4A04A

Structure of the dna-bound t-box domain of human tbx1, a transcription factor associated with the digeorge syndrome
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
189
structure length
181
Chain Sequence
b'GVSVQLEMKALWDEFNQLGTEMIVTKAGRRMFPTFQVKLFGMDPMADYMLLMDFVPVDDKRYRYAFHSSSWLVAGKADPATPGRVHYHPDSPAKGAQWMKQIVSFDKLKLTNNLLDDNGHIILNSMHRYQPRFHVVYVDPRENFKTFVFEETRFTAVTAYQNHRITQLKIASNPFAKGFRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-BOX TRANSCRIPTION FACTOR TBX1
publication title Structure of the DNA-Bound T-Box Domain of Human Tbx1, a Transcription Factor Associated with the Digeorge Syndrome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 39
structure length 181
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00907 T-box T-box
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.820 Mainly Beta Sandwich Immunoglobulin-like Transcription factor, T-box 4a04A00
1H6FA 2X6VA 4A04A 2X6UA 5BQDA 4S0HA 5FLVA 5T1JA 1XBRA
chains in the Genus database with same CATH superfamily
1CCZA 4WSKA 3VWKB 4M5TA 4F2FA 3F05A 3NRFA 1CE1L 1WO2A 2ED9A 4LAQH 1E27A 4KNTA 3U9PH 1HQ4A 5C08E 2XNAA 3WTTA 4N2DA 4P2OB 5EZOL 3UDWC 3WDHA 1PNCA 5KTEL 4J4PC 2FSEB 1KJMA 1TTGA 2P5EB 3HBQA 4RGND 4Z76B 3RVTC 4N2MA 2ZF8A 2VOTA 1I1YB 1PLCA 4JR9L 5FCUL 1QMUA 3U9UB 1GS7A 1DFXA 4PJFA 4KAQH 1SJMA 5LDUA 4WI3A 3MBXL 4NWTL 2LV4A 2WBJA 5JPNA 5I8CA 1PJWA 4XP4L 3RAJH 2VDQB 3HAEG 1NJ9A 4X80L 5E99L 2NYYD 1GZPA 3D2TA 2XICA 1NLDL 2D3JA 4NI6A 5B39A 1ZHLA 5DI8B 4I0PD 4R90H 4L8DA 3HFML 4BCXA 4D7PA 5DJ8B 4RNRA 3ZX1A 4YHML 3GSXA 3D08A 3KPRE 3AQYA 1EXUA 4YOKA 2NZIA 3AQZA 2HUEA 3AREB 2FATL 5EMYA 1D9KD 1NGPL 4JO5A 4RX4A 1F4XL 3MLWL 4NO0B 4NZRH 3D25A 4YDIL 1NM9A 3L5WB 4WFFE 4KKLD 3I6KB 4ZTOH 5JOPE 3MUZ1 2ARJA 3L4CA 5CKAA 4G7YL 1ZA6A 4MA3A 1BZ7A 5L8KB 3B1UA 5E5LA 3FQ2A 1KCVH 4ZFOA 2FSDA 1KV3A 3BT2L 1EFQA 4UZUA 4GKZB 2IOIA 4XMTA 3CFDA 1UWEL 2CO7A 1R3LA 3WN6A 3ZOAA 4IKJA 1CDIA 2RALA 15C8L 3ELAT 4EI5D 2AEPL 5KBLA 3EAKA 1HAUA 4UINH 3E8UL 3AS3A 3V5DA 3O6LH 3QAZC 1P1ZB 7TAAA 3LX9A 2AV7B 3T3PF 3FDWA 4H7VA 4JDZB 2A0LD 4OI9A 3GKWL 1FZJA 4X9IA 3MV7D 4FXGC 1I7ZB 4GRLC 5DRXA 4K3JL 4LP5A 3ARFA 1C8QA 1CO1A 2ZKXA 3FQRA 3CHXA 1XF4B 4KKAD 4LCUA 4U1NA 4ODXA 4WWPA 2AFNA 5J1AA 3MGOA 5T1MA 3UZEA 1MVUA 5DMKA 3RKDD 3VFNA 1OTUC 1RI8A 1LDPL 3UIZA 1QFHA 1AQDB 3AY4A 4GRWB 5E8PB 3TVMD 4QHLA 1A3QA 2AI0H 2X42A 3WEXA 2OJ1A 3UTTA 4NQCA 4P2AA 2DWYA 5EOTA 5H35B 3MNZA 2DRUA 3ZDZB 2CM5A 2A2QT 1Q9WA 4HVBA 1SGKA 3BZ4B 5F7DA 3KXFE 4ZUUA 4LSRH 5H37H 5LBSL 2WLLB 4FFVD 4MXQC 4CNIA 2WUBH 5C8JB 3CVBA 3VFVA 5KYXB 1Y1UA 4ELME 3AB0B 4HIJA 3F85A 2YQ3A 2QL1A 4XC1H 3H3KA 4K15A 4Y5XC 5BNXD 5DT1H 1VEPA 3QZNA 3QO0A 4Z7QF 2VJ8A 5IOPA 3FONB 3Q8AA 4PJGB 4NYLA 4XXCC 2IADB 3QJXA 3AT9A 4TUUA 1OEZW 3M1OA 4G7RB 1Z9SB 1TETL 3T3ME 2XN0A 4H1LB 4JHWH 3ABZA 3E80A 4H26B 5IEKB 4Y19D 4F7TA 4R4BB 4PJCB 2YOCA 3CH1B 1ODAA 3HMXA 1JK9B 2N0KA 2OMXB 3BD3A 3QPQC 3SN6N 3AMKA 4LCWA 2YPVL 3LZPA 1RUAL 5E9NA 4ZUWA 3JTTB 4GI8A 4Y2DB 4HGWB 5HHOD 1EQWA 4P23C 2HRPL 2APXA 3KVDD 4XBGB 5DJ2A 3VWKC 1AO7E 2F19H 1NCWL 4N90E 3HG0A 2JCWA 4I77L 3EGDA 5CP3H 2BWIA 1IBHA 4NENB 3RL1A 5FO9B 4P2OC 4ZFGL 5LWYL 2JNZA 4FERA 3S3BB 3R0MA 4IS6B 4NFCA 3ARQA 3MBEA 2FJFA 4F9LC 1NBCA 4DPCX 3BJLA 4D9QE 5HDBF 4F7MA 4JFHD 4XBMA 2E9JA 5HVFB 1KB9J 2GTZB 2YA1A 3OHXA 3A22A 1MNUH 1OQOA 4NWUH 1YLBB 2VW7A 2WTRA 5AW6B 4YEEA 3IDGA 4CU6A 1A14L 1I1FA 1ED3A 2ZICA 3CVDA 2FUTA 1U8PA 1IAMA 3G04A 4E9RA 5FGBA 3CZFB 2WC7A 4C83B 3Q5YA 2UV3A 2VM4A 4NKMA 7CGTA 3F5WB 1CICB 5ITBH 4TRPL 1OL0A 4PRDB 3AREC 4GW5B 3HLAA 3OXRA 2R4SL 5CJBA 3DETD 2X4RB 1WAAF 4ZMAT 4U6XB 3ES6A 4P2QA 3V0GA 4MD4B 1ORSA 1INDL 1OLZA 3WIAA 2NY3D 3DWTA 1JRHL 4HIHA 4CVZA 1GC1C 4OCLC 1BX2A 4MDJB 3QJFB 3MUJA 2IBZY 3QZPA 2ZX9A 1PGRB 3ZTCC 3EG9B 5FYJD 4X6CA 1QFOA 1QTSA 1AANA 3ERXA 5I1IH 3KPPB 5I8EA 2BPBA 5D2LA 2XIDA 4HK0A 4IOSD 1OVZA 5C1MB 3SCMD 4N28A 4MNGA 3ATBA 1H5BB 1ZS2A 4M62L 2VMJA 1J0IA 4QOKB 1TVHB 4Y1AD 4BKLA 4J8QA 3CHOA 3OGCB 2J6EA 3FH7A 3MRHB 5JHDD 3OMZA 4LOEA 2CDGB 2UZXA 3BDYL 1LILA 3KNBA 2IAAC 1CLOL 4KJYA 1M7XA 3K72A 1JPTH 4ZOBA 4OF3A 3JXAA 7PCYA 5K9QI 3IGLA 2IAMD 1FL6B 1JPFA 1LO4H 1OPGH 4JKKA 4YDJA 3TA3B 2F0CA 2GJJA 3MYJB 3S36H 1J18A 1IFHH 1IE5A 3EXJA 3GMOA 4A7VA 1CLYH 1U8JB 2VLRD 2JVUA 1VFMA 1TYRA 2IH8A 4HD9A 5EZLA 4KQ3H 4TQHA 5KYUA 3EDDA 1PD0A 2F1BA 2GY7B 2Z8WC 2UX7A 3D07A 1HHHA 4R7LA 4YH6A 2F2HA 5F3HA 2P28B 2NUTB 2Z93B 4WFGD 1OKEA 3FSAA 4U4BA 2OMWB 1NCDH 2OMYA 5HDQL 4S10A 3FZUC 4YL4A 2OMTB 3ZYZA 4HPHA 4XI5C 3O0LA 2DN7A 1XF2A 1I9JL 3W0WD 3V0HA 4PJAA 3G6AB 5ECGA 4I0PA 5KVFE 1E3FA 3ATFA 1DYZA 3S2CA 5I1HL 5IR1A 3E1ZA 3LVEA 2HVJA 1KGJA 1Q8MA 1HDMB 2FX8L 3GHEL 5FDYA 4JY6A 1SBBA 1HI6B 4QYOB 3WNOA 1D9KA 4AI7A 3BO8A 2ZUQB 3SIKA 1HSBB 2F7IA 3QQ9D 2AV1A 4QRAA 4P5MB 4AKQA 2VR5A 3IPFA 3KCPA 4FMFA 4N86A 1DQLH 1IC4H 4UM9D 4ZG1A 2VDML 3IM1A 2UXTA 1ZHBA 2APWA 4PG2A 3OLIA 2Y2YA 3OHMB 4Y2DC 2H45A 1AOHA 3T77A 5I0WA 3BJ91 3U30B 1PFCA 3GBML 1D6VH 3PWVB 1RSFA 5DYOB 5ID0A 2CO4A 2GSIB 4EI5A 4HJ0C 4ZMPA 4FF9A 1KBWA 1BQSA 3K2UL 1MUJA 3SPVA 5TE7L 2GJZA 3KWVA 2BHYA 1PG7L 4FQ2H 5D8JL 2B14A 3O3AA 