43CAA

Crystallographic structure of the esterolytic and amidolytic 43c9 antibody with bound p-nitrophenol
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
DVVMTQTPSSLAMSVGQKVTMSCKSSQSLLNISNQKNYLAWYQQKPGQSPKLLVYFASTRESGVPDRFIGSGSGTDFTLTISSVQAEDQADYFCQQHYRAPRTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords PROTEIN (IMMUNOGLOBULIN (LIGHT CHAIN))
publication title Structural basis for amide hydrolysis catalyzed by the 43C9 antibody.
pubmed doi rcsb
source organism Mus musculus
total genus 26
structure length 113
sequence length 113
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 1999-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 43caA00
2J1KA 3KYAA 4LSTH 4GW4A 4A6YL 1A02N 3RWFB 3O4OC 1R24A 1MCFA 5ICXA 1KN2L 2FZ3B 3N50A 5JA9A 3GSQA 2VLRB 4XB7A 4P9MH 5DT1H 3L3GA 4ZO9A 2VH5L 2VL4A 3G6JF 5DWUH 2J88H 5ID1A 4AIOA 3GIZL 1F4XL 4FQJL 4UTAH 2A6JA 3LAFA 4MVBD 1MFNA 4KWUA 3T0WA 5C0ND 3GGWA 2W0KA 1CE6B 2HKHL 4I9WD 2I60H 4FXKA 2P24B 5CILL 4FABH 3BVNA 4E42B 1ACZA 3AY4A 4PRBA 1BM3L 1NC2A 2P5WB 5D71L 5DF0A 3BYYA 3GSVB 1MJUH 4OGXH 3V5DB 4M7ZB 3LSOB 1VACB 4GXVH 4NO5B 3ARZA 3LPWA 2WP3O 1R3IH 4RIRA 1J0KA 1U92A 5JMRA 1MJ8H 4HC1A 4WW1B 2ICWJ 1F97A 3MV7A 4N90D 4XHQA 4I77H 2ICEB 4ZS7H 5TF0A 2R0LH 2LQRA 1O0VA 4WEBL 3QO0A 4JHWH 2ERJC 1GAFH 3MXVH 4PJEB 4X99A 1TZIA 4JCMA 3D3VE 3CVIL 4OIAA 1MQ8A 3ULVC 4I18B 3BKJL 1T3FB 1ROWA 4PS4H 3TZVA 1CVRA 5DHYA 2FEDC 3V9FA 5AYQA 5D7LE 3JWDH 4Z7VA 4RDQG 1DCLA 2PYEE 4FTVE 3DX9A 3ZHKA 1A64A 3WEXA 2KZ1B 3EJYC 4NZTL 4Z9KB 2UYLA 3MRLB 3QQ9C 1QLRB 2OI9C 2XKUA 1SBSL 1YMMA 4J3OC 1YEJH 3W0WE 5F89B 1GXEA 5F7WC 3TM6A 2W0FB 4L4VA 4RAUA 1NGQH 4ZUTB 2EYTA 3P73B 4ODTL 3DX6A 5E6IB 4JFED 3Q0HA 4GW4B 4OCWL 4LEXL 2Y4SA 4B0MM 4IDJL 1C16A 1WUNT 4HMDA 5I6XC 1R24B 1CE1H 2C26A 4LSQH 4NGHH 4UV4L 3HR5A 5EO0A 3GSQB 2CR3A 1J8HD 3MOAL 4YO0A 1P53A 3F7PC 3L3GB 3VH8G 1A0QL 5ACMA 1E6OH 3ZKQD 3SKMA 5ID1B 4YPGB 5KOVC 3UTZB 2A6JB 4HCRL 4NWUL 4JFDA 1TMCB 2Q7YB 2DJSA 3GGWB 4I0PA 3CX5K 1ZLSH 5F96L 1QKZH 4Y19A 2HT2C 5ANME 4PLKD 4FXKB 1YEIH 2DWEA 2PNDA 4OFKA 2Z8SA 3UTTD 3B6SA 5IMLB 2X9YA 4X98A 2GJJA 1NC2B 2G2RB 1G7MB 4LLVA 3FRPA 1DL7L 3KR3H 3C87A 1EHLL 3VFGH 5DMYA 1G6RL 3BFOA 4KROD 1F45A 3CK0H 3MV7B 4JB9L 1UGNA 4L3ED 4F9LC 3QHZH 3E8UH 4HIXH 3HLAA 1BFOB 4F2MB 3QO0B 5IESL 3CDCA 4RX4D 4X5WA 3HC3H 1JN6A 1X9QA 3UJTH 2XN9E 4O5LL 1TZIB 1UYWL 4M6OL 3DRQA 3UTSA 4LNRA 2PCPA 1DQTA 3FB8B 3RWIA 5FYKH 4YFDB 1G7JA 3Q6GL 4Z7VB 3SCMD 1D9KC 3BMVA 1XGQA 5C0BD 3D18A 5JR1H 4CL7A 3DX9B 5GGUA 1T0MA 3WEXB 1QD0A 3P40A 3G6JA 1KB5H 2UYLB 3EOBA 4PGEA 5C07E 3MLZH 1E28A 5FOBA 4PFEA 2Q86A 2WIMA 4XGZA 2JJSA 1IE5A 5E6YA 3FAWA 4U31A 3ARFA 4U1NA 4MLSA 3S4SA 2UZIL 3TVMB 2UV3A 4L4VB 4RAUB 3O6FC 2EYTB 3RAJH 3DX6B 4IRJA 1UB6A 3C8DA 1FL6B 4FQHA 1S7TA 3UO1H 3BEVA 2MKWA 4NCC1 1A47A 1A9EA 1C16B 3W0WB 5EO0B 3HR5B 2OP4H 3TCLB 2VDKH 4YO0B 3ARSA 4C56E 4S11A 3EYUL 4GKSA 3T4YA 3HE7D 5BRZB 3L5XH 5E99H 4WTZA 2Q20A 4CN6A 4JFDB 1LGVA 5D1ZA 2N7BA 3VWJD 4UT7H 1NC4D 3ULUE 4I0PB 3OAZK 4FQ1L 4GRLD 1IAKA 1BF8A 4P9HC 2DWEB 2GSIA 3B6SB 1J7VR 5B4MC 1JPGA 1JNHA 5JZ7C 3EO9H 3WUWG 4M5ZH 4KMTL 5TE4L 3NFSH 4G6ML 3P2TA 4LLVB 1P4IL 3K2MC 4I3RH 4WU7A 3BI9X 3N0PB 1CDJA 3QHFH 1J9CT 2ZUXA 4WV1C 2XZAH 1UZ6F 3HLAB 5B38A 4RGNC 4FNLL 1CF8H 4X5WB 4BH8B 5MENA 1JN6B 1CT8B 3UYPA 4EUPG 1E4JA 3DRQB 1JNLH 3RU8H 3UTSB 1I9RL 4LNRB 2ZOKA 4JM2C 2PCPB 5AAMA 2ARWA 3RWIB 5JW4N 1N8ZA 1ZLVH 3C9NB 1FIGL 5FA4B 1NFKA 1INDL 2QQNH 3D18B 3NFPA 4GW5A 2DQFA 2H45A 4DCQA 2QL1A 5DJDA 5KZCD 4DVRH 3BH9B 3DJ9A 3AB0C 1KG0A 1HHIB 4MNQA 5T33L 1E28B 1C5DA 5INDA 5FOBB 4XGZB 3KYOA 2K3TA 2ZG1A 3HZMA 1A6WL 4U1NB 2J2ZA 3H3PL 4NZDA 3ULUH 2GJ6E 1G9ML 4D8PA 3CLEL 3HC0A 5T1KA 4LCWE 1TJIL 5KSAD 3STLB 4FQHB 1S7TB 5CIPA 2FX9H 3VMPA 3BEVB 5A2JH 1A9EB 3MLXH 4NZRL 4D0CB 1EHXA 4WCYL 2BMKB 1WBYA 5HHQA 3T4YB 2K9UA 4LQFL 4Z7OE 4M5YL 2WBJC 3E2HC 4I13B 3RL2A 2QSTA 3N9GL 1ADQH 3V6ZA 5D1ZB 3FB7B 1OAKH 4O02H 3PWPD 1WZKA 3GSNL 2V5YA 1IAKB 4ONGL 2HLFD 4YK4B 1BJMA 1DP0A 4E5XA 2VISA 2GUOA 1EAPA 5KJRH 5I74B 1JPGB 1U8OB 2UWEA 2XRAH 4PGCA 3D48R 1JNHB 3MA9H 5T1LA 3WNPA 3EKCA 3NZ8A 4WU7B 4MA8L 5FKPB 4KK5D 2MCG1 3TWCH 5IG7A 3JWOH 4YHZH 4U1LA 4Q0XH 5TQ0H 1MWAA 2OTWA 1I1AA 2FX7L 3ARXA 4RGMC 5I8KL 2E7HA 3MA7A 4QHUA 1DQJA 5B38B 1LO5B 5MENB 4MMXC 1MAMH 1EMTL 5F9WB 3DROA 3W39B 4G7VL 2ZOKB 3S88H 2VDML 4UMGA 3QJFA 3DVNA 3BKCL 1N8ZB 4TSBH 3IDUA 5GZOD 3MRQA 4Z7UA 3WJJA 3QG7H 3TFKC 3H42L 3NFPB 4GW5B 2DQFB 4DCQB 5DJDB 1V7ML 1SQ2N 3V0WL 2EDBA 2AEQL 1MNUL 1KG0B 4MNQB 1NCCH 5INDB 2OCFD 3DOSA 3KYOB 5F8QC 2E7CA 1WVZA 5IQ7L 3HZMB 1QSED 4R26L 4KRPD 4D8PB 4EI6A 1Y0LA 2RFXA 1VADA 5EUOA 3HC0B 5GRVK 4PREB 2FH8A 4HK3J 2OR9L 4LPWA 4YFLI 5EZOL 3UZQA 4Z7NE 2GJ6B 2AP2A 4O4YL 1UADC 1KJ2A 4OT1H 4V2BA 2E6QA 2FGZA 4PJ7E 3RJDA 2CLZA 4MX7A 4R8WH 4KTDL 3ZTNL 5EN2A 1JWUA 2Q8AH 1JHTA 4AEIH 1WBYB 5HHQB 4OCRL 4JGMA 3MLSL 2Q3AA 2R4SL 1ZVSA 2C3VB 4OQTL 4QRRE 4WW2A 4NQCD 4TQEH 5GJTL 5DVKA 5SX5H 5E2VH 3X3FH 4BSJA 4E5XB 2VISB 5A40E 2GUOB 1EAPB 2WBWB 3BN3B 3RA7L 5T1LB 5MI0B 2E8YA 4WVRA 4WY7H 3NZ8B 2F5AH 4BELD 5ELIA 3DX7A 3BO8B 1Z9LA 