4A04A

Structure of the dna-bound t-box domain of human tbx1, a transcription factor associated with the digeorge syndrome
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
189
structure length
181
Chain Sequence
GVSVQLEMKALWDEFNQLGTEMIVTKAGRRMFPTFQVKLFGMDPMADYMLLMDFVPVDDKRYRYAFHSSSWLVAGKADPATPGRVHYHPDSPAKGAQWMKQIVSFDKLKLTNNLLDDNGHIILNSMHRYQPRFHVVYVDPRENFKTFVFEETRFTAVTAYQNHRITQLKIASNPFAKGFRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-BOX TRANSCRIPTION FACTOR TBX1
publication title Structure of the DNA-Bound T-Box Domain of Human Tbx1, a Transcription Factor Associated with the Digeorge Syndrome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 39
structure length 181
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00907 T-box T-box
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.820 Mainly Beta Sandwich Immunoglobulin-like Transcription factor, T-box 4a04A00
4A04A 1XBRA 5FLVA 2X6VA 4S0HA 5T1JA 2X6UA 5BQDA 1H6FA
chains in the Genus database with same CATH superfamily
2OXGB 1FH5H 4PHZA 1O0VA 3C12A 1OOAA 1BMWA 4D9QD 3B2VH 3FQUA 4CJ1A 2W0KA 2VR9A 4J2XA 4HZ1A 2H0JA 1CFNA 1MCIA 3TBVA 1E5UI 5CF3A 3P9LB 4ZAKB 2B77A 3BP4A 5F7EL 4ZOBA 3JV6B 3LNEA 1I1AA 4OM1H 3G6JF 4AYEC 4OFYD 4RIRA 3FFCA 3EYVA 1E9OA 4KBPA 3NZUA 4PRBA 4AW7A 1A6WH 1PZSA 4OCYL 4P99A 5ALBL 2EIKB 3OSKA 3QARA 3TTSA 1PLGL 2VCOA 3UTQB 4W4OA 4DW2L 3ZKNC 1N6VA 4L3EA 3NA9H 3KS0H 3TNNA 4E9RA 5B1JC 3MRKA 2QDWA 2R0ZH 3AROA 3BSZL 2XWDA 1F1DA 2DQJH 1DQMH 1MHHB 3FCTA 1YA5A 2V7HA 2VDPH 3GJFB 4N0UA 3O2DA 4NEHB 4WI5A 3L16A 5FK9B 1P0SE 2A6IB 4QF1A 3V6ZB 3VSUA 2R1XB 5C0CE 1IKFH 1PKOA 5AW1B 5I76A 3QC6X 1C9SA 2DTSA 4ELMA 2R1WA 4IRJA 3QUKB 3DBXB 1V3LA 3S3CB 2IDFA 3I3DA 4K7PX 4P23D 1P5VA 4L4TD 4AYBA 5HSFA 3T4AC 1HHIA 5EO0A 1H6UA 1Z9SB 4JJOA 4TNWF 3FCUB 2P7TA 4GINA 4Y19E 1EZUA 2BSTB 3QJVB 3SJVD 4Z3TA 4QTHA 5HYJB 2Y7MA 1SJHB 3GMQB 1X5AA 4TPRL 2JJUA 2MCG1 3AQZA 1NIEA 4GRLB 3QYMA 4EN3D 3F8UB 3K6IA 3DETC 3BD3A 2HFFB 1UOWA 1YEKH 2Y1ZA 4IKIA 1ULVA 3GWJA 2CHNA 4QHNB 1HQRB 4U1HB 4B9IA 2GIXA 1NMAL 3EBGA 3OD3A 4L5FL 3FT2A 3QIWB 2A9NH 5A2JH 3K2KA 2X40A 1Z7JA 2RALA 5CLTA 3T6QC 2ALAA 3C60D 2OMWA 4P4RB 5GGTH 3U83A 1BDYA 2CKNA 4HBCL 3ZPDA 1MG3C 1KTBA 2VLKA 3VI4A 4BSVB 8FABB 2EVFA 4L9LB 1J05B 4HS8H 4S0TD 5CJXC 2H2SC 1JPEA 3OAZK 2DQCH 1BLNA 4JZJB 3A6CL 3RAJH 3BOVA 1AXTH 2XKNA 1TNMA 4M5YL 5FA3B 4QRFA 5KYWB 3TEWA 1KB9J 4EOWL 1VZIA 1N5AA 1PY0A 5I1AB 4UZSA 3CLEL 1JZHA 3S36H 1OCZB 4DPCX 3GI8H 1E40A 5IROA 1R3IH 5BS0D 1QBBA 2EIBA 4B53A 5EG6C 4MJ2A 2G30A 2OMUB 2DQUL 2BCKA 2MQ3A 4MQ7B 5ANHA 4E9QA 3DYMA 3BT2H 4EAEA 1HCZA 1M1XA 4YEEA 4PB9L 3WUWA 3NRFA 2QGCA 1NBVL 4O02L 1TLKA 1KFAH 2AVGA 5F1IA 2J12B 1JRHL 4U0QB 4Y9EA 4ZUVA 3SQBA 3WN6A 1TLMA 2K8MA 4UAOC 1OTTC 3U25A 4RAUA 2YJQA 2CRIA 1IGYB 2VDQH 2G3NA 4KHTL 4NUPA 1V8HA 4DPBX 4BQBA 2FIRT 1I9IH 1I3RB 1TMCB 4MQXC 4BCYA 5HHPB 1MIML 3FRUB 4W1TA 3SDCC 3PGFL 4J3OC 4MHHI 4Z78A 3NACH 4F3FB 6FABL 4I87A 2HFTA 3TO4B 4Z3IA 2AEWA 4TTDD 3MYJB 3CTTA 3MYZA 4FULA 4HJTA 3L3DB 4TVUA 5BVJA 1SDDB 2W0PA 3DK2A 3MNDA 1J8HB 1N0XL 3MRNA 3TYGH 1IFGA 4HT1H 1JYWA 4FF9A 3O41B 3MLPA 4NN7C 5F3HA 4NQEB 4R84A 1VFBB 4CC4A 4O2FB 1PX4A 1VFMA 2AQ3A 5I5JA 1KULA 3TA3B 1LWHA 3EYSH 1THAA 3ULUL 1E9QA 1QX1A 2DM4A 4N8VB 1XSOA 3RL1A 3T4AB 3QFJA 1OAXL 2LW3A 4A7GF 1H3PH 4GBXA 4JN2A 5C3IA 2EXWD 1T7ZA 3ECUA 1QNZL 4H8WL 5E8PB 3O45B 4EQ2A 4YSQA 1IBHA 4HU2A 4NWUL 1CQYA 4BELD 4MNQD 3ARFD 3MJ7B 4GAAA 4MJID 5KS9A 1YJDC 1FDLL 2VMFA 4UQ3B 2BOBB 1E7VA 4HEME 4LSQL 5E2TL 1XIWC 3VFUB 2TAAA 4YGVA 1JZJA 4YIQB 4E9TA 4ES8A 2E74C 1ESOA 5J1AA 4LFHG 1M56B 3FDWA 1WCBA 3VFOB 4A2DA 1LO3H 3QIBA 2OMNA 3O6FC 1E8XA 1S9VB 2FQFA 3FQTA 5IV2A 5EOTA 4R7LA 5D5ME 4PRDB 3TVMC 3EFOB 1A2YB 2FX9L 2AQ1A 4BBWA 2WINB 4TL5A 4YDLC 2WKLA 2Z92A 5G2NA 2HKHH 1N8OE 3TX4A 4B3EA 2X6MA 2XIBA 3V0IA 4NRXB 5GXBB 3EADA 4LEBA 3RDTA 2KLRA 1GGTA 3F7KA 1Q9WA 4N2GA 1FFNA 2HFEA 4I88A 4U1MA 5DHDA 3X1NA 2L7QA 1E2VA 2H6UA 5JHLA 3BVUA 5GS0H 5D7JD 2E6QA 2FJHB 5T1KB 5E0QA 4GRWH 4HIQA 3C9NA 1DVSA 2XXFA 5D70L 4S11A 4EIUA 3PV6A 2QVMA 4XE0A 5HDQL 3MLUL 3NFSL 1DBKH 4WFFE 1RJZB 1G5GA 3HZMB 2C3VB 3QORA 5IJDC 4GRWB 3OAWA 1K5NA 5ESQB 4XMWA 4O4YL 3G5VA 3MC0A 4PLKC 4RA3A 4X5LA 5JYLA 3S37X 3TF7C 2GBTA 1HEZB 2D03L 5D7LB 3CFCH 4FQ1H 3QWQB 9CGTA 1VCAA 4UAOB 1MFEL 4XN8A 2F15A 2GJRA 1WT5A 2LV4A 3QRLA 1Z0MA 2H47C 3CCHB 5EEYA 5IVNA 1HIML 3VRLF 4Y1TA 2E76C 1W72H 1KPVB 2X6BA 1LK2B 3IU4H 4FXGA 4OAWB 2GJZB 4LP4A 3NSDA 2CDFB 3RA7H 2RHEA 3T65A 2W81C 2X10A 4KTEL 3L3OC 2B20A 3BP7A 4YBLC 1AKJD 1KN2L 4UQ2A 1FIGH 2CSPA 2OI9B 3QR0A 3SY0A 2YUVA 2OW6A 4XHJC 3T04D 1BQ5A 4P46C 1C12A 1QEWA 2C1PA 4LASL 1RZJC 1HHKA 2WLKA 3KNBA 3BGMA 4NN7B 1EO7A 1L3WA 4RGOL 5IOPA 5FUZH 3U9PH 3HC4L 4OV5A 4PJAE 4NKIL 1R6VA 5D2NB 2WQWA 2UZXA 4QHLA 1U3JA 2YOAA 4YPGA 5L2JA 4AM0B 2FJSA 4QRRD 4MAYB 5JHLL 2GSIB 2RFXA 1NGPH 5G5DB 2R2CA 3PL6D 2X4RA 3RX9A 1GW6A 1HQ4B 2QV4A 4NDMA 3VFPB 4M62L 2Y6SD 4WTZG 5EMYA 4P57A 4FLOA 5B3NA 2EYRB 2WIIB 4CMMA 3ARBC 3MRRA 5AOJA 5ES4B 2OL3H 4G7VH 1JK8A 3OLIA 4HK3N 2HX9A 3NCWA 1EJFA 4J28A 3WTUA 3ETBF 5GGVH 4X7EC 4Y4HD 1QSEB 3K6DA 3PWUB 1PLBA 