5T5FH 3HNSH 1BEYH 2K1MA 1RIUH 1BLIA 4PY7A 1G7MA 2DD8H 3MV7A 4ZXBB 4KI5F 4PJGF 4HOWA 5ISZD 2PYEB 2VM9A 3HJ0A 5GGRB 4YX2H 1KCKA 3FO2B 1HNYA 4PG2C 1J9SA 1OAUL 4Q0XH 3SJVD 3GSUB 3Q6FB 4XCNA 2P8PA 5EPMB 1R3JB 3SDXE 3MREA 5FIEA 1CICC 2XFXB 4UT9A 3RGVB 5BOZG 5KS9E 1EH9A 4LNVA 1U8MB 1ACCA 3MOAH 3EOAB 2G5BA 4JQXC 5EO9A 2YPLB 2FO4B 1KEGL 4LLYA 2ZUWA 5DJDA 5CEXA 1B4RA 1KUMA 4KK9C 1QFWM 4JNXA 2I5YH 3LPOA 2NYKA 2R2BB 4OQTA 2VUOA 1UGNA 4JB9L 3WIHA 4WW1A 1S7SB 3O2WH 3ZE1B 5AW4B 3P4MA 1DZ0A 4NHUB 3PGCB 3AM8A 3MLSL 2OZ4L 1Z32X 1EEQA 2FX7L 1JD7A 2HG5A 5DURB 2O5YH 3SGJA 4M6ML 4PP2B 4RGMB 5JIQA 3UPCA 4NQXB 4X0KA 4ZMXA 3KHOA 4AQOA 3D7PA 2H32A 1K6QH 2PWDA 1T04A 3MCLL 1UVQA 5I1DB 4Q74A 1H5BC 5DRNA 2PR9A 4LKXB 1JRHI 2X4PB 4Y19A 5DC0A 3MRQA 1C5BL 3PNWA 3U48A 2J1XA 4ZUTB 3V0IA 3ARYA 5I19H 2B08A 5FYKD 4FQHA 4PS8A 2B8OT 2BNUA 3VD1A 4HSAC 1VSCA 5I16B 2Q86B 3EJQA 3T0EE 1NZRA 4PPTA 1VACB 5JW5A 1K4CA 1LWJA 4W4OA 5HHOA 1OALA 3E6HB 1I8UA 3PPSA 3L95A 4ZPTA 1HVXA 5CEYB 3TA3C 2IBBA 3SEPA 5C0RL 2NUPA 1U91B 1U8KB 3L7FB 3NCFB 1A6ZA 3FKUS 4G6AC 4NUGH 4G43A 4J3OF 3BN9D 5DVKA 5IJDC 1BVOA 3MLUH 1KN2L 1PKQE 3QHFL 4HH9A 4O4YL 1MJUL 1QLEH 2Q7YB 2ZKYA 3MMEB 2E75C 2XT1B 2VSKB 2XXGA 2W9LA 3JYBA 3EHBD 1XB6A 4K71B 1KACB 2KZ1B 5E95B 4WK4B 1I85A 2PXYB 5GRJL 4JZNB 3WS6A 3IJYA 2YARA 3ILQC 4K55A 3FU6A 1EJ6A 5KZCB 4W1TA 2CJUH 3QJRB 1LHZA 3NAAH 5IFAL 3DURA 5DFVD 4W4OC 4WK0B 4PJHE 4F37K 1IGYB 3PP3H 5I9QC 4Z7WE 1H3GA 1MW1A 4ZMVA 3NJVA 2WLMA 1EEZA 2EC9T 4Z3JA 4M6AA 4XGZA 3MR9B 2Z31B 2NZ1A 3AWFA 3NJLA 4U33A 2EAEA 1BGXH 3WS3B 4Q58C 5CXPA 2BERA 3QJZA 1WTLA 3DO4A 1S9WB 4UU9B 5C09B 2ZSWB 4EOWL 2ZUQC 4Z0BH 1O7VA 2ZUUA 5FO8A 1NFDE 4HWZB 2CIKB 5T3ZH 3TT3H 4CBZA 4RFEB 2JLLA 5JDJA 2JJTC 4OTXL 1LO5A 4AC2A 1PZ5A 4WTWA 2KI6A 4OZGE 3RB5A 4MNQE 1HEHC 2WLNA 4AENA 1RHHB 3C6SB 3QUMH 4YDVA 1KXVA 2WINA 5CEZD 4U6HB 3U30C 3RPBA 3X1FA 4X9YA 3FB7B 1WH0A 1QFWH 4W9ZA 5DK0A 4UILL 3HUJF 1DJYA 2WQVA 4IOSA 3BLKA 3SCMA 5F6IB 3NIGE 3CDFA 2GIMA 2IO5A 5I8KH 4GKLA 1N8OE 3N43F 2BOBA 3EJTA 1Z9OA 4Y1AA 2MTPA 4MD0B 4BSVA 5B1CA 3SE8L 5H37G 5CJOH 4DKFL 1E7UA 3D9AH 5CWSB 1BZ9B 4CSZA 5D7LD 2CR3A 5E8DH 5IROD 3DO3A 5HYJB 1A6TB 1CXFA 1IARB 4L3CA 5JHDA 4G6MH 2ZCHH 5J57B 2P9RA 2RACA 2YHGA 1X9QA 1AVAA 2CKBB 5F7AA 4MB5A 3O6FB 1RUML 2IAMA 1VB9A 4BKSC 3WAJA 2IALB 3CDCA 3GBDA 2VLJB 3PCYA 1KYAA 2KLSA 1Q1PA 4JHAL 4XB8A 4DT2A 3DSFL 5ITFB 4BFIB 1UB5A 2J8UB 1JUFB 4J27A 2OYKA 3VCLB 2VLRA 2P49B 5IV2A 1P6AB 1RUQH 4GAYA 3RGVC 4ZMZA 3VI3E 5BVJA 1JTOA 4S11A 2RAMA 4QDGA 3TEUA 5DC9B 2OJEB 2CIIB 1N6VA 3OKMB 4A6YL 1NMBL 4RMWA 2AVGA 2ERJB 2JKSA 3UBXG 3UFIA 3VFMB 5CBAA 1T7VA 3WFHB 2R1YA 1MQ8A 3RVXD 1FV1A 3M46A 2RBLA 1XL4A 1Z66A 5IK3A 5C7XH 4Q6IA 1KIQA 3ESMA 3UJIL 2DB8A 3MJ8A 3W0WA 4R96A 5EU7C 5K9JL 3BH8A 5BVPH 3S34H 4B9IA 4DEUA 1HOCB 3KYMB 2GSGB 2H2PD 4XXDA 2PCFB 3DXAE 3TWYA 2C9UA 1ZSDA 3E3QC 1TLKA 4PRNB 3B9EA 1B4TA 1BAFH 1AC0A 4NIYE 3HC3H 1MI5E 1AMXA 5DHXB 3BEVB 1PEZA 5KAQF 4Y5YA 4Y1TA 1M7IA 2HJKB 1WEJH 3PWNB 5CGTA 4CC1A 5JXEC 3P0VL 4UT6A 4EN2A 1C9SA 3UO8B 5IOKA 4OJYA 5GSVB 4FI8A 2YK1H 2IPTL 2KLTA 4UM9A 2VLKD 1S9YA 1SM3H 2Q5BA 4NRYA 5IM7A 1L9OA 3F7RA 1E8ZA 4PV9B 1L7IH 4LASH 4HH8A 8FABA 3QUZC 3BSGA 4CAGA 3FMGL 1KCBA 1RSYA 1ZV2A 2LT9A 2PTTB 2VDPH 4ONGL 2YXWA 4A7GA 3SOBH 3BKML 2YRLA 2XWBA 4LE8A 4Y88A 4EF3A 4TUOA 3UGUA 5DUPL 3CHPA 3O4OB 4IDLA 4QRSA 2M2DA 3ZE1F 3OX8B 4OJCA 3M17A 1MQKH 5DD1L 4DUWA 4A2HA 2AQRA 5E2TL 1CG9B 1VGKB 3WJMB 4J6RL 1BLNA 1E4XL 4YE0A 3JWOL 4XCYA 3ZSTA 3ETBF 2A4EA 5H94B 4NJ9L 3MROA 5ISZA 4WU7B 4YAQB 1INEH 4G42A 4JFWA 1G7IA 1BBJB 1J0JA 2WLIA 1UQSB 1BXAA 5FYLD 5CGMA 1DBJH 2CUHA 1I4FA 1T22B 1U36A 1UHVA 1HNFA 1ZSHA 3VSVA 3SJVA 4X50A 1CUOA 2F61A 2IVFC 4Y1SA 1CXKA 1NCAH 1IT9L 1G6RL 2Z31C 5EUOB 2IH3B 2V17L 2DIBA 4ETYA 4KITB 2ZP9A 5IW6B 3QZLA 1FNSL 5FX3A 1RVFH 3G6JF 4G8FA 4U6YA 5DJCB 3MRBA 5GS0C 1LO2H 3RZCD 1M1SA 3B6SB 5KSVA 1WFUA 1OWWA 1T2QH 3L5IA 5BZXA 1XGTA 3EO9L 3HZMB 2V2WA 1X9LA 3IDNB 3MXVH 3TF7C 2OMVA 2HKAA 1FCGA 2NY6D 4A55A 2CUAA 1MCFA 2YA0A 2ZJSL 3D4CA 4LCCB 5D72L 4AQEA 3GLZA 5AZ2L 5AAWA 1V10A 5F6IC 3LKRB 4YIQB 4BFJA 4NFDA 4L9LA 4BCZA 1KBKA 1KEMH 1H15A 1QPPA 4QHMB 4NM8H 2A1WL 4WFHD 4JO2L 1FRGL 1KIRA 3CWGA 3MUGA 4QY8B 2C3XA 3SKNB 2PPAA 4E42A 5ENWA 1HKLH 3BP4B 3KLKA 4YL9A 3ZIMA 1AXTL 3B9KA 1LEKA 3DJTA 3O6FC 1IV8A 4KY1L 5AOKA 1UWXK 4BBWA 2QPFA 3FUKA 3INOA 2BSRB 1TKWB 3STBA 1NDGA 4RDBA 2VB5A 3FB5B 2X4TA 2D9CA 2AK1L 2X6BA 4AEEA 2PW1B 4FXLA 4G8AC 1OSZA 3PABA 2D0HA 3MUHL 5AAWC 4POZD 3A24A 2NY5H 4URKA 3IXTA 2BXZA 4AE1A 2Y07L 1T20B 2ERJC 2ZAHA 1CU4L 1QRNE 4R7DA 3NFPA 5F96L 4UYPA 3QDMB 4PVMA 3RUGE 4TNFA 4A1RA 1N4XL 1OAXL 2RIKA 3B9KC 4IIZA 3IK2A 1XT5A 1MVYA 1FN4B 2ESVD 4UM8B 1MRFL 1O75A 2CBQA 4P4KB 3PIQB 2EXYC 2BLFA 3WCYA 5GS3A 3V9FA 1A4JB 3JWNC 4FNLH 2XTJB 1NFAA 3U36A 2H1PH 2R0WL 4BIKA 3P9MA 4PGEA 1L9MA 2OMZB 4YBQD 2ILLA 3Q3GB 1L9QA 3CU7A 2KC0A 5GRWA 3GUTA 3QPXL 2IWKA 3EBHA 4PLJD 4B27A 3S96A 5IVZB 4U1JB 32C2B 3ARDB 4KXZH 2VO5A 4EUPA 3K1DA 3CXDL 5FFLA 5JLZA 1YN7A 2HSIA 1I8IA 2J8UF 1D2PA 1YDPA 4U1SB 1YCSA 2XG4A 5D7IE 3VXNB 1A3LL 3TO4C 4JVWA 2F5BH 5E6ZA 2A4ZA 5HGHB 1XXFC 2V5TA 2XZQL 3OAYK 1PZBA 