5I1IH 4U1LB 4CW1B 3RTQC 3LB6D 5KG9A 1FGVH 5DQDH 1MWAB 2OTWB 1VERA 3JV0A 2ATKA 3OQ3B 2ZCKH 3NCCB 3MA7B 4QHUB 5DVNA 3HG1D 1MCEA 5CJQL 4ZS6D 3H2WA 3N85L 3U79A 2XYCA 4ODWA 1RUQH 1I8LC 3GK8L 5FYJD 5EPMB 3DROB 5LCVH 3WUZA 3M1BA 3U4BH 4ZTPL 1F3DH 1U8MB 3DVNB 1T03L 4L9DA 4X80H 4MQ7A 5FCUL 3IFPA 3QEQA 4ZO8A 5GRUL 3MRQB 4Z7UB 3OJMB 3QZWG 4HUVA 1X5JA 1V3MA 3HTLX 2CDGA 1CXIA 3WO3B 2A73A 4U3HA 3DUUA 1YQVL 1DANT 1AP2A 1DBAH 3TN0D 4OKVA 3MMEA 2R8SL 4XC3H 4TYUA 3IFNL 3AS3A 4OCSH 1MFDL 2YHGA 4Y5VA 2EEDA 1BGXH 2W59A 1Y0LB 4EI6B 2RFXB 3IAPA 5EUOB 4QGTA 1S9XB 3LHPL 4EN3A 2AQ2A 4HWZA 2H1PH 2H26A 4DTGH 4F33A 1CXEA 5HPOA 1A6UL 1KJ2B 3ZE1F 2R9HC 1O5DT 4QYOA 2CLZB 4BSVA 4MX7B 4NQDE 2ARJA 4A6YB 5LJYH 1J1PL 5EN2B 1JHTB 2GCYA 3KYKH 5C8JA 3VXSE 4GRMA 1Z3GH 5EWIL 3HZVA 2BVOA 2VLKD 3QPQC 1BBDL 5IF0A 3VMNA 2LVEA 3IFLH 4WW2B 2HTKD 1A7RH 4Y4FC 1NMCC 4NQED 1N6QH 1NLBL 1UM4L 3CSYB 1T0NA 4QTIL 4N1EA 1CLOL 1FBIL 4P2OA 2FO1A 3ZKXC 4Y16D 2QQKL 4BZ2H 1H15A 1RZJH 3F7QA 1K3IA 3U0PB 5TDNA 4NJAL 3C09B 1U6AH 4IOIA 2VERN 1RZKC 2ATKB 4MD0A 2FWOA 2EC9U 5GGRA 3NN8A 1G6RA 2OL3H 3V6OA 5C0CE 2R2CA 3IDYB 1D5XA 4S1DD 4U7KA 1XF3B 2EDWA 4WHTB 3EGSB 2IAMC 2ED8A 5D2NA 4PRPD 5EOTA 4MDJA 3X3GL 5GS0L 4MQ7B 1IEHA 4HUMB 4Q9QH 3IFPB 3QEQB 1MSPA 1KUMA 2I26N 2BOBA 1Q8MA 5GGVH 1B6UA 4HUVB 5D93C 4PRHE 1L9NA 2FCBA 2CDGB 3Q3GA 3LKQB 2JJTA 2A73B 5K9QI 4LHUD 1AP2B 3WFBL 4OKVB 1I7TB 3MMEB 2FH6A 3BQUC 5HVWA 4Q6IA 4JFXB 4Y5VB 3DUHA 4QY8B 1JWSA 1MOEA 4EN3B 3GNML 4HWZB 2H26B 5JORA 4PJAE 2XTJE 1TJGH 4WI3A 1IC7L 3P4NA 4QYOB 3ZDXE 4BSVB 1A1OA 3NCJH 2ARJB 3CXDH 1IKNC 4IMLA 2A38A 2GCYB 2ZUSA 5C8JB 4GRMB 4N5ED 3WHXA 5FDYA 5IIEB 1LK3L 3HZVB 4WHDA 2BVOB 3QRGH 2APXA 2R0WH 2VXTL 5B39G 5T3XD 1H5BA 1HNFA 4M1DH 4XWGH 1DQMH 4PTTA 3WSQH 4O51A 4ORZC 2EECA 2VYRE 5JHDD 4NM8H 3RGVD 4KI5D 2YOCA 3O8XB 4DUXA 3H9YA 4P2OB 1KSRA 1A7PH 4S1SH 2LFGA 5C0AE 4FQCL 1H15B 1GZPA 5TDNB 3I9GL 4KZDL 2A2QT 4NBZB 1AE6L 2ADJA 3SDAC 4QRPA 1H3PH 4MD0B 2FWOB 2P48B 1QOKA 4UT6L 3MBXH 5GGRB 5E9DE 1G6RB 5D7JA 1D5XB 1U36A 1YY8A 5HI4C 4QXTB 2VLRD 3DURA 2NR6D 4PBWD 1PG7H 1JPTL 3B4NA 1NGPL 4O9HH 4P23B 5D2NB 4HIIA 3UTPE 5EOTB 1UC6A 5BO1L 4Y4KA 1OT1A 2EEAA 4PJ9B 5A3ID 2XKNB 1BFVL 1P5VA 2P5WD 1MCBA 2BX5A 3ZSTA 3MJ6A 4X4ZA 4XPGH 3VRLE 3VJ6A 2QTEA 1FP5A 4AQ1B 3WDIA 1YEGL 1TETH 3REVB 3SQBA 1JWSB 4LIQE 4PJIE 1JZ2A 5HI5C 1AHWC 3RPKA 4JO4L 3PL6B 4KI1A 1YJDH 2B1HH 4X7SH 5H37G 3FKUS 5JORB 1V7NL 1X6NA 3BZFB 1CFVH 3LRHA 5MHSE 1Q72L 4CDGC 5LQBL 3P4NB 1WIUA 4XI5C 1A1OB 2AJVH 2VTFA 5C0RH 4PD4J 1G0DA 1J12A 3WHXB 1GIGL 4LCCA 1ACYL 1IRAY 3DHJA 3V5KB 1JNJA 5ILTL 4PG2A 4E0RB 3G6DL 4NBXB 2OQJA 4XNQA 1H5BB 2W07A 3QEUA 1NMAL 5BV7C 4PTTB 15C8L 1MCHA 4O51B 1EFQA 3GSNA 1KGCD 4YWGL 4ZTOH 4ACPA 1FAKT 1B2WH 4HFWA 4GS7B 4OZHA 1AKJA 2CQVA 3IDJA 5E2UH 3ULVF 1KCRH 1GZPB 4R3SA 4X8JB 3U2SB 3HPJB 1JGLL 2J5LC 3BHBB 2ADJB 5E6ID 5E8NA 5I15L 4QRPB 3UMTA 2K1MA 3Q6FA 2VNCA 4FMKA 5D7JB 1YY8B 1NCDL 5DRNA 5E4IA 5JXEC 3DURB 1ZVYA 3AMLA 2VWEE 5KVGH 1BEYL 1RUMH 3OKMA 5D6DC 1A6VL 2VDOL 4JQIH 3AMKA 5DLML 3V52L 1R5VA 4LIQH 4EI5A 3QEHA 3VG9B 1KYOK 4TOYL 2VXQL 4D9RE 3VDAA 2Q87A 4GAGL 3STZA 1RU9L 5D1QC 1CU4L 2R0ZH 2AKRA 2LVCA 3P30L 4LSUH 4PR5A 1SY6A 5FHAH 3BT2H 1NC2D 4OM0L 3QI9A 35C8H 1FL5A 1F8TH 2OZ4A 2B0SH 5F1NA 3BXNA 4YBLC 5FKAA 4EZMA 1WZLA 3MV7D 5DFTA 3GHEH 4PY7A 5F7EL 5J3HC 1AFVL 1CGVA 2CH8A 3FFCB 3U9UA 4XTRC 3ZHDA 5BS0A 2ARJQ 4K8RH 4G6AC 3KPNA 2X6MA 1BD2B 1MIMH 3T04D 3GBML 4LRIA 1Z9MA 3ARUA 3BJLA 1DR9A 3VFNA 4OZIF 4LCCB 1EA9C 3BESR 5EB9A 3SY0A 3NIFF 4LF3B 2HVJA 3VW3L 4WUUA 2OQJB 4J3VA 4E41E 2EH7L 3WHE0 4XNQB 3P11L 5F97E 4WWKB 3MNZA 2HT4D 3QRFM 3KNBA 3QEUB 3WFDH 3AREA 3CZJA 4DN3L 3GSNB 1MJJA 4OQTA 3O6KH 4D3CH 5ITBL 3LIZL 4HFWB 2NYYD 4OZHB 1AKJB 4Y89A 3TVMD 4AIXA 3IDJB 3RNQA 1OAQL 5I1LA 3GJFB 3QDGA 4R3SB 1QSFE 4L4VD 1TVDA 1YYML 4YDKH 2EDYA 1OGTA 5E8NB 4UT9L 4JG1H 4KQ3H 4FHBD 4N0CD 3OB0K 3W0WD 3O4LA 2NY1C 4JFZH 2IQ9L 2H3NA 4NT6A 4FFVC 4MD4A 1FG2A 3B2VH 3UPAA 1U8LA 4MJIE 1RI8A 3OX8A 3SGKA 1R5VB 3CX2A 2Z31C 4KKLD 5BRZD 3BUTA 3QEHB 4NQSA 4EI5B 1NAML 4P2RE 5HDQL 4JFDD 1MHHA 4AG4H 1XGRB 4I0PD 4BSWA 3FHAA 4M62H 3STZB 3KS0J 4M6ML 4LGSB 1YUHA 3QNYA 1J0IA 3R0NA 3T0XA 3OMZA 1WSST 4FFYL 4J12A 1NCTA 5C0DA 3TYGH 4BUGA 2AKRB 3WDHA 1YDPB 4M1GL 4PR5B 3VGEA 4Y2OA 2L7JA 2AABH 5MP6L 3K0WA 4WFFE 5FUZH 3MYZA 4OB5H 5F1NB 3U0WL 2XXCB 4LHQB 1X5KA 5IW6B 1GC1C 1ZGLA 4K94H 2YC1A 3RUGE 3WXWL 4CU8A 1C1EL 4PY7B 3NGBC 5IFAH 1DUYA 5I8EA 1DBBL 5GS2D 3THMH 4LSPH 1RPQA 3OXRA 4JY6A 3FCTB 4XCEA 1BP3B 4ERSL 1W8OA 1A22B 3UTSD 1GGTA 3ULUC 5D4QA 1OP3H 3VFNB 5E2WH 2E3VA 1CK0L 4OLEA 5EFIA 3R1GL 1JPST 5MEOA 4B7LA 2I9TB 3SY0B 1CBVH 1RZ8A 3NIDE 4ZUWA 5CD3B 4WUUB 4H20L 1MCQA 4O2FB 3F6LA 3MNZB 2IALA 5T3XH 1MJJB 4PJBA 2KL6A 3FQXA 3SGJA 4N0YH 3RI5K 3VA2C 5JA8B 1QHPA 1JPSL 1MFCH 3UEZA 2UZYB 3BISA 2FHBA 4MVBC 3RNQB 3SKUD 4JM2F 5I1LB 3QDGB 1OGTB 2CDEA 2D4DA 2OR7A 5ETUB 2ZPKH 3FN0H 4NOFA 2IANA 4HGWB 4Y4HC 5EOQH 3O4LB 3ZYJA 2H3NB 4NT6B 5LWYL 1FFOA 1OTTD 2Z9TA 4MD4B 1FG2B 1U2CA 2NY0B 1BQSA 2G75A 4M7JL 5IFHH 1KPRA 3NCBB 2WUBL 3CPLA 1U8LB 5GISL 3OX8B 1GZQA 5T3ZL 5I73C 4K3GA 1S9WA 