4A04A

Structure of the dna-bound t-box domain of human tbx1, a transcription factor associated with the digeorge syndrome
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
189
structure length
181
Chain Sequence
GVSVQLEMKALWDEFNQLGTEMIVTKAGRRMFPTFQVKLFGMDPMADYMLLMDFVPVDDKRYRYAFHSSSWLVAGKADPATPGRVHYHPDSPAKGAQWMKQIVSFDKLKLTNNLLDDNGHIILNSMHRYQPRFHVVYVDPRENFKTFVFEETRFTAVTAYQNHRITQLKIASNPFAKGFRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the DNA-Bound T-Box Domain of Human Tbx1, a Transcription Factor Associated with the Digeorge Syndrome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords T-BOX TRANSCRIPTION FACTOR TBX1
total genus 39
structure length 181
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00907 T-box T-box
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.820 Mainly Beta Sandwich Immunoglobulin-like Transcription factor, T-box 4a04A00
5BQDA 2X6UA 5T1JA 2X6VA 4S0HA 4A04A 1XBRA 5FLVA 1H6FA
chains in the Genus database with same CATH superfamily
2W95A 3S48A 2FX7L 4I7ZC 4NRXA 2JKWA 3HHRB 2DJMA 1MJUL 4YDJB 1RCYA 2F53D 3Q2LA 4FFYH 4TNWK 1NC2B 2X6CA 5DWUH 3KWUA 3WN5C 2OULB 2GAZB 3D52A 4U1NB 4GIOA 3RKDD 1EHXA 1G9EA 1E43A 4LOEA 3UAJC 3KPPA 5ETUA 4L3FA 3COOA 4OSUH 2DMKA 4ANVA 1CBJA 4HIEB 4HJ0D 4FQ1L 3LQZB 2NW3A 4XPAH 3VFRB 2G4EA 3H1ZA 3BHBA 1MKFA 4YHZH 4HCRA 1F58H 2ATKA 5GJSH 4HWEH 1ILUA 4QKTA 5DK0B 2N7BA 3B7SA 2FSDA 2P8LA 2HX9A 2BVOA 2K6YA 1HHIA 4XX1E 4Z7VA 5A40E 3WIHH 1J5IA 5I1HL 4ZMXA 4X6CA 4JFEB 3TH3T 1N3NB 5GGUA 3UYPA 2CDFA 1SQMA 3BD3A 2FH8A 1HXYA 3JSSA 1GKOA 4ODSH 3IS0X 5CLZA 3L1OL 1IVLA 3ZKND 1RZKL 4TVPL 1K9TA 4IS6A 4HFUL 3EDJA 4NQSA 5B7MA 1R5IB 5DC0A 2GJ6D 3KHOA 3R06A 1GGCH 43CAA 4Z5RA 1SLVA 2GK0B 5I76A 4UILL 1G7LB 1JZ2A 4MMZC 2E6PA 4ANUA 3QEGH 1XXDC 3ZGHA 3DX1A 3S34H 3T1FA 1NIAA 1H3GA 1I82A 4HH9A 5CD5D 1R47A 2IF7A 4FZEL 2WKOA 3HR5B 4L4TA 5A2LH 3BQUD 4G1MA 2OMUB 3KPSE 3V0HA 1P0SE 3DXAA 4LIQL 3MBXL 3CCHA 5C07B 3T2PA 1CYGA 1E8WA 1FFTB 3ARFD 2FX9L 1MFCL 1BVNP 3BDYH 3QJUB 4LCVA 4NZDA 2EDFA 4WTZA 4X50A 1DSYA 1LO5A 2PCFB 2XYCA 3FJTA 4N0UE 