5I18H 4X4ME 4PJIE 1FIGH 3KL0A 4H8WC 3MOBH 5EU4B 4KPHL 2V33A 3GUFA 3THML 5F70A 1DLFL 4X7TA 4EQ2A 4DUVA 3O4OC 4JM2D 5IW1A 2GK0B 3K4AA 4JX0A 4DOHB 5D7LA 5IROA 5F1KC 1TDQA 1OAZH 1KBVA 4W9KC 4P2RD 1KPVA 2IG2H 2FECL 2VDOL 3Q7JA 1JXGA 5DZVA 5FA4A 3JTSA 2MQ0A 3A23A 1H6TA 1AJ7L 1PY9A 2DIEA 1O6SB 3QUYA 3V4UH 4EAEA 4NO5B 3LN4A 1Q94A 3M86A 3HE7D 4K3EH 5EUKA 1OGSA 1ZWIB 2YAEA 3TBSB 1E4XI 1SOSA 1HXKA 1UM6L 1LMKA 4NQEB 3UROR 4YHKL 1U58A 2FH6A 3GXPA 2FEDC 5B1JA 4AMKL 5EA0H 2DQJL 4LAJH 4BSWB 1QW8A 2DWEB 2EIMB 2Q2EB 2XV0A 3FTUA 1HS6A 2C9RA 2ZXBA 3I84A 3DI2B 4JRWA 2DM4A 3BD4A 3KWWA 2PW2A 3WKYA 3H3PH 2YUWA 1JFQL 5ALCL 1F45A 1YNTF 2BSTA 1T21A 3QO1A 2ZZUT 2Z7UA 2YD2A 2EVFA 3W81A 3QJTB 2EKJA 4CMMB 3MV01 2ED6A 1UM5L 4LCCC 1TU2B 3I6SA 4RFOH 3UCRA 3QUYC 2E8ZA 2B4CC 3MQIA 3QG6A 2XZZA 4K7PL 4ABVA 3VXTB 1LQSR 5D96B 1D7CA 2FVNA 2R69L 3IFNH 3KGTA 3QH3B 2UWEE 2WOBA 2VN4A 4B3EA 4OH2A 3FRPB 4IDJL 4TVSa 2W0FA 1DQTA 4FG6C 3DUSB 4KHTH 2VLKA 1FZKA 2BDNL 2ZIDA 4OGXH 5T3XD 4ZAKB 3IFLH 5EO1A 4HBCH 3MV9B 5EUOF 3SDYL 4JANB 5B38G 1UWGL 2YSSA 3GK8L 4KMTL 4W4NA 4U3HA 4WWKB 1HL8A 3MRCB 2DOCA 1ZMYA 4OLXL 5CZXC 2VXQL 3ESUF 2UZIL 1XCTB 1DLHA 3UEZA 1B0GA 2Z35B 1QLFB 4JPVL 3JWDC 5E2JA 3BKCH 2W9EL 2IQ9L 4MASA 2OL3A 5DHDA 4Z77B 1FNEA 1T1WA 2G3ZA 3HI6H 2Y7QA 5D6DC 2VZOA 4RESB 4LEOB 5GGVY 4WF7A 3DJRA 3OZKA 1AXIB 1Z3GL 4X5LA 2QHRL 3W11C 3VRIB 1KCRL 4B41A 3MJ7A 4H2AA 4P4KC 1UFUA 1I7UA 3GSQB 1B3IA 1IAKB 2DI8A 4F37F 2Y6SD 1WV7T 3W82A 2K0RA 2XTJC 3C8KB 4UOJA 5DEFB 3QFGA 1CTMA 1ES0B 2Q76A 3NDYE 3U9PL 1RZKC 4ZO8A 4N1EA 4FTVB 1IIKA 1VF5C 2PP9A 3QDAA 1N7ML 4HT1L 1SOQA 4R0LB 4KMLB 5DJ0B 3UBGA 3M45A 4NQSA 4XPBH 4UTBA 3WTUA 1S7UB 3ARDC 2IANE 3LMJL 4PJ9D 5SV4A 1HHIB 1RK0B 3VO0A 2ZONA 3EJZC 5EH1A 1G9NC 4LPCA 1P4UA 3L6FA 3RZCA 1T5KA 3CDYA 4KAQL 4PRPD 3LB6D 5KVDE 3NCYP 1NGZA 1BMWA 3RU8H 1CFQA 3N85H 5I6LA 4G9DA 1BOGA 2K4AA 3RAJL 4HUXA 4MWFA 4ENEC 5DSCB 1T5WB 2GTWB 1UM4H 2NZ9C 1DJZA 2JCCE 3N40P 3P2DA 1X9RA 3WNMA 4WHTA 1HINH 2X3BA 1BD2E 4U7KA 3EFOA 2WLHA 5K93A 1UZ6F 5C0JB 3CC1A 2FQGA 4XNZB 4LCYB 4QRFA 1QBBA 4JFEB 1HESA 5ESQA 3HMXH 3TCLB 4I13B 3VB9A 4NZRL 3ARBC 4XVUC 1UD3A 3B7TA 3V5KA 4ZTOL 1CFSB 1AD9A 2CDFA 4OJEH 2YQBA 1FL5A 2BINA 4ORGB 1NCGA 5GGSB 5KVGE 3IB4A 1OZTG 2GUOB 4GKNB 3VI4E 3PREA 3BMVA 1R4XA 3LRSB 4ZMYA 2QADD 4PJXF 4JRXD 1KMGA 5CUSH 2XOTA 1ACYH 3FTXA 4JN1H 1KLFA 2OBGA 4PGCB 1T3FB 1KN4H 2FECI 3DBXA 3K8LA 3ATAA 3QQDA 5CJXA 5T8IA 1DQQB 4UINL 2E56A 5ANMB 3EF4A 3FK3A 2NX5E 4XMPH 1IFRA 1VFAA 1FFOA 3QQ3B 3V79C 4FA8A 1CGWA 1NMAH 4KROD 2ESVA 5L2KE 3DX4A 2YR3A 3N06B 5LQBL 3GXDA 3WBDA 2EEBA 4OU3A 2PPCA 1G9MH 4HJ1A 3VU1A 4AITA 1CT8B 3VMNA 3OKKA 3DECA 1NCTA 3CVCA 4EN3B 1UOLA 4H8UA 4YSCA 3ZKNC 5C08B 3V5HA 1T66D 2AI0L 4AOFA 4TF4A 2ENJA 3TYFA 2IH1B 1YEHH 4R97C 3TBTA 5J11B 4LRNH 3ZZ1A 4X5QA 4MZIA 3S5LG 2C3HA 4ZFZA 3HZKA 3KG5A 4Z7OE 1FVCA 2ZXEB 3S5YA 4N2GA 3C8DA 5EBLB 4LEXL 5IF0B 1J1OH 2DBLL 2I9LB 3HRPA 2WUBL 3HI1B 3ML9A 4APQA 1O7DE 2JE8A 2VLLB 1CQKA 2P43B 5BZWB 3EOBB 5DT1L 1XH3A 2VABA 4H0GA 1N59B 4EXKA 3FAWA 5ICYA 1JFHA 5KVEH 3ARTA 2OCCB 3VJ6A 4JM2A 5T1KD 1RIHL 2J6EH 3SE4A 3W57A 2I26N 3JV6B 2BH0A 2WZ6A 3QB7C 4AH2A 3NYKA 4JFQA 1F4AA 4ONHA 1SLUA 3OKNA 4XB7A 2NSXA 4P2RA 2LLGA 4TUJA 1WCBB 4PRHD 1VIWA 2CUIA 4O51B 2DWDA 1N8ZA 3S37X 5C0AE 4P48A 3ZO9A 2P8LB 4X6EB 5C70A 2M83A 4FXTA 4WFED 2HLAB 2ZP8A 3IFOB 4APQC 3VH8G 4HF5L 3GFUA 1P1VA 4RCAA 3WOVA 4NZTL 5DLLA 3HE7A 3JZYA 3UGXA 1NAMB 4K5LA 1XMEB 1LO0H 4R0LC 5FAAA 2FO8A 2W91A 3CSYB 2WY3B 4H5SA 1QO3B 4ODWB 3OJDA 4ESKA 3ME0A 3ROOA 4X99A 3PFUA 4RMQA 5HHQA 4P9HH 3A4AA 4KGJA 3TT1H 1RJLB 3BPCA 1ESOA 3QJVB 2GFBB 3D06A 4MJHA 3MRIB 5ICUA 2VYRE 5DVNA 3R8QA 4YDNA 2D4FA 5GGVH 5LG6A 5JIMA 2GIXA 1MNUL 5ALBH 3KDPB 3CE1A 4NWUL 4OCYH 3PQYE 3QNXA 4RWHA 4FFYA 1NMCB 5HD8C 3QG7H 3H9HB 4G5AA 2WNGA 3PAYA 4HXBH 1TZHA 3C08H 4DZBA 3AQDA 4K7FA 1KCLA 5FUOH 1WVZA 3LKOB 4XPTL 5IMLA 3KMDA 1OF0A 2F58H 4WI7A 3RY4A 3SPHA 2C4FT 5AEAA 3DPBB 4QAWA 5ITBL 1J11A 4XNZC 4AY0A 5C0BE 5K9KB 1KCUH 1ZEAL 3FN3A 4ONFH 3M1CA 4CA4A 4OI8A 3DJ9A 2JKTM 4JHVA 5HHNA 3ECBA 1MW2A 1Z9NA 2AAVA 3KXFB 5JDSB 2FQFA 2GC7C 5SX5H 4L3AA 1S9VB 4LSPH 1T0MA 4GRMA 4PB9H 5CLZA 2R1XB 2WGNB 3MRGB 4BFFA 4AQ1A 1DR9A 2HN7B 3F12A 5L2JB 2ZX6A 4O02A 1GGIH 1AG0A 5FFGA 1OK8A 5FXCH 3CUPB 5I1IL 2UXFA 4IIQA 4DIXA 1BVKA 1NCCH 1Y0LA 4OLUL 3T0AA 2B2XH 3KPOB 1IBDA 5D71L 5G5DA 4M1GH 5IFHL 4GYBA 4C58B 5C9JB 4M3HA 3C60B 5IB4B 4U2YA 4KRNA 5C6TH 1YYCA 1S3KL 3Q0HA 2HT4D 3CFCH 5B3SB 4Q14A 4YGAB 3GHBH 2O61B 4XC3H 5E5MB 1M71B 1AOZA 3P3TA 4PJDA 3DGGA 3QCVH 3C5SA 1T2XA 1JPTL 1OPGL 4FHJA 5E7FA 2Q3ZA 2VSDA 2NNFA 1IGTB 4IRSB 4BH8A 2VN3A 3RP1A 3S36L 4UT9H 4PJBF 4F15B 4JFTA 1AO7B 1H3UA 2QKSA 4X6FB 3VXUA 1A1NA 4AJ0A 3EZ8A 4EN3C 1CLYL 3EO1A 3HPJB 3MN8A 4DP9X 2BOLA 4DGYL 2Y7OA 3DUUB 1OTSC 3C9NA 4FEIA 1GIGH 4NIKB 3TX4A 1GW6A 1U2YA 3A5VA 3OC8A 3L9RB 5AL0A 5C07E 1UJ3A 4KI5D 3V0JA 4KQ3L 1YEJH 4PJ9A 3ZIYA 2EDRA 3BIKB 4HISA 4OQTH 5J9PA 1KLGB 2C8NA 3MAWA 1FH5H 3PV7A 3MFFB 4RIRB 2E5EA 4PRPA 5GIRB 1XGQA 3OQ3B 3IMBA 2EADA 1MREH 3BE1H 4WIQA 5GRVK 4OGAC 5AYUH 5CU9A 3ZO0A 4MZ3A 3X12A 2OQJB 3Q13A 5HHMD 2H32H 3GLDA 1LWHA 1JF6A 1ZAGA 3B7SA 