1TTAA 5D5MF 4H20L 4X80H 1DL7H 3DGCR 1ZLUK 1D6EB 3K74B 5TE7H 2OL3B 1NAMH 2YSSB 2BX5A 4JHAH 4OIAA 4BRVA 4IIQC 4FERA 1XX9C 1U2HA 3LD8B 2BIOA 5IMKA 3TCLA 5FW6A 1LO0H 1FWXA 3TVMB 2ROXA 1U91B 2Y1YA 1NAMB 3CJJA 1XR9B 3QUMB 4LU5L 4S0HA 1ANUA 3EH2A 5KJRL 4CSZA 5DJAB 4NO3A 5E8OA 1Z9OA 5T3XL 4IBLT 1NGQH 1P6WA 1Z5LB 1JSYA 2YOCA 1TYRA 4KKZA 3PWNA 2BVOA 4Z8FH 5KSBE 3JTBA 4WU5B 5DJ0A 4HCFA 3SKNA 3ZT7A 4DHLA 4KMTH 4OF0A 1IJ9A 4F7TA 3TEZA 2C4XA 1FPTL 4Z0XB 3BWSA 3WNKA 3KYKL 2PWEA 3BXNB 5AOLA 3K80A 1I82A 1I31A 1BIIA 1YQ2A 1FCCA 2FJFB 4UINH 4ZG1A 5FO8B 2GTWA 4NO0A 1G1YA 1R3HA 5E6IC 5I15H 3FN3A 4FXLA 4LL9A 4E41B 1QA9A 3GUTA 2ZNXA 4KPHL 4ZQKB 1LYQA 3RGHA 4NRYA 3U2IA 3MRDA 2QSCH 3U6RA 5JIHA 5I24A 3HVNA 4BGLA 1XF4B 2EILB 2DTML 4L8BB 4XMLL 5I16A 3CPUA 2D0GA 4RGMB 3U9UB 5IQNA 4TV3A 4LSRL 5LGHH 3VDBA 4AMKL 2BRRL 2QADD 3RNQA 1G94A 2EO1A 4DK5A 2O6DA 3C87A 5AVUB 1XO8A 1JVOA 2J1ZA 3UGUA 4DKEH 4TSCH 5DQ9A 4ZSOB 2WSPA 3IAQA 2ZKHL 3OKKB 4IU3B 5I2IB 3BCFA 2ZG3A 4GMTL 4R3SB 1A9BA 4FD0A 3P02A 1IC4L 3LPWA 2WTPA 5IKCA 5MEND 1C5DB 2DIBA 4OCRH 5IWLA 2ALWA 5BQ7B 1I1CA 5F0MB 3BAKA 5HY9A 2DBLH 2FX7H 5I73B 5IK3B 1FQ9C 3NJFA 4HOXA 5AKSA 2NYYC 1B4JL 2JCCE 2WXOA 3GMLA 3OKDB 1OARL 1ZT7A 3DURB 4IOFC 4ISVA 5AW0B 2E7HA 5HDBB 1KJMA 2Z7UA 2J8OA 3MBEB 3UDWC 3QNYB 2DM2A 3LZFH 4Y5YB 3DX4A 2G2RA 5EIVA 3KPPA 3IPBA 4HEPG 3SDXE 4NNXA 5AUMA 4QO1B 2V9QA 5SWSE 4PWJA 3TZVC 3F3HA 4HKZB 5DUMH 1TZGH 4H1LG 2AEIT 3ECWA 2VLME 4UU9B 2P24B 3LQAL 5GGRY 1CPUA 5FX3A 4ZMYA 5H35A 4HH8A 4BHUI 5FGCB 4IIQB 4UV7L 1Y18A 3NTCL 1Z0NA 5DRZA 2QPSA 4I4WB 5J9PA 2BVYA 1GR7A 3EUUA 3RPKA 4L0YA 4RMUA 1UM4H 4MJ5A 4PRHE 5GS1A 3P11H 3NOIA 1LILA 3T0ED 3N9GH 4OFQA 3C2AL 4LE8A 3CH1A 1DQQB 1OO2A 4TNEA 1QSFD 5IW1A 1A7NH 5B38G 2WAHA 2Q7NA 4M1CC 2PWGA 1P84J 4IU2B 4Q58C 3KLQA 5K59E 4Y2NA 1A5FH 3VG9B 3D3VA 2HT3C 1X4XA 3HC3L 2YARA 3UEQA 3T3PB 3IDNA 4BV1A 4MQSB 4PCYA 1MHCB 1VESA 4WUUA 2H6OA 3PQYB 3PABA 3ARGC 1FZJA 2C7UA 2DWDB 4WHTB 5E6IB 1RVFH 3UOAB 2OQJB 5JW3L 2PW2A 4P3CH 4GUQA 1OE3A 2P8MA 4ZXBD 3U0WL 3L5WA 3UTSD 4D7BA 1U8PA 5A2FA 1HEJC 2BHZA 2L0DA 4OCMC 1K8IA 4Q9QH 4B9GA 4I1PA 4D0CB 3DMMD 4HS3A 1FHNA 4KZEL 5J8OA 4HUMB 1DN2A 3QPQC 5SX5H 4BFBD 4O5LH 2DWSA 3MLYH 1YHPA 3OPZL 3EYOA 4JCWA 3H8NA 3U79A 4WI4A 3HBGA 3VG0H 3TC9A 2R9HD 5GISH 3Q6GH 4OD3H 5D1ZA 2VZUA 1M7IB 2IADA 1IL1B 1DQDL 7CGTA 2WBJD 3RWJA 3B2DC 3UMNA 2ENPA 2D7QA 4JFZH 1TTUA 1INEH 5HGDA 1TTCA 4JS7A 4GOSA 1AHWA 4HKJA 4M9PA 1OSPL 2DYSB 3QSKB 5DEGA 1UD6A 3G04A 5I8KH 4WWOA 5DLML 3RWGA 3PFUA 4BRJA 1JVLA 5F1KC 1T89A 1FP5A 2FB4H 4L48A 5D1QD 4JM2D 2FECI 3STZA 1GC1C 5ID0B 4HS6A 5KJ7E 3QCVL 1U8QA 1W15A 3PAUA 4J1UA 3SDXF 1I1YA 3KG5A 4NUQA 1V7NL 4XVUD 3JVGC 4WTXA 3OKYA 1RFDL 5HBBA 4WNSA 3SPJA 2EDLA 5D7KE 1CE1L 1KCUH 3FQRB 1ZIBA 2QZQA 3NEXA 1NKOA 4WO0A 4HUWA 4PJXF 1WIPA 4KAQH 2D3LA 3TZVB 2IBGA 3OAUH 2DIAA 3ZU8A 5HHQA 1QFWM 3MCKA 4YDJB 4P23C 4JFEA 5T3ZH 3LH2H 1X4YA 4IRZH 4NRZB 4PSPA 4Y88A 3UIYA 5ISZD 2JKRM 4PSRA 5IIEA 5JHMA 4WV1A 3MUHL 4XNUH 5F1OB 1MFAH 5FXCH 4YSEA 4GP5B 4KVPA 3BISA 1X5YA 1Z3RA 4O00A 5I26A 3L1GA 1T1WB 4EN3C 2OCJA 1HJCA 3BMWA 3GTNA 1JN6A 1ZLSH 2WV3A 4HC1A 5BO1L 5J5EA 5F0JB 3TS8A 4DT2A 4AH2B 1WAEA 3VGHA 2WOYA 4M5SA 1A7PH 1A6VL 2CHWA 2WXQA 3BIAX 2EDHA 3C60C 1EA9C 5FDWB 3UG5A 4WW2B 4RISL 4YWGH 1DEEB 4PJFA 5IEHB 2F18A 2ITDB 4RMQA 2AXFB 2DQMA 2EUXA 3FKUS 1CC3A 2VLJB 4UOW1 1YEFL 3ISRA 2EC9T 4TULL 4PTUB 5BW7C 4KRPD 4DGUA 1J48A 1PKQB 1UWYA 4P05A 2FLMA 4P9ML 4YHNA 3V4PB 3CFEB 2BH0A 5D1XB 3NAAH 1FGNH 3MUZ1 3OJDB 1S2EA 2EYTB 1FGVL 35C8H 3IJHB 2XIIA 5EO9A 1AGEA 1ZS2A 4M29A 5C0IA 1SLUA 4LMQI 5LN4A 4AL8H 1OW0A 2DQ6A 1QRNE 3V4VH 4AQ8C 1KGIA 1CDUA 1PZCA 1D7FA 3P4MB 4XXCC 4B97A 4QRQB 1KXHA 2UY6A 4YXKL 4G71B 2FAUA 4NHUB 5EEUA 4ZUTA 3V4VB 1FYTA 3NT0A 2BWDA 5DHVA 4ODUA 1R24B 3QYNA 3EJPA 4HFWA 4M7ZC 2NY4D 1WE5A 2PCYA 1B9ZA 2W5PA 2RBLA 2J20A 1KLUB 4JO8A 4X6CF 3TPKA 1SJEB 5DVNA 1YAZA 4X50A 5BRZA 4AQEB 5ACZB 1BZDA 3VXOA 4LCYB 5DUBA 4XT1C 3PWVB 4GKNA 1ZT4A 4G8EA 4J27A 3GYRA 4IBQA 2HPTA 4A1RA 4Y16D 5I82A 4XMTA 4NUMA 3OX8B 1TDQA 3EGXA 3F7YA 3NFPB 4WO4A 2BNQE 4TTDC 2QDVA 3P40A 4DEPB 4HZLB 4RWHA 3H6JA 3G5WA 4QCIA 5T1MA 1CD8A 5GRVK 2JLLA 1ZLVK 3GEFA 5IVXA 4HEPA 2XQBH 3CVHL 2IPUK 4OD2B 3IB4A 4XO8A 5F9WC 3VWKA 4ALAC 1IV8A 3L5IA 5EC2B 3E1F1 1YJDL 4GFTB 3UPAA 2J4WL 4H1LA 4UIKL 3FS9A 2IF7A 4UTCA 4P23B 3FYEB 4L4TB 2VDML 2BSEA 1UFUA 3QDGD 2LQRA 3CUPA 2EXWC 3SJVB 1IQWL 1TYJA 3O8XA 4I0PB 4KQ3H 2EO9A 2KS0A 4DKFL 3WTWA 3APCA 3ARFC 1TFHA 2V0AA 2BIMA 4EN3B 1JFHA 1ACZA 1MLCA 1KB5L 2AV7B 4L8SA 2B2XH 2PXYD 1AHKA 3QWRD 4UNVA 2BZCA 2UX7A 5DJDA 1E2WA 2A9MH 5LN8A 4ZFZB 2MWCA 2VAAB 2R2HB 1G4MA 5CMAA 3BQUA 4KV5E 4TNGA 4KO5A 3RU8H 2YUXA 4PEEA 5E2JA 3M45A 4TNFA 1BZ9B 5B38A 3KPOB 4XX1E 2VDKH 5EU6D 2Z3FA 5KANG 1RLBA 2FEJA 2K6YA 3PYCA 4FRWA 5CP7A 3CSYB 5DVPA 4HZAA 1CXFA 1ZVNA 3Q8EA 4HUXB 4RGND 3KW7A 3IGLA 1TETH 4PB0H 2RH0A 5BZDA 4L3FA 5L6YH 4PWEA 5BRQA 4LOVA 4KGLA 3D0VB 2CQVA 2QFRA 4PRID 3ZW3A 4QYAA 1FL6A 4MDRA 4LPVA 1V3MA 2GSGB 1IC5L 1VPOL 3JV4A 5LWYH 4IGBD 3K5RA 3LMJL 1E6JH 2UZIL 2VXQA 1NSNH 1PMYA 1NGZB 5E8DH 5AVSB 3GKZA 4JPIA 4FQ2H 2AVFA 3QUHA 1A6PA 2GAZB 5C2UB 3EHBC 3L3KA 