2VLKD 3Q5TA 1AZNA 4O02H 2LQRA 5A3ID 2K1MA 2FX9H 4JE0A 1DQJB 4JFDB 4QRTA 2DKSA 2ICCA 4WEBH 5KWYC 3GK8H 1VSCA 3ZTJG 1XDTT 1CFTA 2EXWD 3FL7A 3FTSA 1SDAB 3O6ML 5I0YA 5JIHA 1KJ2L 3CXHJ 3IWUA 5FA4A 2CGRH 1CF8L 4YOKA 3BPNB 5DJXA 1BIHA 5GRUL 5EF1A 2YPLB 2J1KA 4Y4KA 2MEJB 5DYOA 4ZOCA 2LTQB 1NAMB 1J0IA 1KYOK 3MRJA 5DHDA 2F61A 4PMEA 2YUXA 4ZXBC 3EXLA 3VSQA 3CV5A 3MLXL 2EDRA 4NKQB 3HE7C 2ZONA 2N01B 4OV6F 2ZOLA 1F11A 2FZ3B 3S97C 3CHSA 1IEAB 3CH8A 4PYHA 1YN7A 3WN5A 1LEGB 2VNCA 4IIZA 2XTLA 4MJ5B 4QRPA 3X14A 3STZB 1NCHA 1II4E 1RUQH 4GINA 4FQCH 2Z6FA 4XN5A 1L5GB 4CSSA 2PTVA 4DQOL 1T21B 4G7VL 5CZXD 3AM8A 4AZ8B 1A7OH 4PRAB 3DMMC 3V9FA 4U7SA 2DJUA 3IDYB 4G9DA 2JQAA 3SIKA 1ACCA 4KNSA 3CH1B 3FB6A 3LV3A 4JGNA 1NGZB 1TPXB 3Q5YA 4NQDA 4PGCB 4TOYL 2CDGB 1H3VA 5DJAB 1ORSB 4HWBH 4TSCH 2WZPA 5HYJD 2ADIA 5LCVA 5SWSD 5IFAH 3TNNB 5BXFB 5EU6D 2LHAA 3X1FA 1YMHA 1RZGA 2WZ6A 5AL8A 1NCGA 3IXTA 2WNWA 3T8XB 1A1NB 1NCBL 4JEGB 1B2WL 4NAMA 4XNYL 4OJYA 1UG9A 4ZUWA 2Y5QA 3G9VA 2YIHA 3PE9A 3WNNA 4ZO8A 1D6EA 1HQ4B 4BZ2A 4NZJA 2JIXD 1HDMB 1FBIH 5I1CH 4GS7B 1ZTXH 3D39B 4G7YH 1JPST 1KJ2A 1XD1A 2YD8A 4LDOB 3SDXB 4B9ZA 4XP5H 1UM5H 1ORSA 5EU7C 2JXMA 3CSFA 1AJ7H 4E9VA 2ZICA 4Y19B 1RL1A 5CJ5A 3QQ4B 3D9AH 4HIQA 1GC1C 4PW3A 5IWLC 3RDTB 3RGVC 3B2VH 5DRNA 3ZT6A 4O51A 3TFKD 1P7HL 5I1JH 3OZ9H 3LIZL 1HVXA 4MWFA 2ZG2A 4PSRA 4OLVL 4ZDHA 4NCDA 2A1WL 3MRGA 3S4SB 3PFUA 5IF0A 4MJ5A 4LARH 1QVOB 2PYFB 1LEGA 1F18A 1JPTL 1I8IA 5FUOL 2KPWA 3INUH 3LHAA 4KZCA 3RVVD 3C60D 3JT0A 1QKZL 4JRXB 2HVKA 4QRRA 1NGQL 4KMQA 4XO3A 2GBTA 2H1XA 2ADGB 5BRZA 2OKMA 2CBQA 3NJVA 4FLRA 5AVXB 4FQ1H 5EWIL 4LSSL 5FKAA 4KK5D 5T3XE 3UEQA 5K39A 2EC9U 2AEOA 4Q9RL 5JIMA 1FC1A 4I0PD 2FJFB 1I31A 3KH4A 1UURA 2YPLA 1MFMA 4H26A 3ULVC 3D5OF 2EDNA 4D0BB 4PHZA 5CLTA 2HH0H 3BEWA 3VX0A 1S3KL 5JQ6L 1MCQA 2VIRA 3HUJB 1MVFA 3ALWA 2J21A 2AJZA 2I27N 5KJRH 2Z8WC 4ZFOB 1F42A 1FI8C 1WWWX 5TK2A 2B7DT 4G7RB 2Z91B 1BD2E 1OK0A 1I8UA 1MUJB 2EAEA 2N7SA 3GZKA 5D1XB 3BAEH 3Q6GL 4ZMOA 3FHEA 5M7QA 2G9HA 1EBAA 1NIDA 4ZTOH 3WFEH 5D5MB 1GVIA 3BUTA 3NFSL 4NEHB 4TSAH 12E8H 4TNVF 3EO1B 1B4RA 4HPHA 3K6SA 