3D39D 4JKPL 4LEXL 5SX5H 1N2RB 3F58H 4JHAL 1T7ZA 2VITB 1IL1B 1U8PA 2IALA 3MV7B 4XMPL 1SYVB 3ECBA 2ZUUA 3DETC 4QRRA 3QA3A 4JRXB 3BRGC 1QLEL 4AYFA 5B4MC 4P9ML 3CVHA 4MJ2A 4NJAH 4KVCH 3MV9D 3V8OA 4X5XA 3JTSA 3DUHA 4JR9H 4N0YL 5GPRA 5E70A 2F8XC 3BWUC 1QSEE 3DO3A 3MODH 3LKNB 4MQXD 4JY4A 3TVMC 4QXGH 4NNXB 2ZOKB 2E7MA 1YEDA 1ZT7A 1R24A 3UROR 4KUZL 5EZOL 5C08B 1KPRA 4Y16B 3AY4C 4PRID 3V2AR 3G6DH 2MQCA 2DTMH 4JVUA 3IETA 1SJHB 2AJYH 4L1DA 3UTTB 3HC0B 3QUMB 1HKLH 3EOAB 4WV1B 5D5MB 3TPUB 4DW2L 1GGIH 3HZKA 3MUHL 4R4ND 1LO2H 4WU7B 4YGVA 2KQMA 3NPSC 3PP4L 3VFGH 1EEZB 3MFFA 1DN0A 2IPTL 1WUNT 4RFNC 3HG1B 2HWZH 4X8JA 3EW3B 1EIBA 1KLFA 4N0CD 1T3FA 4HAGA 3DUSA 4Y1AB 1A0QL 3WEXA 3ZYZA 5HHVH 1MFDH 2YWYA 4RQQA 4CJ0A 4IS6B 3O11A 1BM3L 1AY1L 4QHNB 1ZLWH 1DLHB 3UTSE 5IKCA 1AQDA 2J88H 2D4FA 4OUOA 5KSBA 5AG8A 4X7TA 2X4PA 3WS3B 3QPXL 3CLEH 3ARBA 3QCVH 2YRZA 4Y19E 5DA4A 2W9EL 1P7QB 4CU6A 5EOTB 3U2SA 4PLKC 3TT1H 4LSTH 4XAWH 3TV3H 3DSFL 1PJ9A 2GJZB 4O51B 5F8RC 2WWKT 2FEDD 4KRPB 3KR3L 5HD8D 3FRUB 2EDOA 2FX7L 2PXYD 4QRUA 4LVOC 1R3KB 1G6RB 1LP9F 4EBQH 1I4FA 1L0XA 1OSPL 5IESH 4OZIA 4PJAE 5BXFA 4U2YA 3AU1B 5SWQA 5E7BA 2UZIL 4DFHA 2AERT 3BP6B 1PEWA 5HHOB 1V3MA 1OARL 4LRIC 5J6HB 3BXNA 3I6GB 1DQTA 2ATKB 2VJXA 2A6JB 3I85A 1NMAH 1CFVH 3O8XB 1J8HD 1OM3L 2ERJC 2HJFB 1HHIA 4XBEL 1A64A 5TDNB 2JJTC 1NC4B 3MRKB 4WW1A 2ITCA 2FZ3B 4OCMC 2P45B 3GI9H 3U9UA 3QNYA 5I8EA 2GK0A 3K4ZA 3CPLB 4M6AA 4BZ2L 4HULB 2MJWA 3ROLB 1TVHB 2UY7A 4RAHA 5B39B 2DWDA 4L3EA 4QLRA 4XBGB 2Z9TA 4HV8B 4PP1D 3N1GC 5I8KH 2APFA 4NKDB 1DZBA 4G8EA 2NTFA 4X4XB 4PLNC 1MJUL 3V6OA 1VEPA 1AKJB 5IVXE 3QT2A 4ELMA 2NY1D 4H8WL 4MNGE 4M8QA 1F00I 3JWDL 5IQ9A 3P4OB 3T2QA 1JV5B 2FSEB 3DV6B 4HS3A 3OR7B 3O3DB 4X4ZA 4WTXA 2XT1B 3OKDA 4G8GA 5JOFA 4N0FB 1B9ZA 3ULUE 5L88H 3PWUB 4XH2B 3A0OA 4U1HA 2VUYA 5DR5L 1W2KT 3SKNA 4G6AD 4NDMB 2DJ4A 4JZJA 5DRNB 5CGMA 1AR1D 3QDJD 5M94B 1JWUB 1SYSB 2LQRA 3CFEA 3SPVB 1I8MA 1L9MA 1DBML 5DRXB 4FQHB 4E5XA 3BQUD 4GMTL 3EO9L 3U4EB 1FZOA 4F2MA 4C56B 4MQTB 2MCPL 1T03L 2CLZB 1EEUA 2R2EB 3PV6A 3SO3C 3GHEL 5IW6B 3S98A 2HKFL 1MNUL 4NBYB 4X6CB 3NGBB 2YMXH 2FBOJ 4DFIA 5DEZA 3ARGA 4EI5D 2NW3A 3PDOA 5ITBH 1IAMA 2K3TA 4ERSH 5CAYB 3HZYB 4J12A 5EN2B 3M1BB 4EIZC 1M1SA 1CCZA 3V5HB 4OZFA 1W0YT 3D39B 2W65B 5ESQB 5IHLB 3MRBA 4HKXA 4GKNB 4CAGA 3QULA 4UQ2A 4ORGB 3WJJC 1DSFL 4GBXB 3H7BA 4K94L 4MJID 4Y5VC 1JGEB 3O3EA 4OLZH 3GMRB 2RHEA 3V4PL 4AEHH 