4CDHA 4NP9A 1QR4A 1IQWH 4KKQA 3K5RA 1AKJB 2NTFA 4R83A 3CNKA 1A1OA 5I66A 3PL6C 4WV1A 4Z5RA 4FFTA 4A7QA 1WZ1H 1ILSA 3K91A 4LNRB 5ADPH 2CNYA 4DF9A 3GMLB 4RETB 5B39G 7FABH 1TQVA 3EUDA 3SY0B 2XZAH 1YC7A 2Z92A 3KW8A 1DQLL 25C8H 1IC4L 2XQBL 2YEVB 5J6GB 1SRDA 4KUCF 5LCVA 4JEGB 2B5IB 6FABH 3ULUC 5I6XB 2G3XA 4I85A 1A7QH 3L3IB 1SEBA 3N0PB 2QQNH 2FBJL 3F84A 4UBDD 4R5TA 3QDJB 3IU4L 4JRXA 9PCYA 5EC2B 5CLYA 1ZTMA 2ITCB 2VDNH 4PR5A 4CVWA 4IBUA 3VXSE 3H9SD 4O5LH 4HZLA 5DA4A 1JHLH 1XTLA 2YGVA 3KD4A 5JHLL 4X98B 2QGCA 4XMVA 4WHYH 3WTSA 3UBXI 4PLKC 4APXB 4BSJA 2VJXA 3GXTA 5BUGA 5F93C 3NH7H 1T4KB 1FC2D 5HHXL 1Z9PA 4YLBA 5CZRA 2DD8L 5E6YA 4YXLH 1N3NA 4HSCX 3FUMA 1E9PA 3CHQA 1KNOA 2UXGA 3DJZA 4J3OD 2CLZB 3DBSA 3T5WA 4HIIA 4IRZA 2YXMA 3HCVB 1K4DB 3DVGA 4HXAH 3PHSA 5ETUA 4Q0XL 1BVLB 3TNMB 3OR6B 1W6WA 2A9BA 4LCIH 4OUUB 4RAUB 4ACTA 5KYYB 2WPGA 3IJSA 1ZLUK 5JNYB 2OAAA 3K2KA 1L9TA 1GGBH 1PYWA 1PZ2A 5E2WL 1KGCD 3QIBD 4L4TE 1MFBL 3T6WA 4E9WA 1CGVA 1MCKA 1NGWB 3MYZA 2BRRL 3DTUB 1R5WB 2I5YL 5FYJH 1A3RL 1JPST 2A3TA 2EDQA 1RL1A 3ARGD 5AW2B 1N9PA 1FJ1B 3F62A 4AKOA 1JGDA 1HZHH 2OYPA 4ZOEA 4XXWA 4R7XA 3MGAA 1XCXA 1MF2H 5BW7A 5BMFH 5C3LD 2O5YL 1B2YA 2BHFA 3V8CA 2NY1D 1MHHB 5DO2D 4FKHA 3MV8E 3UAJD 5T1KA 1SQMA 2HJFB 1WAAA 4JN2B 4K8RC 1K6QL 3OJ2C 4IGBD 2KS0A 2HZHA 3C60C 1KLUB 4GSXA 1YN6B 2V9TA 3TZVB 3NIFE 3WENA 5JO5A 3C5JB 5E9AA 4WI0B 4JO8A 2E9WA 4N0CC 4ANUA 4PRHA 2D7QA 2Z8VC 3OKLA 2Z64C 3ASNB 3ETTA 4BFEA 1VCBC 5I19L 2RFXA 1IC1A 4NHCH 2X70A 4Z0XB 2C9QA 3S5ZA 5F3BA 5T5NG 4LQFH 1MVFA 4Q9QL 3QZOA 2Z91B 4IRSC 2MCPL 4NUGL 2IDCA 4Z95H 4F15C 3EDJA 3G08B 1F3JA 4J8RB 3QEUB 3DOIA 4Z76A 4LPUA 1QLEL 1VZGA 4ELMF 2J1ZA 4PI2A 3SGDH 5DLMH 5I73B 3EF7A 3CXHK 1XB3A 4D0DA 1EGJH 4WNJA 5HJ3B 3GZOA 1OIOA 5E1IA 4MAUH 3MRFB 4NOFA 4LQ1A 2R7EB 4M00A 2XACC 4MZ2A 4M7JH 3VE0B 3AT0A 2P5WE 3NOIA 3P2BA 2CJUL 3POHA 3O3EA 4TVPE 2Y4SA 1LO3H 4N22A 1M42A 1U8NA 1ZTXH 2QQLL 3PJNA 3QEGH 4M7ZC 5M95B 5BQDA 2AK4E 3BVNB 2NCMA 3W2DH 3SYAA 4HU8A 2J88L 3SDXB 2WMPB 2VL4A 3MCYA 1BGXL 1P84J 4BJLA 4OLVL 3GEFA 4JFZL 5SWSB 4PRIE 3EYFB 1KGXA 3FT4B 4DKAA 3DVNA 3DX9A 5FF6B 2EVIA 5T33H 1SJVA 1YEEH 5T3ZL 5FYLH 3TT3L 1MELA 3UTOA 5DRZA 2FBRA 4U1KB 1L9RA 1P1ZA 1PW3A 2A7BA 3TV3H 5C2BL 1U33A 2B5IC 3QUML 5I6XC 4ZXBD 3T08A 2ATPA 4PU2A 2X3CA 3WFEH 4JFXA 1IEBA 1U93B 1E9QB 1FL3A 4P04A 1T0OA 4X4XB 4ADGA 3QYCA 4DGIH 2WXMA 3T0DA 1GVIA 1RZIA 3R4DA 3ZDXB 3NCBB 1BIIA 3P77B 4IW4C 5I8KL 4Z3TA 1M6OB 5KG9B 3L3DA 1H3PL 3S97C 1JNNH 2DH3A 3BFOA 5CJOL 3BYYA 1UA7A 3K0YA 4IKLA 3FU7B 5FM5O 4MYPA 4A68A 2XFGB 5L8JB 3DX6A 3T0EB 4ABQA 2JTYA 3PXHA 1JS4A 4JDTH 3FTVA 2J3SA 3AS1A 3GSNA 3IDMB 3MLYL 1IKFH 5MEQB 1AHWA 3IE9A 2ZUSA 3BPLB 5IFJA 5HGAB 1LEGB 5FGRA 1PKQB 3UPAA 5C0FB 3T4YB 5CIPA 2OMUB 5IQNA 2BVOB 1R5VA 2P8MB 3OPZH 3Q1SH 4OF5A 4G1MB 1XGPB 2W95A 4LP4A 5DK2A 3R1GH 3SPGA 4Y2OA 1CFNB 4PJGA 2V7NA 1QYGH 3DV6A 4PV1C 2F8OA 4X8XA 1ZPUA 2WVVA 2X38A 1Z9SA 1OOWA 1F58H 4XVJH 5JXAL 4JFUA 4E0RA 4J2XA 3PXLA 4XH2A 2YPVA 5HGBA 4H26A 3QXUA 5IEKA 1C1EH 4KTDH 5J06A 5HPMA 2WYTA 2YQ2A 3S9DB 5AW3B 4DN4H 3AGVA 3GMQB 2XTSA 3STLB 2OMXA 1YQ2A 4FQCL 3BRFA 3FO1B 3TL5A 1ROWA 4U6VH 4ZDHA 2G2PA 4F58H 3CN0A 1P9MC 1DCLA 1VFBA 3T2OA 5F1SA 4CN6A 5F7HA 1ONQA 3EO0B 5KSBB 3FYEB 4HJGB 1CYGA 3HN5A 2FRGP 3TZVC 5FYKH 4G82A 3CAFA 3QA3B 1WEJL 4ODHH 1UACH 4TV3A 1DQMH 3MLRH 4I5BB 1EAPA 3WJJC 1SYVA 1MJ8H 4R4FL 2VXVH 2YK1L 4XMZA 4ES9A 4MNQB 3C2AH 3MA7B 3L2MA 3GDCA 1O5PA 2PXYD 3QI9C 2ADJB 4FS0A 2DLTA 4LASL 4TTDC 3CQQA 1J0ZA 4P59H 4PMFA 4ADIA 1A7BA 5I76A 5KZCD 3ASOB 2IIJA 2VDPL 4R4ND 4RRPG 1DVFB 3NIGB 2DQCL 3AS0A 3SOBL 3UTZB 2ADFH 2AQSA 1YEFH 4QF1B 3H9SA 4IOFD 3P9WB 2O6DA 4YR6A 3CCHB 2GEEA 2DQHH 5FKPA 4Y4KD 5I73C 1ID5I 4C83A 2DLEA 3EGXA 4KKCC 3BIAX 4L4VB 2AJVH 2DZEA 2E8YA 1U3YA 4ATWA 4W9LC 4PRDA 1CDCA 1Z3RA 4HIEB 4OFYD 2COVD 43CAB 3LYRA 4JFDE 3KYAA 4WEUD 3LKPA 4HPYH 1FG2A 1INEL 4P4RB 4F2MA 5J1TC 4ZW7A 4GBXB 4TSCL 1I9RH 5DZNA 2DTSA 5E8EB 1GCYA 1NAKL 4B9KC 1YZZA 1WFIA 1JP5A 1JZHA 1OCRB 5E1AA 1F97A 4Q4EA 1NCBH 3EYUH 3TH4T 3N04A 4BK5C 5L7XH 4LVHB 4M7KH 3EG9A 3CC5A 4HAGA 4NKOB 5I75B 2TAAA 1V3KA 5FO7A 5TDNB 5D1XB 3VI3B 4B9CA 4EUPH 3O4LE 3QIBA 4UIKL 1XF5A 1QI4A 3RVWD 2GC4C 2JXMA 4N2LA 2N3JA 4FOMA 5CKGA 4X7EC 2A73A 5CP7A 2F74A 2XX0A 4TSBH 3TBBA 5CEZH 2HVKB 3S4SB 3BZEA 3ARGA 4P05A 3WGVB 4FA7B 1T2QL 1SLVA 2R0KL 2XQ0A 4L4JA 5ACZB 4PV8A 3O41B 4HWBA 4HWUA 4M3JA 1WAPA 1KJ3H 3QJQB 4QRRE 3NIDE 5FCSH 3MXVL 3WLBB 1S78C 3DDGA 1LE5B 1G94A 4FHBD 2WUCL 3AJ7A 3K8MA 2DTML 2MKLC 1FL6A 1Z1WA 3UAJA 1NIEA 2WQWA 2O5XL 3F7YB 3I2CL 4XTRC 1MI5B 1JN6B 3MYJA 1PNDA 3IRPX 4IGBA 4LSQH 4OIAA 4AYID 5JORB 2B1HH 5HHPB 1KEML 4JQVA 3T8VA 4B9PA 2Z4QA 5IVXE 1NL0H 2WWOA 2G2RB 3K6SB 2VDKH 3KE0A 2KHAA 1YYML 1R6VA 3LOWA 3U4BH 2YD4A 4N0UA 1MCCA 1MEXH 3FB6B 1QFWI 1WBYB 1Z6JT 1BQKA 2Q6WA 3SDXF 3Q06A 3FOLA 5KS9F 1NIDA 3MX0B 3HUJA 3LQZA 4GIOA 4PYHA 5E4AA 4MXWL 4ZZFA 4NNYA 3L3OA 2CPCA 2D03H 3IJHA 4U3CA 1DEEB 3BPLC 2OMTA 1WWBX 1XD0A 3NFSL 2WGXA 1IGFL 1BF2A 3ALPA 1I8KB 2VL5A 3QSKB 1PX3A 3H7BB 2ICWA 4BRVA 4ABWA 3NUKA 2GJ6E 4JQVC 1WTGT 3G3LA 2ETWA 5IJCC 5MERB 2CHWA 4HHWA 3BLPX 2WO2B 3P9LB 5IKCA 4C54A 5AFAA 