4XX1G 2WBJA 4BWTA 3AMLA 3FYIB 2FLBT 1HCYA 2ZNWA 4AKQA 1NSNL 2C7FA 4YLBA 3CZFA 4YK4C 5DUJA 3KEDA 3MRIA 3MFFB 3T65A 4MQ7A 3BH8B 5MENA 4ZMVA 5CBAA 1P5UC 2Y5TA 5CJXC 4J3XA 3UZVB 4XVSL 3II1A 3I3BA 5D7SL 5D2NE 2AGJL 5IG7B 4E41A 5C2UB 2I5YH 5F72S 1R5IA 2XZAL 3LRMA 4I1PA 1Y6MR 2RTTA 3V0EA 4ZPVA 1D9KC 3V4VB 5I8KL 4P2QE 1R34A 2HPOA 3SO3B 2Y7SA 3TO4D 5IB3B 2W9EL 4HJTA 3L2NA 5D1QC 4X4KA 5C0BB 3V0JA 2C3WA 2J6WA 3PQYB 1JNJA 3LPWA 3I75B 4BFKA 4JO3H 4N2EA 5DHVH 3Q2VA 5HGHA 4YE0A 1T1YA 5AKTA 1BAFL 2P8LB 3L45A 3MODL 1FPTL 1X3DA 2H6PA 5BW7C 4KJWD 1HCFX 5A3IC 1EJ8A 4NUJA 2BCKA 1YEJL 4WSKA 4MZRA 25C8H 4ZMTA 3N41B 4Z7UB 3A5VA 3ASNB 3GLDA 4RESB 4IIQB 3L48A 4X5RA 1EIBA 2V33A 1WTGT 1I7RA 4ANWA 4OF3A 1S5IL 3VTAA 2W80C 1NLDH 4ZUVA 4DZBB 1BECA 2IAMD 4OCYH 4FEMA 3HUJA 5TQ0L 1MDAA 4KTEH 3MJ8A 5EUKA 3HCVB 3X1NA 4C4KT 5JW4R 4P5TC 1U2HA 5J11C 3A22A 3Q1SL 4JDZA 4PGBA 5IFHL 3ZYZA 4XWGL 4BQBA 4LVNC 3ARZA 4X9FA 2A9ML 4W6YB 3DPBA 3K1KC 1WFNA 2EXYC 2ZUWA 4DESA 4FI6A 2E5EA 1HX0A 4ZAKD 1S5IH 3BVNA 2BP5M 2FYVA 3QQXA 4JLRA 4XN1A 2DDQL 4X7SH 5DR5H 3QXDA 5IVXF 5HJ3A 4H4NA 1KEGH 3H3PL 1G7PA 1PYWA 5SX4H 3ZL4L 1AIFB 3ZKXC 3IGUA 2BWIA 1NM9A 1KNOA 4IRZH 4OBRA 3CFQA 3OF6A 2EEDA 5F7KC 1F3JA 1Q9OB 3MV01 5I17A 2O93L 1CGVA 5EBGA 1GR7A 4MWFB 3BKMH 3BISA 3RWHB 4P5TD 2BVEA 4YJZL 2F8OA 1BEYL 1BVZA 3HE7A 5SWSB 3UP6A 5A43C 4RAHA 2ZZUT 4U49A 4PJ9B 2YJLA 5LVEA 3MLSH 4F9PA 2RR3A 4GAGL 3ZDZB 2CKBL 4D0CB 1I7UA 3RGBA 4ACTA 2D7OA 3MA7A 1BAWA 2FO8A 3VFTB 1IAOA 4UOW0 5CMAB 3KBEA 5SV3A 2V7HB 1DQQB 4XP6H 4KXZI 1HKFA 1MCFA 1MJ7H 3D39D 5J3HD 1L0QA 2G3NA 1PG7H 2PYED 2AEIT 2XZCH 2NUTA 4NFDA 4S0HA 4JHAH 4Y1AA 1XH0A 3K5RA 2B2XL 3TN0A 3UPRB 5J57B 3E1F1 3FT0A 2F54B 3LCYA 4FF9A 5I1GL 3IRZA 4B3EA 2E9JA 3VFWA 2HJLB 1OCCB 5EA0L 3CDGB 1M3IA 2VZUA 4PMFA 4H25A 4NN7C 3SJVA 3X2QB 2NY3D 2VLKB 4ELDA 2ETWA 3TH4T 3EOYG 3W9DB 4PJCA 5BRZE 4ZNEA 4BSVA 4MMYA 3EG9A 3ZRFC 5AAMC 4NKIH 1FH5L 3L54A 3SGJA 4TQ8A 3HE6A 3U30C 5F6IB 3JBG7 3LS4H 3IE9A 4YNYB 4EI5A 4R83A 1T0NA 1E40A 5FDWB 4AYEC 2XWDA 1UT1A 3OQ3B 3CFEB 5IW1A 1CFVL 2ZX5A 4J3OD 1ZHKB 4KV5F 5I8KH 2GSIB 3QQ3A 