1MCDA 3QFDB 3OGCA 4XCCL 3DVIA 4OF6A 1PZ5B 3S37L 3VXMD 1JMZA 3LKSB 4R2GB 2OL3A 2VIRB 5I1HH 2NY2B 5IUSA 2D31B 1Q9KA 4ZPTB 1NUNB 3BZEB 1JPFB 3G6JA 3TNMA 2AXJA 1FNLA 3VI4E 1YEGH 4KDTA 3PGFL 2O26U 5E7FA 3MZTA 3LQZB 3BH8A 1WTGT 3TCLA 1GC1C 4L8DB 5JIKA 5BO1H 4Q9RL 4JDVA 4LP4A 4DKFH 2WUCH 1GZPB 3UJTH 1GOFA 3TA3B 4EOWH 1HH6A 1ZT1B 4Y4HC 2VDPL 1DUZA 3MRMB 4NC1C 1I85C 1Q1JL 1VFBB 1S5IH 4PUBH 3CVHH 3SHSA 3STLB 1LD9B 3QEHA 3SOBH 3VGAC 3MTRA 2H41A 1QSED 5DFVC 1NGQH 1RI8A 1D9KD 2NY5L 3JV4B 3RGVC 2R4RL 1OAYH 1PKQA 5F6HJ 3INUL 3WIHA 3P4NA 3WLWD 1RJZA 2F5AL 4K3HA 5BJTB 3ULSB 4OGZA 2VRAA 3SDDB 4CU7A 3BIKA 4XNZC 1OSZB 4ZOCA 3QHZL 1ZV5A 2N1KA 4NO0A 2YD7A 3T0WA 1UQSB 1RSFA 1FZJA 4R7NB 1HHKA 1QD0A 5BZDB 1LO5B 3E3QC 3U79A 3QIWB 3MGOB 3GBMH 3DRQA 4GXUN 3OKNB 4M7KL 4GQPH 4U1SA 2A83B 2VQTA 3K2UL 1QBML 3U7YH 3MRGA 4J3SA 5DURD 2PXYB 3TJHD 2DDQH 1I1FB 4PJFB 2BFVL 4Y5YB 4ZFZB 1CFSA 3QQ3A 5TF0A 5FXCH 2I5YL 2HKHL 4XP1L 5HY9A 4Y5XA 1FFNA 2ARWA 3UTSD 2YUZA 2GAZA 3L6FB 1IQWL 2CK2A 1XIWC 3NACL 5EC1A 4PJDE 3J8F7 4XGZB 1NLBL 3VXUE 5LWYH 2R69H 2H3NA 3FB7A 1A3RL 1N4XL 4B7IA 2W60B 3REWA 2M8XA 4Y19D 2AQ3A 1J8HB 2AKRA 1X7QB 4FZ8H 4OCSL 4YBQC 1U8IA 3ZKND 1JNHB 4ZUWB 2FGWL 1ORQA 2IFGA 3BZFA 1E4JA 1E28B 3HPJA 4QXTB 2BMKA 2IBZY 3HI6H 2NPLX 3F58L 4XC3H 2N7BA 2CLRB 1JWSA 5ETUA 3KDMB 2YC1A 1NL0H 4KVNH 4Q7DA 4EDWH 4GAYA 1HXYB 4K7PX 1DFBH 4G6JH 5CZXD 3MLSH 3L7EB 4PJEE 2A0LD 4X0KB 2Y5EA 1I3RA 4RBPH 3IT8D 2VC2H 3RIAF 3BD4A 3MCLL 3B9VA 1IM9D 4PB9H 3PQYB 4HG4J 4R96A 1NEZG 4KRLB 4Z7UF 1ULVA 1G9NH 4OSUH 3BD3A 2K7PA 3V8CA 3QO0A 4P3CL 1H3TA 1K4DB 1S7SB 5DF0A 4CN1A 5DUMH 4FFZH 3BKYH 1PZUB 4OLYH 4RNRA 2HLFC 1PBYA 1A7QL 2EDLA 1OAXH 3QEQE 3OKKA 2NY3D 1HKLL 3LV3B 5CSGA 4TULH 3V6FA 4OTXL 2R56L 2EH8L 1OP3K 1D9KC 4CMMB 1I7ZA 2WUBH 4NWTL 5EFIB 5F88A 3DMMD 3BQUB 3CUPA 1I7UB 2R9HC 4GG6E 1EEQA 2Y6SC 2IANA 1JHKH 2NY6C 4JJHA 5SX4H 2BCKA 2Z4QA 5JLZB 4GG8B 1HH9B 3Q6FB 3G6AA 3QUXC 2JB5H 3BKML 3T0AA 2OLDA 3U1SH 1KB5L 2A38A 2Z31D 2ATPB 3BPLB 1A1OA 3MOBH 3QUKB 4NKMB 5EU7E 2KQNA 1N6UA 2P24B 3L3OA 3GHBL 1UVQA 3JTTB 4JKLA 3UYPA 1M7IA 4BFEA 2Q7YA 3GO1L 5I73C 3ULUD 3ARYA 1KACB 4YK4C 2D0GA 1KPVB 1E27B 2NW2B 2AGJH 3HZVA 1KG0B 5EORL 4EQ3A 1OAUH 2ZJSL 5GRWA 4HXAL 4P46A 1MFCH 2IQ9L 5F9WC 1T2QH 4XCNB 4XRCA 2F54A 3ULVE 3UPRA 4DUVA 5JIPA 3IU3A 4QWWC 4MJIB 3G08B 3MBXL 4RZCB 4UQ3A 1FBIH 1K8DB 4MA7H 4FQJH 1SEBA 2ZUQC 2EE6A 4JFZL 3HA0A 3OAUL 4G5ZL 