4ZTOL 5FDYA 1H8SA 4I2XE 2FT6A 3MKGA 1N26A 3BE1L 3IE4A 4PJBA 3RJOA 3B9DA 5BS0B 3DXAA 5CGYD 3EZ8A 2AQRA 3QAZB 5C09E 4KROD 3JZ7A 1HCYA 3WJLA 5D7HA 3FNKA 4YVNA 5HHVH 5DJYB 4WFED 4EZMA 1PZ5A 4ZMVA 1JGVL 3KGSA 1J5OL 3ZTJG 4OLUH 5A3ID 2EP6A 2JJTA 3FO9B 4UYQA 4BKSC 2VDLB 3F7VB 4UF7C 4JM0A 2AXJA 4NWTH 1U92B 3IKKA 1HSAA 1DLHB 4FHKA 5C9JB 1RZJL 4XCCH 4CRPA 1ZGLM 1EGJH 4OZFG 2JELL 1VEPA 2XN9D 4OFIA 3IDMA 2WCGA 5F96L 5GZNA 5I19L 4LCIH 4HPHA 1JPGA 2XZCL 2B15A 5IJBC 5EO1A 4XR8C 4XN2A 1XWVA 2VDRB 4LLYB 4K71B 1JCKA 4YQXL 2QMKA 5I1JL 5KVDL 4U1JB 4FQHB 1CF8L 2Y7OA 3GBNH 5GQBA 3MJWA 2IANA 4R90L 4NBYB 3X13B 4NGHH 5CEZH 1K6QL 2XT1B 3TTYA 3VVWA 1EEZB 2XXCB 2VXQL 2I85A 3MOBL 2XU9A 4JRLA 2H7WA 3DUSB 4JFDE 1FJ1B 3AUWB 3TT3L 3LZQA 5E5MA 3IS1X 2WQRA 1VGEH 5MERB 1HNGA 3TBSB 3VGEA 3DLQR 4M6MH 3UJJH 2YRZA 3IGAB 4H8QA 4Y5VC 3FQXA 4OTXL 5HJ3B 3PL6C 5EU7C 2H0PA 3D39D 3GGWA 4PGEB 2Y6SC 4GO8A 4KTDL 4PJ7F 2CKBL 1QKZL 5IB2A 4MJIB 3RFRA 4BFIA 3JT2A 5TE6L 3SE3A 5F0LB 4R4ND 1M05B 3TA4D 4JHWH 4PD4J 1NIAA 4CVXB 1MHEA 1CN4A 1MRCH 5AYUH 2FT8A 4Y0GA 3U2SB 4WRLA 1ID2A 4JPWH 4PW3A 2E5EA 4Y4HC 3ZYZA 3DKHA 3U7WH 3QPXH 3S96A 4JY4A 5E9DE 1S7WA 2HG5A 3MZTA 4EXKA 4C83A 3ZDXE 4YHYB 4IOIA 4OUUA 4G80B 2AERT 4NJAH 4P2RD 4GI8A 3VSVA 4Q14A 1I9JL 3LKQA 6PAZA 1OK0A 2XV0A 3QH3A 4U0RC 4FYQA 3P69A 3KVDD 1EZVX 1CXLA 1S9XA 4ZTPL 2ADIA 1MAJA 4Q0XL 4Z5RB 4AG4H 1LWJA 3UYRL 1XMEB 1ET7A 1H6TA 1ZK9A 4NQVB 4Y2LA 3LNGA 5D7JB 2NY7H 2FCBA 2DQIL 3LKNB 1CB4A 4BFNA 4QHUA 3T77A 3DOSA 1VDGA 1QACA 3VI3E 5E99H 1SYVA 1WF5A 4MCYA 4QHMA 4QTFA 5DZNA 3WJJC 5FW8A 4UBDD 2Z64C 4AK2A 5BXFA 4N2BA 4WI8A 1UWXK 3VJ6A 3DRQA 1PU0A 1XGQB 1RU9L 3GMPA 2IBZX 4OF5A 1HKFA 1NLBL 4LAQL 3S3PA 4HPYH 3LKOB 4UDUA 4LDLB 4WFGD 1QWNA 4JM4L 2LAAA 1K2DB 3U0TA 5FC9A 5FYJU 1HE7A 4U1KA 1XVSA 3F12A 4OJCA 5T1LD 2HAZA 3QEQD 4R0LA 1PEWA 2C4FT 4I18C 4XP6L 4X99B 2XYBA 4JREB 4L1TA 3FF8A 5LHDA 2QADC 3DV4B 1Q38A 4X4YB 4R83A 2Q76A 4TOYL 2BHUA 4NO5B 5E8EB 5TK2A 3SDYL 1GGBL 1AKJB 4LIQH 1SEQL 4XCEB 2E27H 1YMMD 1Z6JT 2CDEB 2EDJA 1BJ8A 3A3YB 4G42B 1PJWA 2R2BA 3L4XA 2CHZA 2ZJSH 4EUPG 1FZKA 4JGNA 4MHHG 2AABH 1OAKL 3DO7A 2W91A 1U8JA 2J25A 4AUJA 1JNNH 3GHBL 2R69A 5B8CC 3VD0A 3WKML 2MHAA 4PN6A 4HULB 1FC1A 3ZTNL 3SGKA 1HNYA 4ETQA 1R0AL 4W81A 5J6HB 1IM9D 3WTVA 3BPCB 3PL6B 3WU1A 2HVKA 4LSDA 4XO3A 4HLEA 3D0LA 1QPPA 2LE9A 5A40E 1OAYH 1SY6H 4G1MB 4LLDA 4R4BB 3ARQA 1A9EB 1N59B 1P9MA 4QXTA 3AXLB 4DOHB 2PPCA 2YQGA 1CFVH 3A23A 3MXVH 3ATFA 3B1TA 5I23A 2WNGA 5FYJL 1IIKA 1YLBB 2XJKA 4J6RH 4JFQB 1QBML 1TVBB 2WWKT 2AQTA 3M1BB 4M93C 1I8IA 4YZWA 5C0CD 2IBBA 5B1CA 5ACLA 1JGUH 3V0VA 2EUVA 4JDTL 1QYGH 3VGAC 4U3HA 1Z9MA 4Q2ZB 5D71L 1JTPA 3ZTCC 4U0RB 3S34H 4R8WL 1BBJB 2J6EL 3ZMEA 3V6OA 1IFRA 3F5WB 3IAGC 3O81A 3PUCA 4F8PA 4FE9A 2EVJA 3D2UD 4JG5A 4Y19D 5KVFE 3VI3F 4LLUA 5DC4B 5EU4A 1YY8A 4R7DA 2CLZB 2YFOA 1A3LH 5B4MC 3P4NB 3EJCA 1U8LA 1JPFB 4N2OA 1VFUA 2CO4A 2VC2L 2Z31D 1U6AL 2WKGA 3V0WH 4ZMWA 3HCVB 3RY4A 1SJMA 2WXNA 4MMZC 4F80A 2VRKA 2C9VA 5FKPA 2CE6A 4OKVA 4X5QA 1G7JB 3CHXA 3S4SG 3P73A 4ZXBC 4GXVH 1FNGB 1OPGL 4OZIE 1J8KA 5FUCE 1UM5L 1EUTA 2N59A 3V9FA 4I3SL 1B6DA 3BKYL 4JANB 3WUZA 1J12A 2P4AB 4PGDB 4K5LA 2WHVA 1OKEA 5FA4B 2Q7YB 4MZRA 4NCC2 3LRKA 4QI3A 4N2DA 4X7SL 3R4DA 1AD9A 4MDIB 2ARJA 1JV2B 5CZRA 4YUEH 3ZE0E 1E30A 3CBJB 4OI9A 4LDCA 5CP3A 4G59C 2R9HC 5T33H 4NIYE 1TCMA 4PWHA 1MJ8H 2OX5A 1GC1L 5LNGA 3F85A 2PR4H 2WBJC 1MLBA 3GIZH 1RI8A 3O6LL 3QZWG 3LIUA 2WWMD 3O3EB 3A67H 3DSFL 4Q89A 3X17A 3N1MC 4PW4A 4PY8J 2NXZC 2ZWKA 4FZ8H 4HBQA 1BXXA 5F1NB 1RUML 2ZXAA 3SE4C 3ULAB 5EZIH 4P06A 4NQXA 4C55A 4Y7MA 4YHPB 2L8AA 1CICD 4DNLA 4R9HA 2NX5A 5D1QC 1TF4A 4JM2C 3WIIL 1T21A 1MCEA 3DX6B 2FNWA 3GDBA 3T6ZA 4NO2B 1OCWL 4FFZA 1QSZA 4DEUA 4OIFA 4KRNA 3RIAK 4XVUC 2LTQC 2H1LM 2AFNA 1D5ZA 4FNLL 2Y06L 5SV3A 2B08A 4F2FA 4N0YH 1U8NB 3P1VA 4YZFE 4AUYA 2PYEE 2CGYA 5BMFL 3KWWA 5FUOL 3MACL 1H15A 3OXSB 4PJ9D 1R47A 3MO1A 2JJSA 4AGPA 1MCCA 4U6YB 2N3JA 2B1HL 2WTOA 5CXPA 2D7OA 2EEDA 3FTGB 3B9KD 3U4BH 1SBSL 5I30H 3IFLL 4MJ6B 2YD4A 4G7SB 3VGAB 2A9CA 3BAJA 2XQ0A 2Z35B 5IG7B 2A4CA 3HZ3A 3IDIB 3T0EB 2ZX8A 5C6TL 5AAPA 2DS4A 5JOFB 3GI9L 4YAQB 1BOGA 2WVSA 2JKJA 1KJ2L 1QSFB 2VWEE 4JQXA 1S78D 4LQFL 1NGYA 2J8UA 1Q0XL 2CM5A 5LLIC 2RQ8A 5E2WH 3V0EA 3DECA 4X9IA 5EUOA 1EFXD 1U8OA 3GMRB 5JUEL 2WN3A 1LP9B 1RZPA 2RQEA 4LVNB 1J9SA 1AO7A 5TE4H 3TIDB 2OYKA 4OZIF 3ABGA 4XZUB 4KRPC 4PRPE 1FE8L 1OF0A 1ZHBA 4GKSB 1CGYA 1EBAA 3RUGE 3HR5B 4GP8B 4ZXBB 3OR7A 5D7IF 2WLYA 2Z6FA 1IZJA 4AY0A 1X5FA 2EVIA 5T5FH 4C56B 2DQEL 1N8ZB 3DMMB 4N5ED 4ZPTB 3RX8A 1NQBA 2UZYB 3FUIA 3B56A 3WSQL 2VXSH 4WEBH 3D5OF 5HYSA 1SXBA 4XNZB 4S1RH 2OZNA 2ODIA 4HAFA 5C0GA 1F58L 4H25A 2G60L 4N8CL 4WDIA 4AYMC 4ABUA 2GKIA 1OM3H 2Q9OA 4L5FE 3FFCE 2APFA 4Z0BL 1XF2B 5CU9A 2AJ3A 1G9HA 1W0VB 1WVZA 2MNUA 3GXNA 3PJSA 1KV7A 3B1UA 3K2IA 4UNIA 3W39B 1YCSA 3IDYB 1H8LA 2XUWA 2WBJB 4PTTA 5TPWH 1OTSD 5EZJA 3PHSA 4XGZA 5IEKB 3FONA 2W0FA 2NY4C 2R0WH 1II4E 1DLFL 4KK5D 2Y6TE 4EUPA 3BKML 3E9UA 3HZKB 3ZHKA 1LE9B 2X88A 3IJ9A 3OMZA 2SEBA 4L3EE 1AS7A 3H1ZA 5IOKA 5GGQL 1EDQA 1W2KT 4OLVH 3UO1H 4WFFD 4XPFL 4ALAL 2YPVL 4HPOL 3KHQA 3U6XA 3CZKA 5D1QB 5GSVB 