3JWOC 4NQSB 1RZ7L 3DV4A 1MHHB 1FLRL 1BQUA 1IM3A 5D1ZD 2FLBT 2GT9A 3O3EA 4BSWB 2J4WL 4E9LA 3QNYB 3LCYA 4R7NA 4AIZA 1AY1L 3TBSA 1FZKA 3DVFA 4HSQA 3L3HA 5IHUL 5I1GL 5CUSL 2EIEA 1UM5L 2EC8A 5EIIB 3FN9A 4LP5A 3QDJE 3BP7B 2QLVB 1AQKL 4DUWA 2ICCA 1OCWL 2YC1B 2GHWB 1DUYB 2H32A 3EYOB 2DB8A 4QRQB 4JQXA 1DBMH 5I8EB 3UDWA 1NAKH 1CXKA 5IMKA 3OXRB 1VDGA 2R29H 4QXWA 5MEND 4JY6B 1KFAL 1ODAA 4XCEB 5GGSY 4HMCA 1YNKH 3V79C 1NCAL 5K9OA 1FH5H 3GKWH 4HGKC 4YHYC 4JRYB 2WM0A 5EFIB 5MEOB 4HUUB 1OQXA 1DVFC 2ILLA 4DGYH 4CJ1A 1RZ8B 2O5XL 5DI8A 4XCFL 3U30B 4NNPH 4M3KB 3RIFK 1OTUD 2ZSVB 4MNQD 1V3JA 3FQXB 5EA0H 2DKUA 3PJSA 1MH5A 5F9JA 3I3BA 1K2DA 5KN5A 3MLVH 3FO9A 1QFPA 5DK2A 1CXLA 5FA3A 2RIKA 3RVXD 1RULL 4XPHL 2EDJA 4Q74A 2CDEB 2NNAA 4WIQA 1DFBL 2GJ6D 2Y07H 3QSKB 4U6HA 4MJ6A 4LARL 4K7PH 1FFOB 2A77L 3AC0A 5KAQG 5DYOA 1FV1A 1JZ6A 4LLUA 4QGYA 1TTGA 1KPRB 1R6VA 3CPLB 2DMBA 5JQ6H 2CDFB 2ZCHH 1GZQB 3L7FA 4JHAH 4LAQH 1R0AL 5C08A 4F9PA 3OPZL 4TNVK 3ZSSA 5DTFA 4YHLL 2H6PA 4K3EL 5A16A 1WAAF 4NHCH 3O3EB 5HYFA 4KKBD 3QCTH 1LP9A 5L2JA 3VCLB 4ODSL 4R7NB 3VXUA 4XMPH 4AIZB 3TBSB 1FZKB 3QT2A 4KY1H 2EDKA 1KYOJ 4CU6A 3NPZB 3VFVA 5CGYC 1YA5A 4YE4L 5T1LD 1M6OA 1DTUA 4Y8DC 2GTWA 1MAKA 5DURB 4PLJD 1A7QL 1NCUA 1PEWA 4LU5H 4X7CC 5BVJA 4TVPD 5C2UB 4P3DA 4PJ8B 4XVJH 3SE8L 4P5TC 4BFEA 2H32B 3ILQC 4HC1H 4QOKE 5LBSL 1SEQH 4OCXL 4JJHA 2YD5A 2ADGA 3I75A 4RFOL 3ZMRA 5IMKB 4HBCL 5T5FH 3T2QA 4OZ4A 5IV2A 1W2KT 1DUZB 3QAZB 4POZC 2DBLH 4FXGA 1Y18A 4M6AA 5K9QG 1XR9A 4P5KB 1A1MA 1RZFL 1EZVX 5DI8B 4RGOH 2NX5B 4W4OC 3QWOA 2JELH 2VE6A 3P0YH 4WUKL 5J1AA 1FL3A 5LG1A 3VWKB 2JK5A 3PJSB 3M17A 4PRDB 1D6VH 5F9JB 1F90L 2NY7L 1K2DB 2CK0H 5D7IA 3DPBA 1CQKA 1RAMA 1I1YB 3FO9B 5DK2B 3QDMA 1EGJL 4EVNA 4KV5E 3VWJC 3M8OH 5L0QC 2NNAB 1AO7E 4YHML 3H3KA 4U6HB 4KFZC 1MCIA 1J1OH 3VXMA 2RCSL 2DQCL 1N5YH 2MNUA 4F7CB 1FV1B 3VXTB 4LLUB 4N0UE 1KACB 1RK0A 1W72L 2BNQE 2YA0A 1RZJC 3G6JE 3L7FB 1MI5A 2CGRL 2YD2A 4LPVA 5C08B 3RBSA 3U4AA 4JO2H 5DTFB 2Q3ZA 1KV3A 1JYWA 4PJ5E 1LP9B 3QDAA 4ZSOA 2P46B 5L2JB 4HXAH 4ELMB 4X7TA 4YEFA 1T2QL 3FL7A 3S36X 2HJFB 5D2LF 2JJVA 1IC5L 2EYSA 1M6OB 1JUFA 5EUKA 3G08A 5BVJB 4DW2L 2MWCA 2W65B 4JZJA 4FZ8H 3BX7C 4Z76A 1KC5H 4P3DB 1EIBA 3FB5A 1QA9A 5IOPA 2E7LC 1DLFL 1HWHB 5T1MA 3EO1B 2A9NL 1ORSA 2DQJH 1MAJA 25C8H 4HZAA 3ZL4H 5D9SA 3KPSE 2ADGB 3I75B 5IWLC 1IZKA 1FC1A 1KCSL 1WZ1H 2GFBA 3QFJE 5ALBL 3CDGB 5HGHA 3O0RL 1I4FA 1N0XL 3LKSA 2B7DT 3FO0L 5D1XA 4ONFH 2XY1A 4FXGB 4XHJD 1C5BH 1CD1B 4NKIL 1Y18B 2VSDA 1MRCH 2V17H 1DEEB 4U05A 5HI3C 1XR9B 2GY5A 3KHQA 1YEFL 1BIHA 3GSUB 1CD0A 3QEQD 4U1MA 3D0LA 4FS0A 1M05A 4LMQI 4OLVH 2Y36L 4Z8FH 3LY6A 3QWOB 2IGFL 3BWUC 3V4VH 2VE6B 1BJ1H 4ORGA 2Q8BH 1OVZA 1QLFA 5HYJE 3M17B 5HTSA 4M9PA 3WLBA 2ZUUA 4YHNA 5D7IB 3EOYG 4UB0H 1OY3B 2W60B 3QDMB 2X1PA 4KC3B 3FOMA 4C55A 4HF5L 1IT9L 4EN3D 1QO3A 4EVNB 4OZFA 2NXYB 1RMFH 5GGTL 3HUJF 1Y6MR 2HLFC 4DVBA 3QIBC 4RWYH 2YPVL 3VXMB 1O7SA 2AV1A 3QXTA 4ODVH 2F19L 1D7FA 2MOVA 1RK0B 4MNHA 4KVCL 3TLRA 2J8UE 3LZFH 1MI5B 4ZDHA 1CDCA 2VDNL 3FZUC 3H9ZA 4KK5C 1FFPA 4IIQC 2F8OA 4L4TA 5EG6C 2F74B 4ZPTA 2V5SA 3ZYZA 4NKOB 4J4PA 4DK3A 1NAMA 5IROC 1XFPA 4HX1A 4X7TB 3FHQA 1OP3K 3U7WH 3MRFA 4Q9RL 5EIVA 2DL2A 3QQ3A 3O8XD 1I7ZA 2EYSB 2CLRA 4H1LA 2DTMH 4P2OD 4PRIA 1JUFB 5EUKB 3U4EB 2BY3A 3G08B 3QXVA 3EDFA 3KVQA 4UU9A 3GMQA 5F3HA 3EJZC 2EKSA 4EDWH 4JZJB 4G6JL 3FB5B 1QA9B 4U1SB 5IOPB 1W0VA 3HI5H 1T6VN 5D9SB 2GFBB 3IKCA 5HGHB 5JOEA 1I9EA 1I4FB 3LKSB 1AD0B 2X4SB 5JW4R 5D1XB 3MXWL 1KOAA 4P23D 4HHAA 5L2KE 3ARDA 3H6JA 1YJDC 4Z7WF 2C3GA 3O81A 4U1MB 3D0LB 4PJ9D 2XFXA 1PKQE 1M05B 2APFA 4GG6F 4W6WB 3VE0A 1BQLH 4I1NB 1OLZA 4Z77A 2X41A 3ZKMC 4JFFA 5I8OH 3VXOB 2HH0L 4ORGB 3B9KA 4ZNCD 1QLFB 4XPTL 2E9JA 3GBLA 1J0YA 3WLBB 4YHNB 1H3UA 3BW9A 3MLUL 1KF9B 2XZQL 3FOMB 1JZ8A 1MEXL 1YNLL 1QO3B 4EBQH 3PL6D 4G8GA 1QPPA 1R5WA 4OZFB 4PBXA 3SKJL 4UV7L 4J7RA 1R3JA 3Q5OA 1XT5A 4RA0C 3N1PC 5CIPH 1T1XA 3IETA 3AGVA 1J1XH 1RIHH 1BQHB 5FAAA 4ENEC 2NY2C 1MF2H 2C7UA 1S7SA 2KBGA 2P8PB 12E8L 5IBUB 5FO7A 1FFPB 4L4TB 1H8NA 4M9OA 4ZPTB 1OLLA 2P45B 3B2UC 1ZEAL 2J8UB 1NAMB 1KT2A 4EIZC 1BIIA 3SE3A 4HX1B 1P7KA 3JBG7 1HQRA 3MRFB 3LDBB 1J88A 2DLFH 2BXYA 1I7ZB 2CLRB 2DQHL 2GJZA 4H1LB 4YBQC 4PRIB 3HFMH 5C92A 1S3KH 1DSFH 1I9JH 3INUL 1X5XA 4UU9B 3GMQB 2Q7NA 2EKSB 3FQUB 1S7RB 1XGPA 1QFUH 3QDHA 1ZANH 1HHJB 1Y6NR 4QRPD 1SJHA 4JQVC 4APQC 3VD4A 3RKPA 3BZDA 5D7JD 5H35A 1P9MA 3IKCB 1UZ6E 1F6FB 3CU7A 2NY3B 3HNTH 3MSPA 4X9BA 3TN0C 4F37K 5L7XL 1QBML 2CRIA 5DQ9B 5I1CH 1C5CH 2XWJB 5HHOE 4HHAB 1CICA 4F57L 1J0HA 1LO0H 2I5YH 4PRAA 3FQWA 3DTXA 3ARDB 3ALPA 3DIFA 3KPOA 3KPRE 3W5MA 3B8YA 1N3NA 4L5FH 4EOWL 1MHEA 4K8RC 1WF5A 2AK4E 3VE0B 3OKKA 4XMLL 4Z77B 1RD6A 4JFFB 3ARYA 1N5AA 3PHOA 1UXWA 1AC6A 1LILA 1KTKE 3S3JA 4MB5A 1RIVL 5KSBF 2CR6A 4IRZL 2GKIA 3V4PH 3KJ4B 3BAEH 2D7TH 1F11B 4G8GB 1R5WB 3L3IB 1ZS8A 2JB5L 3FFCD 4HS3A 2VWEC 3LEVH 1T1XB 3IETB 4KVNH 4OZGA 3NMEA 4FFWC 4NP4H 1KJ2H 4YHOL 3EYQD 1IAIH 3CFCH 5B8CA 1BD2D 1H3XA 3LKNA 5D96C 2C7UB 1S7SB 3Q2CA 5BMFH 2FDBP 4Y16C 4JPIA 4PJXF 3KLHD 2VSCA 3F12B 1FZMA 3PUCA 4LK4A 2WLZA 2XKSA 4KK8D 5ISZA 4LVEA 1KT2B 4WI8A 