4F91B 4X8GA 4NZ8A 5DMGD 7PAZA 2DICA 1K6QH 1WIUA 3UBXA 3ECVA 3NEEA 3UYRL 1FFNB 3WFCL 4MNGB 3TA3C 3V7AG 4FQLH 3DA0A 2ZXCA 2W92A 3APNA 3IM1A 2LT9A 4Y4KB 2ICWB 1DLHA 2ZF9A 1J8HA 2B9AA 3T4AC 2G5BB 4X83A 2NY7L 4MA1C 2GYSA 3MGAA 4OLVH 1N59B 1OAJA 3GMQA 3X11B 3N44B 4HUXA 2YMXL 3QJHB 1WSST 2YD5A 1WAPA 5KJRL 3LN4A 4UQ9A 4Z7WB 3NCCB 3QH3A 1XVSA 4ZOBA 1HINH 4YSAA 3IE4A 3B34A 5HYSG 4XRCB 1KJMA 2B20A 4N8PA 5IK3B 1J0JA 1H6FA 1NCAL 3UAJA 2OMUA 3CZSA 5HHVH 4PJXB 3LEVL 3C60C 2X4PA 2I69A 2VZVA 9CGTA 4XMTA 1OP9A 2WINA 3L4CA 4UF7C 2OMBA 4OLXL 3NZHH 5KSBF 4F7TB 3PJLA 1IQDA 1R0AH 1GC1H 1HHJB 3MJ7B 1WAEA 3SKNA 4WFHD 1Z9PA 2EJ1A 4Q74A 1SN5A 3F00A 3KLSA 5EZLB 4CGTA 4Q58C 3EOBB 4AYDC 4H2CA 1OW0A 2ZG1A 4N8VA 4CAGA 4PS3A 5JNYA 5DMGC 4DKDC 3BAJA 2K4WA 3O6FB 2YRZA 4APQC 2ZP0T 5F7DB 4ALAH 4KKCD 4MNQD 4X6CB 1E30A 1SBSL 4XHJD 4PIBA 3UTTE 3U2SA 4KKBC 5E4EB 1ZXQA 3QRBA 3UERA 2BERA 5ESAA 5ACMA 1I3RB 1S7XA 1NAML 4HHAA 2B0SL 3EO0B 3VXME 3OKKA 2WXRA 2DQGH 4XCYB 4NM4L 4E5XG 1XGRA 4YR6B 3UC2A 1FE8H 3T2NH 5AB9A 3D9AL 5IB1B 2J8UA 2WLNA 4YZFE 3W57A 3MRDB 2Y25A 5EULV 5IP4A 5BMFL 5BRQA 1DBBH 4FTVA 3DVGB 3QUZB 3CFTA 3S36X 4FG0A 4XP5L 2ZKHH 5EO9B 1E27B 4ADIA 1BBJA 4GKZB 4CL7A 1BD2A 1E9QA 3JWOL 2BS71 5C0GB 3MSPA 4NO3A 4PJAA 1SXCA 4XNYH 4F2FA 5JXEC 1G9NC 4HWBL 3FT1A 4HGWB 1OY3B 5HVWA 1NPJA 3I9PA 4PJBF 4KY2A 3CVBA 1AE6H 1XSOA 5CWSB 2OMTA 1HEHC 1S7QA 1PJWA 1DBMH 1YPZA 3SPCA 3ZR6A 3KVDD 1YEGL 2OSLB 1EXHA 2Y36L 3RA7H 3WXVH 3N9GH 5BOJA 1EUTA 5JDSA 4HALA 2VLLA 4PTUB 3VXTA 5KVDH 3CBKB 4XAWH 5JDJA 4PS4L 4JN2B 1E5CA 3CXDH 4R2GD 4JFZL 4LHUG 4NAQA 4G9FD 4NI6A 4LLVB 1XIWA 4NC2B 1S5HB 3QFJE 3I50L 3ZUNC 3APCA 2GT9B 2C3HA 2VWEE 3ES6A 3LQAL 2J8UF 4K2UH 2W07B 4AJ0A 4L8DA 1AOZA 4OFKA 1L9NA 5DK2B 4ZFQA 4F15C 3FQUA 3P4NB 3WLBB 3E3QC 4NJ9H 5L4JA 4AK2A 3GXFA 4HF5L 3EUDA 3Q8FA 4IDJL 4F3FA 2H1PL 5GGQL 3A0OA 2EEAA 4L3CB 1IBHA 3TEWA 1Q4NX 3U2JA 4XPGL 1HOEA 3GSVA 2I25N 3M1BA 1U8MB 4N90D 4NGHH 3ZYJA 5ISZD 2PW2B 3LIUA 3NZUA 4MXVE 1NEPA 3FTGA 5EOCL 5CEXA 3G6JE 2IAND 1A7QH 3N04A 5CD3A 2CA4A 1R24B 3MBWB 3CD4A 4ZFFB 1DCEA 2NCMA 3UTQB 3D0VA 2HN7A 1L9MA 