3POCA 4AJVA 2XQYG 1FGVH 5FK9B 1DBKH 1DSWA 4LLMA 1PIGA 1CE6B 1HSBA 4LPVA 3CMOH 4AM0A 2XRAH 1BFVL 3MUY1 5ILTH 1IGCH 2EC9U 3UC2A 3LTVA 1IBBA 3BAWA 5EFIB 4K3HA 3JWDH 4B53A 3NZUA 2GI7A 1U3HB 4FNLL 1TG8A 2H1PL 4JQIA 1DANU 3PWJB 4JJ5B 4WHYG 5LAXB 5BJTA 2B59B 1PD1A 4HUNB 4RMTA 3DC0A 5I17B 4KKBC 3Q8BA 3RWGB 5A2AA 4PH8A 4WY7L 1A4CA 4JRFA 1D5BA 4MCZB 2UUDK 2HFEA 2O93L 1MIMH 2ZG1A 1SVZA 3HG1E 3LSOB 5H2BA 2R2CA 2MOGA 5D7KD 2XWJB 4GAFB 4JO4H 2OMNA 2F5BL 4ZXBA 1BAGA 4EDWL 1DJSA 3MJ6A 4KZDH 3VA2C 4OCWH 3J8F7 1MJJB 5GGRA 1B6UA 3RNKA 4UYQA 2YXFA 1D6EB 3ULSB 1JERA 2DQGH 2IQAB 2J25A 4TVUA 4E41B 5JQ6H 3PJLA 2EDKA 2OL3H 3LQAH 1F11B 3HFFA 4NXKA 1UKSA 2X4QB 5EZPA 4YPGA 2VAJA 4DVRH 2R9HC 4P3CH 3RWCB 5LBVA 4PJHF 3I02A 4L3EE 4XX5A 3QFJD 4Z7WF 2XFXA 1OAZL 1X7QA 1FORH 4QCIA 2EYRA 3AXLB 1PTZA 2JJSA 3QEHA 3H53A 1CDJA 2IG2L 3C6LB 2WNXA 4MX7B 3P73A 4HX1A 2JB5H 2OZ4A 2BSSB 2W9DL 2ISDA 1YYLH 4GBXC 1UUNA 3U1QA 3HN8A 5F7BA 4LGPB 4TXVB 1D5ZA 2OTUB 5DJ6B 5CCHE 5AZUA 3QRFM 2ZTBA 1NFDF 5AVRB 4DGWC 1J5OH 2ZCZA 4NHUA 3PGCA 3HAEB 4LVHC 4UTBH 4K3EL 4QT5B 2K4WA 2X10A 2PO6B 5GRUL 2X28A 4OZFA 3RHWK 4CU8A 5I75C 5D1XC 2ADIA 1J05A 5TH2A 2VN7A 4GEIA 2R29H 4YK4B 1J48A 4W9EC 3L4UA 3G6DH 3ULVL 4LKXA 2C7UA 2AXFB 5F89A 3V6FA 4L8BA 1CGXA 3NIGF 4L0PB 3ABMB 3H3PL 3S3CB 3EXLA 3UZQB 4AQ8C 2I9TB 2XJLA 4A2GA 2VR4A 2BSBA 5EC1A 1TTUA 5I71B 5AZEL 3TEZA 1J9RA 3E6HA 4UMSA 3MACH 2VCOA 5B1KA 3G6JA 4WUUB 1U91A 2VJ0A 2YGNA 4R5VA 3IFNL 1A1MB 1BCIA 3RDTB 4L0YA 1T1ZA 3DKHA 5GS1B 3I75B 1AGCB 4YSOA 1YMME 3CVHL 4K23L 4EDXB 1SHXA 3A47A 3QQ4B 4PCKA 1RIVL 4DN3L 4YVUA 3MRJB 1JV2A 2QZ5A 3O6MH 1PX4A 2IPKB 4GLRI 4KHTL 2XN9D 2ICEB 3IRZA 1I7TB 5F7YC 2Q8AL 2OSLB 5E8OB 5D70H 4KJPC 4HBCL 4ZFOL 3A67H 2N01B 1OO2A 2JQZA 5CZVL 5DQ9A 5MENE 5I6MA 3VI3F 1JWSA 1RJZB 2PXYA 3ECUA 4U3SB 5BPPA 1RPUA 4JZNA 2AGJH 4NZ8A 2R8SH 3NJJA 1IGJB 4G8EB 4PJIB 4ZTPH 1WE5A 3KPLB 4XVSL 5AG9A 4NCDA 3M6DA 3NABH 4QWWD 2DWTA 1FHGA 3BVTA 4RLDA 1T03H 1WK0A 2DM3A 1KB5B 2KDYA 2WSPA 4Y4KA 4ZMTA 1VLXA 1X3DA 5I1EH 2BO0A 2CHXA 3MZGB 4NKIL 4XP1H 3G5YA 4ACPA 3EYSL 3GIVB 1DO5A 3HI6L 2OYLA 3GMMA 4MMZB 3GB7A 4OFYA 4A7TA 4IHOA 3WG7B 3UYRH 4JUTA 4JG5A 12E8H 4HKJB 3U0TB 1HHKA 1JZ5A 4FABH 2OFQA 4NQUA 5JZ7C 3AU1A 4YE4H 4XP5H 3L8QA 5TFSL 3BQUB 4WI4A 1J8RA 1MXDA 2DAVA 4JW3A 4JCMA 3EGSA 5AOMA 4WZ9A 5IJKA 3QEQD 1U3HC 3N9GL 3RY6C 3LS5H 5AL8A 2BVUA 3X14B 2GW5A 2EXSA 4LEBA 4MB4A 2KH2B 2RB8A 5KYWA 2H9GB 1OHQA 1BF5A 5EO0B 5DHVB 1H3XA 1PLBA 3US9A 4XPBL 3IJEA 4OZIB 5AOZA 3FRUB 4V1DD 3ZL2A 1HCYA 4HUWB 2PCPA 2YWZA 3TTYA 3CDZA 1YMHA 4DHLA 3AY2A 4Y16D 5KVMC 2EE2A 3K74B 4XMKL 3FFCD 2WYIA 5JIHA 4L8SA 4KRPB 3P02A 1O9ZA 1LL1A 2VT0A 5C71A 3S8FB 2YD8A 3N85L 1FVDB 1O9WA 2UVFA 4KK8C 2YSTA 1MPAH 3FL7A 2L3BA 3DARA 1FNGA 1UM4L 5B7MA 1IL1A 1U9KA 4D94A 1HINL 3B1TA 4KXZI 1W16A 2YD3A 2EH7H 4I1RA 1HIMH 4LSDA 5ITFA 4MYWB 3X3GL 4B3VA 4A6YA 2ZD0A 3OKOB 2R56L 4CADA 4FZ8L 2AZUA 3X11A 2HPTA 1IAIL 3B9VA 4Q2ZA 1HZKA 4Y4FB 4X8JA 4OGYL 3EH4B 2V3FA 3WXWL 4AQZA 5FECA 1CXLA 5FHBH 3C6LC 2Q2LA 3ESNA 3VFMA 3WD5H 2YC1B 3F7PC 3Q2WA 5C86A 3Q2CA 2D8KA 3T2QA 1HHJB 4LRIA 3AADB 4JG1H 3HZVB 5L9DL 1QUNA 3EBGA 1S7RA 1G0XA 5EU6D 3LIZH 2DJUA 2OM5A 1W9XA 3ZHFA 3LV3A 3TIEA 4U1IA 4XVOA 2PO6C 2CUMA 1ACYL 5HHVH 1MCJA 4X2UA 1OTTD 1HEZA 3IXAA 1GYWA 4J28A 4LLVA 2PCFA 3OLDA 2BVYA 2J44A 4PJFE 3TJPA 1P6FA 4YK4C 3QIWD 2DBJA 2EIZB 4Y9CA 3T0XA 3L3KB 4XMPL 4YFLF 2K70A 2EVHA 3PWNA 4FFYH 4OFDA 5E6ID 2NY2B 3M07A 1UEYA 3APDA 3GXUB 3LXBA 2EACA 4OIIH 5ERWA 4AZ8B 1N10A 3OR7B 3PJSB 1KC5H 4ZAKD 4HCGA 1G9ML 1KB9K 4ZZKA 5E00A 2HYMA 3SYCA 1LXMA 2X2JA 1Q9KB 5TQ2L 3QUGA 3PAZA 3HE6B 4XPFL 1BJ1H 4FNPA 4P9MH 1ORQA 1PDKB 5DD3L 4WWKD 3GT6A 1HILA 3F58H 4F2EA 3RDTC 2IF7A 1YEHL 2BJMH 1JGUH 1MCOL 1X6LA 1TZOA 4LK4A 2MFNA 2XI9A 4LRNL 5K39B 5C0IB 1YNTA 4S1DC 1M9WA 3ESVF 2IH9A 5F9OH 2V2TB 5E0FA 3EYOA 5EZJA 4EBQH 4O02H 1J1OL 2XKNA 1UCBH 1IUZA 1FNHA 3GLAA 4S1SH 1S7QA 3IFPB 3KM1A 3M1BB 3N6YA 5HI3D 3SQBB 5H94A 3MRNB 1E5AA 1TMCB 2EDWA 3DV4A 2CR6A 4GH7B 1G6RA 2ZP0T 4EUPG 2JCCB 1H0DA 2WXNA 4WEMB 3CN3A 1E7VA 1VADB 2BCKA 2GI0A 3GSWB 3RUGF 1T22A 2A9NH 5KVEL 3ZDYB 3ZTJH 2L7JA 3FCSA 2FD6H 3PLYA 2V8MA 4K5MA 5E9DD 1JV5B 2J6EL 5FC9A 5GJSH 3GO1L 4NBXB 4DP7X 3FQ4A 3GD1C 4QJ4B 1T83C 4NO2B 2ZXDA 4DCQA 3QFJA 4NKQB 4P49A 2YUZA 3P54A 5AVSB 3VXMB 4FTVD 3JWOC 4MMZC 4AQAB 4UQ3B 1TYEB 1EMTL 5D1ZD 1T1YB 4ABUA 2H0JA 1X5JA 3ETSA 3UAFA 4XB3A 3V4LA 1C5DB 1D5XB 4N3UA 3VI4B 3BAEL 3BQUC 2I60H 4OCXL 2OSYA 2A6JB 3U1SH 4N0FB 3GC3A 3R7QA 3V95A 1B0RB 2YBGA 5D7IF 2KT6A 1LO0L 2BNQE 3MO1B 3QIUC 4PGBA 2ZXGA 1CGSH 1HNGA 2OXHB 3V7AG 5IJVA 2QKIA 1QX1A 1SOXA 5DJZB 3FB8B 3S3JA 4R9HA 2EXWD 5B8CA 3VQ1C 4YSSA 3HB3B 3FO0L 4DZ8A 3LPPA 2E6PA 2NX5B 3BAYA 3CX5K 4P9HL 4PJIF 3OKDA 5GRZA 5INCB 4BV1A 5GZOC 3ULUH 3TT1L 5LXVA 4H25B 1IKOP 2K7QA 4JY4A 3WN5B 2NYZA 4JFED 2O72A 4JMXA 4KRPC 5JOFB 5GGVL 4ES8A 1KXTA 5ALBL 4OCYL 3KH3A 4LMQI 3CZEA 4G2AA 1PQZA 4HXBL 1R3KA 3EBAA 3C08L 4P3DB 3SPCA 4KXBA 5FUOL 1GCFA 5FKAB 2F58L 3ZK0A 3EJPA 1ASOA 1IZKA 4MSWB 2YD6A 4D0BB 4NPKA 2PW1A 4UV7H 4OIBA 3BKYL 4WW2F 1KCUL 3MUUA 1I1AD 3KYNA 4Y4FC 5DJAB 3IMRA 4LCWE 4Z7OB 3L48A 3N2JA 2XN9A 3PYCA 5DQJA 