1BIIB 1P7KB 5HGBA 4UQ2B 1NANI 1HQRB 3GM8A 4G7YL 4JN1H 4MA7L 2N1KA 2GJZB 3GMNB 3IDXH 3HNVL 3D9AL 1U0QA 1ZHNB 4TPRH 4IRSA 2XTLA 5GS1A 3EIFA 1AKJD 2VLJA 4YDJA 5F9OH 2VXUH 4LLWA 1KEMH 3GKZA 1XGPB 3AS0A 3QIUC 5TQ2L 5CLWA 5KAQF 4ZFGL 3DHMA 1SJHB 4NUGL 2WWMC 3BPNC 1E6JH 1ZWIB 5H35B 1CZ8L 4NSKA 3MLYL 5E6IA 5J57B 3MV9A 4PJHF 2EO1A 3LS4H 4LLDA 1YEHH 4ZO6A 3MUHL 4EI5D 4H88L 1CICB 3DYPA 3UBXB 4K94C 4PRAB 3FQWB 4P49A 1NUNB 3DIFB 3KPOB 4NN5C 3GSXA 4FP8H 1N3NB 1EFXB 3WFZA 1MHEB 4NQXA 5IBLD 3ARQA 1CFTB 3KPRB 5FXCH 3QI9D 3PHOB 3V6OE 4S1QL 3V2AR 4U3CA 2CIKA 3T0DA 2PUQT 4N5EC 1U8HA 1I3GL 4M3JA 3SDDC 3WS6A 4KUCD 4RFNB 4UAOC 4JVUA 4ETYA 4MWFB 4PV8A 5EU3B 1ZS8B 2QHRH 1S7UA 3RZCB 4L1DA 4HIEA 1JYVA 4WI2A 4OZGB 2V2XA 3SQOH 5B8CB 1TJHL 3LKNB 3TYFA 2X70A 1HOCB 3CSGA 4BK4A 1JFQH 2W92A 4JPIB 1W72A 5IK3A 3VFTA 1FZMB 2VLLA 5DEGA 3QUYC 4PUBH 3HMWL 4WUUD 5FM4A 3HI1A 1UH3A 4NWTL 4AL8H 1XCQA 1K5NB 3MOQA 3ARWA 4XAKE 1WITA 3A6BL 1A3RL 2AAVA 1BAFL 4IRSB 1FNEA 2DL9A 5GGVY 2BVYA 5KS9F 1QRNA 1OP5K 3QDGD 4LLWB 4UZGA 5DS8B 1RUPH 1QBLL 5A3IC 4AENA 3O4LD 3FMGH 3ESUF 1FSKB 1G6RH 4NSKB 5GSVA 2XACC 5E1HB 5I1AB 4M7ZC 2CRYA 4P2CG 4NZJA 2X4QA 5FYKU 5E95B 3QPXH 5CJOH 2I07B 3M45A 3KLAA 5IGXL 4NNYB 3SDXA 1J05A 2NY4C 5AWNH 1TTFA 3GSXB 3QG6A 3JV6B 2PO6C 5D5MA 4NQXB 3WMSA 3V8CA 1WZMA 5CSBA 1PSKH 3PP4L 4PY8I 3L5HA 5E4EB 4XCCH 2JCCF 1NEZG 1RFDL 3TV3H 1G9NH 3PNWA 5CEZD 2CIKB 4ZOAA 5CCKL 1NFDF 5HDBF 5IJVA 1GHFH 4WU5A 4QWWD 4HKBA 2VZUA 1X5FA 1ZGLP 4PV8B 2ORBH 1UJ3A 3FAXA 1JNNL 2APBA 4NQVA 5TPWH 3CXHK 2JJUA 3WFHA 2VITA 3ZE1E 3P0VL 5EORL 4D0BA 5GGTA 1LEGA 2QJDA 4DWHA 1ED3A 3WO4C 1QFWH 4P9HL 2YSSA 4JDTL 1IAMA 1ZA3B 5E8DL 2X70B 3AXLA 5CJBA 4DEPB 1FVDA 1FLTX 1P4BL 2DIAA 4JRYD 3MJ9L 3GSRA 3MGOB 5SWSA 5L88H 5I76A 1F4YL 1W72B 5IK3B 1LEKA 2VLLB 5DEGB 4OD1H 4HQQL 5GZND 1ZV5A 3EYUH 1PJ9A 3MRBA 3BGAA 3MUZ1 1UWXH 1T83A 3HI1B 2AJYL 2X44D 4LASL 3QUML 3PABA 1XCQB 2VDRH 1OM3H 3HC4L 3QYCA 3O3AA 3EZ8A 4YDLB 2LTQC 4R9HA 4YJZL 4GMSL 5IJKA 1KXVC 2FO4A 4G8EA 2PYFB 3QCUL 3FFDA 3NA9H 1J87A 8CGTA 2GEEA 1S5HA 2EDFA 5DJ0B 3K4AA 4HPOL 5DD1L 4AENB 3HI6H 2WUCL 4LKXA 5HHVH 3B8SA 2ZJSH 4NIKB 3HNSH 3OKYA 4L8SA 3MGAA 3AY4C 5C0JA 1ZVHA 5GSVB 5TFSH 3RWGB 1P84K 4GRWF 1L7TL 3UROR 2FBJL 2FX8H 1UCBH 3CD4A 2X4QB 2X1WL 4KTYA 3NTCL 3RJQB 4FNLH 5GSRA 3KLAB 3L5JA 3NVQA 3BD5A 2UUDH 3SDXB 3ARBA 1J05B 1QBAA 3SGDH 3EHBD 2GAZB 3QG6B 3VU2A 1XGYH 1I9RH 1BLNA 5GS0D 1NH6A 3MUY1 4JRXA 1PZ5A 2WNGA 4CMHB 4CDHA 5CFHA 1YEKL 4L8BB 4GSDH 1A6AA 3S36L 3O2WH 4ZMAT 5L6YH 2X89A 5DURD 2P1YA 4R6UA 3OB8A 5IJVB 1JZ7A 2YD8A 4WU5B 3W2DL 3TZVC 4P4KA 5BZWB 1Z0MA 2EE3A 3O6LH 4PJ8D 4HKBB 1GOFA 2F58L 4NO3A 3R0MA 3E6HA 2FECI 5DVOA 4NQVB 2P49B 2IPUK 3CLEH 1A5FL 3RPIA 3WFHB 2VITB 5FHBL 3I50H 4D0BB 1LEGB 1TJIH 1ED3B 2O5YL 2YSSB 3PWNA 1AGDA 1FYTA 2B20A 3AXLB 3I85A 4Y0GA 1T1YB 3MCG1 3TH2T 2NYYC 1FVDB 5A2IH 3T2OA 5SWSB 2V2TB 1DBJL 5I76B 1LEKB 1AGEA 3O2VL 4X6DA 5CMAA 3MRBB 4YDIL 1Q94B 1TNMA 1B0WA 4NC2B 1AXTH 2NX5D 1GGBL 4N0CC 4WFGD 1JTOA 1IGFL 1MJ7L 3MLWL 1F4WL 3VWKD 5K59F 4XNZB 4BQBA 1IAII 3GSNH 5BS0E 4P2QE 2CXKA 2QQLL 3O3AB 3HR6A 1EAJA 4Z95H 3GFUA 1QTYT 4HAFA 4FQ2L 5SX4I 5C6TL 4JREC 1T5WA 2LE9A 2FO4B 4G8EB 1JGVH 1CIUA 5I18H 1R3LA 3FFDB 4I0PC 1Z5LA 4JG0L 1UVQB 1S5HB 4V1DE 4HK3N 3C60A 2PR4L 1GGIH 4L8SB 1LK2A 2DICA 3RQ3A 5FM5O 4K3DL 4IDLA 5I1JL 1SJXA 4JKPL 5J11B 3LV3B 3VH8B 5KVEL 5JOPE 5C08D 3DSNA 5GSRB 3BYTA 4C57C 3ARBB 2XIDA 2B1AH 1BLNB 1HWGB 2IPTL 3VXUD 5JW5A 2VN7A 1QNZH 3BJ91 2IG2L 4KU1A 1UENA 5CP7B 2JTDA 1SY6H 1A6AB 5DD0H 5EULV 3OGCB 5C6PB 2OZ4H 5IB3A 1GYAA 5SWZA 3RVTD 3T0EE 5C7XH 4MAUH 4P4KB 3BD3A 4NO3B 3E6HB 1MCSA 1V5JA 3CH8A 1ZTXH 2ZSWB 4FZEH 1IKFH 3K7UA 4IBLT 2RGSA 1NDMA 4OLWL 2GK0A 3PWNB 1FYTB 4YXKL 4LCIL 2Y25A 2O61B 1ITCA 5JW3H 4LPTA 1IJ9A 3ARFC 3SO5A 5GQBA 5HHPA 2G60L 5FO8B 3RI5F 3CJJA 3EDEA 3WFEL 4X6DB 5CMAB 1KIUA 4IRJC 5J13B 1U3HC 2ED7A 5A2KH 1I3VA 1OGAA 2DS4A 1ONQA 2WW8A 1N7ML 3MLRL 3TJEH 2P8MA 5FDWB 3RDTB 3S5LA 4PJFA 2Y06H 3BKYL 1X5LA 2X4NA 1FDLH 3QDMD 1T5WB 4AY0A 3ULVE 4JKKA 4NRXA 1R3LB 4IS6A 2NXYD 4D94A 1Z5LB 3UYRH 2Z4QA 3I2CL 4YK4C 3C60B 1A4JA 4JKLA 5IVXF 2OBGA 5I74C 2O93L 5IT2H 3VXMD 2R2BA 5EOCJ 3HAEA 3BGFB 1FNLA 5EU6E 1NEUA 4XVSH 1MI5D 2ATPA 3HMXA 4TRPH 1L0YA 1C7TA 4KHTL 4L8CA 4L3EA 3OAUL 2HFEA 3WD5H 1OT2A 2CPCA 4K3HA 5JW5B 4JKWA 2SEBA 4NM4H 4KAQL 1LO4L 1X5HA 3BN9D 3LOWA 4WWID 1HSAA 4UI2A 2XA8L 2FL5A 2IANE 5F9WC 3C8KA 5HJ3A 1E4XL 1EVTC 4ZUVB 5IB3B 5SWZB 1RUKL 5CEZH 1NFIB 2HN7B 3MZTA 4HZLB 3O4OB 4HT1H 3B83A 3SCMA 4M48H 1MLCA 2ZNXA 5KW9H 5I1KL 4KZEH 5DK3A 4YAQB 4BJLA 2NW3A 2D0GA 2OTUB 3TEUA 5HHNA 3OGOE 1MRDL 4DZ8A 5D1XD 3T2PA 3OKOB 2GK0B 4PJDA 2BY1A 3SOBH 1TDQA 1ETZA 1YYLL 3RIFF 2AVGA 1CCZA 3CXHJ 2EDTA 4OZIE 5HHPB 1UKSA 5I19L 5B3NA 4XPBL 5HYSA 1IGIL 3NIFE 2HRLA 3MRHB 3L1OH 2CKBL 2KUTA 3EW3B 5DZNA 1YECH 4LBEA 1OGAB 4J8RA 1ONQB 5H2BA 4F58L 4YZFF 3GUTA 1RZKL 1IC4H 4PY8J 4XAWH 3U0TB 2P8MB 1AC0A 3PQYE 3H7LA 3S5LB 4PJFB 2FATH 3HE7A 2X4NB 1K4DB 4F9LA 5TJWK 2YD9A 2JLLA 4FFZH 5K33A 1KJMA 1CLOH 1S5IL 4GRLA 3N06B 4XNYL 3VGGA 2QQKH 5DJCA 2Z4QB 3U1SL 1M1SA 1A4JB 2DLGA 2RB8A 4TNVF 