4UOQA 1S7TA 1X5FA 2DB8A 1EJ6A 3BPLB 5C08D 3V6ZA 4WI0B 4F8OA 3ZHLA 3ZRSA 3WDJA 1QLRA 3M1CA 1IBDA 4GB9A 3GTNA 2ESVA 1FZMB 3DJSA 3E9TA 3O41A 3L4ZA 4PWHA 1YG9A 3CDZB 2UWEB 3S35H 4PJ7A 3S96A 2OQJA 2IGLA 3DLQR 3BQVA 3L3JB 3ZE0B 5L4FA 3D50A 4OF7A 4L8CB 1ZHBB 4XZUA 5LCVH 3AWEA 1AP2A 3V0AC 1G1YA 2CRIA 1SOKA 3SQRA 1Z9LA 4WW1B 4YN3A 3IFNH 1RK1A 3B9EA 4Q89A 3Q8EA 2HG5B 5FO8A 4J27A 5E4EC 5IVNA 3D2TA 3A4AA 5EC2A 2RCSL 2J88L 1KBGL 4X6DE 1FH5H 4TXVB 1T7WA 2DLFL 3JTSA 3MVSA 1T22A 4JY4B 3QUML 2C3GA 2R0WH 1ZV9A 4IDLA 2UUDK 3RWEB 3WUWA 2VC2B 2VR5A 2XXCB 3U79A 4WFHE 3BP5A 1N5AB 2W38A 2EDOA 4KKAD 3LRGA 5F3FA 4UOZA 5FB8A 4WWKA 3ZL1A 2ZUVA 1XD0A 5K9KA 4X6BA 2JB6A 4A2EA 2YAMA 4M7JL 1V7ML 4XBPA 2Z0BA 2AXJA 3FFCB 4QXGH 4HCGA 4FG4A 4IBTA 1N9PA 2WVTA 5TDOB 5EZIH 3LHPL 4WI8A 3IFLL 3QG7H 2QSCL 2QPDB 2VOTA 5I28A 1SJEB 1WG3A 2VXSL 4JCWA 1PLCA 3BP4A 3V6ZB 3CX5J 4OGAD 5CGTA 5DRWB 3EBAA 5JORB 1FFQA 2WSKA 1LO0H 4U3HA 4B6ZA 1WBZA 3IDIA 4HULB 3EYVA 4AV4A 2R2HB 1XF4A 4M93B 3QUXC 1RJZA 1JRHH 2YKLL 2ZKYA 3Q6FB 1A3LL 1G6RL 2X2YA 4ZO7A 3ZKXB 5IVOA 5FGSA 1EGJL 2R4SH 1WH0A 2MTPA 4RVBA 5B38B 1UM5L 3S5LG 2JJTC 5C09B 3VGGA 2WLIA 4YPGB 2ITCA 3E7JA 2Z1KA 3GEFA 3RVVC 1I7ZB 4XMPH 5HI5D 4BH7A 2MIZA 1B6DA 4PJ9C 3VFUA 2CA3A 4G7SB 2P8PB 2OW6A 1FFOA 1OL0A 4HQQH 4N9GB 1OOAA 2R23A 2HH0L 5B1JA 4BM7A 4RMWA 1IGTB 4AEIH 1Q0YL 4GW1B 5IROA 3CQFA 3TP4A 3FT4A 4BIKA 4J3OG 4QRPD 1MCRA 3WTYA 1DVTA 4HS6B 2K0RA 2EO1A 5L88H 1IAII 1E5BA 3VFOA 2HJFA 4FD0A 4RLDA 5H4ZA 2WLLB 4XVOA 1A64A 3ZZQA 1JPTH 1TQTA 1M7DA 2YPVA 4YHLH 2F5BL 5DRWA 2CO6B 3KLKA 4TTDC 3L9YA 4XWOC 4QRQA 3GSOB 2AXGA 1H6UA 1PLAA 3T4AB 4Z3JA 2H41A 2WPGA 4OD3H 3H9HB 5I15L 5I6NA 2D31A 5AOKA 4YDKH 3CNKA 2VL5A 3GMPB 1U36A 3FSZA 3L7EA 4TUJA 2ZKMX 2WUBH 3AUWB 4QHLA 3SPIA 4KQ0A 1PG7X 4U0RC 1RUAH 2F1AA 1DFBH 3K2UL 2YARA 1AGEB 4KI1A 4PJ8C 3S35L 4EN3C 5AB1A 5FECB 2AXGB 1A4AA 2RAMA 5F8QC 5KVEL 3IJ7A 2HKAA 4XNAA 1XCTA 3ISRA 4QXVA 4AQ8C 2HLFD 2EH7H 1KY7A 1ZVSB 4EUPG 5MP6H 5I18H 1A3ZA 3QDMD 3HNTL 3C12A 5C0IA 1RK1B 1U3JA 3ZX1A 3HFFA 2OR9H 3T6XA 5IMKA 5G4OA 2DQHH 4F57H 2AK1H 2WZ5A 3MJ9A 3QRGH 