3SKMB 2FWOA 4NN7C 1KIUA 3QUYD 4OGAD 4Z6AT 2VLRA 2XTJC 3RKPA 3ROOA 3O6KH 3KPPB 2BVQB 1YPZA 2GT9B 4LQFH 1HKFA 4O2FB 2VAAA 3IXAB 4ODUA 2E27L 4XNQA 5EWIL 5I8OH 3RDTD 3WN5B 1N2RA 4NQXB 1S7QB 4JB9H 4ZNEA 3O3BA 5IIEB 4NKIH 2DQCL 2VITA 1IL1A 1S8DA 3MLVH 1V7MH 5D9SB 2E7LA 4NQEE 1SYVA 4OZFH 4YC2B 5LBSH 1OWWA 3K1DA 4BQCA 3MV8E 2KZWA 3H6JA 2Y06H 4JRXA 3S36H 4LHQB 1KEMH 4ZYKB 4R26L 4R8WL 3G5XB 1J1XL 3N85H 3WIIH 5ERWA 3OGOE 4PRHE 4D3CH 2C4FT 1A22B 3C8HA 2V5TA 2C4XA 3DGGA 5FUZH 5GXBB 1GHFH 3QDGE 4QTHB 1F3DJ 1CK0H 4I3RH 2FIKA 5ESAB 4NNXA 1UCBH 3NIGF 2ZOKA 4PJGF 2OL3H 4P2RB 5I8KL 5J0BA 4LCIH 1VEOA 4NZJA 5DT1L 1FNEB 4HFUH 2CKNA 4RISH 5C08A 3ARFD 4Y16A 5D1XB 4KJWC 1FHGA 2C26A 5BMFH 4LLQB 1CE6B 1MIMH 1P7KB 4KROC 1WFUA 5J56B 1JZ8A 5E8PA 3UTTA 1EFXD 3QUMA 4FQIH 3EOAA 3TPUA 4D9LH 3C5ZB 1XF3A 2P4AB 5C0FB 4XVTH 1OD9A 3TZVD 3VW3L 4H1LG 4WU7A 1W0VA 3JWOC 3HE6B 4KKLD 3O41B 1F58H 5GRXG 4DJMA 2O5ZH 4NUGH 4MXVE 5SWZB 4GRWH 2A77H 2AJSL 4P4KB 4FZEH 1I1AC 5C0DA 4XMLH 1U3YA 1T5XB 5LGJA 4Y1AA 2QL1A 5DURB 2RR3A 5JNYA 5D1QD 1VGKA 3P9LA 4KHXH 3NABL 5E4EC 1W72H 1ONQA 2ADGB 1OQXA 3N9GL 3AAZB 1H5BC 5FKAB 4CMHB 3N1FC 5MENA 2BX5A 1DVFD 1PG7L 5I19L 1X4ZA 3UTSB 1WVZA 4PG2A 1KJ2L 4JPKL 5I30L 4YEEA 3MA7A 3H9SE 3WIHH 3SGDH 1QFWM 5D7LB 3ZT5A 3W9EB 1I8KB 5DZOA 1P7QA 4K71C 4KI5E 4W81A 5FKPA 1JP5A 4FHBD 4O51A 3J7HA 3TBWA 3THML 3BRFA 1OL0A 2X41A 4HPOH 4HC1H 1K3IA 1QSFE 1N64L 3OSKA 1VERA 5CD3A 3MRIB 2EYRB 3GSOA 3FRUA 4X6EB 1N6QL 1CS6A 3G5YB 4FFYH 1CF8H 2P8LB 3V0WL 4YHNA 1R3KA 2C1OA 4TVPH 1G6RA 1IC7H 1VESA 2WBKA 4OLZL 1MIEL 1U8KB 1TZHB 2NY4C 3IDIA 3MNVB 1WQVT 2BRQA 1HEZA 1U8NB 3AU1A 5E6YA 4E41E 5L2JA 4WO4A 4PGEB 1XGYH 2OR7A 4PP2A 2VDOL 3RGHA 3I6GA 4QEGA 2MMXA 3WHE0 4M7LL 3KPOA 1TXKA 1E4WH 3VXUD 1NKOA 1JTPA 1UWXK 2P49B 3H3BC 3CDFA 2BY3A 3GSQB 4G8FB 2ZG3A 3QPQC 5DD5L 3EO0A 4LGPB 1NMBL 5TDNA 4KMLB 3HNVL 5JPMB 1D5BB 2FJGB 1VB9A 1JGVH 5DRZA 4DKFL 3QJFB 5C0RH 2J8UB 1N0LA 5F7DB 1X9QA 5D2NC 3VD3A 4F9LA 2AXHA 1J0JA 1YN7B 4XBGA 3OXSB 3RY6C 4NKDA 4ENEC 2YPLB 3HFML 3VXNB 5DK2B 1JCKA 1ZHBB 3EDKA 3KPRB 3UO1L 4JO2H 5DJ2B 3IDXH 1AKJA 3RZWA 3Q6GH 1KXTB 2IADB 4NGHL 4HKBA 1CL7H 2QADC 2ZUXA 5C0ND 1EMTL 2R8SL 4I1NB 4MA3B 4OLEA 2QSQA 2FSEA 4GQ9H 3DV6A 4XX1E 1UYWL 3MRPB 5DD1L 1BFOB 3NAAL 4DGVH 1MHPL 4UDUB 2R2HA 1AQKL 1W0WB 3STZB 2Z93B 1CFTB 3PWUA 2FEEL 4HUUB 3B83A 3TH4T 2ADFH 2WM0A 5TE4H 3QEQD 3TT3H 4GW4B 1EFQA 4P23A 5KS9F 2I9TA 