1EJ6A 5CZVL 2R2BB 3HAEB 4KXZH 4PGBA 4X6EA 4QXUL 3TGXA 2OK0L 4H8WH 1T0PB 4DOHB 3GO1H 1JGDB 2DM4A 1MCCA 1IAOA 1Z9SA 4Z0BL 5F1SA 3ZTJH 1AGBB 1I3UA 4L4TD 3V6FA 5J6GA 1N4XL 4L8CB 3R4DA 3D25B 2HFEB 4WTWA 4J4PD 3ZE0F 4UINL 4M43H 5E1AA 1I1AC 1Q0YH 5FYLE 5TDPA 1F58L 1UZ8B 1BECA 2SEBB 3JTTA 4OLYH 1EUTA 4PGJA 1DN0A 5DUBA 4D9QE 2OR8A 1HSAB 5IVNA 2FL5B 4PRID 3GM0A 3C8KB 4NKQB 3D2UB 3O6FA 1IEAB 1ZE3C 1UWXK 1GGCL 4OI7A 3LH2L 4NQUA 3QXAB 1MHCA 5I6XB 2DM2A 4Q58C 1PX4A 4LL9A 1A7NL 3WJJC 4RBPK 3VMOA 3FRPG 3VGBA 1FC2D 3HE6C 4LSTL 2NY3D 5HHNB 2HG5A 4R0LA 2P42B 4WENB 4DZ8B 1TITA 1N2RA 4YHPA 4P9ML 5DT1L 5BQ7B 1FPTH 1ETZB 2EDXA 4M7KH 2J88L 4KHXH 3ARDD 4FMFA 4X4XA 5DWUL 3AROA 1GCFA 1INEH 2VR9A 4UTAL 5KSAA 4K7PY 5HYSB 2HFGH 3MJ9A 4P46A 3HB3D 2ID5A 4LBEB 4OZIB 2X2YA 4JFFD 3ROOB 1FRGH 1JL8A 2I60L 5ITFA 3GUTB 4FABL 1BBJA 3AAZA 5F9AC 5I30H 1PX3A 4RGNE 1CD8A 3MJ8B 5GRVL 1MJUL 4OGXL 4UIKH 3QULB 4GXVL 5FYLH 3ZT7A 3VXRA 3O2DA 1BHGA 1D3CA 4G8GD 5C70A 3X17A 1OW0A 4LSRH 4YUEH 1MJ8L 4WW2C 2DBJA 5I66B 5DJCB 4PBVC 3S4SG 2PTTA 1MCWW 4I77L 3SE9H 3O9WA 4ZS7L 2R0LL 4OF3A 4U4BA 5DRXA 4X6EB 2DQDH 3WN5A 4JHWL 4K07A 4OGYH 4JFHE 1GAFL 3MXVL 4XC1H 3I6LE 1IAOB 1D5IH 2YXFA 3S37H 1CDBA 4XPAH 3V6FB 5J6GB 5JNYA 4RMVA 4I3SH 5T3ZD 1RIUH 4PS4L 3T2NH 4GG8B 3JWDL 3JTTB 1RURH 1DN0B 5DJ8A 1AR1C 2HWZH 4HS8H 4WTZG 2ICES 1OPGH 5DUBB 1FCGA 3CC5B 2DM7A 2KH2B 5KOMC 1MFEH 3O6FB 1QYGH 4HWBA 3IJHA 3MNWA 1MHCB 5GIRB 4JM4H 1YEJL 5TE7H 5BW7A 4ZYKA 2BHZA 3RVVD 4MXQC 3OG6B 1JRHH 1NGQL 4UOW0 4YXHH 1L6ZA 3V5HB 4Z0XA 3HCVA 4X5LA 3GMOA 4DN4H 4Q2ZA 2WBJA 2YK1H 2MTPA 1PG7X 1T4KA 1Q1JH 2HG5B 1CE1L 2L0DA 2VUYA 4LSQL 4NGHL 2HAZA 4R0LB 3S34H 1H9VA 1N2RB 3MODH 2F53E 3DRTA 1CICD 4Z5RA 1E6OL 1QG3A 1YPZF 1I3RA 3IXTA 4Y5VC 3NBNA 5B38G 4X4XB 5EU4A 1EFXD 1K9TA 2C4FT 2VZVA 1MCRA 3TBYA 4P46B 3KG5A 4R4NC 1FORH 5ABDE 1CL7L 1QKZL 2BSRA 2HFTA 3KPRD 5DO2D 4P59H 1YEIL 5ITFB 3LQZA 1PFCA 1L7IH 3AAZB 3EDKA 1QHOA 4OQ1A 1PY9A 4DAGH 4WHYH 3VXNB 3QUMB 5BVPH 2DF3A 1XF2A 4WV1B 1W0WA 3E0GA 1JJUA 5HHMB 5E56A 1G9EA 3KR3L 4RGNB 1LO3H 3VXRB 4L8DB 4AH2A 2IBGA 4RMUA 3VFGL 3DV6A 3RZCD 5D7KD 3CK0L 1YNTB 5GHWH 2PTTB 3O9WB 5HDOA 3QHZL 3E8UL 2ENSA 4HIXL 5FYJU 2BVTA 2X09A 3MUJA 3PE9A 5E8EB 1CS6A 4P2OC 3HC3L 5F7KC 1T1WA 3UJTL 4NN6C 4X6CF 2ADIA 5GS3A 3BGMA 3KXFA 3RWCB 5JNYB 7FABH 3T1WA 3AB0B 4DQOH 1WAAE 5FYKL 3VFOA 3BSZH 4YC2B 3V6OC 3BE1H 1ZOXA 5DJ8B 5JR1L 5LVEA 1RU9H 4HPYH 3EFFA 1OSZA 3T0VA 3TA3A 2EDEA 1KB5L 4IRSD 4HJJH 4KI5F 3MLZL 3WIHH 4N8CH 2YRLA 5D2NC 1FHGA 3S35H 5HPMA 3MNWB 3L7EA 2VZOA 2RAMA 4KH2A 2IPUG 4WFHD 5CINH 4U0RB 4MQXD 4L9LA 3RAJL 3LKPA 4Z0XB 3HCVB 4H0HB 4UILH 3UJIH 3GMOB 2NY6C 3UO1L 2JJTC 2WBJB 4XBEH 3E2HB 2X7LB 4XP4H 1TVBA 1T4KB 1G9NC 2OP4L 4JY4A 4JJ5B 2VDKL 1TFHA 3DRTB 4RSVA 4Q6IC 1NBVH 4Z5RB 2ESVE 5CD5D 1I3RB 4J1UA 3AS2A 3IXTB 4LEOA 5I1DA 2X4RA 3V0VA 2PW2A 5EU4B 2F53B 2MCPH 5E99L 3TBYB 3B3IB 3MRMA 4UT7L 3RVWD 5J4MA 4D0DA 4PJCA 2HRPH 1HKLH 3PHQB 3JUZA 2PTUA 1J5OH 1EBPA 5HYQA 1XF2B 3EO9L 4M5ZL 4AYFA 3NABH 3NFSL 1W0WB 4RGMB 1UEMA 4I3RL 1NGXA 3TESA 5L8KB 5J56B 5ITBH 1B0GA 1U8IB 4P5MA 4M8QA 3UAJD 4AH2B 5E8OB 4BH7A 1GL4B 3L6FA 1L9MA 4OZFH 4QO1A 3QHFL 3IDIA 4NQEA 2N56A 3ET9F 1H5BC 3TO4C 2XZAL 5ESAA 1Q9WA 4RAVA 5JMOC 4GS7C 4F7PA 1VPOH 4PJEF 4OIIH 4IOSD 4GLRI 2ADIB 1JNLL 2ITDA 3RU8L 3BGMB 3KXFB 3OBAA 4WI5A 4MSWA 3K8MA 2W9DH 4JY5H 4OLZH 1JWMA 2J8HA 3PV7A 5D7JC 3F7RA 4QRUA 5JLZA 2QQNL 5E5MA 3B43A 5DZLA 1VB9A 5D2LE 5DUPH 5CGMA 1OSZB 4RWHA 3TA3B 3PDDA 2EH8H 4NBYB 4DVRL 5TH2A 2PW1A 4G9FA 3CFKA 5JOFA 2C3XA 2NY5H 3VG9C 3P3YA 5HPMB 4Y4KC 1V05A 3L7EB 3MFFA 4OTXH 3EYFB 3ULUL 4L1HA 5D72H 4F37F 3W9EB 3GRWH 5E8PA 4U2ZA 4LPXA 3LKPB 2HTLD 2AV7B 2FX9L 1OWRM 1H3TA 4LHUA 3ROLA 1YEEH 3MLXL 2ZUQB 5H37H 4JY4B 2BFVH 2YA1A 1KXTB 4TVSa 2EE9A 5I1DB 4LEOB 3V0VB 2PW2B 1T89C 2WINB 4HK0B 1ADQL 4XNXH 1G9MC 1H0DA 1OAKL 4O02L 5GRJH 1WTGT 4D0DB 3QJHA 3R1GH 3ZO0A 3OAZH 4MZ3A 1AGCB 5EO1A 2CKBA 3BEWB 4JZNB 4PJCB 2KQNA 2HLAB 2VKWA 4OFYD 4H20H 5KJRL 1K8IB 2DLEA 2FD6L 2XRAL 3MA9L 5HYQB 1JCKA 2VAAA 4LCCC 1TQBB 1S7VA 1NGXB 1B0GB 4P5MB 3GJEA 3IDMA 4M8QB 2OX5A 3PDOB 4KK8C 3TWCL 4BH7B 1SEBA 1IGJA 3JWOL 1JPSH 3CIQA 3L6FB 4YHZL 4Q0XL 3JV4A 5TQ0L 2V5MA 3HUJE 5ESAB 3RGVA 1CGSH 3V7MA 4RAVB 3O3UN 1XIWA 3H9SE 4F7PB 3LVEA 4F8TA 1MAML 4XXDB 5SWSD 2ITDB 5JHLH 3AVEA 1MCDA 3S88L 1MHPH 1WC7A 4B41A 5HYEA 3RWFA 4HH9A 1JWMB 4TSBL 4Z7VF 1WEJH 5T3ZH 3BPCB 1EERB 3BMWA 3QG7L 4QRUB 5F6IC 5JLZB 4PJGA 2J4WH 1HXMA 2M8XA 1F6AA 4XBPB 2OJEB 1Q38A 4Y1AB 4KJQC 4WEMB 2ITCA 5TH2B 4G9FB 3CFKB 5JOFB 1NCCL 4EI5C 5HY9A 1QBBA 4M93B 3L3KA 2ZKHH 3ZZ1A 3ZKSD 1CE6A 3MRDA 1TPXC 5TF1H 3OKDA 1IKNA 4LGRB 5GGSA 3D39E 4U6TA 1HHHA 3JVGA 1LO2H 1FAIH 5IB2A 4OT1L 3ROLB 3QI9C 3MBEA 1VACA 3ZKND 4R8WL 5I71B 2Q8AL 3TIDB 4AEIL 2VDPH 4WW1A 3ARBD 4TUJA 4Z7WE 2VLJE 1H0DB 5FECB 4CMMA 4GG6E 3ZKXB 1RJCA 3QJHB 2YPLA 4ETQB 4TQEL 5EO1B 2CKBB 5E2VL 3X3FL 4GO6B 2X89D 3PGDB 4LRIC 1H3WM 2VAAB 3IU4H 3MV9E 2AGJH 1S7VB 4P4KD 4WY7L 4JKMA 2F5AL 1OD7A 4XVUD 2CUHA 3IDMB 1ZA6B 1ND0B 1SEBB 1IGJB 4JVPA 5I1IL 3JV4B 1LE5A 5E00A 3IJSA 1FGVL 3AREC 4ZOEA 2H2SD 2ZCKL 3E3QC 1F2XK 4LSVH 