3IK2A 4P3DA 4ZMNA 4L8CA 3SDCB 2XCMC 3D4YA 1WD8A 3QXTA 4GIPD 5GZNA 4GBXB 1AGFB 4OGQC 3TU6A 3GNMH 2KZKA 3CIQA 4AVHA 4EQ2A 4OIBA 2QL1A 4GIAA 2UYLB 4QXWA 5L2KD 1NC2D 5I66A 4X42A 1OAXH 5CLXA 4HD5A 4HF5H 1T0OA 1E4HA 1VADB 1VFUA 3FU8A 4IDJH 4ZS7L 3S34L 3NABH 4GT0A 1JVOA 1TYEB 2K78A 2A6KA 5FK9B 3QIBD 3RGHA 3A4FA 1UD3A 1IGYB 3OR7A 2OZ4L 5CJOL 1ZKAA 4ZTOL 3MOBH 4P5MA 1INQB 5D7LD 1XF5B 2FO4A 2R2HA 3G04A 4RWYH 3M7FB 3Q1EA 1CFQA 2LU5A 1XFPA 1G43A 3AQDA 3ECBA 3B7UX 3QZWG 3CU7A 4IGBC 1SGKA 4KTYA 1ZA6A 3TNMB 4Y5VC 5DJ6A 6FABL 3WFZA 1SJEA 4P2OC 1N8ZA 1K5WA 3MUGB 4XXCA 4JFQA 3PV6A 4PJ5D 1T1WB 2VDOH 3RAJH 3RZWA 1PNDA 2V2WA 1PAMA 1SN0A 3NJIA 2GJPA 4I4WB 1MVUA 5I26A 1C7TA 4X5PA 1XCWA 2WP3O 4N86A 1MG2C 3LQAH 4K2UL 4L3AA 1LM8V 4PJFE 1TTUA 4N8CH 4JHWL 1LO3H 3FQUB 4FQXD 1P1ZB 2BRQA 2X41A 1F4XH 3DJRA 2WXKA 2WAQA 4KZEL 3H6JA 3WTTA 5I1KL 4BRVA 2ROXA 1JGLH 2D3NA 2X28A 4NC1E 3PWPD 3C09B 5CFHA 3RWJA 1YECL 1IT9L 4PGZA 1XZWA 3V4PL 2ZX7A 2XQBL 3TPUA 1KSRA 1XX9C 2O5XL 1TITA 4LHQB 4QJ5B 1XCQB 2EYTB 2AV1B 1TMQA 1SPDA 4KK6C 3TIEB 5IV2A 3CMGA 2ARJA 1IX2A 1Q1PA 1ZJBA 5HYJB 2VMJA 2VDLH 3ARGB 3CFEA 5IW1B 1BOGA 4KI5D 2OSLA 1QI3A 4QHPA 1VZHA 2ICEA 5FUCE 2E4FA 3HE6B 1NDMA 1SYSB 4JY5H 3UOAB 1DVZA 3H4FA 5CWSA 4KJWC 4N2AA 1TTAA 1OTSC 4K71C 2Y22A 4HKBA 4PJCB 1YC8A 1T0PB 4CVUA 4JFSA 2DF3A 3DGGB 4JRWA 4OF5A 4PJCF 4FJYA 4GAFB 4Z0BL 4O00A 3MRLA 3K2KA 4NN5C 1S7TB 4X8XA 3UTQA 1BBJB 2HT2D 2A83A 2YBRA 1RUAL 5GSVB 5DQJA 1RZFH 1WAAE 2F54A 2VR8A 2EXSA 5AZUA 2EDWA 3WJMA 3O0RL 1XGUA 4TOYH 2DD8H 2VXTL 4GQPH 4ZPTB 1KPUB 3QDAA 9PCYA 1U8OA 3GLEA 4Y16D 1U8MA 4Y1AB 5I15H 1VCAA 3GS4A 3OLIA 4TRPL 4JREB 2PPCA 2PN5A 5KBPA 3V5HB 1S7XB 1HN1A 2DZEA 3AU0A 3RNKA 4RFOL 5TPWH 4MDIB 2NTFB 4E41D 1RUQL 3GRWL 1H3TA 2Q87A 1UB6B 3WCYA 1O7DC 1KYDA 5KYXB 1ZDSA 1KLUB 3CZEA 5GRYA 2BIHA 1JF6A 2OMNA 1H8OA 3L9RB 4ZUUA 3ABKB 2YFNA 3MLXH 4HHGA 1EZVY 3GLAA 3JWDH 3HE7B 3F7LA 4LLVA 5EEYA 3FU0A 4R90L 4Y1AE 2IH8A 2PPAA 3MJWA 1Z9SA 4OFYA 2DPKA 2YAPA 1JGIA 1ZT1A 4A2DA 4YE4L 4P57B 1NUNB 5I17B 2JCCF 2YAEA 4QRSA 4PTUA 3VXTB 4XPFH 5EEUA 3DX6B 4ODUA 1AR1D 2BOLA 2R56L 4CDGC 