5LCVH 5J6HA 2HH0L 4F57H 3OV6A 2Z3FA 2XCMC 3LKSB 5A43C 1P4LA 2AJSH 1T20A 1X5MA 3TGXA 3LH8A 3VDBA 4JPWH 5DZJA 4PB9L 2YAHA 4NPJA 1EWHA 1AI1H 2X3AA 4YLCA 1UOKA 2XBZA 4FG4A 3ZRCC 4X5WB 3GMRB 2RH0A 1CN4A 4H44C 1IAII 3ABGA 4ELDA 3PPEA 4GP5B 3LZFH 3Q5TA 3CSTA 1A4JA 4GAAA 3BZFB 3MHZA 2E7CA 3F01A 1HXMB 2DI9A 2UY7A 2O30A 2VN6A 5C6TL 3VGBA 1BJ1J 2FWLB 1YPZA 1S8DB 4QXUH 3CFCL 3TWCH 1A22B 3RX5A 3GHBL 1EDHA 5ID1B 4KUCD 4OCRH 4NKDB 4KZEH 4O9HH 5IHZB 2Z7ZA 3I50L 1IVTA 1FNAA 1WWCA 2ENSA 2NY2C 2QVIA 32C2A 3CSFA 2AQ1A 2FZ3A 3QXVA 1UXSB 3E6FB 4PJXA 3BP6B 3T04D 1ETZB 5IG7B 1IB5A 3CX2A 3KGSA 1T2JA 2WCPA 4WJ5B 3U7YL 3QEQA 1BYNA 3RVVC 3PG2A 2YZ8A 3EADA 1FA4A 2A6DB 2F7RA 1CGTA 3WIFB 3HE6C 3DMMB 1I8LC 2JSFA 2IDSA 3MV11 3BQVA 2OCJA 3ALWA 4LARH 3UG4A 1JPSL 1DJXA 1YEJL 4P2QE 3KPRD 4HIXH 4V1DA 5CN2A 3FCTA 1S5IL 4Y16A 4XHQA 3FN9A 3PUUA 3WIHL 1EFXB 3O0RH 1NGYA 3FFCA 3DVFA 3CFJB 3BUIA 4JM0A 5AKSA 1UT9A 1MREL 3BE1L 1CE1H 4WI9A 4HJIA 3QR1A 4GRWE 2R2EA 4WFFD 5D6CA 5IBLC 2KL6A 3Q44A 4HS6B 5JOPD 5EZOH 3B56A 3D2UB 4ETQB 4XNMB 3LZLA 3S3SA 1CXIA 2M1KA 4OSUL 3ZDZE 4F7PB 3HR5B 3PDDA 4G71B 3WKPA 4JR9H 1NOAA 1KYFA 1SHMA 4I1NB 3TPUA 1ZE3C 2BMKA 2EDHA 4IEFA 1OT4A 3IETB 4NWTH 5ADPL 3UERA 2NDFA 4XP4H 3HBPA 1CR9L 4KK5D 3IMUA 1M7UA 3F6IA 3VXPA 4QTIL 2XZAL 4BSWA 4XNQB 1X7SA 3TNNA 1ASQA 5B3NA 4M56A 4YHMH 4TLSA 4LDCA 6FABL 4DQOL 4IBLT 1G7HB 5JW4N 4QRTB 1VENA 2X2IA 3IS0X 2BZCA 2QQNL 1W2KT 2P7TA 5EU6A 2FATH 1A6AA 4X6BB 2WAHA 1NGPH 2R69A 1F4XH 3GJEB 5F1NB 4OZHE 1MFCH 3HS0B 3RHWF 4PJCE 2P48B 4G9FE 4WEBL 2ZCKL 1IC0A 2P45B 4X42A 2D7MA 3SSGA 3QIWA 3HB3C 1TT6A 2C3VA 3LZNA 1XCQA 4KOBA 4LF3B 3WLWD 3BISA 3NH7L 2DWSA 2JCCF 4WLCA 3R7RA 3UPRB 4Z7VB 4DFHA 5E6IA 3T2LA 2LU5A 3KPTA 5LAPA 4IU2A 3N44B 3IU3B 1UWEH 4ZAKA 15C8H 3CQFA 4M8UA 5EWIH 4HXAL 3V6OC 2QV4A 3MRLB 2AEPH 1JZ4A 1BFOB 2PWFA 3BKJL 4DESA 4Z23A 2FLMA 2NPLX 3IWUA 4N6RB 1DFBL 2EICA 4OD1L 5DFWH 2VAAB 1M1XB 2TRHA 4PTUB 3K4ZA 4WWKA 5I0ZA 5KBPA 4GUQA 3GKWH 1GGBL 4M8RA 5C07B 5E70A 4K3JH 4ODTL 5FHAL 4P5TB 5D7HA 2WVUA 3VI4F 2FIKA 3B5HA 2AXWA 2D3LA 3C87A 4FMKA 5G2NA 5FYJL 5CBEA 3D4GA 4Z77A 2FQDA 5F7UA 1LDPH 1OK0A 3WAKA 4L1SA 3VVWA 2LTQB 4B60A 1AD0B 3EDKA 3UGEA 3WNJA 2OV0A 3T4AC 2J21A 1MF2L 4YEFA 5AD0B 5BMFL 1A4KB 1IQDB 3FT2B 4F92B 4E36A 1PZCA 4MAYB 2K9UA 3D39D 3VRIA 3GTTA 1K5NB 2EECA 5KEZA 3GSQA 3KEDA 4LVEA 4WU5B 5D7SL 1DTUA 5E8NB 5E9DA 5CD3A 4GUPB 1AO7D 1F0LA 2D7PA 5KUKA 3VFRA 1ANUA 4FTVA 1RZJH 1P5VA 3QR0A 3MLPA 1KYUA 3PWLA 1DN0A 4PWEA 3S88H 1HJCA 4CGUB 2N7BA 5D1ZA 3GSNH 4NHCL 2A6IB 1HHIA 3ZT7A 3UBXB 1AR1B 3BWAB 4QXGH 2DQEH 5C3TA 2Y72A 2D9QB 2Z1PA 3V0VB 4LQFL 2F1EA 4PIBA 5D7JB 4M7LH 3QORD 5CIPH 1TETH 2VC2H 4E68A 2QGEA 2AJ3A 1K2DB 4YFDB 4GQRA 4Z7OF 4QOKE 1KZYA 1JWMB 1G87A 2IOMA 1P6WA 2GTWA 1MFAH 3AG4B 2YAFA 3DMMC 5CLWA 2L4OA 1U8QA 4A63A 1AMYA 4UIMA 2ZOOA 2YPVH 1RUAH 3TH2T 3SO3B 2QFPA 1FLRH 4M93B 4LU5L 5FOJA 3CLWA 4JFEA 4MAUL 2B7DT 2HRPH 3A4EA 3QVAA 5IQ9B 4PJBA 4M7JL 4FKEA 1NCWH 2PTVA 1WFJA 1W80A 1CXEA 3SO5A 1NSNL 1UD8A 1ZK5A 3V0WH 4I77H 3WFDL 1DJIA 3K46A 4KX9A 4Y7OC 3R18A 3QXAB 4B6ZA 4LLQA 3QEGL 1O6VA 2H3NB 4Z7UB 5GGSA 4ZMLA 3KPQA 5FWQA 2WIMA 1OOAA 2GUOA 4XP9H 1KY7A 4GKNA 2V5MA 3FT9A 4GP8B 3NTCL 4UT6L 5I5JA 3S36X 5HYQA 4JE0A 4L4TB 3OTTA 4PVLA 3BCFA 1I1AA 4PP1C 2WZPD 3T6VA 4CL7A 2Q8BL 3NEEA 1MCBA 3NZ8B 1F4YH 5SV3A 5HHOE 4B9ZA 3T8XA 3WL9B 5FUCE 2DI7A 5KBNC 1KYOJ 4O2CB 3TBVA 5KANI 2EO9A 3CSPA 1RZ8B 2PN5A 5JHAA 4N2BA 3PWUB 3HBGA 2C9PA 4TRPH 2DL2A 2A4CA 3C5ZC 4OFIA 3RA7L 1WGOA 1UXMA 2WZAA 2F8VA 4FJZA 2DKMA 1ZT4B 3HJEA 4P2CG 3ZSSA 1UXWA 3HS0C 3L7EA 4WI2A 5ABAA 1DCEA 1R46A 4I3SL 1JRHH 5T1JA 1JNNL 4MMXA 3PP3K 1OM3H 4DKDC 4PY8J 3MCG1 1LWRA 5TDNA 4J3OH 1L9SA 4N87A 4XBEL 1UKTA 1N2RA 3VGDA 5HJDA 1WA0X 3QCUH 1RULL 3RQ3A 3WUZA 4UDTA 2DS4A 2WW8A 4JDTL 5ELIA 1IKFL 1R5IA 5FPIA 1BXXA 1WFNA 1YAIA 4AW4A 5A6IA 3ZTJG 2LVEA 4M62H 4S2SB 2EDDA 2LQRA 1RJCA 2XV3A 2EYSB 2JTDA 3Q1SL 3OPZL 3NCEB 2ZAGA 3D85A 3QNYA 3R1GL 3TJEL 2ENPA 4MQXC 3G9VA 1EDQA 3KPRA 1QYGL 4LLWB 4P5TC 2PYEE 5HGDA 5F88B 4AVHA 3P4NA 2P24B 4XVJL 3JV6A 1EO5A 4HWBH 2XV2A 5JOEA 3WFBH 4PS7A 3H55A 3K71B 4HQQL 3D18B 4ZD3H 4TQEL 2WSKA 2Y7NA 1C1EL 2GAZB 4KTDL 2P5WB 1SXNA 4HIPA 5JIKA 4F91B 4BWUA 2DYPB 2ARWA 3TN0D 4DN4L 2LTQC 5E6RB 2ADGB 3BVXA 1FO0A 2P8LA 3F00A 4MCYB 4AM0Q 4MAYC 1AGBB 4U6VL 4F58L 3ZL4L 4F33A 4O2EA 3OJMB 4JM4H 1RZGA 2MJWA 5C0EA 4N0YH 3N44F 1B3JA 1DVYA 1RK7A 4IKIA 3PV6B 4PRIB 4UQ2B 5CSGA 1KG0A 1I3RB 1NAMA 3GINA 1NCOA 4OKVB 5FYKL 5A2FA 1ZJBA 1HX0A 1AHMA 1HYSD 1UACL 2EP6A 2I32A 4Z9KB 3SBWA 1EEYB 4NN7B 1I9JH 3P0YH 4MVBD 5IB2B 1KGYE 1MJ8L 2RJMA 4I7ZC 2ZYSA 4X5XB 1HE8A 4N9GB 5EU7E 4ZTEA 5K1NA 4EE2A 5J12B 3CPUA 1MCRA 4MNHA 2FX8H 1JYVA 3GHEH 3E3QE 3FUJA 5D7JC 2D7OA 2NTSP 3MRIA 4ZS6C 3FT3B 5AB1A 4AXWB 4LDLB 4HBQA 5F72S 1UD6A 4GS7B 5EOQL 1HHGB 2L7QA 4F8LA 1OZUA 2ADFL 4U0RB 3UAEA 4ECNA 4IMLB 2HMID 4XBPA 1L6ZA 5IT2L 2Y5EA 3O3BB 2DQHL 1I7RA 4OLZH 5H4ZA 2VDMH 1CFTB 3OB0H 5C0DA 3GZPA 4WFGE 1OGTB 3SO3C 1LK3L 1U8CA 2C3WA 4M93C 3LKQA 3D52A 3GBMH 4JZJB 2QSCL 2PMZA 5D5ME 3J2PA 2Y06L 5HDOA 3KPMA 4HPYL 5EU5B 2R51A 1FSKB 1EHLL 4FL4B 1I9RL 4JQIH 4LLDA 5D1QC 4KX7A 3JVGA 