1XIWB 1FYTD 1RUQL 2YMXH 3DGCR 5LCVL 1QVOB 2W91A 3QEGH 3X12B 3FN3A 1WC7B 1KLFA 2YUXA 4BA8A 3LRGA 1VEPA 4I2XA 4X80L 4HH9B 1L6XA 1HQ4A 3DBXB 3BQUB 2AJUH 3GMLB 4OF0A 2BNRE 2NCMA 5IBTH 4PJGB 3F58L 3MRJA 3T0EC 1HXMB 1F6AB 3RDTD 4TSAL 4YPGA 3UTZA 1OQOA 1AHWA 2ITCB 3FO1A 1DBAL 3MGTA 4XH2A 4XC3L 2Q7YA 5HY9B 3L3KB 4YBHA 4YE4H 5DJYA 2Y72A 3JZ7A 4P3CH 3MRDB 1BGXL 2F54E 4PP2A 4F8QA 3GI9H 3OKDB 3C60D 3DLQR 5IMLA 2H1PL 5FGCE 2XICA 5GGSB 3L9RA 4K7PX 4DTGL 1HHHB 4OBSA 3RIAK 2G2RA 1G7MA 4ZFOL 5IB2B 3MBEB 1KELH 4O2EA 1GGYA 3D39B 1HSBB 4G5ZH 4KQ4H 3KYKL 4R96A 3F6IA 4QWWC 4F15B 2M26A 1Z3GL 4TUJB 1BFOA 2VDLH 3DVIA 4CMMB 4F2MA 2J6EH 2YPLB 3IFLL 1G7IA 4G3YH 1BVZA 1CVSC 1A7RL 4CJ0A 1N6QL 3ZE2F 4R4BA 3MV8E 4P57A 4XNUH 3SDAB 5SWZD 3FB8A 3GDBA 2AK1H 2H9GA 1RVFH 4PGDA 5KSBE 3EFDH 4BZ2L 1RZJL 5JXEA 1F90H 1CGYA 5E2JA 2NY7H 1U6AL 1JTPA 1T1ZB 4TULH 5D7LA 4M6NH 5E00B 1LE5B 3IJSB 3F8UB 1FNSL 1EDQA 2XZZA 2OL3L 3B5GA 5EBWA 3SGJC 4FTVA 3BP6B 5C0EB 4ODHH 1I7RA 3TVMA 1DZBA 4JPWH 4B53A 2RCSH 2DQCH 1MIEH 1XF5B 2OJZH 4PJXE 5FYKE 1FL6A 2EKJA 5DMGC 4I2XB 4NN7B 1FIEA 4W4NA 3W0WA 4Q9QL 1HQ4B 1OGAD 3TCLA 5GGVL 5E2TH 5BV7H 1PLGH 3MRJB 3SKNA 3OSKA 4H8WC 2DM3A 3WV0A 1KEGH 1KIQB 1Q9LA 4HMEA 1AHWB 1IGTA 2BNRB 5BRZA 4U49A 3FO1B 2DQTH 3MGTB 4XH2B 4NYLA 4JCLA 1KB5A 5DJYB 1YZZA 1IC5H 4G6KH 3RL1B 3MX0A 1YMHB 4GAJH 5ADOH 2XWTA 4U1HA 3MRRA 4XVTH 2XWBB 4PP2B 3O3BB 4LVOC 5GS0C 4S1RH 4DGIH 3MRGA 5DD3H 3L9RB 4J3SA 1TJGL 1UCTA 5ANMA 1NPUA 2FEDD 2A9NH 5CZXD 4BUHA 5GGQH 4PJHE 2ZOLA 1IARB 4O2EB 3NCJL 5BJTA 5DD5H 1KCSH 4R96B 2Y5EA 3FO0H 1N64H 3QQ9D 5BOZG 1XR8A 1SYSB 4JQXC 4YX2H 2YR3A 1WJ3A 2R0WL 2VDQH 4OF6A 4BH8A 1G7IB 3IJYB 5AAWA 1CT8A 32C2A 3WNMA 2E6JA 4M1DL 4XWGL 1DQML 1FNHA 3WSQL 4KTEL 2UWEF 3QAZC 4R4BB 2BVQA 3D2UD 2J5LB 4CUCA 4NM8L 3BOVA 4P57B 1P1ZA 2H9GB 5M95B 3C9NA 4PGDB 1A7PL 1FZJB 3D3VB 4S1SL 1EXUA 1G1YA 5FA4A 4KJWC 3MJ7A 2FGWH 2E9WA 3U46B 1GGUA 5D7LB 2FSEB 1Y6KR 3BH9A 2VXVH 1HHIA 1JHKH 1H3PL 1IT9H 3MBXL 5IB5B 1T80A 1JZ4A 5IP4A 5EBWB 2PYEB 4FTVB 2GW5A 1QLEH 2UY6A 3OF6A 2BRRL 4JRXE 1TZGH 1I7RB 5J9PA 1PG7L 2HT2D 5C07A 1KTRL 3KS0H 1BREA 2YPVH 2JE8A 2JIXA 4O9HL 4HUXA 1X4ZA 3STLA 1OHQA 2AXJA 4YHIA 4BZ1H 3WLWC 3OZ9L 4HKZB 4OLUH 4Z7UF 4D0CA 4YBLB 1WBZA 4HW6A 4M1CC 1MUJB 2BMKA 2N7AA 3U82B 2XT1B 3SKNB 1NUFA 1PDKA 4PB0H 2DQUH 1Q9LB 1IGTB 1YEDB 4U7MA 4EDXA 5C09E 3ECBB 4X7EC 1UKTA 1IILE 2P5EE 4NYLB 4XPGL 4C56A 1OD9A 3FB7A 1KB5B 4Y88A 5KS9E 4G42B 2QHLA 5IHZA 1NUGA 1QR1A 1HINH 2XWTB 4R90H 4U1HB 3MRRB 5EUOF 2R56H 3SJVE 1TETL 3MRGB 5C0GB 1YJDL 2B1HL 4O2CA 4X7SL 3ZDZF 1U8OA 5FGBA 1CFVL 4YR6A 4AMKH 5ANMB 1G1CA 1QRKA 2ZOLB 2DAVA 4HULB 5BJTB 5FKPA 2AJVL 4AK1A 5HGAA 4UNTA 4HKJA 5C0RL 1FN4A 4OD2A 1MFAH 4DUVA 3VI3F 4ALAH 4OFDA 1X6LA 4W6XB 1XR8B 5BZDA 1SJVA 4WW2F 1LO5A 2P47B 4I9WE 3W39A 2R69H 32C2B 1WBXA 1A6TA 4KPHH 2C3HA 2BVQB 2JCCE 3O6FD 4LLYB 1UWGH 3P4MA 3C08H 1B2WL 2XN9B 1P1ZB 4K71C 1NFDE 2HH0H 5HDBE 1GC1H 4Y4HA 3EYSH 2NY1B 1B3JA 1EXUB 5HHXH 3UBXI 5E2UL 1KCRL 1U3JA 4KUZH 3U83A 1NKRA 3MJ7B 3OKLB 1CGXA 4GKZA 1ZSDA 1YN6A 4N90E 4UIMA 2Z31B 5DMIH 2G5RA 2D31A 5C0FB 5DFVC 5KVGL 3PGFL 5J9PB 5C07B 4JQIL 4B5EA 3GEWB 1SBBA 2JIXB 4X9FA 4HUXB 4LIQL 4PREA 4LVHB 2HJLA 4YHIB 2GJ6A 5JZ7D 4OLXH 4P46D 3QWQB 4QXGH 3S9DB 1MCOH 1DQLH 3I02A 5F7UA 1WIOA 5FV1L 3RY5A 1WBZB 2R0ZL 4LSUL 1KULA 5FB8A 5FHAL 3BT2L 3NGBB 3ZYIA 35C8L 4EDXB 5HHMD 1F8TL 2B0SL 3LN9A 4C56B 1IBGH 3VXRD 2DQHH 3ARRA 3T3PF 5IHZB 2C3VA 1QR1B 4O58H 1KPVA 5AG9A 2Y5TA 3QFDA 1GOGA 4O2CB 5JIIA 4RMWA 5KS9B 3GMMB 4BFIA 3O9WD 4YR6B 5EZJB 4JFEE 2PTVA 4OI9A 4K8RL 3BN9C 4LAJH 2WK2A 3VFMA 1KIRA 1N26A 4GRWE 1MIML 5HGAB 1J8HE 4HKJB 3BO8A 1FN4B 4HXBH 3W11C 1B4JH 4OD2B 5D6CB 4CW1A 2JF1A 3B9VA 5F8RC 1KTDA 3VGDA 3V8OA 5BZDB 1RK1A 3D87B 1HI6A 3ZTJG 4PPTA 4G8IA 4MA3A 1FO0H 3T3MF 1FNGA 4EOWH 4UBDC 1CR9H 5EPMA 3UTTE 1WBXB 1A6TB 3WFDL 3WHE1 3O6KL 4D3CL 3OKEA 3NFNA 1MREH 1U8MA 3P4MB 4MHHI 2WSKA 4Y4HB 4QF1A 3SDYH 5E6ZA 3OKNA 4XWOC 2DWDA 3REWA 2BC4A 4YDKL 4HD9A 5DR5H 4ZNEE 1F2QA 4GKZB 1ZSDB 1YN6B 4XT1C 4L3EE 4UIMB 2WBJD 4JG1L 4KQ3L 3WXVH 2D31B 4JFZL 1A7OH 1LD9A 1VA9A 5J06A 2AJ3B 4M7LH 4PP1C 4U1KA 4TSCH 1I1CA 1S9XA 3QUXA 4PD4K 1OAYH 2F53D 3UYOD 4EJ1C 2HJLB 5DJXA 4AG4L 3PWLA 4M62L 5INCA 3I02B 1DJSA 4LCWB 3WIIH 4A6YA 4QHMA 4GRWH 2YZ8A 5C0BE 3TYGL 2QQQA 3IU3A 5K59E 4PJ7A 2R1XA 5FB8B 2NTSP 2QSVA 2AABL 3NCFB 1HCVA 4G7YH 3TT3H 5CJ5A 4OB5L 2DYPA 3I3EA 5JQHC 1MQKH 3HNVH 5F1IA 5DUMH 1KPVB 4HJGA 4J4PC 4K94L 4OM1H 1EV2E 2Y5TB 5IFAL 4OSUH 5DQJA 3CSYA 3QFDB 4HIJA 5KTEH 1KJ3L 4BFIB 3LDBC 3F7YB 4QRRA 3THML 1SYVA 1OAZH 3MCKB 4LSPL 4JO3H 3VFMB 3GHBH 1KIRB 1DVFB 4QTHA 2NY5C 2IEPA 4M4RA 4EKXA 3TFKD 2VL5B 3CFBB 4RQQB 4ZFOA 3U0PA 3KXFD 6CGTA 3MOBL 3HMXH 4U1GC 5E2WL 5J1SC 1KTDB 2R23A 1EO8H 1RK1B 1CBVL 1HI6B 4G8IB 4MA3B 3GB7A 1XF3A 4WHTA 2NY3C 1FNGB 1ZHLA 3EGSA 3TA3D 3F62A 3AS1A 3P9WB 5F21B 1S8DA 3QH3A 5T3XL 3IYLW 2VQ1A 3BPLC 3OKEB 3LQAL 1JIBA 3NFNB 4N0YL 3MRNA 2X1OA 4QF1B 5E08H 3TBVA 1MFCL 1U58A 3OKNB 2L4OA 4XP9H 3KPLB 4S1QH 2ZUYA 2DWDB 3REWB 4RISH 2AJSH 2BC4B 2CMRH 4XP6H 2BJMH 3LKQA 2HKFH 1IFHH 1NJ9A 4WO4A 2ZPKL 3FN0L 5AZ2H 