5DVOA 1YNKL 3SPVA 3GJFB 4Z78B 5EB9A 5HHMB 5CKGA 4Q0XH 1BMGA 1P2CA 2ZOLB 2WIIB 2HYMA 4GAGH 4WW2B 4M62L 4M1DL 1N5YL 4LLMA 3OPZL 5F93C 2ZKHL 2FNBA 5GS0L 4Z7VF 4LOUC 1UM5H 1NPUA 1H3WM 1FZKB 4GXVL 4JFEE 3HUJA 4GT7A 1WAAA 4HS6B 2UZYB 1UZ8A 5K9OB 4JQXC 5CP7B 5EBWB 3Q48A 5EN2A 1CR9H 1RK1A 1P4BL 4KK8C 3OKLA 5GJTH 5AG9A 5GRVK 3VG0L 5J1TC 3D39A 1N26A 2W65A 4JO4H 5GRJL 1YNLH 4G6KL 4GKNA 1T1YB 2WP3O 3P2TA 4UV4L 1CBVH 4ORGA 3RNKB 4GSDH 1E6JH 1FLTX 1JGEA 3TJEH 3ULVD 3IDMB 4ONFL 1BECA 2GITA 5FK9B 4FXKB 1TJIL 2OBGA 4KVNL 3MV9A 2XACC 2OTPA 1QNZL 4MX7B 1FZMB 1NFKA 3WKMH 5F3BA 4HK3J 3A67H 3TWCL 4K8RC 5FYKU 1MREL 3V52H 4BZ1H 1JPFA 1B0RA 3NFSL 1FGVH 1BFVH 1U8QA 1LDSA 2VC2L 4AMKH 2H2PC 5AWNH 2EC9U 3MRLB 2BNQB 3QO1B 3VXTA 2XA3A 1QPXA 4XXCC 4LPTA 3UTQB 4PRIA 5CIPB 5EO9A 3OB0K 2J6EA 3S9DB 2HVKA 3O9WD 4L8DA 4U1GC 4Z0XB 2EE9A 3T65B 1A6ZB 2CDGB 5I16A 5TFSL 2PETA 5I1GL 1MEXH 1JZ6A 2ZSVA 3SGEI 1QBBA 4RIRB 3TA3A 3KYAA 3OAZK 4HEPG 1I9IL 4NQED 4JZOB 4UOW0 5CJOL 4DCQB 1ZT1A 3MV8D 5FCSH 1B4JH 1VFOA 4HGMA 3K8KA 6FABH 2W9LA 2GTZB 4ZTOL 4MB5A 2D3VA 4PRHD 2YPVL 4MD4B 1TJHH 3QDGD 4NWUL 2XZQL 1CICD 4FXGA 4XPHL 4PJXF 5C9JA 3DLQR 1J11A 2EDWA 3RWGB 3LHPL 1LEKA 3VGHA 1FJ1B 4DQOL 4M5ZL 3LN9A 1QKZL 3F5WA 4FQLH 5AYQA 1U2HA 3BT2H 3HB3C 4NRZA 3ESUF 1CU4L 2FB4L 2WBJD 1WBYA 1EGJL 3VMOA 2IF7A 3FHAA 3HHRB 2NY0C 4LNRB 3K46A 1B3JA 3JV5A 5H94B 1KTLA 5GRUL 4FNLL 3U9PH 1Y18A 2XA8L 1ZK9A 3GSWB 5IWLC 4PG9B 1OW0A 3QUMH 2WQRA 4TUKH 1GGCH 5D7IF 2HFGH 3QQNA 5CEYB 5A3ID 1UQSA 4BFBD 3O2DH 5CZKA 4R7NA 2DI7A 4M6OH 4U7MA 2LTQC 4WUUE 4H5SB 2H1PH 3SKJL 1HYSC 4NQVA 3OKNA 1LILA 4IRJD 4BQ6A 1EJOH 2PXYA 5F97E 4NNYB 3BESR 5F89B 1E4KC 2PO6D 3B9AA 4MVBD 2P43B 3P9WB 2B1AH 1G9MC 5F7HA 4OI7A 4NJ9H 1YYLH 1AFVH 3C8KA 1U91B 3V4UL 2D9QB 4Y7MA 3QQ4B 4X98A 3NZHH 2XQBH 1WWBX 1I8LA 2DIAA 1YEJL 4XGZA 3W39A 3CVIH 5FYJH 1IGFH 5KOMC 4R0LC 2W60A 3H9SD 2XKSA 2PYEE 3OTTA 3WCYA 1J8HA 2B39A 2BOCA 4KI5D 2Q3AA 4HGWA 1DEDA 3LN5A 1QO3B 1BIIA 5FYKE 3LDBC 4EN3C 3O6ML 2BVPA 1BQSA 1QPPA 3KDMA 1QSFD 1HXYA 3P0YH 5FIEA 2KL6A 3ARRA 1SJXA 4JRWA 43C9B 2EIZA 3OJ2C 5EUKB 1G6RH 1BOYA 2BHUA 4PJIB 3I75B 5IFJB 4E41D 5TE6L 3QEUB 3MOAH 2VZTA 1XGQB 1Z9SA 2XG5A 5LCVH 3CFJB 1IC4H 2C7UA 3VFPB 1S7SA 4EI6B 4OBRA 1NGWA 5E8DL 2JCCA 1S7WA 3T0BA 5IP4A 4KJPC 1BREA 1WEJL 2X1QA 2A2QT 1I1CA 5F96L 1BVZA 2FR4B 5T3XH 5IW3A 2C3GA 4PBXA 2YOCA 4CMMA 4U6YA 3WDIA 1CQYA 1CDYA 3QDJA 3LEVH 5IMOB 