4ZMPA 2IV8A 4I0CC 4MA3A 1HKLL 1Q90A 1NMBH 3EJZD 3QQXA 3GBDA 4LSVH 4QXVA 4JRYB 2LHAA 5LBGA 3K6SA 1LK3L 1NL0H 5IB3B 4PS8A 4YZFF 2NY5C 4ELME 2IAAC 1CDJA 2LTQB 3OKLB 1OT1A 4D0BB 5HVGB 4ZNEA 1NJ9B 5AVTB 3LEXA 4YNYB 2C9XA 3D25A 1T5WA 1JHTA 3LPFA 4Z7WA 2XBDA 4WU7A 3CFNA 4HGWB 5C8JB 2XBTA 4A6YB 2QGEA 4M61A 2YPLA 3D2TA 4LCWA 4OJFH 1ZA6A 2ZONA 1SEBA 3MCYA 4PP1D 2LU7A 1VAHA 1HXMB 2QT6A 2ZSVA 4HUKB 5AD0A 3IEAA 2YD5A 2V3DA 3P0VH 1KZQA 5JZ7D 3AM8C 3MREB 3BH9A 4KHXH 2I7OA 3C2SA 3LHAA 4K8RH 5JHAA 5KWYC 1U3HD 2AV1A 3AS0A 4NBXB 5E7BA 4H0GA 1NCWH 3J07A 4V11A 1MPAL 2Y5QA 1XF3B 1D9KA 3BEWA 4XNMA 1VZGA 2PXYC 3O2VH 3DX8B 3HHMA 2NUPA 1X44A 2LU5A 1VKXA 1T4KB 4FGMA 3ZOAA 3VRJB 1OXYA 2VLKE 1BZOA 1WZKA 1WFUA 1FFRA 3VI4E 1YYML 5EU5A 3WKQA 4IBTA 3MBXL 1IEAB 3GXTA 5K9JH 3I02B 1FO0L 1U30A 2F54A 2PPEA 3DVGB 3KBEA 5TF1H 2D8KA 3CDZA 4YX2H 1BAFL 4ZFFB 3B4NA 4HWEL 4Y5VA 1G1CA 2J88H 4YLCA 4ODVH 4BJLA 2FWSA 4B95C 5FB8A 4MXWL 1I85A 3QXWA 3ELAT 4KRPB 2H3KA 3KWXA 3N0PB 1YEHL 2W9DH 3E2HC 3RVVD 3CQFA 5C0EB 3AQYA 1KTDB 3ZL4H 4F57L 1GHFL 2ZWNA 3EJRA 3CK0L 3BWAB 1UUSA 1HILB 4XVOA 3K6NA 3ABZA 3GSXA 4JRXA 5LAXA 2F5AL 3MLWL 5EIQA 3HPLB 2YKKA 3MUUA 1HS6A 1PPIA 2ATPB 1BD2A 4TLSA 5CGYC 3FUHA 4PV9B 3H9SB 5M95B 2VISA 2Z8WC 4LDOB 3FB5B 5JPMC 4KROC 2BFVH 2YAPA 3NCCB 5A43C 1EXUA 3V55A 3GHPA 5IQLA 5C1MB 1JDCA 3TCTA 3KPMA 5I8OH 5HI4D 3KPTA 1HL5A 4KY1L 4TLUA 3I3BA 2X09A 3QZWA 5A3IC 4AIZB 3IFNL 5KW9L 3PAVA 5K1NA 3WY2A 3NQKA 1QBLH 3MODL 2EH7L 4JHUA 2ZKYA 2XN1A 1IGFH 2GITB 4GW4B 1YPZF 2H5UA 4ELKB 1AZNA 1F00I 2VLRA 4P48A 4AGQA 4ELMF 1AZCA 1XGYL 2DQFA 1WZ1L 4PMEA 5JPNC 1WWCA 2ZF8A 1SMOA 4Y16B 5AVVB 1OB0A 3IFPB 3TWCH 3WN5C 3MRFB 4NP9A 3WJJA 3ZE1E 4CW1A 4J6IA 1MFBH 3LKSA 3STLB 1PTZA 2N01B 2GIMA 3WGVB 2HVJA 3I75B 4KJPC 1M3IA 4G1EA 4JQIA 4P3DB 4F27A 2K9FB 3HMXA 4HDIB 3DUUA 3QFJE 2ZOLB 4NOFA 1G4RA 1OIOA 5SWZA 1KWKA 5CCJA 32C2A 1AYRA 2VO5A 5DMKB 2NR6A 3UC0L 1XXFC 1X6LA 2P5WA 2ZXDA 3DO4A 1C08A 4AYGA 1EHLL 5DI8A 5KS9E 1A7QH 5DURD 2Z0BA 5DJCA 2H3XC 1U58B 5JXED 4DAGH 1G7LA 1XR8A 4TL4A 4HWUA 4N2FA 3VI4F 4XMKL 3MCLL 3NJMA 1ZJAA 2R27A 4R4NC 3QJHA 4P2AA 3OXRA 3HN3A 1CLZL 3L1EA 1MHPH 4JO1L 4DKTA 1T03H 5M94B 3GBLA 1R5WB 4DQOH 1X9LA 4FQXD 2ZWZA 2XWJB 2F7PA 3Q8BA 5JOPE 4RGNB 3GZKA 4UNUA 2B59A 4E5XB 3ARDA 1N9PA 1F45A 3CFQA 4ILDA 3DX7A 1ILUA 2WZ5A 1JNHB 1CFQB 1NCJA 1S9YB 4X7DC 1NBZA 1E9PB 1J0IA 5DVLA 3V52H 3L9EA 4L0PB 4PRIB 5SWSD 1QABA 3EYQD 4A67A 4IGBB 2R29L 4OLEA 2VLMD 1S7VB 4YHOL 4JFTA 1AZVA 2ERJC 5A6IA 2QSQA 1KJ3L 1MCQA 2KKQA 3P4OA 5E1IA 2FEEI 2EDMA 3AG2B 3IRCA 5DD5H 3C6SA 4PRHD 1JZ8A 3GLZA 1EZLA 1YNTA 4UV4H 4HJIA 2CK0L 1LO2H 2J44A 1PLAA 2UZPA 3VTMA 4HQQH 5JPMB 4U49A 1WEJH 1A6AA 4Z3HA 4JJ5B 1KCBA 3HZVB 4UBDC 1OP3H 1NIDA 1FNEB 4LNRB 5AZEH 4Y2DC 3DJSA 3FL7A 3RPIA 2DWEB 2CO7A 3RVUD 3BH4A 1DVFB 1IBYA 2E59A 1JFQL 3NPZB 3MRHB 3LKRB 2IQAB 1PCXA 2DF3A 3CSBA 2XKSA 5K93A 3APMA 2XICA 2YXVA 1BZ8A 5C0RL 3ZE1F 2XN9B 5DRXB 2E9GA 2A6DB 1A3QA 1A0QL 4JZOA 2V2XA 2VQ1B 1PYWA 4XP4L 3ARSA 1T5XB 3FMGL 4M56A 5CIPH 4JB9L 3WN5B 4BZ1H 1TQUA 3UG3A 3CVBA 4FKHA 1NBYA 2WKOA 1OPOA 2FYVA 3NCBB 4LRIA 5EC1A 4I48B 1T0MB 4W6YB 4UCFA 1IGMH 5J6GB 1S7QB 2EINB 1BP3B 5CIPB 4RRPA 4DGIH 2D7NA 3NEOA 4XP1H 2N4IA 43CAA 4PY7A 4OCXH 5JW4N 4X8JA 5KS9F 4BYHA 3KPNB 4PJCB 5D8JL 3Q3GB 1EWHA 5D7SL 4OFVA 2OTUB 1FNSH 2EUZA 1ML0A 3UBGA 3UPRA 2NY2D 2OYLA 1F3RB 2J8HA 2V17L 1K4DA 2YBRA 4PIBA 4GUOA 3KW8A 3B5TA 3BVDB 3II1A 3N50A 3FU7A 4LL4A 3D39B 1PJ9A 2IXQA 2O5XL 3DVFA 4F58H 2XNAB 4OI7A 1E3FA 1FORH 1BVNT 1HI6B 1SRDA 1TTFA 3CNKA 1R17A 2DQHH 4HK0B 4UANA 1I1FA 3I9PA 4MTMA 3INUL 4BHUA 4TSBL 2IGFL 4DZ8B 4RBPK 2IFGA 3C08H 4S2SA 4NZTH 2CZNA 3RKDC 3AREA 3NABL 4HHGA 3MLXH 4HIIA 4RVBA 2IPTH 2DEYX 2WXKA 2Y5TA 2FZ3B 2N1TE 5D7KD 1OSYA 2ZUVA 4KO7A 5DD6B 5SX5K 4P2RB 1QI4A 1L9TA 5DO8A 2OR9L 1DE4B 4K3DH 3V2AR 3P9LA 1S5IL 4HGMA 5E1AB 1DZBA 4FADA 4FKKA 3JV6A 3ZIMA 1H3UA 2XZQH 5D7EA 3IMUA 4YPJA 1EPFA 4DF9A 4WW1B 3WFEH 4CGUB 4HUCA 3SPIA 1P7QD 4EJ1C 5KEZA 1W8EA 1GS7A 2DRUA 1OT4A 1U9KA 1R5VB 4XNQB 4NENB 1YN6B 3QCUL 1AE6L 1M1SA 5CZXD 2LT9A 2BY2A 3DX1A 3HNTH 5LQBL 1FAKT 4FN0A 4OJEH 4RFEA 5EZOH 3SD5A 4QRSB 2PCPA 4XZ4A 4XXWA 4MD0A 5IB5B 1ERNA 1DUYB 4Z7OE 1MHHA 5F70A 3MLSH 4NQSB 3MOAL 1SM3L 4B60A 1P2CA 5FK9A 4F5CE 3V6ZA 4HKXA 3OJMB 1IAIM 2R1XA 2EXYD 4W70A 5HGHB 2BNUB 4DVBB 2C9UA 4G8AC 4PBDA 2VIRB 3GSVB 3QEQB 4BFGA 5L2KA 3QUKA 4IKKA 1CLVA 3UAFA 1PDKB 1ADQA 1TQBB 3EO1B 4ZS6D 4PU2A 3WGUB 4M8UA 2HH0L 4HWBA 2LFEA 5KG9B 1A7RH 3MTXA 3O2DH 1HT6A 3QGVA 1N2RB 5HD8D 1Z9SA 1U4FA 3HE6D 3VFVB 4DP4X 2BSTA 4NNYB 3SDDD 3F65A 3NSFA 5HYJA 1RIUL 1LDPH 4TYUA 1SJHA 1XCXA 2UWEB 3GMQA 5IJKC 5EOCL 2HLFD 2G3MA 3I9GH 1QRND 3QJRB 4ODXB 2WWMC 2D2CC 1JGDB 4H5SB 4HP5A 3U7YH 2HFFA 1ILSA 1ZANL 1Q9LB 1FH5L 4QHNA 1HQRA 4ONFH 5FS5A 4U1HA 3B2VL 1UB5B 5BVPH 2KHAA 3ESNA 5LKNA 3QIWA 4F37K 3ALXA 2ITCA 4XCFH 5I6LA 4F8LA 3TCXA 1TQVA 1SHWA 3ZDYE 3PDOB 1UJTA 2X2YA 4OM1L 4XNXH 1IM9B 4WI2A 4K3EH 4L9LA 1SFHA 2YAFA 4HFUH 2GFBB 4LSPH 2CJUH 1ADWA 1J05A 1XAUA 4YHIB 1HN1A 4XNYH 2CBPA 1RP8A 1XGPA 5GIRB 4FYRA 4TTGA 3ASOB 1GY2A 2YGOA 3FQNA 2LVEA 4IIZA 5I74C 2HJLB 3WIFB 2CWRA 4YHZH 4P5SA 2CUIA 