1ZGLA 2WCSA 1YQVH 1OT2A 3CVHA 3T3PE 4Y4FD 3BPNC 4EIZC 2O30A 4TV3A 4D8OA 3FQTB 1YPZB 1P84K 1OAQH 1A3LH 5C0EA 3F65A 1YY8B 3PP4H 4X2UA 4FNPA 1YPZF 2DWDA 4YO0A 2VR4A 2EE6A 3GMLB 1TPXC 4AVKA 3N41F 4N2CA 4NT6A 5IMMB 4X4XA 1IMHC 3U0WH 1COBA 4C58B 3O8XD 1TQSA 3LS4L 4PJAB 5JMOC 3UP1A 4NO3B 1J5CA 1AO7B 3LH9A 4CN4A 4D8PB 4W9LC 3F62A 4LLDA 4BZYA 5BS0A 1X44A 2FLRT 4OKDA 1N2RB 3CSBA 3V2AR 3RX9A 2P48B 1IM9B 1U4EA 4TULL 1RAMA 1UXSB 3DVGA 4Q9BA 1SLXA 4ELMF 3B2PA 1BM3L 4UQDA 1NEZA 1ZLWK 1TEFA 5I30L 5I9QC 1JNLH 4YHKL 2YAQA 1T4KB 1HI6A 4MVBC 4AENB 4PBXA 4OQTH 1OEZW 1FFNA 2X4QA 2YD3A 3UBXB 3NJNA 3HOGA 4X4MA 3G3LA 4AT6B 3ULSA 1QRNA 3P77A 1QFWL 2A6DB 3MNVA 2Y3AA 5ESAB 3VI3F 1BVOA 3DX9A 1ZHKA 4NBYB 4I0PA 3MNMA 3KD4A 5AVYB 3CTTA 3PQYA 2OMYA 4MAYA 1E67A 4GRLD 1LTXA 2E75C 4LBEA 3ARED 4EI5B 5DQDL 4H8WH 4AWJC 4JO1H 5IB3A 1VGEH 1YC7A 2UZXA 5T1MB 2DQIL 1OO2A 4BSVB 4N85A 4FC3E 2X3BA 1OE3A 2EIKB 3F12A 5JUEH 2YD9A 1CO1A 2CRZA 2QMKA 1OP5K 5E03A 1W0VB 3LKQA 4EZJA 1RIVL 1KCRL 5IR1A 2BVTA 1A6VL 1URLA 3AABA 2V9TA 1A6WL 1TSHA 1Q0EA 3VVVA 5BVJB 1OGPA 4TQEH 3ECUA 4DK6A 1LHZA 4IOSA 4F7TA 1PBYA 4LSRL 2MH4A 1SHWA 1JE6A 1CVSC 4XXWA 1O6TA 2DM3A 4PB9H 3FF8A 4QR7A 4B0MB 4FG6C 4E9LA 5IBTL 1WS7A 3IPBA 4HG4K 2WVUA 3KYAA 3NABL 5L4IA 3QH3B 2YA1A 1G5GA 3QUMB 1MEXH 4OVVA 4URTB 5GJTL 4ZFOA 3ULAB 4FNRA 3UPAA 3FOLB 4ODVH 3DUSA 1KCLA 3D1MC 1INEL 3E9UA 4TNEA 3GXTA 3QK0A 1YDPB 4F9LA 2XWRA 5HPMB 2ZPKL 4A66A 1NCWL 4F7PB 4IYKA 5EORH 1NA8A 2CWRA 2YS4A 1FZJB 2WXMA 4ODVL 4PJ5B 2FLMA 1J8HB 1GS6X 3KDPB 4KJQD 8CGTA 4IRZL 2BY0A 4BE5A 5DTFA 4U3CA 3B9KD 4BZ1L 1YA5A 4P49A 2H6OA 3HNTH 1CL7L 3DI2B 5BRPA 2WYIA 3VH8G 5ID1B 5KANI 4LVHC 4BELD 4QRRB 1MCPL 3IU4L 1TXKA 3VFGH 5LNEA 3OKLA 4R0LC 3VRLF 3RTQA 5FYLE 1OF2A 5DDHB 1QVOA 1GH7A 4YNYA 2JCCE 4HDIA 3IGKA 4L8SA 5AKRA 4GY4A 1U21A 3BVUA 4NLHA 3EG9B 4M3JA 3SDYL 2IADB 1W8EA 5L9DL 1KCBA 4IM8A 2XXGA 4XBGA 4UILH 2FL5B 2UVEA 2ZG3A 4WNQB 3JVGA 5FV1L 1H5BC 4XOBA 4A2MA 1DUZA 4PGJA 1A1OB 3LXBA 2CKNA 4Y1AD 4NO5A 4ERSH 2Y07H 1TQCB 3N44F 4H20L 2PWFA 2VXUL 1L0YA 4DKFL 5ITBH 4AYBA 2JKTM 3D39A 2H3NB 2H32A 5DVLA 2XA8H 