4YO0B 3VGDA 5BW7C 3GKZA 4I5BB 5J1SC 2X70B 3BQUA 3T0EB 2DLFH 4HK3N 4HWBA 4I0PD 5INCB 5JLZA 4KTYA 3Q6FA 5DI8A 1HK6A 1MUJA 1FYTB 1JZ7A 4YHZH 5D5MF 3HI5H 4FABL 3QUKA 2RJMA 2ICEA 2P24A 3HMXA 5JO5B 5T1LD 1D6VH 1K2DA 3SE3C 4EI5A 2VISA 1LO3H 3HE7B 3JTTA 3PWJB 1QFHA 3TNNB 3PWPE 4YEFA 5C09B 1KJ3H 4JANA 3W5NA 2BDNL 5EH1A 4NKOA 1C08B 1BQHG 4LBEA 1E27A 1YYML 1AR2A 2CIKB 3DHMA 1KG0A 3B2VH 3D1MC 3LIZL 2HT4D 3ZTNH 1JPTL 3VI3F 1N3NB 2I24N 3GKWH 3I9GH 1FRGH 5I1LA 4JM2B 4L4VB 4MJIA 3IDNB 4RZCA 1K8DA 5DWUH 3WS6A 1INQA 2DQJH 1CGTA 5DJXA 1YJDH 5HDQH 5ADPL 1A5FL 1GRWA 1QSVA 1O7VA 3RP1A 5HI4D 3VXMA 4YHKL 5GGSB 1F3DH 4X9FA 4K3DH 4HBCL 4JCMA 3DGCR 3O6FC 4IRSC 1JL8A 4MDIA 3ALWA 4JFED 3RQ3A 1R0AH 4K3JH 3KPPA 1UENA 3DRTB 2GT9A 4O2FA 4PRNB 2VXQH 1RQ5A 5FV1L 1FNGB 4G7YL 5DUBB 5LAXB 1C5CH 5LXGH 4TRPL 5BS0E 1PGRB 1RZKL 1ZVSB 5FHBH 4NQXA 1S7QA 3D18B 5JDSB 3TYFB 5IIEA 4OD1H 2DBLL 1BVKB 3DVNB 5K9KB 4LLDB 3UJJL 3RJDA 1OLZA 5TQ0H 4FG6C 4MNHB 4MB3A 4TN9A 1AXSA 1LK2A 3QIUD 4ZS6C 1EO8L 1ZLVK 3MO1B 5I8CA 4K7PY 5CMAB 3OX8B 4OZGE 35C8L 5DJAB 5GZOC 1X5HA 4OD3H 1FCGA 4HEME 3U0WL 2VXVL 5D7KE 5FYLL 3VXQA 4K23L 5ESAA 3VG9C 2HT3C 1ZGLM 1UA6H 4P2RA 1QSEA 1O5DT 2DAVA 1PX3A 3QG6B 3X3FL 1QYGH 1JPSH 2ORBL 5D1XA 3S5LA 3WFBH 4PJ8B 2RB8A 1A6WH 5L6YL 4AT6A 4Z95L 5F7WC 4Y8DC 3MGTB 2WBJB 1EJ6A 2X4NB 4P5KB 4JM4L 1KC5L 3E1F1 2J6EH 2I26N 4IDLA 5C0FA 3QFJE 4DGVL 1FL5B 3MRJB 5IEKB 2X4TA 3AUVA 3O3AB 3MLWH 4RMVA 4U6HA 1BGXH 2R0WH 3O41A 4YNYB 1T0PB 1PSKH 2BC4B 1AGEA 4NN5B 1IGIL 5J9PA 3VWJD 2AK1H 1CXKA 3X13A 5IBUB 3SQOL 1T04A 1YA5A 2PTTA 5DSCB 3ILPA 4TSAH 2P42B 1S3KL 4Y4FD 4JRYE 4ZFOL 1AD0B 5DQDH 2HN7A 5TPWL 4R3SB 4Y2DD 2QQNL 5T5NG 1LP9E 1A9EA 3U46B 1S9VB 5CCKH 5CD5C 2Q76B 1G7IA 4HK0A 3H42L 5DJZA 3UTSA 5DDHA 4TNVF 5IQ7H 3RWIA 4IOFC 4ODVL 3MCKA 3V5DB 4L4TE 5C92A 4ZD3H 4LAQL 3NPSB 1UACL 5H2BA 4M7JH 2E8ZA 4MDJA 1MCSA 4F7MB 4QHMB 3O0RH 3Q0HA 4HX1B 4UINH 1OAZL 4WJ5B 4WUUD 4KKCC 4UIMB 2OK0H 4RFNB 2XTLA 4MA1C 3GSRB 1T1WB 1ZTXL 2EYRA 3TIEB 1RVFH 4X6EA 4X6CF 3G5YA 2CIIB 2P5WE 1XF4B 1K85A 2M26A 4GSDL 4O58L 2B5IB 3ZMRA 1K4CB 1U8KA 1TZHA 5E6IB 3MNVA 4LCYB 5T5FH 5HDOA 2X4OB 4I77L 1F4XH 1U8NA 2ZSWA 1MY7A 1NLDH 4PGEA 1IM9A 1R3IL 4PJAA 3SE4A 3RTQD 2Y07L 5LQBL 4E41B 3EFDL 2ICES 1UKSA 3BIAX 4ODHL 2QV2A 5IVZB 5F7FA 3MFGB 3FN0L 5E99L 1KCLA 1YECL 2VXUH 2E9IA 4G8FA 4ZO7A 4C4KT 3MQIA 4YDIH 2PYED 1IGCL 3CD4A 4K3EL 3AB0C 3HNSH 1OP5K 4JQVA 