5FA3A 1U93A 5KYWA 4K94H 3I85A 3NA9L 2BNQD 2F7QA 1L4IA 2R0ZL 5GRJL 3N91A 1LM8V 3DRTB 1DQML 4LP8A 3S8WA 2VDPL 5C0CB 3B9KC 1W91A 3T4YB 4MX7B 4QXGH 2YGQA 1IT9H 3E8UL 5JORA 2FHFA 2ADFH 1UXLA 4MQ7A 1UD8A 5ETUB 1IE5A 4XPHH 1CD1B 3ZO9A 3N43F 1RZKC 2BY0A 3LEYH 1ODUA 1S5HB 5IFHH 4RDQF 5FHAH 3AC0A 2D31A 3D2UB 3HKFA 4Y19B 1OOWA 1LWRA 4HUVB 2N1KA 5CFHA 3I6KA 4XOAA 1VACB 2QFPA 5KN5B 2DWXA 3HC0B 4Z7OF 1GAFH 1IGYA 1GVIA 1TQTA 1R5IA 1FI8C 2Z31B 2HB0A 2OA9A 1ZRUA 4F2ME 1EAPA 3I6GA 4XAWL 1YG9A 2JQAA 3MX0B 3CXHJ 1DJHA 2V5RA 4F3FA 3TO4A 1YC8A 3HBPA 4PJHB 1EAQA 4FMKA 1YC7A 3GSNL 1JPTH 3KM1A 3L3DA 4U6TA 1SDDA 3UAJD 5CJ5A 3QUYD 1NWOA 1G0XA 1A47A 4RETB 3BRGC 2G0LA 3H56A 2Y9RT 5GGTL 1HESA 3C6LB 4N5EC 5I6OA 5JA8B 1UZ6E 5CR8A 2QZ5A 3WHXB 2W9LA 5DS8A 4U6HA 1CYGA 1HL9A 1XH2A 4O2FA 1VADB 4EI5A 3VXRB 5L88L 3TA3A 1G7MB 4N2EA 5LBSA 1JZ7A 4HS8L 1I7ZA 4NI3A 2DQCL 1NM9A 1IKOP 5E8PA 3W5MA 3RAJL 1AXTL 1MRDH 4NSKB 5JDSA 5JXAH 4F24A 4HX1B 4Z7UA 3QQ9D 1Q72H 2ENYA 1P7KB 3MJ7A 2B4CC 2NY5L 1H0DB 1L5GB 2BOBA 3S37H 3S36L 3SIKA 1Y6KR 4U1GC 3WIHH 1R3IL 5C09D 3ALWA 3JV0A 1WFOA 1OCCB 1NCBH 4YIQA 4MXQC 1F3JB 1CICB 1J87A 1A14L 3BWUF 2DWTA 4GB9A 4W9EC 4YBQD 2Z1PA 3BT2L 4NC2B 5CHNB 3EJZC 2WCPA 2X4SB 1Q9OB 5CZVL 1JWSA 4L1LA 5C07A 1UD3A 1KIQA 4PRDA 1YEIH 4UQDA 4B9PA 4GRMA 3EFOA 2O61B 3PPSA 3PGDB 2WN2A 4UQEA 1JL8A 2WINA 3KPQB 4M6NH 4K4KA 5BV7H 4XVJH 4MD5A 1G7IB 3OL2A 2DLGA 2N0MA 2VDQL 5CKGA 1IAKB 3QXAB 3OG6B 4JG1L 4NRXA 2VGLM 3DTXA 3IDJB 4PP1C 4ZMXA 1CL7H 5EEXA 2R59A 5C2BH 4PJ9B 1KCSH 3DTUB 4GG8B 1KBPA 5IJCC 1R9FA 1OGPA 3OGCB 3QWOA 1U2YA 4OZGA 4R96B 4X5WB 5JZ7C 1KDJA 3SEPA 2FJHA 2EYSB 3WHE1 4N8UA 2K6WA 4C4KT 2JJWA 5HVHB 4FYTA 3TYGL 3VXPA 1NWPA 1EXHA 3VXTB 4BSWB 1KDIA 5FR3A 1RJZA 1NCDH 1NM4A 2C3VA 3MJGX 2F68X 4YFEA 4JFDD 5ESQA 1BFSA 1WH0A 1S7TB 1ORQB 1X9QA 4PUBL 1FNHA 4Q8BA 2OXHB 1RK0B 4JDZB 4PJFE 2EDNA 2P8PA 5FHBH 1ETA1 2HZHA 3DHJA 3QNZA 2J2ZB 2H32H 4JFHE 2NW3A 2AAAA 2F6AA 4P2OC 1NCNA 1NFIB 1EV2E 3CCHA 5K1JA 1RKRA 1F11A 3X12B 2B1AL 3PWLB 3FQ4A 2F5BH 4KO9A 5E9AA 1LK2A 2ICEA 4D9LH 1ACXA 2B8OT 2IH8A 2CDFA 4QT5B 2GJ6B 4KXAA 1JZFA 1NEPA 2NXYD 3ORJA 2JCWA 4AQ1C 2FWLB 2A1WL 3QUGA 4LPYA 4CU6A 1AACA 1WFIA 5E9DD 3LN5A 3FQWA 4LF3B 1MI5E 3SPHA 5CSGA 2YIHA 1RUQH 3RG1C 1A4JB 1F8TH 4F7EB 1J5IA 3W3BA 4PJEB 3LX9A 1FYTE 5ICYB 2YAQA 5D2NA 2BZDA 3KCPB 4G5ZH 1TU2B 5IREA 1MCWW 4AM0A 4MAYA 5DD0H 4GFXA 3WV0A 5KBPA 3KJ6H 1ZGLB 25C8H 1GS8A 5G5DA 4UILH 1SYSB 1HQ4A 3VFPA 3KH4A 2HG0A 2YO3A 5BRZE 1X5ZA 2XWBB 2EYRA 2P28B 3AY4C 4U1GB 4OCSH 3QB7C 4FI8A 1MNUH 2EDEA 4JVPA 4JRWA 1NGXA 4P2CG 5IJVA 2WUCL 1DBKL 1UZGA 3PWUA 2BP8A 3WLWD 5KVEE 4ADIA 2RB8A 1UT2A 2OL3A 3DJRA 1ZE3C 4Z7QE 1HVXA 3DIFB 4Y1AE 5EBWB 5FEBA 1JYXA 4TM9A 1MVUA 2DH2A 4NJ9L 1J9TA 3RZCA 2AS5M 1I3UA 1TR7A 1CD0A 1U91A 4YH6A 1KCVH 3PCYA 5DEZA 1NAMA 2WNKA 3QUMA 5LAPA 2V9UA 1JXKA 2FQGA 1KGXA 1AOHA 1RH8A 3UTTA 1V7MH 5ILTH 3HVDA 3PLYA 2NY3B 1HHGA 4PG2A 3HFML 1W72L 1GZPB 4OT1L 1Z5LA 4KXBA 3GRWA 2NY1D 3CVIH 5CCKH 1ZMYA 3IRPX 5L8KB 4G83A 5IR1B 1KCRH 2VL4A 5DYOA 2YSTA 2LVCA 1FIGL 4JJHA 1BBDH 1U3HB 1CD9B 2HUHA 1MFCH 5JXEC 1IX2A 5CEXB 1HH6B 3BXNA 2HMID 3GMMB 4PJFF 2A83B 4PJAB 4UM9A 3VXQB 3FUMA 5ANMB 5FUZL 2MNWA 1WBZB 2PF6A 3TJHD 3T0DA 1F18A 1NPUA 4FNTA 3RKPA 4ICWA 3RBSA 4L4VE 1X9RA 4XCYB 2VDOH 4ZQKA 2HXAA 2IO5A 5KVDE 1NAKL 1CGUA 2DEXX 4FQXC 3CLFL 1XF4A 3GKWH 4A7TA 3N85H 1WG3A 4L8BA 5DUPH 3U9UA 2FWOB 2BXZA 4ZW3A 4XB8A 3NQIA 3PIQA 3CZSA 4WSJA 1I9RH 4RESB 3O9WA 4Q74A 3EYQC 4RMRA 4G7VL 4FKEA 2HCZX 5GGUB 5C70A 3AGWA 5I1CH 3WTXA 4PVMA 1EMTH 4BFOA 4ZUUA 3QJSB 5I2IA 1KSRA 12E8L 3DXAE 4R3SA 1HAWA 2DQTL 5CJQL 5PAZA 5TE7L 1YN7A 2FT7A 1C5DA 2WUBH 3BPOC 5BQ7A 4FHBD 3RVXD 4G9DB 1LO0L 4ADGA 5IK3A 3GB7B 1TCRB 2V8LA 4AEHL 1XSKA 2BJMH 4ZW6A 4EI6B 2W1NA 4RAVB 3CDCA 2CD0A 1J1OH 3BUIA 4HU8A 1JGEB 4RZCB 2XTSA 1IC7H 2F58L 4BH8B 1QO3A 4XBGA 2AJSH 3MBEA 5G4OA 4Z77B 1EJOL 3QNYA 2XDHA 1P5UB 2ZUSA 5KSBB 1KELH 1T7XA 4Y5YA 1HWHB 3MRBB 4CKVX 4X6DF 3EFFB 4M7LL 3SBPA 1KY7A 3IU3B 3KDMA 3D4CA 4V1DA 2CNZA 2XC8A 4QO1A 4Z7QF 1CYXA 2CLVB 5IVXF 1NCAH 2O30A 3O3AB 3CXFA 3UC2A 1ZHNB 4UU9A 3VXSE 2P24A 4A7GA 5KSAD 4UINL 3WNJA 4K2UH 4OLWL 2HLAA 3EJSA 3H2PA 4ZO6A 2IANE 3Q06A 2BOLA 5ICXA 4FZEH 4I4WA 4GS7C 2EJ1A 2WLLB 3F00A 5DZOA 1NLDH 4NT6B 2MCPL 4JG0H 1A65A 3GRGA 4PGBB 4Z7AA 4CNIA 2JB5H 1AKPA 2DLFH 4KUCF 1TKWB 1Z9LA 2J1YA 1MCWM 5CSBA 1OB1B 1KYOK 1WGOA 4DKEL 1MFVA 3FO1B 3GJEB 3O2WH 2E9IA 4TSCL 3WOVA 4EKXA 2WP3O 4DN4L 3VYPA 2X9ZA 1RULL 4M6OL 1DVQA 2HJKA 5HVWA 2CR6A 4WSKA 5IFJA 3WYRA 3KL0A 4NQDA 4OI8A 1JNJA 5EFIB 3VQ1C 2BVPB 1MHCA 3NRQA 4V33A 5D6CB 3TBTB 2VJ8A 4ZW7A 1NOAA 3PQYA 3QUXD 4OCRL 4P4KC 5INCA 4WF7A 2DWDA 1HOCB 2YAHA 5KUMA 5GZOC 1OWWA 2PETA 1BVLA 2DBLL 2HRPH 1F6AA 3IGUA 4U3SA 4XHQA 5DZLA 2JCCB 3W38A 4Y1SA 3OBAA 5F88B 1H6EA 3VM7A 1BEYH 1XF5A 4FXKA 2NT0A 1V05A 2PO6D 1IAMA 2EIJB 4FFYH 4BKTC 3W1ZA 4D0CA 3MVSA 1X7TA 3MJ9A 2HKFH 2XFXB 1ZA3B 4GSRA 3CFUA 4NAMA 3WJMB 2ZOWA 2QSTA 1OSZB 4HG4J 4PJ6A 2PYED 4F33B 4PJBF 1GOHA 2R23A 3NJIA 3QBTB 1MW0A 4R7NB 3DROB 2KPNA 1RJYB 1M7IA 1TZGL 1IL1A 1DDTA 2Q20A 5A6LA 4JFYB 1HDMB 1UCBL 3PRZA 4P2QA 3GXMA 4X7TB 5A2KH 1EEUA 1J88A 3BPOB 