1IGYA 4Y5YC 4HJ0C 4XX1G 3MLTA 1GSMA 2MQCA 4V2CB 5EOQL 1I7TA 3B9KC 3DXAE 3BUYA 3OB0H 1LD9B 1WCBA 4JFXA 5IFHL 2VLMD 4U1KB 4QY8A 3HKFA 3QUXB 3TBTA 5I16B 3IRZA 3IAGC 5GRXG 3A67H 5DJXB 2DIBA 3PWLB 5INCB 3TNNA 4QHMB 4ZUUA 1NL0H 1OB1A 3IU3B 1IQWH 1TQCB 4PJ7B 2R1XB 1MCKA 2C1OB 4P5TB 5IIEA 2AJXH 4OD3H 4NQDA 5IWLA 3FO2A 2DYPB 5FUOH 3VXSA 5F1IB 1UWEH 4HCRA 1F5WA 4WHYG 4HJGB 2IQAA 3SE3C 5DQJB 2V7NA 4HIJB 3ZDYF 1DBML 2PF6A 5IVXE 4QRRB 3O8XA 5HVHB 1NAKL 1P7QA 3U9PH 43CAB 1SYVB 1U42A 2KPNA 1XZ0B 2XNAA 3FOLA 3WL9A 4QTHB 5CGTA 5FOJA 1S7QA 4ZFOB 1F02I 1YNKL 1ZXQA 2VUOA 4I0CC 1FH5L 3GKWL 4U3XA 2R23B 2DI8A 4GQ9H 4OFVA 1M4KA 3RVVC 3QCVH 1T22A 1CYGA 3PWPE 4QXTA 2V2WA 3GB7B 1P9MC 2XA3A 3WJLA 2ZZUT 2B5IC 1ZHLB 5K9JH 4NNPL 3C2SA 3CAFA 1S8DB 3QH3B 4Y1AD 2DQEH 2VQ1B 4P23A 5C0CA 4G9FD 4JFQA 4CRPA 2P43B 5EA0L 5GRYA 1CICC 3MRNB 5DGRA 5CJXA 4OZHF 3TBVB 1C7SA 5ERWA 4PJ9A 1U58B 1XCTA 2XKNA 3AM8A 2W0LA 4NHUA 1NJ9B 4MNGE 4WO4B 2Y07L 5DO2C 2PXYC 1IGYB 3MLTB 1W8NA 3UCRA 3I6GA 3BUYB 1IM9A 4K7PL 3QPQD 2VMFA 4N8VG 1WCBB 4TUOA 5D7SH 5F3BA 2OL3B 3REVA 4ZOBA 5JQ6L 3TBTB 3DXAB 2ZCHL 4DFHA 3PL6A 4JHAL 4LAQL 3BZFA 3LPFA 5DRZA 4UNUA 4JPKH 1FVEA 1VEOA 1MRFH 4NHCL 3MROA 4LOUD 2A0LC 3MRIA 3TNNB 2BP3A 1WFUA 4XMPL 2IBBA 4ZUUB 5B8CC 4PJAA 5J1TC 2B2XL 4KY1L 4YZFE 2A1WH 3V95A 1OB1B 2QADC 2R4RH 4H25A 2BVPA 2X1QA 4NQDB 3CSPA 4K7FA 3V5KA 1RJYA 4E0RA 4ZFFA 3FO2B 2R1YA 2IFFH 4LU5L 4QRSA 3NAAH 3U7YH 3VXSB 1QSEE 2Z8RA 3O2DH 4KUCF 4L29A 2IQAB 3M07A 1KCVH 1IGMH 2DDQH 2Y7QB 4HC1L 1FFNA 2V7NB 4OCYH 1C12A 3O41B 5ACZA 3ZT6A 1SEQL 1YY9D 1V3KA 1P7QB 1XIWD 4OZFG 5T5FL 2XNAB 4FQXA 3FOLB 3WL9B 3S3SA 4IRSC 4F3FA 2EYRB 5GS1C 1JZ5A 1S7QB 1EZVY 5IVXB 4X8JA 2DOCA 1EUUA 3G5YA 2DBLL 3U2SA 5CAYB 3HPJA 3Q48A 2XZCH 4TTDD 3BHBA 5C0AA 2ZWLT 4X4ME 1LNUA 4G6FB 2EXYC 1T22B 2NXZB 3BQUD 3QISA 3GSOB 1FSKC 2V2WB 1X7QA 4RGOL 4NQCE 5GXBB 3KLSA 5E9DA 5C0CB 3OHXA 2JELL 3P0YL 1LE9A 4JFQB 3RY6A 3PP3K 4D9LH 1BZ7A 1D6VL 5CD5C 2CK0L 3QIBB 4HWBH 5ERWB 1UB5A 1XCTB 5ECJE 4LFHG 1QFHA 4H1LG 4A2MA 2I9LB 3RVWC 2AEPH 3M8OL 3OR7A 4YGVA 4NHUB 4LLMB 1A21A 1EO5A 5LKNA 4NO2A 3MBED 3HG1E 1REIA 4PRHB 1J1OL 1JK8B 3I6GB 1IM9B 4HG4K 2MQ0A 1NCWH 7CGTA 1N5YL 3IRPX 4TUOB 5EC1A 4AT6A 4HWEH 5F3BB 3QBTB 5FYJE 2D4FA 1E4WH 2O5YH 3FFCA 3UAJC 4JO2L 5DRZB 1FVEB 2YEZA 4BQCA 2H41A 2ZUVA 5T1DH 3MROB 3MZGB 2K7QA 4PJIA 4POUB 2YPLD 3KPPA 3MRIB 4ZG1A 4HXAL 1BD2A 1PQZB 1JF6A 1U9KA 4PJAB 1C8PA 2XTJB 4H25B 3A6OA 2BVPB 3SDAD 3T8XA 2MKLC 4QRTA 5CKGA 4APQA 1BWMA 1ORQA 4K7FB 1RJYB 4MXVF 4ZFFB 5DFWH 4LF3A 2R1YB 5HI4D 4QRSB 4U6YB 2B39A 1CTOA 2P7TA 2QQLH 4OCLC 4S0SD 4FZ8L 4WWKA 1KC5L 4L29B 3WFCH 3ARTA 3MV11 4WNQA 3VI4F 1FFNB 1C12B 5ACZB 2DQJL 4RFEA 1P5UA 25C8L 4KJPC 4HIHB 4N0FA 3ZL4L 4X5XA 3ZT5A 1WZ1L 1S78D 2ED9A 3SDCA 2VZ3A 1H8SA 4FQXB 5IEKB 1HYSC 4F3FB 1ZKAA 3UJJH 5DDHA 3GJFA 1A14H 3G5YB 4ONFL 3CVHH 2VC2H 1MRCL 2V17L 4HLZH 5C0AB 4LLAA 1DEDA 2IADA 1LNUB 4CGTA 1PEZA 1OARH 2VLKE 2F5BH 3E6FA 4Z8FL 4OLVL 1GJIA 1X7QB 4W6YB 2HTLC 1ZMYA 3JUYA 5E9DB 3EAKA 2EXWD 3MUGB 5FCSH 4NQEE 4PJBF 5FYJH 3OHXB 5IW3A 3V4VL 3B9DA 1LE9B 2BNRD 2AQ1A 2Q8BL 1BZ7B 5JW4M 1XGRA 2R1WA 3ABZA 3IDGA 4UB0L 3HHRB 5MEPA 1UB5B 4XI5D 2NY2B 1BMGA 5EU5B 1AD9A 3MRCB 2NW2B 1YDPA 3OJ2C 3OR7B 4YGVB 5AZEH 5F7FA 1RMFL 4DGVL 1CXHA 4NO2B 4WI4A 4RWYL 1MY7A 2VZSA 1T2JA 3PHSA 5MERB 4LVNC 3NACH 5IW6A 2FJGA 5EC1B 4AT6B 4ODVL 2VO5A 1YPZE 3MYJA 4IOFD 2FYYA 3LZFL 3K74B 1K4CA 4DKEL 4PRPE 1CLZH 1UJ3C 2YEZB 1NMBH 2Z35B 1T5XB 4PJIB 4W81A 3KPPB 3FCTA 3PDGA 3U7WL 4JFYA 4MCYB 4MQTB 2W9EH 3T8XB 4QRTB 4APQB 1ORQB 2EDHA 2IMNA 1AJ7H 2LV4A 1I85A 2DTML 1KCUH 3T09A 2I9TA 3D3VD 1UA6H 2JB6B 5CD3A 5JXED 2P7TB 2YD3A 4EDWL 3TBWB 4O2FA 5IB1B 4LMQE 5D7LD 1T83C 4WNQB 3HI5L 2MMXA 4JLRB 1R3KA 4RFEB 4N0FB 3QNZB 5DA0B 4X5XB 2PYED 2WQ8A 3UPCA 3C8HA 4FTVD 2VXSH 3IT8D 3SDCB 3WIFA 2VABA 4WGVB 1HYRC 5TGBA 5DDHB 5IJKC 4X6CE 3UTQB 1FFQA 3DETD 5ETUA 3JWNC 3T4AB 2IH3A 3J8F7 3NZHH 5FK9B 4HGWA 4Z6AT 2IADB 1QSFA 2J8OA 1B0RB 2D7MA 1T66D 3B5TA 3E6FB 1S9KC 5FYKD 1I7UA 4ZQKA 1BQLL 3IKKA 4EQ3A 5T3XE 5C3LD 1I1FA 3QXDA 5J11C 5I8OL 3FTGA 4NJ9H 5JHDE 4KI5E 1K6QH 1GPOH 3C5SA 3GI8H 1A7BA 2R1WB 2YKLH 3IDGB 4MJIA 3ARBC 5MEPB 5CBAA 1J86A 4P2RA 1I9IH 5A2LH 5DMJB 3UC0H 1AD9B 1MFBH 4EBQL 4RRPA 4NZUH 4PTUB 5EIIA 3EO0A 3LD8C 4K23H 5JIKA 3V4UH 2NZ9D 1J1XL 2Z91A 1DANU 1RIHL 3EOTH 3OR6A 3QUYA 3BP7A 2VLRE 3OTTA 1JYNA 1MF2L 2FJGB 1KBGH 4GQPH 3MYJB 2AS5M 2FYYB 3EYOA 1K4CB 4QRQA 1HKFA 4MHHG 1X44A 3RUGA 1LP9F 1QACA 4ELMF 2DIJA 4DKFL 5ALCH 4GMTH 4JFYB 1A1NB 1D6EA 4HWNA 3QIUB 2EDQA 4Q7DA 2DLFL 4JRYA 2P5WE 1UEYA 1ULVA 4M02A 2QSCL 2XN9D 4GOSA 4HUUA 3HFML 1S3KL 1DSFL 2NY1D 1I9JL 4Y8AA 2AJZA 2WAHA 3TH4T 2I27N 2IWGA 4FFVD 1IGCH 4GXUN 5J13C 1QFUL 2ZSVA 4N9GA 1R3KB 2Z31D 5CP3A 3PG2A 4ZUSA 4E41B 4X0KB 1KIPA 4RNRB 2QV2A 3OF6D 3RP1A 1SJEA 4NN5B 3HNTL 3WIFB 1I1RA 2VABB 2W0PA 5TGBB 4X6BA 5C07D 4P0DA 4PJEE 3CZFB 5I1CL 2JIXD 5GJSH 5C0NC 1C5CL 1EHNA 1KN4L 2O5ZH 4AM0B 2OK0H 1LO0L 2I5YL 1UJTA 2IH3B 4XXCC 4ONHB 4L5FL 1QSFB 2DLIA 4RA3A 1I7UB 4GKNA 4ZQKB 3SDDB 1NSNH 3K2UH 4MDIA 2CDFA 1I1FB 1RUAH 3QXDB 4NPYA 1KGCE 2X4UA 3FTGB 