1J87A 2WAHA 1D5BA 3FFDA 4FP8L 5FYKD 1U93A 4H20L 1T6WA 3X3GL 1BAFH 2CR3A 3MXWH 2AV7B 3WE6B 1VKXB 5F7DA 4M48H 5ALBL 5ID1B 4LRNL 1EUTA 2MNUA 4LVOB 4GAFB 5IMKB 3ME0A 1NDGA 1CQKA 4YHOH 4NQCB 5KSUB 2JJSA 1A3QA 2YPLA 1F6AB 2VN7A 2EE3A 1U8LA 2FGZA 4O5LH 2BSSA 3L3GB 4EUPG 4JDZB 4M7ZC 4M7LT 3HRZB 4X5WB 3O3UN 3CMOH 3NZ8B 3I50L 5IVXA 2BOBA 2Z31A 3T4AB 1BBJA 4MA3A 1UM6L 2HRPH 4NT6B 3AREC 3O4OC 2DL9A 3KJ4C 4PPTA 3TO4D 4UDTB 1BFOA 4K7PL 2C5DC 4MNGA 1W0WA 5GGRA 2ERJB 2CDEB 1DQDL 5FCUH 4MA8L 3ZSSA 2HH0H 2Z93A 3O4LE 1CFTA 2E3VA 3VFVA 3WJLC 3R06B 1A7PL 1INDH 1ZEAH 4FQXD 3BSZH 4M1GL 4PIRF 2Y25A 1NANI 4WTWA 1FP5A 3C60D 3W0WE 4DGIL 4Y2DC 3CNKA 1ACYL 1DTUA 3GSNL 3MROB 2ZOLA 2WIIA 3JV6B 3IU4L 2DBJA 5E00B 4G3YL 1MCIA 4PGZA 4XTRC 1WCBA 2O93L 1JFQL 3MRQB 4MJ4A 1RFDH 1YEFH 4MJ6B 3MBEC 3SDCD 4HWBH 1IEBA 2EIBA 1XF5B 1FZKA 5E4IA 5DMIL 3FMGL 3QUYA 5J11B 3EYFA 1U8OB 3JZ7A 4OJFH 2X40A 2CMRL 4XPFL 4XPAL 4RA3A 5D1ZC 2GSIA 5K9OA 1WCQA 3EHBD 5EBWA 2HMIC 2OQJA 4V1DB 4DVBA 3PWPD 5C0EA 2F58H 4OUUA 4UIKL 4ODXA 4DOHE 1KT2A 3D0LB 3S4SG 3RA7L 1OTSD 2VB5A 3RDTA 2BK8A 3TYGL 1DDHB 1INEH 5HI3D 2B20A 4JG1H 1RZ8A 1I1YA 3P4MA 3RNKA 2EYSA 2Y9RT 2EC8A 4F58L 1FO0B 1AXTL 5DJ6B 5BOPA 3IYLW 5T3ZL 4XX1G 2Y36L 1FCCA 3IDMA 4CVUA 3MC0A 1MCRA 4FXKA 4FTVB 4HLZG 1MRDL 3QIBC 2EDRA 3FOMB 4TPRH 4MX7A 5KG9B 1FZMA 1A7RH 1P1ZA 1RULL 2XNAB 3KVQA 2NMSA 4PJBB 5GGVY 2FCBA 5I1JL 5C8JB 3RVXD 3OZ9H 1NCUA 3IFOB 1VFAA 4HKJA 2OR8A 4X7SL 3MRLA 3ARFA 3QWOB 5EO0A 3V7AG 1BJ1J 4RFOL 1MPAL 1I7TA 2B4CL 5EG6C 2J3SA 5FO9B 5GISH 4H8WC 4N0RA 2GHWB 4F80A 4XXDB 4H88L 4LVNC 3JWDC 5BS0D 3UBXG 1EFXA 2DQFB 3RHWF 3B9KD 3VXSE 4NRXB 1YUHB 1ZWIB 2A1WL 1XGTA 2O5YL 4JZOA 3TZVA 3A6BH 1RUKL 4CNIB 5D7JD 4Y5VB 5DQ9A 1LO4H 3BIBX 1F13A 1MF2H 4AIZB 2QR0B 1F5WA 2I07B 1NGPL 3BDXA 3ES6B 1T7VA 5D96C 2GTZA 5EZIL 3MGAA 5JHDE 1NUDA 5IG7A 3CK0H 4UNVA 4RWYH 3SDXB 5D7KD 2XI9A 3O2VH 5E95B 1Z3GL 4Y4FB 2RIKA 2FATL 2EKJA 2VTFA 5D1QA 4KY1L 4ZPVB 4GKSB 4HFWA 3RWGA 1NCWH 4K2UH 1OY3B 5TE7H 2A9MH 4WI9A 1CN4A 3HTLX 5E1HB 2VERN 3WFZA 1I8IA 4RGNE 2YR3A 2NXYC 1DVFA 5FM5M 2F15A 3UTZB 3HI5L 4HUWA 3S88L 1EHLL 5H94A 1G7MA 5E08L 3WUWB 3UZVB 1TETL 3F12A 1XGRB 3GSWA 4PG9A 2FD6H 1MLCB 4FN0A 3QFJD 4RGMC 3V0VB 5MERB 3WLBB 1AGFA 1KJ3L 3SDCC 2YK1L 2Z91A 4Y4HB 4ZXBD 3ELAT 4YHMH 5TQ2L 1IE5A 3MLZL 5TF1L 3CFBB 1JGLH 1LO0L 3SCMC 3T3MF 3W2DH 4HCRA 3V7MA 4K94C 2J4WH 3VGAB 5F89A 1V05A 2OJEB 3T1WA 4M5YH 