1OP5H 1HNFA 4AGOA 1MY5A 1A7BA 4CBPA 1KV3A 8CGTA 2E6PA 3RLSA 2E7CA 4LGSB 4QWWC 3N2JA 3OHXB 2JIXD 4ZMLA 4GQPH 1UM4L 5HTSA 3P11L 3KLSA 4IBSA 4PBVC 5ID0A 3FCSB 3QA3A 1TJHL 1TJGH 4HIHA 4FEMA 4FA6A 2R7EA 3RWIB 3DGGB 4X42A 3EBAA 1NUGA 1U3ZA 1ZJBA 3H54A 2O1AA 4K23H 4LPUA 1S3KH 3RFZC 3TFKD 3US1A 3FQRA 4NZRL 2EXYC 3FRPB 4R2GD 4RQQA 4QAMB 2I9TB 1A5FL 1PD1A 5BNXD 1QFWI 1WYJA 4LOEA 3GZPA 4CADB 4APQB 1QLEH 3VA2C 4ZS6C 4PRPD 4YDJA 3DI2B 4AOFA 4BINA 3EDJA 3QT2A 3SE6A 2Z93B 4U7KA 5HD8C 4CJ0A 1QUPA 2BVQB 2WANA 1RVFL 3HE6C 2K1MA 4G7YH 4J4PD 5F89B 4QMEA 3W9DA 1JZ2A 1X5XA 3BW9B 4LNVA 1ZSHA 4NM8H 1TPXB 3SDDC 4HWZA 1QLEB 1DJSA 3UL4A 4GS7B 4AW4A 3TT1H 5IUSA 3THMH 2A3TA 1IEBB 4MSWB 5BRPA 2DJUA 4J5VA 2HLFC 3SO3B 3L5HA 4FG4A 3D9AH 4IRZA 3OKNA 1Z3GH 2VZ3A 4U6VH 1I1AD 4FA7B 4O5LL 4HOWA 4CU8A 2F53E 4B50A 3FFCD 3MLYL 2NTFB 2BY1A 1TUPA 5T1DL 4AH2A 1BYOA 1QLRA 4XODA 3M88A 4X2UA 1MVFA 3VG0L 1QW9A 4BZ2L 2IALB 3PDDA 3Q6GL 3S5YA 1UURA 4OD3L 2NY2B 3S98A 3DOHA 3FTWA 4BSJA 5FDWA 4WW2A 3T1FB 5IEHA 5J13C 3BHBB 4DO4A 3JWOH 2FSEA 2I5YL 2W95A 1OANA 2AXFA 3CDFA 4WWKA 1HL4A 1INEL 1XEDA 2BFGA 3BKJL 3P3YA 1A4BA 4L3ED 4AT6B 2VLJA 1KTLB 1AS6A 5FYKE 2Y72A 3A6BH 4FLHA 4UTBH 4EIBA 5I1IH 1ZV2A 2FH6A 4KKNA 1E4JA 4KKCC 4P5KB 5AOIA 5I8KL 3S3SA 1L7TH 4UT9L 5D1XA 1F13A 3OJDA 2FB4L 4AGMA 1RZKL 2EYTA 3IJHA 4X4MA 2X12A 1F56A 3BIKB 3MRQA 4RFNC 5TQ2H 1L6PA 2DPKA 3QXUA 1SOQA 4IRJD 1N18A 3ZHDA 5ESVB 3IETB 1SQMA 4GEJA 3CH8A 4UDTB 4IYKA 2WW8A 3P4MA 3VRIA 3BAYA 3V6OE 1NCCH 2OJEB 1KCUL 4LBAA 4QRQA 1ZHLB 1N64H 2DM3A 5KYUB 4NHUA 2OCFD 3V4VA 1F1AA 3EDDA 2AGJH 3OAUL 4OFYA 2C9RA 1R24A 1TJXA 1C1EL 2FJGB 5E03A 5KBNC 3CHOA 3JYCA 3RL2B 1P7QB 3LOWA 4J12A 1OAJA 5B7MA 1KLUA 5HDRA 1AG6A 1SJEA 4NZ8A 4GG6A 5EBMB 2AJVH 3CFTA 2MOQA 5EA0L 4XNUL 5ACZA 4LCYA 3ULSA 1MFAL 3UCQA 3PWVA 2QKSA 1A1OB 2VM3A 4F8TA 3W2DL 2ZXQA 3QEUB 5AAWA 2B3RA 1UEMA 4QUOA 5AWNH 2VLKD 2Y7LA 3B2UD 1ZLSL 3OX8A 2OS7A 1D5XA 2YRLA 3T08A 2AQQA 1OGAA 4H0LC 5F7NC 4HZLA 1A7PL 4NM4H 5DUJA 3WMSA 3UAJC 4N1CA 2OK0L 3QUYC 3RFZB 2CO1A 5FOJA 3NFNB 3FF7A 1GTFA 7FABH 4YWGL 4OZHB 1GGIL 2ZCKH 3HN8A 1INQB 2XACC 2B4CL 1BMGA 5DCCA 4DVRH 4R26H 2NZ1A 4L4TA 1ZTMA 2ORBH 1WFNA 1BQRA 3NDZE 2BOCA 5IROD 5JW5B 4K5PA 3SDDB 4F9LA 3NAAL 1DN0A 1M6UA 1FGNL 1WAAA 4BQ6A 1DANU 3JWNH 4I0PA 5DGRA 1G7PA 2WLMA 2AV7A 1RZ7H 4MA1C 4L18A 2NX5E 2XFGB 3GNML 3ILDA 4I1NB 4ZFZA 2FO1A 2VAAA 2R2HA 2VO8A 4FTVA 3X11B 4HIEB 1KIPA 1CL7I 2OJZL 3SKJL 1FFOB 5JO5A 3B37A 2AQPA 2MPVA 3UZEC 4MD4A 5KSUB 2VXVH 4AGLA 3I3EA 3CSYA 4PP2B 1FV1B 1RXLA 3VFTB 2CXKA 2CIIB 2R2EB 2WYIA 7PCYA 5B39G 5L8LB 3D0VA 4HJJH 4GSDL 2XIDA 1QNIA 2GSGA 3JWDC 2N7SA 2ZUUA 3ECBB 4F2EA 3IJYB 5DYFA 4PMFA 1XBDA 3SE9H 1D3CA 2A73B 2MH4A 3KPLB 4M48H 4Y4FB 3ZKXC 1AH1A 1C8QA 2BNQB 2VZSA 3KPSE 3QISA 3BZ4B 3VD1A 3SCMD 4WEMB 4LEOB 5B22A 3VWJD 1E3XA 1N4XH 2H8PB 3RPBA 2QTEA 1B88A 1G6VK 1CFTB 1DVXA 3BP5A 2G4EA 4MVBD 4XAKE 4BFRA 4EDXB 1SLWA 1BIHA 4OZ4B 1A7OH 3QFJD 3L3GA 4KK6D 4JR9H 3IFOA 3DPDA 4GBXD 1I3GH 1T6VN 5DJYA 2J8UE 4G72B 3OPUA 5F7HA 3TN0C 2CUHA 3HE7D 4GNKB 3W9EA 4WHDA 3U4EB 1VA9A 5JQ6H 5EUOE 3D7PA 4MA7H 5I0XA 3D6GA 4FS0A 4ORGB 2VTFA 3F7VA 2A74B 1AO7E 3IMTA 3P3RA 4GT7A 5ESAB 1PG7L 1DLHA 5DVMA 5C9JA 1M42A 2JKLA 4PCKA 3BEVA 5IW3A 1R33A 2NSXA 4J2QA 4KQ3L 3N42F 4CVZB 1WJ3A 5AAMA 2JK5A 3L5XL 5JIKA 4OIIH 5ICZB 4JDEB 3LEVH 2NXYC 3QIBD 2GBVA 1TTGA 4LLYA 2Z91B 4NXSA 3RU8L 1JZEA 1JF1B 1RUPH 4U1JA 4B6ZA 1N0LB 2VDNB 4NAJA 3T71A 3UJIH 5JOPD 2VDKL 2HRHA 1U8IB 3P2DA 4L8DB 4N9GB 4OM0H 2WQUA 1I7UB 1NDTA 3MAWA 2XRAH 4UT6H 1UH2A 3GSOA 1EEZA 4HIXH 3MGTB 1TETL 3CMOL 4PB0L 3S88H 1SXAA 5L6YL 3RDTD 3P2TA 1NGWA 4BGDA 3ZQXA 1A6ZB 5MERA 1GH7A 1MCDA 2X4QA 1OK8A 5LWYL 1KTKE 2H3NB 4PJIE 1K72A 1LJMA 1E6JL 5F3BB 5K1VA 5HJ3A 1KY6A 1FBIH 4NFDA 4Y4KA 4J3SA 4HA1A 4PGEA 3D08A 1SLXA 5CFAA 4MJIA 3H4FA 3QORD 2JI3A 1SOKA 2FK9A 5DMYA 6CGTA 2BP5M 2H26B 4OQTA 1QI5A 2FTAA 1ZTXH 5C09B 3LRLA 4CVXA 3D34A 4H26B 1E4XH 3DSNA 5ABDE 1UB6B 2AKRB 1S8DB 1Q94B 3E6HB 1QFPA 3HI6L 4ZNEE 5C6PB 1BZ7B 4P2YA 5HHVL 4U6XB 2AJYH 3HHSB 5F1SA 3ZSSA 1Y0LB 1Y1DA 2P80D 2Y3NA 3HB3C 4G80A 5DR5L 4Z7WE 4WKZB 4LLVA 5SX4H 2YPLE 3QQ3B 4LCWE 2YPKB 3GS7A 3EH1A 5C6WH 3RZWA 4Y5XA 4YSTA 3QHZH 3NSXA 4K9EH 3ULVE 3TNMB 4LKCB 4TQPA 1BJ1H 3BSGA 1EGJL 3BUPA 3MFFB 4MZ3A 4WUKH 2PLTA 3ZKXB 4IBYA 3HEIB 3M1CA 4Z5RA 2BVEA 2ZT9C 4HCIA 4LCIL 1BYNA 4RZKA 1BQHG 1NC2B 2RCSH 2ZPKH 4XNDA 5E8NB 3LVTA 2QQLH 5D7JA 2D9QB 3EFDL 3OKMB 3T0WA 3CVDA 4PG9B 2J8UF 2X70A 4AJ0A 4YFDB 3GBNL 1H5BC 1A1NB 2ADGB 2GVYA 2YMOA 2G2PA 1FVDB 3S48A 2ZWLT 3QZLA 5CEZL 5C0AA 1TEGA 2DMKA 4N6QA 3BAXA 4NPYA 4FQCH 4D9RE 2JV6A 2FWUA 4GMSL 4OIBA 1FVEB 4JFDB 5C3LD 3LNHA 4APXB 4R5VA 2JKSA 3TJHC 1BREA 1KYUA 1OP3K 2F54E 1JBJA 1S9WB 3Q48A 4DETA 1IQDB 3CFDB 1ONQB 2M26A 3LKOA 1MW3A 1VGEL 2ZX6A 4M6ML 1K2DA 5FECA 1J5HA 2DQDL 1G5AA 4Q6IC 3QNXA 1T5KA 2V37A 3ISWA 3ZRSA 2BMKB 4FP8H 2CBTA 5MI0B 3WTTA 3PHOB 1VZHA 8PAZA 3LKPB 4X99A 3AUVA 2DD8L 2QHRH 1CGVA 2ED9A 3BFQG 2APTA 3BAEL 4JHWL 1Y07A 2WQXA 1BFOA 1C5BL 1MWAH 1YRKA 2VQUA 4JRXE 2XVBA 1E42A 4PRNB 2LU4A 2HLEB 2ZUTA 1GYAA 1MRCL 2Q0ZX 4XCEA 3FQ2A 2CDEA 5FCUH 3OMAB 1IUZA 4G42A 3ZDXB 2NRDA 