2E27H 1WWBX 3H0TB 4C56D 1TXKA 3C5SB 5D7IF 3RIAF 3MJGX 4MJIB 2EDDA 4OI8A 5CBAB 1VGKB 4WI9A 4FQIL 3VCLA 3FQNA 4P2RB 3BAEL 1Q0XH 2D7TL 3P9LB 3ULUD 3WNNA 3LEVL 3EO0B 4X9HA 4JGUA 4KVNL 5I1HH 2Z91B 4NP4L 3CU1A 3OR6B 1IAIL 1DE4A 1AQDB 3CFCL 3QUYB 5C6WH 1U8JA 4MJ4A 2MPAH 1D5ZA 2W9LA 4PJ8A 2HJKB 5BMFL 2CD0A 1TVHB 3QDJA 3WKMH 3BZEA 2YRPA 3TJHD 3SO3B 4HG4J 3RUGB 4U33A 1ZHKA 1M7IA 1G7QB 1HZHH 1DUZA 1D6EB 2BDNH 4JHZA 1K3ZA 4JN1L 2A6KA 1FG9C 4LSSH 2QKIB 3PWUB 3ES6B 3IDXL 4P5KA 3QIWA 4J6RH 4TPRL 4Y4HD 2AJZB 1ITBB 2YWYA 4B50A 5M94B 5F9OL 2VXUL 2NX5A 4TNWK 2X1XR 1KEML 2UVEA 3MV7E 2DQIH 4N9GB 3VWKA 4ZUSB 5FF6A 1E6JL 4PRDA 1KIPB 2YD6A 1SJEB 3NIGF 2NY4B 3SGEI 4YQXH 1I1YA 2VR4A 2PO6B 4BQ9A 4X6BB 3LS4L 3B9EA 4U0QB 5EBMA 1MCLA 1PYWB 1YEHL 4MJ5A 1OSPH 2KKQA 1CDGA 4CAGA 3KJ6H 5I2IA 4PIRF 1OTSD 4PLKC 5B21A 4FP8L 5EU7E 4LCWD 4Z7VE 1EJOH 2CSPA 2WV3A 1PKOA 5MEQA 1CDIA 4F7CA 4GKNB 4NO0A 3VXTA 4EXPX 3EJJX 4MDIB 5CZXC 4NPYB 2X4UB 5SWQA 4HV8A 5L9DH 4KROC 4XPFH 1S7XB 1YMME 4YHKH 4ELMA 3FQNB 3WO4B 2IF7A 1JHLH 2DD8L 2HJFA 4J3UA 4L4VE 5EC2B 2FLRT 2QHRL 2HVKA 3VFUA 3DGGA 1F3RB 1E27A 2YN3A 3LS5L 1NCBH 1MVUA 1DVFD 3SQOL 1DE4B 2XV6B 1U8JB 4NRZB 3QWRA 1D5ZB 2W65A 3BDYH 5TE6L 3S37X 4Q97A 1YC8A 5ICXB 1JFQL 3QDJB 3EO1A 3SCMC 5BRZE 1V3LA 3BZEB 4JFDE 3BH8A 4PUBL 3CDGA 2J8UF 1ZHKB 1TCMA 5CSZA 2LTQB 4QOKA 4Y19E 5J8OA 2ZP0T 1M7IB 1U41A 3TT1L 5L8JB 1HNGA 4KRNA 4A2LA 3QQ4A 2A6KB 1CD1A 1CL7H 5ESQA 4AL8L 1OAUH 1DEEA 2XPGA 1JZ3A 4IMKC 3QIWB 1KENH 3KPMA 3BD4A 3GSUA 3KAAA 3BVNB 3Q1SH 3MR9A 4J2XA 4PRBB 4BQ8A 1HDMA 4ZD3H 1RUPL 4TTGA 5D8JH 5FF6B 4WI6A 3FMGL 2L7UA 4RIRB 1U92B 1CDUA 2A74A 3NCEB 2EC9T 2W60A 4ESKA 3MACL 3HE7C 5EBMB 3QUXD 1BF2A 1EO7A 4MJ5B 3UTSE 3KWWA 1UM6H 2YBRA 3QPXL 5CJOL 3NCYS 4GRLC 5CGYD 2IC2A 5I2IB 1NANH 5AWNL 3P77A 4X99B 1T2XA 1LDPH 5MEQB 4HUWA 1AO7A 4NO0B 4KKCD 4IM8A 4HFUH 2VQTA 1FZOA 6FABH 3TZVB 5DHYB 1PSKL 4P5TD 3ILQD 1F6LL 4XCCL 3TV3L 5SWQB 4HV8B 1G9NL 2CLVA 5HDLA 4N0UA 2DYPD 2BNQA 2F74A 4C59B 4NKOA 1GHFL 5DHXB 2X42A 4KK9D 1CLYH 4POZD 1F4HA 4XMKH 2ORBL 2HVKB 4KDTA 3DGGB 3LEYH 4PJ5A 3VFUB 1YMMB 2A9MH 4QRRD 4CN1A 1E27B 3GBNH 5TPWL 5JPMA 4W70A 1NUDA 1FE8H 1MVUB 1OF2A 3U4EA 4CBPA 5EH1A 3S3PA 1QFWL 1U3ZA 1U3HA 4U1SA 5D70L 3K8LA 2A83A 5L88L 5IMMA 1BVKA 1E4XI 2YD1A 3BH8B 4OD1L 4NUJA 3SKMB 3V7AG 5GS2H 2Q6WA 5CSZB 4PB9H 4QOKB 4Y2DA 1AD0A 2X4SA 4JREB 4R0LC 1NBZA 3KPSA 3QFJA 3QQ4B 5DVLA 5ESQB 3ZE2E 5I1EH 1G7LA 2XPGB 4Y19B 3S35X 2VDRL 1OM3L 4W68A 2AI0H 3KPMB 3A0OA 3K1KC 3F65A 4JO1H 3P4LA 3MR9B 4H26A 4X98B 5KSAC 4X4YA 2OXGA 3I6KA 1HDMB 2K7PA 4P46C 1OP5H 5EOCH 3NA9L 2E5EA 3CLFH 4WO4D 4LGPB 3VXOA 3F5WA 3HI6L 5HHVL 2ZJSL 3HNSL 3AFLA 2A74B 3VA6A 5TFSL 5MENE 4LSDA 1UQSA 5HYJA 2FX8L 1UCBL 3DXAD 5ICZA 4OJFH 3KWWB 2YBRB 1IQDA 3G04A 3G5XA 1OW0C 2W38A 4IJ3B 3VG0H 3SN6N 3P77B 4XP5H 1BQHA 1XGYL 3NPSC 1BFSA 1AO7B 4HUWB 3O9WC 2CKNA 1FZOB 3WN5C 3O6MH 1G7JB 2P8PA 2AXHA 4MNQE 4NQDD 4GSDL 1BOGA 2Z8VC 4AEHH 3O11A 4MXWH 3O2WL 1XGQB 5L6YL 3BPOC 2CLVB 4N0UB 5GGUB 1T0MB 2BNQB 4R4FH 4XP1H 3VXSD 2J8UA 3G6JB 3EOBB 4PGEB 2BY0A 4ZPVA 3O6LL 5I75C 2Q86B 3S5LG 5EZIH 5DVMA 4YC2C 3ARFB 4PJ5B 2DMCA 4KJYA 3S4SB 5KVFH 1P7QD 5JPMB 5HI3D 4OZGF 1JYXA 1OF2B 3DO3A 4U6VH 4OIBA 3DSFH 3I50L 5DRWA 1RJZA 4IRJB 1UB6B 3FQUA 3DMMA 1U3HB 1S7RA 1HHJA 5GZOC 3HAEG 2HYMA 4K2UH 5BW7C 2A83B 5IMMB 1BVKB 4G6FD 4HGMA 1ZLWH 2NXZD 3E1F1 1MCNA 4NUJB 4U0RC 2Q6WB 4GKSB 4Y2DB 4J3TA 1AXTL 4UDUA 4PYHA 3RX5A 1NBZB 5DQ9A 5C0CD 3KPSB 2I25N 5DSCA 2XWJA 3QFJB 5KVMC 3NH7H 5LGHH 2UWEE 1G7LB 5E0QA 4KRPC 3VFPA 4AEFA 3P9MA 2GSIB 4JPVH 3QIBD 3MCLH 4Z95L 2MJWA 3BKMH 4H26B 4X4YB 5L2KA 2EICA 2FD6H 2G9HA 1JGVL 3I6KB 4LHJB 4FQLH 4TVPE 5I18L 4JGJA 3KYNA 1CDYA 1PKQA 1HIMH 3F5WB 5AD0A 3FZUD 1MCPH 4BYHA 4PRHD 1GGIL 1IM9D 2QR0A 4PLOB 4YEEA 2XQBH 4MLIA 4TUKH 1UQSB 5HYJB 1P2CA 3ARGA 3CGTA 4GH7B 1E4KA 1F11A 5ICZB 3L3IA 3W9DA 1IQDB 3G04B 3G5XB 4EEEA 2B1AL 4Z7UE 3EJZD 1NLDH 1QNZL 2XTJD 3A6CH 3RRQA 3LN5A 4OUUA 5HYSG 5DEFA 1WFTA 1A3LL 1BOGB 1SY6L 3O11B 5DD0L 4YXLH 3F12A 2OZ4L 4G43A 5AYUH 3HE6A 3LB6C 4YFLF 1DQDH 5C7XL 4MAUL 4ZPVB 1C5DB 4UQ2A 4ZS6C 5EUOE 1ERNA 3OWEA 5JUEH 4AQOA 3IGAA 4KJYB 4LKCA 3ZDZE 2B4CH 3GMNA 3TA3C 1ZTXL 2ZCLH 1ZHNA 4FQXD 4FZEL 1IKFL 5T1KB 5DRWB 4I5BA 1RJZB 1WCQA 4LRNH 4N0RA 1VHPA 2IJ0C 3K3QA 4K3JH 1JGUH 5CIPB 2R0KH 5HVFB 3DMMB 4Z78A 4TVPH 5JW3L 3ZKMD 5KVDH 4HEME 3VI3E 4K9EH 5C0AD 3QQNA 3LRSA 4UTBH 1MWAH 1AI1H 1ZWIA 1FGNH 1JGEA 2DQGH 4JZOA 4L9LC 5EDXA 2FB4H 2RBLA 2H2PD 3TC9A 3BDXA 4UDUB 3RL2B 4CVWA 4BZYA 5E9DD 2D9QB 3V6ZB 2ZUQC 5DSCB 3VFWA 2BNUA 2CUMA 2CJUH 3TJEL 3UBXA 1U8KA 4BFBD 3VFPB 3P9MB 3OG4B 5F7YC 2Y06L 1EFXA 5HHOA 1FDLL 3UTPD 4ENED 5L2KB 2NY2D 2G9HB 2UWEB 4PGCB 2XXMB 4GXUM 1CFTA 1UACH 1FCCA 3CX5J 3KPRA 2F8XC 3KYNB 1RHHA 5C2BH 1PKQB 1SM3H 1VGEL 1EH9A 3UYRL 5AD0B 5ADPH 5JXAH 4LLQA 2AK4A 3FQRA 5IG7B 2QR0B 1WQVT 5IT2L 3HS0A 1Z9OA 1T20A 3B2UD 1CL7I 1I1AB 1MPAH 5F93C 1TQBC 1P2CB 3ARGB 1DQJB 4XVSL 4MWFA 5EU3A 3W9DB 3C2AH 3IAQA 4TRPL 4JR9H 3SDXF 1IMHC 2HTKC 3RZCA 2NTFA 4YBQD 4ISVA 5D5MF 3QEQE 1DBKH 3WD5L 5IR1A 2XG5A 2A6DA 5F70A 2WZPD 5MHSD 3QJFB 4NM4L 3RWHA 3ALWA 4A6YH