4ELMA 1ZVNA 3EJYD 1YA5A 1ZTXE 2A74B 2CLVA 2R1XA 1MJ7H 5F3FA 4KFMA 3EYUL 5DXWA 5GGTL 3SGDI 3K2UH 5L2JA 1E28B 5TE7H 2H47C 1H8SA 1O0VA 4M7KL 1PG7H 2BSED 5D8JH 3WUWA 2ZX8A 2IBZX 2AABL 1HL9A 1MRDL 1C8PA 4LKCB 1S7TB 3NGBB 1J0HA 3OL2A 4JPIA 1L9NA 4D8PA 5CEZL 3K80A 1KYDA 4OM1L 2NY0D 1MFUA 2QEJA 3O8XB 2O61A 2WWMC 4BUQA 3OXSB 1JWUA 1WZLA 1GPOL 2OXGA 1E40A 1OCZB 3HEIB 4D3CH 2BOCA 3D39A 2XTLA 4N5UA 3T0ED 1RK1B 3VMOA 2VLME 1BJ8A 5CJQL 4FNQA 5DD5H 5CLTA 2UYLB 5H4YA 1AO7A 1NFIB 3O9WB 2B1HL 4UAHA 1LK2A 4X6FA 4RQQB 3TIDB 5F8RC 3HPJA 2VSMB 2HTKD 4DO4A 4JDVB 3CN1A 3VWJD 3VXOA 1FFRA 4HKBB 4LBEA 4ODSH 5ISZE 4DW2H 1KENH 2OZ4H 3BAXA 3U4BL 2FX7H 5JHBA 3CZNA 3L9RA 3QXDB 4QHUB 4DETA 1NBZA 2VR6A 4IU3B 4OF6A 1V8HA 2XPGA 4MA1C 3MFFA 1YECH 3BUYA 2DY2A 1U41A 2YWYA 3QORA 1W0WB 3P30L 1BIHA 3SDCB 4OZFH 3IKCB 2JQAA 3IVKB 3UTQB 4F80A 3I9AA 4RAHA 1C5BH 2WVSA 1G1KA 1QLEB 4D0CA 1GSKA 1LNUB 1OAQL 5HYJE 4HUVA 4MHHI 2G75B 2JMRA 2GIYA 2HJLB 2YPKA 5DUBB 2A6KB 3QW9A 3D8MA 2C1PA 1QKZH 4NSKB 4ZUVB 2J4WH 3EBIA 1LEIA 1GL4B 2H6OA 1FGVL 2K6YA 2XY2A 3AWGA 1SJXA 1U2HA 5DHYB 3RB7A 4QXTB 3T6XA 4YPJA 2F53B 1SUHA 2W65A 5PAZA 4YHNB 2XRAL 4YDKH 3NIFF 3WFCL 4O4YH 1XQ4A 1MJUH 1IGCL 1P5UA 5B38B 2EIDA 4MNQD 3TS8A 1SDYA 2AXJA 4NJAH 4ALAH 1BJMA 4HOZA 4Z6AT 3L3IA 4RDQG 3UYPB 4XPHH 3VFWA 1S7WB 5GRJH 1OP5H 3O4LB 5DJYB 4QRPB 5JW4R 1RERA 1DVFD 2WZPA 1CDGA 3T1FA 4KXCA 1E65A 1U21A 4NDMB 3LEVL 1DHKA 4LL4A 4IBQA 3L45A 1MIML 1FNFA 1PZDA 3EUUA 5IFAH 5C97A 5F7EH 3O45B 3NJKA 3QYNA 1CBVL 1J8HB 4JG0L 1JF1A 2QR0B 2Z7WA 3JWNE 3OKEA 4MDIB 4F3FB 4QRRB 3EYQD 3QUMB 3NIDB 5I1LA 2D4DA 2WNKA 3MTRA 3SE3C 1NGQH 1XGUA 4Y5VA 1PLGH 3RX8A 4OCWL 4DVBA 5DS2A 3BAKA 4XR8C 1EJ8A 1MCEA 1XR8A 3JT0A 4NGHH 3FQNB 1JL8A 2CO2A 2DQGL 5EB9A 3VFSA 3ZT5A 5JQ6L 5JPMB 4GNKB 1ZVYA 3LQAL 4U0RC 5G4MA 2C1OB 5ESAA 2MHAB 3HZ3A 5IVXB 4DVRL 4U7SA 1F6AB 4LGRB 3UYOD 4P3CL 2W8CA 2R1WA 4JKNA 3VXRB 1ZLVK 1FORL 4FQXD 3VRJB 5FYLL 3SKMA 2A9DA 1A6UL 1KIUB 2LE9A 4LVOB 2JB6B 4UILH 4QJ5B 3NPSB 2JB5L 4DQAA 1KFAL 2G9HB 3NA9L 1R5WA 4FL4C 4LPXA 4BE6A 2IOOA 4ZJ9A 4LFHG 2D0GA 4Y5VC 3H56A 2A74C 4QXVA 3RKPA 2O5NA 3SE8H 4MRCA 4KJQD 4DKFH 5LGJB 1TTBA 4UTBL 2FYVA 3C6EA 2VM3A 3KLDA 5E1HB 1N0XL 1A8ZA 3DXAD 1G7JA 1RUMH 3NGBC 4JHBA 2GITA 4HWNA 1TO5A 4Z7IA 2X4SA 1BQHG 1N26A 1VFUA 2WIIA 4WI0A 4JHAH 3T65B 3TXAA 3F7KA 2X9ZA 1ZHKA 3RTQB 4OAWB 4O00A 3OBAA 5TF1L 3TN0A 3WEMA 4H4NA 4JRLA 4WSJA 1NC4D 1J7VR 2FGZA 4AV4A 2HLFC 4JAMB 3V9EA 1CDBA 2IFGA 2EH8L 4N9OB 4XP6H 2Z7YA 4A6YH 1NMBH 4L5FH 3JV4A 5L4MA 2Z91A 4JFSA 4UTCA 4Z78B 5D7LE 4NRXA 3O9WC 3ETBJ 1JI1A 5IB3B 1DVQA 1QASA 3JZ7A 5GJTL 3VNZA 4CW1B 1JXJA 4LHQB 5TE4H 5C0NC 1K8IB 3UJIH 4Z3HA 4MB3A 4MJ6A 3DHMA 3HG1B 5K9JH 3V7AE 5IWLA 3O6ML 5EF1A 4F1ZA 2QELA 4MQ7B 4OF0A 3VYNA 3IEAA 5D70L 1YEDB 3NJFA 5CINH 1W8NA 2OTPA 2NW3B 2PYFA 4DPRA 4XNBA 1KPRB 2BZ7A 3MBWB 4MBRA 2R7EA 1NCHA 2FJHB 3ZT6A 3SDCC 5HVGB 2VDPB 5EN3A 4PG9A 1RPKA 3P0VH 3VD9A 1T03L 2YRZA 1EZVY 4P5SA 1JHTB 1CBJA 3VFOA 4HU2A 3KJ6H 1N67A 2MCG1 1A25A 3LN5B 5I1EL 1U95A 1OE2A 5KS9A 1GSMA 3FPXA 4L1HA 5BQ7B 4XP1L 4AC4A 4OCMC 3QWQB 1V55B 3TYGL 5CFHA 1LM8V 1QR1A 3PDOB 1BM3L 4U6TA 3UYRL 1ZT7B 3H0TB 3D0LA 2BVPB 3S5LB 12E8L 4KXDA 2YOAA 3BKMH 5KSUA 3U0PB 2L0DA 1ZVSB 3TTSA 2DM2A 5CR1A 3GDBA 5DUPH 3FCUB 4U1KA 4BHUA 5DD1H 3D33A 1J86A 3SDDD 1C12A 3LS5L 5E2TH 3T1WA 2BSEA 1R24B 1INQA 1FZMA 4J6RH 5E51A 1E4XH 1EHKB 3GGWB 2Y25A 4J3OG 4PJEB 4JFPB 4QGTA 4D8OA 2WD0A 2BRQA 2Z0UA 3QDME 2DLGA 4GQPH 5DD6A 1TNMA 2XXFA 4UUJB 2A83B 1OGPA 3OMIB 4I89A 4QPEA 2ZSVB 5KG9A 1U8LB 1ZDQA 1AQ8A 1NBQA 3OAUL 4GIAA 4K7PY 4Y9GA 1SXAA 5I1GL 3V4PA 3VSQA 2W60A 4PGDB 1IT9H 1G6RH 2XTJE 3JV5A 3PFQA 2J55A 5BO1L 2F08A 3T0EA 4CVXB 1MPAL 2HTLD 5TPWH 3PGDA 4FC3E 1IGMH 3APMA 2EDMA 1FNSH 5ANHA 2NRDA 3VH8B 5T3XL 5D9SB 4BZYA 6CGTA 3FO9A 4QRQB 1Y18A 2EH7L 4YNYB 1HIML 1RZQA 3IBOA 4MJ2A 3PHAA 5HGAA 3OMAB 4P46B 2E47A 3R06B 3RIAF 5DMGD 3T4YA 3VWJA 5L4FA 3E9TA 4GG6B 3ULVD 1AAJA 3NZHL 4LOFA 1QSFB 2X2HA 4FULA 4BA0A 2ZJSH 2ZX7A 2XDHA 3NPSC 3WD5L 1XSOA 3ARSA 1QRND 1U2CA 5AZ2H 4Z3GA 1QG3A 4U1MB 5H8DA 2QSVA 3CMGA 1THCA 2X4OB 1UT1A 5I24A 2BM3A 3ILPB 1SFHA 4JG1L 1S9XB 4P06A 1P7KA 4KV5E 3MRMA 4JO2H 1F90H 4HG4J 3STLA 4PJHA 5DEGA 2IXQA 1ECYA 3G5XB 2OX5B 4YSTA 3RPIB 5BS0D 4Z7WA 5K9OB 4BDVB 5IQ7H 5A2CA 3CLEH 5HHVL 5DTFA 1AXTH 4LLUB 2YBRB 3F7LA 3BP5B 2EYTB 4ZODA 2DMCA 3NIDF 3QUXB 5JYLA 2HTKC 5I1AB 2CJSA 3O3DB 3IDJA 1JVLA 4HJGA 1MH5B 1B2WH 1AXSB 4FFYL 4ILDA 1T4WA 1NFDA 3RTQC 2XWTB 2Z8SA 5CN3A 3OZLA 5IVXF 2WZ5A 3OAZH 3BP7B 2IC2A 4OZGA 4MNQA 4GP4B 1OP3H 3BWUF 3VFPB 5F0LB 4PVBA 3PNRB 1WBXB 5E94A 2N7AA 4WFHE 3RIKA 3VFUA 1CU4H 3DTDA 4ZO7A 3FFDA 5F96H 4HFWB 1Q9OB 2FQEA 1DVFA 3Q2VA 2CJ3A 3F58L 1U3ZA 3BMWA 3I3BA 4FX5A 1B4JL 3LXUX 1JGUL 4NO3B 4QF1A 4X6DA 4PS3A 5DWPA 2DQFA 2J5LB 1D5IH 2X2YA 1MRFH 1MWAA 4XPGL 5F9OL 3B5TA 3MNVA 2H2SD 2XX1A 1S7XA 4OGZA 1IEAB 1GH7A 3W9EA 4EBQL 4R8WH 1M05A 3CFMA 5M7QA 4BELD 1JG9A 4G80A 5BZDA 4GFTB 3QFDB 1OARL 5TGBA 1IRAY 4HIEA 5D2NA 4KDWA 1UA6L 3P69A 3QPXH 4JREB 5I26A 4H88H 3U2JA 5ICXB 2CNZA 4GB9A 1L5GA 3CXDH 5CGYC 1HXYB 4NPYA 1WHPA 2OA9A 1G7PB 2FD6L 4ZW5A 1OF2A 5GJSL 4RVBA 4Z1PA 5B7EA 