4JRYD 1WBXB 3BDYL 2BZDA 3HRPA 4BQ9A 2MCG1 3RGVB 2VLLA 1OD7A 1U91A 1QR1A 4BSWA 2OTWA 3HLAA 4JN1H 2APTA 2CSPA 5MEQB 4GRLD 5IM7A 4Z7UE 1KIQA 5IBTL 4DEPC 1A6AB 2APBA 5IB2B 2AEIT 3OXRB 4XNZB 2D7TH 4PJDA 5BZWA 3VXUA 5F1NB 4L4TD 3KPTA 2I25N 1JF6A 1GGUA 4UT6L 1KJMA 4GXUM 4X4YB 5FHBL 4Q9QL 4IHOB 2DQIL 1H3PH 3WXWH 1NSNL 4JKWA 5DD0H 5JXED 4E0RA 2VXTH 4O4YH 4UZGA 5AUMA 4PY8I 2W91A 2P5WD 4JHZA 4QRPE 1V8HA 4PJEA 43C9A 3SY0B 1EH9A 1RIUH 4X80L 5ADOL 3ARDC 1M71B 2F19L 4F57H 3NA9H 4W6XB 1J1OH 2Z8WC 4P3DB 3QEUA 1BQHA 1XGQA 1Q0YL 1FDLH 1XIWB 3NIFE 1L7TL 4J4PD 4XCEA 2XRAL 1J7VR 2NY5C 3LMJH 4EI6A 2DM3A 2DQTH 4S1QL 4YUEL 3RUGF 5CBAB 1F3RB 1MRFH 2YKLL 5EU4B 3C09C 3EOBB 4P57B 5KN5B 2J5LC 3REVA 2HFEA 2O61B 2CLVB 4WU5B 4GRMA 3G9VA 3VFSB 4J6RH 5E2TL 4XVUD 4S1DD 1G7LB 4LGRB 4L8BB 5F7YC 4JPIA 1ZGLA 5IMMA 2UUDH 3MMEA 2WBWB 1MH5A 3MLWL 2VDRL 3T0EA 3R8BB 5IHBA 4RRPA 3EJYC 4J3VA 5INCA 3R4DA 4ODWB 3EGSA 4GG6A 5IB4A 2YZ8A 2SEBA 3IKCB 3VXPA 1A6TB 1IAOB 4JFPB 5CEZL 5HHPB 2YPKA 4A6YA 2PYFA 3TBVB 5HGBB 5KSBE 4YZFF 3PHQB 4OZIF 4KHTH 5JO5A 4PLJC 2FX8H 5HGAB 2D03L 3LB6C 2YD2A 3UTOA 3PNWA 4C83B 5JA8B 2R0KH 4XP4H 2W07A 1AO7B 4NHUA 4NZRL 3O4LD 5DZLA 4EIGB 1MLBB 1JI2A 4MXQC 1C08A 5DEFB 5IQ7L 1JJUA 1MAML 3QQ9D 5ICXA 3IVKB 2OMNA 3W0WD 1OGAB 2R0LH 3VRIB 3L3KB 1U8HA 1N3NA 3IDGA 4YR6B 2AJVL 3KPLA 4ZAKC 4F3FB 3HC3H 1IAKA 1CVSC 4JPVH 3WDJA 3K8MA 3GJFH 1XR8B 2NY6B 1T7XA 3GK8L 1KN2H 4TOYL 3BI9X 5JPNA 1YN6B 2XV6B 4S11A 2F8VA 1D5IH 3SDYH 2BRRL 3H7LA 2EYTA 5GGSA 3BZ4A 1RMFL 3UPAA 4D9RE 3TGXA 4MD5A 4KQ4L 5JZ7D 4ODSH 4BZYA 4F7TB 3GRWA 1CVRA 3KPMB 4JREC 5C0IB 3VMPA 4JFQB 3NIGE 4PJGE 5L0QC 4PRAB 1RIHH 1LEIB 4ZTPH 4ELMF 4PRNA 1HCFX 5BV7L 1JI1A 2ZUYA 3E8UL 5EBMB 2BNRE 1N6VA 1FNGA 5DUBA 4TQEH 1W8NA 3DXAE 5AZEH 1JYXA 4IIQC 1PEZA 1ZVSA 15C8H 3D18A 1I3UA 3O9WA 1NC2D 5I15L 4NO5A 1BVKA 3DVNA 1CLYH 4DKEH 5K9KA 5F9WB 3C08L 5FA3A 1P4LB 4OIAA 3NPZB 3WFDH 4KI1A 4UV7H 4DK6A 5CILL 4NQEA 2Y5TB 3KG5A 3DV4B 3L1OH 5HVFB 5EUOF 3T2NH 3FN9A 5DJ8B 1X5ZA 3D85D 5DJAA 3KPSB 4LCCC 2ZUQB 4OZ4A 4MAYC 4PRHA 2YSSA 2H9GA 4NN7B 4IRZH 4HIXH 5E5MB 1JRHI 4AL8H 1UXSA 1CICA 3QG6A 5BCAA 5JW3L 2XTJB 2IAMD 1GC1L 1MCQA 2NXZD 1NGXB 4KJQC 2W0LA 2WBJA 3C2SA 5E56A 3L5IA 4P5KA 4HJGA 2J8UF 5CIPH 4PRPB 3PIQA 5I1CL 3C8DA 3NCJL 1FL5A 3B8YA 4YHPB 5MP6L 1R3JB 5IEKA 4OLWL 5D6CA 5DD6B 3VXSD 4B53A 3O3AA 1GAFH 5CWSA 1K6QL 1SEQH 2BC4A 1IAII 1HDMB 4NHCL 4ZXBB 3RVVC 2QQLH 