3U7WL 1BD2E 4X6CA 3QPXL 1VHPA 1T1ZB 3IDXH 1XCTA 1W0YT 1E5BA 1LEIB 1CIDA 1MUJA 1NMCB 4NJAL 1P4BH 3BPLC 3MNMA 4F7CB 3CHSA 1A3RH 1ASQA 1KNOB 3CDGA 5ITFB 1KEGL 1BOYA 3FT4A 4WI7A 2C1OB 1QOKA 2X4UB 3KWUA 5DJZB 1MAMH 4MMXA 4JKLA 5CM1A 5J6HA 1L0QA 5CD5D 2WJ5A 1P7HL 5EULV 5FV2A 1ES0B 4MJHA 3N40P 4H8UA 4HOZA 4X9BA 4NO0D 2QKIC 1ID5I 4G1MA 4PLNC 4R4BA 2NY7L 2MQGA 3QXVA 1A9EA 1N59A 3CSTA 4QHKJ 4NQTA 3V5HB 4X5XA 4HJ0D 3BDXA 5TF0A 5ID1A 2CPUA 3K3QA 2EDBA 2VUYA 4POUB 4GQ9H 4KVCH 5KSAC 4WNQB 1BM3L 3LB6D 3MRCA 1DQKA 4LSUL 3T3ME 5FUCC 1IBBA 4B5ZA 4FCAA 1DBBH 4JFQA 5F9JB 1TVBA 3M1BA 4MS8D 4QRUB 5IBLD 5J56B 1P4LB 3ULVF 3ESVF 3QDMB 5B39A 4YN3A 4H13C 4HPYL 4QRPE 5SWZE 3HAEB 4X8XA 2JXMB 5DA4A 3BDYH 1UADC 3LSOB 4G70B 4RSVA 2LFGA 3WY4A 3VFSA 2P5WE 4WFHE 4PJDA 3F5WA 5CLXA 2NUTA 2J1WA 2K8QA 1EDHA 3IAPA 4TVPE 3G5XB 1AJ7L 2NY1B 3N44B 2IAMD 2XV6B 1WD8A 2Q1EA 1AR2A 1LLAA 3U46B 4J8QA 2H4EA 1HOEA 3P4NA 1H5BB 2J57A 1AD0A 1JPFA 5KOVC 3FB8B 4CVUA 4O9HL 2ZJSL 2JB6A 4UT7H 4A7VA 3QUXC 4U1IB 1FH2A 3HNSL 4B96A 2AEOA 4OSUH 4FC3E 4TMPA 4GH7B 1MG2C 1P69B 2WQAA 1QPXA 1A1MB 1F0LA 4JANA 4UI2A 4M7JH 3VCLB 2D4FA 5CLWA 3VDAA 3D0AA 4FLSA 4WY7H 4PGDA 1FF5A 4IM8A 4TQHA 3UTOA 2IPKB 5D1ZI 5GJSL 4XVSL 5ENWA 4LFHD 5FV1L 4BDVA 4DPAX 1WIUA 3SBQA 1ORSB 1OAYL 1CVRA 1JV2A 1INDH 1SY6L 4PWIA 1AZBA 3ZKND 1WFJA 3RDJA 4J3XA 1YAIA 3TURA 3RE0A 1CFVL 1F4YH 5DD3H 3BUTA 1IAIH 4RLDA 3O3EA 2YD1A 3QFDB 4MAUH 3H0TB 1U8CB 4J6RL 5JHDB 2X3BA 5I1HL 3C8KA 5F1NA 1WA0X 1UC6A 2PR9A 2ZUQC 1JAEA 5CP3H 1QYGL 3GBMH 2M83A 3L7EB 3MXWH 3FUJA 1OP4A 1WS7A 4JPQA 2GEEA 3S34L 1O6TA 3DX6A 4ABQA 2VWEC 2ZXCA 4NO2A 3BJ91 4N2KA 3OJ2C 2ZSWB 3WS6A 4BCZA 5E08H 2V9RA 3MV7A 4L05A 4AVIA 4FLQA 1HWGB 4OKDA 3B7SA 2BHYA 3V4UH 4XRCB 1FRGH 4R2GC 3DUHA 2HT4D 1NCTA 2Y24A 2NQDA 4HMCA 1U8NA 5E6ZA 3OLEA 1UWFA 3T3MF 2NNAB 3F05A 2DLEA 4BUQA 5I1DB 3S2CA 2J71A 3OLGA 5GGVY 4MMYB 1R1CA 5KSAB 4LCUB 4A2HA 3WHE0 3KLLA 1XTMA 4OZIB 5DQJA 1CGXA 3RTQA 3FTSA 3IS0X 1D7BA 3FTGA 3M8OH 4GXVL 1T0NA 2K6ZA 3VTTA 2WQVA 2EH8L 4NQCB 3Q0HA 1HK6A 4MJ6A 4Z7VF 4U7MA 2YMXH 4JFOB 4EF3A 4GO9A 1OLZA 5K33A 5IQ7H 3SO5A 2AJXL 2WNXA 3IDIA 4NZJA 3T0EA 5CLYA 5JOFA 2GY7B 4MB5A 3ZE0B 2R56L 3U1PA 1MCPL 3U1QA 1RZ8B 4YUEL 3Q1SL 5DFWH 1BQHA 1QFUH 2VITA 2VMCA 1AGFB 3RURA 1LEKA 3ARVA 1GSMA 4RAHA 5T33L 3K8MA 1CGSH 3QFGA 2PR4L 4HLJA 5CJBA 2E46A 4W4OC 1E28B 3VFWA 1PZDA 1NUNB 1UKQA 3MMEB 4IQHA 4EE2A 3AQXA 1MWOA 4GKSA 3HR5A 2UXGA 1KXQA 2PO6B 4C56A 1ZHKA 1T04B 1N8ZA 4X5RA 2BSDA 2UZYA 4IRJC 5AVYB 4LDEB 4DO5A 2MKWA 3FU8A 3Q05A 4KI5F 3QP3A 5T5FA 2PYEB 4FMVA 1DBJH 1G6RB 2J5LC 3EGSB 1YNTF 3D4YA 4N0YL 2V8MA 3WLBB 1CDBA 4W9ZA 5EU3A 1YUHB 5ALBH 4XBMA 4U2YA 1PLGH 2YD0A 3GXFA 3D33A 3QULA 2E9JA 5IEKA 4DW2H 4QOKA 5F6IC 3ROLA 1ZSDA 1OAZH 1GJUA 1RZIB 3IGFA 3HZKA 3BSZH 4YS4A 3L3HB 1LE9A 4KTYA 5I0DA 2OYPA 3MUJA 4M7KH 5AVXB 3ILEA 3U4BL 2BIPA 4AYSA 3TEXA 5I30L 3D4ZA 4Z7IA 1AIFA 1V3KA 2JIXB 3TBWB 1KTRL 3MRIB 4B7LA 1ZDSA 2G9HB 3F2LA 3X1FA 3B43A 3GSWA 4QLWA 4K94C 1MF2L 3B2UC 1WITA 4AC4A 2XG4B 4JRYA 3U4KA 2XZAH 4GUPB 1QQDB 4OJDH 5D96B 1IM3B 4JFHD 2OZ4A 4D0BA 3NPSC 1VGKA 3OKLA 3TN0A 5L2KE 1NJ9A 1FCGA 3V0HA 4G5AA 2GPZA 4YNYA 3VH8B 3L45A 3AZUA 3ZY7A 1Q1PA 5ERWB 3D50A 2D7TH 5E6RB 5C8JA 1JJUA 5F6HJ 4Y8DC 3OC8A 1QRKA 2UUDH 3VE0B 1SVCP 5CO1A 5T1JA 1HXMA 1XIWD 5CBAB 4KITB 4RWYL 1ET5A 5HYJE 3RUGB 5E2VL 1UYWH 5AEAA 5IVOA 3PJNA 4GYBA 4H8WC 2AK4A 3MV8B 2NW2B 4URTB 2R0KH 5IROC 1MI5D 1ZPUA 4ZI8A 3FQUB 3DDFA 3FTVA 2GY5A 1JG9A 1EHNA 1ZLVH 4FOMA 5DK2A 5EPMB 1BCIA 1RK1B 5DJ2B 4Z3JA 1FYTD 2QVFB 1I1AB 4HBCH 3DX8A 4EEEA 2X7LB 4RIRB 2A99A 3FFCB 3HG5A 1T4KA 4EPSA 2PN5A 3JWDL 3EYVB 1O9ZA 4PRBB 3AMKA 1DBAL 1DJYA 4KOBA 4N1EA 2IH3B 3QO1A 1AZZC 1IEAA 1PZUB 3KYMB 2G2NA 2WXPA 2G9KA 4ZFOA 3O6KH 5BRZD 3A6CH 4YJZL 4ZFFA 5TPWL 2R0WL 4L3EB 5LO7A 1JMZA 3GLAA 1MDAA 4KDVA 5ITBL 3CLEH 1T4WA 5IMMA 3MLRH 1HYSC 3UO1L 5C0EA 2V7HB 4H0IA 1KTDA 4G6JL 5HYFA 5J7CC 3BWAA 1JZGA 5FM4A 3CZJA 1LQBC 5AW5B 2VKXA 4ZMQA 4Y1AD 2P46B 1NMBL 2Y23A 4Q4EA 4IRJB 2OR7A 4YDMA 5T5NG 4NC1E 4ATWA 3HPLA 4FJ6A 4O02H 4X8CA 4Z1PA 4PQXA 4G9FA 1S9KC 1PS3A 2ATPA 2MQ0A 4MVBC 1P5VB 3VFRB 4PV9A 1CUOA 3H9SA 3KWTA 2BSED 3FB5A 5EO0B 1NEZB 4KK6C 3WMQA 1FL3A 4GBXC 2IDCA 1T3FB 2NZ9D 4NUGH 4XCNB 4B5EA 1N10A 1U95B 1AI1H 2BHFA 4GLRH 5BOPA 4A2GA 1OY3B 1QUNB 2W60A 4UTAA 2CNYA 1RPKA 5H37H 3GFUA 4AIZA 1T83A 4CA4A 2V7NB 1MIMH 4HIJA 1OCOB 3PGFH 4YBHA 4K8RL 6FABH 1JWUA 4N2AA 1I7TB 3BQUD 5E5LA 4YXLH 2GITA 1YUKB 5E9NA 4ELKA 4LMQE 3FCGA 3CU1A 1UA3A 3BIBX 3DV6B 4XMVA 3WG7B 1N0XH 1MFNA 3AB0B 1OF2A 3BRDA 3O2VL 1ETZA 4L4VD 2QR0B 3QIBC 4Y16A 3ZUCA 1CLYL 3IFPA 4DP1X 1D2OA 3GIVB 4P9HC 4YK4C 4ZFOL 2NY6B 5AVZB 1FN4A 3STLA 3HRZB 2NCEA 3PWPA 4X98A 3ULUH 1MEXH 5K9JL 4P3DA 4BFFA 3RGVC 5ALCH 2OMTB 5TF1L 4B3VA 1BLNB 4HDIA 2Q86A 4CSPA 2XKNB 3EXLA 2QEJA 2GTZA 2AMUA 5GPRA 3H3PH 3MLVL 3NIFB 2Y7SA 3P77A 4NWUH 2J88L 1N5AB 5DMKA 4Z7UE 3EH5B 1FDLH 1Q1JH 1EBPA 1WC7A 3ZL4L 3DXAD 3SGJA 4ZUWA 5E2TH 1F6LL 2GHWB 4JQIH 4M43L 4WKXA 2H6PB 3RHWK 1GMEA 4MNHA 4QRBA 2Z7YA 5SX4I 2BCKB 2OMXB 4W68A 4XO5A 3VD9A 3QJUB 1A4KB 3QORC 1IZKA 1M1XB 2XWTA 3QWRA 2ARJQ 4ABVA 3LXBA 3ARZA 4CN4A 2BP3A 3LS5L 