4PRAB 1JYNA 3MV9E 4NKOA 3WMPA 2Y1VA 1E4KC 1MOEA 3VI3A 4N8VA 4FQXA 3PHOB 1W0VB 4KDVA 2ESVE 2XZQH 5KAQG 3K6NA 3CZGA 2WLZA 1SY6A 3ARRA 1TZIA 5CSZA 3X1GA 3FSVA 1QEWB 4KPHH 4XZUA 5DDHA 2X5PA 1E27B 1N5YH 3KR3L 3M8OL 1HQ4B 1ZE3H 3ZTDC 3DNKA 2XNAB 3IYLW 1F8TL 3SQRA 4RISL 1JGEA 4EZLA 1KJMB 3MRDA 5KSAD 3WU1A 1G1YA 2GYSA 3OG4B 2KBGA 1NC2D 3DXAA 1CGSL 2VDOH 3B37A 3F7YA 4N2IA 1TTCA 4PJFB 1M2VA 4YXKH 1I9IH 3WDIA 2BIPA 1GOFA 4KNSA 5JPNB 2WBJB 5HHPA 5IEHB 5I8CB 5ICZA 3K6SA 2H8PA 4M4RA 2GTQA 4OZFG 5B39B 1NC4A 3QISA 4K94H 5DD0H 1ZHNA 4L8DB 3ECQA 4RNRB 1D5MB 3FB6A 1UM6H 3GSXB 4RWYH 3MX0A 3DX7A 2OZNA 2FH8A 1EXUB 3NACH 4YHKH 3VFGH 1DJGA 1T6VN 4AMKH 1HJBC 5BRPA 2DQJH 3WNIA 1A9BA 1QAWA 4YBHA 3FAXA 4WO4D 3D25B 4KK6C 2E9GA 4P2RE 4P46C 3LIUA 3BHBB 1JFQH 1GHFL 3IE4A 4NAJA 2YKKA 3K5SA 5ALCH 1KGIA 2BY3A 4B7IA 2ARJB 3H2QA 2QTEA 2VDRL 2EEXA 4ISVA 1ZA6B 4MA3B 1BZ7B 4FE9A 1QWUA 5LCVL 2O26U 4F57L 1RAMA 4ERSH 5MERA 2AJSL 1UM5H 1EPFA 4UOQA 4K7PH 3CDGA 4BWWA 4X7DC 1TF4A 5FK9A 3L16A 1GZQA 2R69H 1YY9C 4OD3H 2CO7B 5J6SA 4ZQKA 4CN4A 3IF1A 2RMNA 1CE6A 3U6RA 1LP9E 2BVEA 4YHIA 3H54A 4KDTC 4IDJH 1V5JA 2YAQA 3QHZH 1U92B 1UWYA 4GSUA 3FU9A 3V5DB 1F1GA 4Q8BA 5B3JE 1IJNA 2CBPA 3OQRA 4QO1A 1CZ8H 4DO5A 3SDYH 1FZJB 3K7UA 5LAXA 1FVEA 3QGVA 4NC0B 1UWGH 3A6CL 4I48B 4PN6A 4QXUL 3ARFB 3AW5A 4Y89A 1RD6A 4KZEL 4O9HL 3QZMA 3FQRB 3V4VA 1ZK9A 3OSVA 2IAND 4A2EA 4LCUB 2VUYA 4U1NB 5BOJA 5J1AB 1FCCA 3MGOB 1BZDA 5T1MB 4OLXH 3DK2A 2VXQH 3GPEA 4OLEA 2UZIH 5SWZD 3VFNB 1M3JA 5DMKB 5E2VH 2OCFD 2X4NA 5EF0A 4QHLB 1BREA 3FU0A 2W9EH 2IQ9H 2XWJA 3UTTB 3SDDA 1JTPA 4NQCB 5EOTB 5SX5K 2BNQB 3MNZB 3GJFA 1NANH 1CF1A 3EDEA 3QARA 1Q9WB 1E5ZA 2XC8A 4LARL 3TESA 1BD2D 1Z3GH 4I18A 5F7DB 4ZUUB 5A6LA 2ZPKH 3FQWA 2FJSA 5J3HC 4DGVH 2J5LC 3Q43A 4HIXL 4CNIB 4YWGH 1ID2A 4QNPE 1KCRH 1NDMB 5A3ID 2V9UA 4HIJB 5F9WB 3O0RL 3HI5L 1D7DA 4M6NL 4WWNA 5KBKA 1T0NA 3W38A 3CGTA 3AXLA 3SZ6A 3QO0B 5IOPB 2VR9A 5LNDA 3BXNA 4JFOA 4JBSA 4HT1H 4NYLB 1N7MH 3FHEA 3ZXAC 1L6PA 5B22A 4JREC 3KLAB 2F7OA 3LMJH 3RL2A 5GHWL 1CL7L 1JGVL 4AZUA 3RY5A 5C92A 2FDBP 2BWDA 1QVOA 5HVHB 4PJDE 4LCWB 1KDIA 2NY4D 4ZUWB 4OV5A 2C5DC 1PFOA 2O1AA 4HD5A 5AYTA 4XNDA 1QRNA 3APNA 2D31A 2NX5D 2X6UA 4FLHA 4MJ4A 1U8OA 4QIRA 4GW4A 1SMOA 5DJ2B 3RUGA 3VXUE 2ZKHH 3FUNA 2M8XA 3UZQA 1MFMA 3EGDB 5L2KD 1NQBA 4M5ZL 5BS0A 4MBOA 5EORH 5E24E 3MRKA 3QRBA 2FJFB 1MFCL 2P46B 3CVHA 2CGRH 5DR5L 1Z0NA 4IOIA 1TPXC 4JLRA 4FZEL 4NAQA 4KGLA 3OHXB 1F3RB 2WBJC 5JPNC 1A1MA 3PXJA 3ULUE 4Q6YA 2ZT9C 4A2LA 4R7NA 5GS1A 1WFTA 1FUNA 2VERN 2IDUA 1JHKH 2CRYA 4HV8A 3VGFA 5MHSE 4MJ5A 2WTRB 4EDXA 3IDGB 4S1RL 2CALA 2XETA 1DDHB 1I1FB 3ECVA 1ED3B 5AW9B 5D7IA 2ICEA 1U8PB 3DDFA 3DYPA 1QTPA 1OGAD 4NKMB 5DK3A 5EWIL 2JWYA 4B9JA 3DI3B 4C56D 4XWOD 1JZ8A 3VD7A 2BY1A 4J2QA 3HLAB 4X4MA 2BW5A 3RI5K 4CU7A 2C9VA 2UY6B 2XV6B 1FE8H 3KPLA 4FXKA 4J12A 3WMQA 2VMFA 2XQYK 3ZDWA 1JVKA 1OHZA 4H40A 4P2QB 4NZDA 4KI1A 4M6OL 4WHCA 1WZKA 1F6FB 5LQBH 1TSHA 4CVZB 1BX2B 2R2HA 4BK4A 3MJ9A 3V0EA 4X6CB 3EJJX 1V54B 4X5PA 5IBTH 1IEHA 3ISYA 2Y23A 3TM6A 3VGGA 5I8EB 4JRXE 2XYCA 3NDZE 3GM0A 3ILDA 5D2LB 4PJFF 3WY4A 5C0AD 2Z34A 5HVWA 2TRYA 1OM9A 4AYGA 3SE6A 2J71A 4WW2A 1MHCB 3IDIA 4BKLB 2H5UA 3PU7A 2XUWA 4IMKA 1AGFB 3HRZA 4DPBX 5FDWA 4LEXH 1F02I 1XWVA 3X14A 2DBLH 2WYHA 3TBWA 4P2YA 2CO6B 4J3TA 3RFZA 2UZXB 2H9GA 3KNBB 1RZJL 4KJYB 3ARFC 3K72B 4K0OA 3WV0A 3S88L 3TO2A 2VMDA 1JPFB 3GSNL 3FRUA 4HZ1A 4AYEC 4Y4HD 4OFVA 3UZEC 4QXGL 2DQEL 3KGRA 3AY4C 3GMOB 1RIHH 3T9WA 3UIYA 2V4LA 4M7LL 2IFFL 3RZWA 2VC2L 4XNUH 4U1HA 4NQDE 3PQYD 2TSBA 5EZLB 4CMHB 2YRPA 1WCQA 4OZHB 4RGNB 3N50A 5KSAA 5KYUB 4FRWA 1MFAL 3D2UD 3X13A 1NC2A 1QTYT 4G9FB 2J57A 1HHHB 2JKWA 2K7PA 1X5LA 3SBRA 1T1XB 5F3HB 1EZSA 1IM3D 3NFNA 1WJ3A 2WJ7A 1EJFA 1EVUA 4N5EC 1F6LL 2OMYB 1FLRL 4KTEL 5F9WC 4FN0A 2UWEA 4HF5H 5C0BD 2L8AA 3L1FA 3NG5A 1XF2B 3ZTNL 4AVIA 2EUXA 4R6UA 2W1NA 4NZTH 5AVWB 1FO0H 1R3IL 4HDIB 2ZUVA 4PJAB 5IR1B 4OB5L 2CHNA 2G5RA 4YC2C 2HVJB 3V0WL 3BZDA 2YC1A 5B4MC 3OVUB 1CIUA 2CK2A 1QNZL 4JY6B 1FBIH 3C8HA 1WSST 4XP9L 3U2SA 1JAEA 2YFOA 1CURA 4WO4A 3CFBA 1BQLL 3JUYA 2GCYA 1WIUA 2NXZD 4PRHE 3RJDA 3P4LA 2SEBA 2AV1B 4KQ0A 5SX4H 3AQXA 5HVHC 3ZKMC 1AZRA 3ZW3A 5ESVA 3MFGB 3D0VB 1ZHBB 3BCDA 2A38A 3OG6B 3EJRA 3T77B 4ATTA 3NQIA 1F4YL 3RVUD 2FWOA 3QC5X 2Q1EA 4XPTH 5FOBA 3L3KA 2LU4A 5IMMA 3JV0A 2IGLA 4W6WB 2NLJA 4PGJA 3BSZA 4O2FA 4JO1L 1CL7I 4WTZA 5F9JA 4UNTA 1ZEAH 3GZQA 3RWFA 4AZ8A 4BM7A 5CJ8A 5E03A 3A4FA 2ZXWB 4P07A 1MUJB 3SPVB 3MBEC 2GJZB 4BFNA 1NICA 3N41B 4U2ZA 3O3AB 4UB0L 3SKOA 4PY7B 1M3IA 2Y5TA 3MV7B 5D55A 3FF8A 2F7QA 1N5AA 1OM3L 1JMXA 3OHXC 1TVBA 2JKXA 5E4IA 2C9XA 1MCIA 4MD5A 5C07D 4PJ5E 4HC1A 3GIZH 3PWPE 2IANA 5T5NF 1AACA 3HPLB 4CSSA 3QCUL 5SWZA 1CYXA 4G8IA 4FNTA 4OLUH 3QDJE 4UT7L 4XCNB 5CCKH 1T80A 5FGBC 5D71H 1G9MC 2BIQA 5IFHH 3GI8L 3B9AA 3MREB 1UZ8A 1REIA 4ENZA 1WIOA 3TJHC 1S3KH 3M1BA 4W9IC 1MZYA 1OE3A 4FP8H 3SQBA 2H0FA 2VIRA 1CFVL 2G5BB 2XWXA 4UNUA 1FFPA 2JCCA 4LLYB 3II3A 5DJDB 5E7BA 2G60L 4QHNB 1BD2A 2DQTL 2M26A 3GSWA 4PAZA 5DMYA 4FFWD 2HRGA 4HUKB 2C9SA 1KPUA 4PCYA 4L2LA 1JV5A 3DGDA 3ZKQD 4WW1B 4TYUA 2NR6D 1L3WA 4HWBL 4BE5A 3WFBL 5FB8A 2HG5B 4ZD3L 3ZZSA