1JNLH 4Z5RB 5JHDD 3LH2H 4IRJA 1ZHNB 4DWHA 5D8JH 5L7XL 1QACA 1C1EH 1F90H 5D72H 1U92B 1ES0B 1AC0A 3FFCE 2PO6A 1LE9B 1S9VA 4M43L 1SBSL 3WNLA 1LP9B 5M95B 1OAKH 2VE6B 4KROB 3TFKC 4X6DF 1TCMA 5MEPB 2BSTB 4RGND 4LLYB 1NCAH 4XZUA 4GRLB 1JNJA 1S5HA 3LEXB 5GRVL 5EU5B 4OCYL 1AI1L 1IEHA 3H9SA 1FIGL 1N7ML 3ZYJA 4WW2F 3HMXL 5ITFB 2N7AA 1CFNA 2P44B 5GHWL 4F7MA 3VMNA 4XWGL 5KSAC 1MFBH 4NNPL 4KU1A 3RWFB 4WJ5A 4UIMA 1ZA6B 4FQ1L 4R4BA 4EUPA 1R6VA 3GSRA 1T1WA 1NBZA 3TIEA 5FF6B 2QJDA 5C2UB 1I1AB 1BHGA 1XF4A 4FQCH 3RL2B 4DAGH 4PJ9D 3P9MB 1HIML 5HI5D 5IFAL 1K4CA 3D2UB 1YEIL 5KJRL 5E6IA 5IVOA 3RWEB 2X4OA 4YXKH 3C5SB 5F21B 3WFCH 4N8VB 4UT9L 4KQ3H 1ODAA 3DPBA 1ZKAA 4E41A 1X4XA 5L9DH 2ZUWA 1TQBC 5IVZA 3HCVB 5F7EH 5J1AA 4LKCB 1JPGA 2CUHA 3GBNH 3FAXA 3VXRB 4P2YA 3VH8G 4G6MH 4HZLB 4K71B 3HMWH 4IMKA 4CVXA 1QFWL 4L8CB 4P2OC 4GRWE 2G2RA 5GISL 5FGCE 4QXUL 2AJZB 4NO2A 1KENL 4NYLA 1NAKH 3WE6A 5EU3A 5ID1A 5HVGB 1UM4H 1A1NB 3AM8A 1MQKH 4QRPD 3MRRB 4GLRI 3FKUS 3JUYA 1Z9MA 4I0PA 1REIA 4P5TC 5C0JB 4YX2H 2CGRH 5I1IL 4KK9C 3IS1X 4CADB 3SEPA 3HRZA 3S4SA 2DQHH 3NZ8A 3TLRA 4FQ2L 2EH7H 4Z7VE 3T4AA 5E03A 4QCIB 5KVMC 2EE2A 2VH5L 5LGHH 5JHLH 5DJCA 5FM8A 4BQBA 3UTPE 2Q8BL 4UDTA 2J1KA 3RZCC 5CJXC 1A2YB 2CDEA 5T1LA 3QRGL 4QTIL 2Y7QB 3DNKA 2X9WA 2HTKD 3R06A 3VDBA 3D87B 1R5VA 4NM4L 4AENA 4TVPE 1ZLSH 4X4ME 4M6NH 3VGGA 3GIZL 2AI0H 5ALCH 2X2YA 4LU5H 3T77B 2E6JA 2IEPA 3RWJA 1LEGB 3KLAA 2DD8L 3JV6A 5K9JL 1MCWW 1RURH 5E00A 3SE8H 4XMKL 2Z0BA 4AEIL 3A6OA 2X4SB 4OZHB 3ZHKA 3MRQA 3IAGC 2JE8A 2ADIA 2BHZA 4ZSOE 1UWGL 4E42A 3KYKL 4L5FH 3BW9B 2ARJB 4Z0BL 3CSGA 2QADB 1KULA 4HUVB 4KDVA 2BVEA 2HT2D 1U8OA 4JFEA 4FMFA 4X6FA 4R90H 3DO7B 3F7VB 3WKNA 3MNZA 1BJ1H 2GYSA 5EIVA 3Q3GB 2LVCA 3HAEB 3K0WA 1LDPH 2V5RA 4TUJB 1A6VL 1DL7H 3L3JA 4KZEH 3PUCA 1GPOH 5HYJE 4W4NA 1SM3H 1IVLA 1G1YA 4DKAA 5ANMB 4YQXL 1MAJA 4GW5B 3CX5J 3MYJB 3FQNB 4M6MH 5FHAL 1ZXQA 5DJ6A 1A6UH 4PGJA 4QGYA 2HLAA 4G80B 4XNUL 4XB7A 1AGDB 3RY5A 1XCTA 2EDKA 1CGSH 2I27N 3U48A 5E8EB 5C7XH 4JFXB 1U3JA 3FOMA 4MB4A 4MAUH 4BQ8A 3H3PL 1JGDB 3ULVH 2QQKL 1IKFH 4I2XB 3GMMA 3HR5A 4PJBA 4U7SA 1L7IH 4D9RD 1EEYB 1F8TL 3QJHA 5CEXB 3LQAH 4YFLI 3TH2T 1KLGA 3QDAA 5K9QG 4QF1B 2AJXH 2DKUA 3PJSA 5EIQA 3PHOB 2W9DL 2BNRD 1XGPB 1Y0LA 3DXAD 3LMJL 4JFFB 3IJYB 3OAYH 2KKQA 1ADQA 1FORL 3BD5A 4RCAA 5BVPH 3FN3A 3WHXA 1YEHL 5E6ZA 5J06A 5T1KD 4HT1L 3WDHA 2QR0A 5D7IE 3DX9A 1DQQB 3CFKA 3GI8L 3VWJA 5F72S <