2XWEA 1PFCA 5F1IB 1D7CA 3KDPB 2WSDA 4LCCB 4LKXB 4F91B 3QE5A 2YBGA 3ESUF 3RIAF 4ZUVB 5C07E 2FX9H 2FHCA 1CF1A 3HHRB 5CILL 1WT5C 1ZK5A 1UACL 4RAUB 4DN3H 1QP1A 5CUSL 3B2PA 4E5XA 4LHJB 5GZND 4EZLA 4FXGC 1JNHA 4J8RB 1S9YA 5TGBB 1E9PA 4S1SH 4PRIA 1QBLL 3OZKA 5LUMA 2FGWH 3VXSD 2OSLA 1QWHA 4OZGE 1IGFL 1NFDB 2AJUH 1A4CA 3GM8A 3SY6A 5BVJB 1RQ5A 1MY7A 2BERA 1DCEA 4KDTA 3ILPB 2IAND 3MLUH 2EDYA 3N06B 2K7PA 3QG6A 1FFPA 3SCMB 3TWCL 1N7MH 3VWJB 2GB2A 4CKQA 2VXTL 3A22A 1UOKA 4GRWE 2FO4B 1FNLA 2DJMA 3TPUB 1E9QB 2D03H 2PW1B 4LLMA 3IWUA 4JJ5A 4JN2B 3HZVA 5DZAA 5D6DA 1MFEH 4OLZH 1ZV9A 1X5JA 3HE7B 4I8DA 2HWZH 2GUOA 3O4LA 2O6PA 2WZPA 2DWEA 2ROYA 3WUWG 1DVFA 3NG5A 4R5XA 3MRHA 5DJ8B 3LKRA 3D85A 1P4IL 4KTEH 1AQHA 1A7QL 4PREB 2K9UA 2NLJA 1OP9A 3ZDZB 3G6JE 1F6FB 5DJXA 4DAGL 5DQDH 3NSJA 1H3VA 5AG9A 1IBDA 4N8PA 5DRXA 5J1AB 4F8NA 2Y2TA 4LASH 4BA8A 1WCBB 1WHOA 3QHTC 4HCRH 5GS2D 2BC4B 3QIBB 4ONGH 4ZJ9A 5HYIA 3FQTB 4XPGL 5EOTB 5DMIL 5IV2B 1TTRA 4NKIH 3TFBA 4I48A 1T0MA 5KVFL 4HISA 5J6GA 4JY6B 1MCHA 5CIPA 4HK3J 4BZ1A 2WM0A 4UUJA 2Y22A 5E24E 2VE6B 3C5JA 4H2AA 3RDTB 3KPNA 3QIUA 4M62H 4PJCA 3V52L 5FFOA 4WGWB 1FFNB 2HFEB 3QC5X 4JL2A 4Q4IA 4LK4A 1EJ6A 2LLLA 5ADPH 5TTRA 2RAMA 5CD5C 1DEDA 3GSRA 2WTRB 1QMUA 3PV6B 3B3IB 5I0YA 4B0MM 1PBYA 3D39A 2X2IA 3S8FB 4TUOA 3CFKA 3U1SH 1HI6A 5A2BA 4H20H 1RSFA 5DD5L 3ATDA 5F0PB 3U0PA 4U4IA 3G5VB 2ZD0A 1WQVT 1LO2L 1Z9NA 4HJ0C 2P47B 4HQQL 3VFNB 3WO4C 1PNDA 1F42A 3LB6C 1BXAA 5KJRH 4XPAL 5IBLC 1E4KA 2K3TA 1NCIA 3HW7A 4MS8C 2Y3AA 4PH8A 3TH4T 4G6FB 5DD6A 5G55A 2VMJA 3DC0A 4FXGB 1RUAH 2ZCLH 5T3XH 2HT3D 1C16A 3UTTE 3T65B 3OSVA 4N6RA 2ZX7A 1J8RA 5B3SB 4QD2E 1AC6A 2AEQL 2WLJA 2H1XA 5E1AA 4MJJA 43C9A 3BP7B 2CPCA 2YUZA 2VLLB 2IGLA 1JXDA 4J3BA 4KXZH 4WW1A 3KYKH 1C12B 2C1PB 2AMGA 1J9CT 4GRWF 5DZ9A 3IDGB 5C0DA 1KOAA 1R5VA 4XNQA 5IHZB 2OV0A 3NJHA 3ARWA 4NENA 4OV5B 1HXYB 4C4UA 4JL1A 4X0KB 4OLYL 1OP5K 2PP8A 2UZXB 4QHLB 3TF4A 1IGML 5L2JB 2F53D 2WQSA 3IMBA 4PI0A 5C0JB 4W9DC 2XV2A 2YK1L 4MKMA 5DTFB 1E67A 5IB5A 1JS4A 2DTMH 2OMYA 1DUYA 2VMDA 4K3JH 4XMLH 4OCXL 1G6RL 3D8MA 4LSRH 4G6KH 4NQSA 1IAII 4XBEH 3QEGL 3QXDB 1JD7A 1FNSL 1MXDA 4AMKH 5L7XL 2BRRH 2O5YL 2H2PD 4CMMB 3MRRB 5EWIL 1S3RA 3C8HA 2BNUA 4DVBA 4WJ5B 3BWUC 3UBFA 1QR4A 3GSVA 3QEQA 3T09A 2B9BA 2ZKHH 5FYKD 1PDKA 3WNPA 4F58L 1BG9A 1FORL 4L3CB 2DQHL 3GJFH 2E56A 4EIGB 1N2RA 3VB8A 3C8DA 4UMSA 5E6UB 3VFVA 3GK8L 1SLVA 3GUFA 5EZLB 4NNYA 1N19A 3SPGA 3TCLB 5IMKB 4NXKA 4JCMA 4NZTL 2UWEA 3X3GL 5GS1C 3U4AA 2EKJA 5GRXG 4H5SA 2YC1B 1OARH 1ADQH 2IPTL 3T1WA 5H4ZA 3EKCA 1Q9LA 4HWBH 1YPZA 2R4RH 4BFEA 1N67A 5E8OB 2MCAA 3MRJA 2TRYA 2WOBA 4G8GA 1CXHA 1LQSR 3BVNB 3PWNB 3CN3A 4CILA 3CC1A 2PP7A 1CT8A 2XZQL 4QXWA 1GGUA 1VF5C 4YSRA 4ZO8A 4V1DE 4YHIA 1IMHC 4XMPL 4OLXH 5IM7B 3LQAH 1RZGB 2GTWB 2VUOA 4NO0B 4PS3A 3U7AA 1R3HB 4DPRA 2HT4C 1PCSA 2FQDA 1QA9B 3WIFA 2WIMA 1QSVA 3NTCH 3QI9C 3O3BA 5CCGE 3IGKA 3K5SA 3JTTA 4PR5B 5FGCE 2X53A 2BINA 3RX7A 1ZV5A 3CSGA 4Z7OB 2I60H 2DB8A 4NRYB 3MRDB 4GSXA 4TUJA 5EZOL 4PLOB 1GPOH 3DRTA 1XEUA 4KKBC 2AJZB 3MLSL 3C2AH 3MV9A 3T4YA 1XMWA 4MX7A 3CFBB 3TESA 3HJEA 5FYLE 2BLFA 3VXNB 1MREH 4YSUA 5ETUA 3BSHA 2IH1B 5D1ZC 1CD1A 5F8QC 3UJTH 4HHWA 4JFUA 3R8QA 1ZVSB 4ENED 1T7WA 1QLFA 4GEIA 2NNFA 1EO8L 4IJTA 1S5HA 2D2OA 4P5RA 2HJFB 1Z5HA 3D2UA 1A9BB 4AJVA 1A7RL 1U8KB 3O2DL 1LMKA 1YEJL 3UZVB 1AHWC 1QHOA 1XCWA 4NQDE 2IAMB 3F7RA 5JW3H 1VACA 3NJVA 1K4CA 2KUTA 5KN5A 3U0WH 3EYFB 4XB3A 3HLKA 5A2AA 5FW7A 3BVWA 2AC0A 1T89C 3I9GL 2NX5D 4PLJD 1ECZA 5CEYA 5IGXH 3MX0A 4XPTL 1KJMB 5IBUG 4ONFL 4WTWA 3EOAB 4PJHA 1N70A 1WUNT 4AKOA 5BVPL 4FEIA 4RDQG 2EADA 3OPZH 3EDEA 4ODHL 4XCFL 3ZDYB 3BLBA 4JFPB 2CM6A 4EVNA 2XTLA 1O75A 3TL5A 3TV3H 3C6LA 4L1DA 4XNXL 1UEYA 2F1BA 4NNXB 3RX5A 3BD4A 3WHXA 4GAYB 4K3EL 4YDVB 3ZL1A 3SZ6A 1HINL 4HFUL 1DQDH 2VERN 4LSPL 1DQIA 2CJUL 3VXRA 2Y0SA 1ECYA 1G7MA 5EOQL 5H4YA 3Q5TA 1KXTB 1BX2A 2EDWA 3KBFA 2P44B 4DCQA 3ARTA 3A6OA 3QAQA 5H35B 1I7RB 1AANA 3Q13A 4FQQA 1SUHA 5I5IA 3SGEH 4P2QE 2D73A 3K4AA 5BZZA 3UADA 4JN1H 3T9WA 4H0HB 5DRZB 2O72A 3KPSD 4NSKA 4WV1C 3QW9A 3GTTA 4O2CA 5DLMH 4K94L 3VRLE 2TSAA 5HDBF 1P7KA 5DS1A 5FOBB 3JWOC 4ZODA 4XAKD 1H0DA 1L5GA 1ZS8B 2M1KA 5L9DH 3PP4H 4WK0B 3CH1B 4BQ9A 5LBSH 1BQLH 1JOIA 2VN6A 4QXGL 1T1XB 4ZX3A 4JFFB 4N87A 5IW1B 2V33A 2X2JA 1RFDH 1YDPA 2Q8AH 4I0KA 3VXMB 2FX8H 2FBOJ 3BT0A 4XPHL 5CHNA 3L7FB 3WIHA 2R39A 4OD1H 2ATAA 2X4SA 3HBQA 2Z7WA 1XGUB 1AO7D 5IFHL 4AI7A 4ZMNA 1A4AA 4E0RB 3QRFM 1MCJA 2O61A 3LRMA 3PGDA 1FZJB 2C7UB 2DL9A 3KPQA 2PW2B 1LO4H 4Z9KB 2P8MB 3L5WB 1GAFL 1U8PB 2CGZA 3GSQA 3RRQA 1IAKA 2JE8A 4F2MB 1KIUB 5C0FB 3WXVL 1G9MC 4PJ9A 2MJWA 4HS3B 4GG8A 5T3ZE 4Q6YA 4X5WA 5TK4A 1OW0C 4PGZA 5EV7A 1NPJA 3FUNA 1A8ZA 2EYSA 3EYOB 3EOTL 1DQTA 3WNIA 4QY8B 1A6VH 1TNNA 3FAWA 3VXTA 4BSWA 3WFDH 3T3PF 3UBXB 4M5TA 4RISH 2IADB 4PWFA 4YHMH 1CURA 3RWJB 2VNCA 2WMPB 3NCFB 3RGVA 5HGBB 2OXHA 1RK0A 4JDZA 2FR4B 2CMRH 3KD4A 3VNZA 2FLBT 2AF2A 1AHWB 1YEFH 3NSYA 4TULH 5AYQA 4RX4A 2J2ZA 3EHBD 5H94A 3WENA 4PRAB 3P3SA 1QZNA 1AXIB 3ATEA 4P9MH 1MRDL 1NFIA 1JRHI 3RWGB 1R3LB 3BZFA 3X12A 4ZZFA 5F7UA 3STZB 3V79C 2ZCZA 4QT5A 2NPLX 3IMWA 1XHHA 2GJ6A 5D1XE 3SSGA 5LGJB 2H32A