3UPRA 3GXPA 1NGQH 1OLZA 2VXTH 4GP5B 4IIQA 3U36A 4W9HC 1G1OA 2CKBA 3IN0A 2ENJA 5EH1A 2DM2A 4HJJL 4X5WA 3OGOE 1QAWA 2YRBA 1KPRA 2EP6A 3FC8A 1H5BB 3FW6A 2O5YH 4WJKB 3NFSH 1ZLVK 5G5DB 5IEHB 2BP8A 4NCC1 2A2QT 1MRCL 5I30H 2EKSA 3BQUA 2VXVH 1RXLA 5DT1L 1G7HA 1LP9B 3V6OC 3TA3A 4WTWA 3PCYA 3BGAA 2HMID 2CR6A 4JZOB 3GKWH 1WVZA 3OB8A 3CH1A 4GQZA 4PJ9A 4WTXA 4XVSH 3JV4A 4R0LA 2CXKA 3MLZH 4RMRA 2HRHA 4GQ9H 4I3RH 1OAYH 4HEPA 1JWMB 1EERB 2YPVL 1KJVA 2BS8A 2E0PA 2Q3AA 5FYKD 4ILDA 4L4TE 3WS6A 3QAZC 1IT9H 4U1LB 3X14B 5CSGA 4UM8B 1EBPA 4W1TA 2C1PB 5MENB 3TZVD 1AO7E 1V3MA 5HD8D 3FKUS 1F4WL 5I1LA 2YO3A 1BXUA 2HRGA 3PHOB 4K23H 4UANA 1OZTG 3SPHA 3B9KA 4PJ6A 2FATL 1GZPB 5TF0A 3E8UL 5K1JA 1ZA3B 1NUDA 1Q94B 2VXSH 3QNFA 5AENA 1ZRUA 5MI0B 5AZEL 3PDOB 1YUHB 4UQAA 1FL5A 4JKNA 2AQ3A 5HGBB 4TKWA 5IOPA 5FM8A 3T6ZA 5T3ZL 5T5NF 5I73B 1QRKA 3RBGA 3WEXA 1BX2B 4OLXH 1PKQB 5C6TH 4F7MB 4JPKL 4P8QA 3ZMRA 5GRJL 4X9BA 5JR1L 1X5IA 5HGBA 1NCCL 3B56A 2XBTA 1H6TA 4K3DH 2B5IB 4MQXC 4QAMB 1YEKL 5D7JA 3KR3L 2DLIA 1ZTXL 2YEZA 4YH6A 5F7EL 1JAEA 3L1FA 3FMGL 3CSGA 4OUOA 3C09C 3V5DB 3C8DA 1KTLB 5E6YA 4ZMPA 1JWSA 3I75A 1MLCB 4MKMA 4LLWA 4TLKA 2C1PA 3SKMA 5I19H 5CNHA 1SVZA 3A6CH 3L95A 3P0GB 1E6OL 4G71B 3S88H 4AEFA 4JPQA 4MQTB 5HHME 1F8TL 1X5LA 3US9A 1KENL 3A6OA 1ZHLB 4UQIM 5EU4B 3JWNE 4U6VL 1HEJC 4O02L 3CFBB 3JV6B 4GSDH 4KKLC 1MCBA 4Y19A 3RFRA 4UINH 4NIKB 4CA4A 4EMZA 3MLVL 4BYHA 3WG7B 3P9WB 2DKMA 3EZJB 5IMLA 1QP1A 4MQ7B 1CDIA 1MCWM 1UWEL 3BIKA 2DEXX 3BSHA 4M7KL 2WBJB 1D6EB 3ZDZE 4AEIL 4RGNE 4KWUA 2QKIA 4LP4A 4LGSB 4Y4KD 5KUKA 3GZQA 4BFGA 2FIKA 3K2UH 1B0IA 4J8RB 4LXFA 2FJHB 2CLVA 5I23A 3TIDA 2G30A 5TDPA 1B0WA 3S0PA 3AY2A 5FDYA 2KL6A 4KXCA 1M6OA 5HYJE 4ZSOE 1WA1X 2AJUH 2DLGA 1IB5A 3LH2L 4HPOL 1XTLA 1N0LA 4HFUH 2Z8SA 2VIRB 1MCLA 1MFBH 5EIIG 1ZVNA 4ZODA 2ALWA 4DP0X 3KYMA 3VG0H 1NC2A 5KG9A 1ZLDA 2MQCA 4D0BA 4F58L 1M1XA 4HX1A 3V4VL 5TE7H 5C6PB 4ZW6A 1L5GA 5K9OB 3QCVL 5L88L 2FYYA 2KUTA 2Q7NA 4BBWA 1SDDA 5CGYD 1GOGA 2WXJA 3AY4C 2NNRA 1FV1A 1EGJA 2ZOLB 5J8OA 3TBVB 3U46B 2PO6D 3OKLB 4CMHC 1F90H 4YHIB 3U1QA 4IEFA 1BQLL 5TTRA 1KB5L 1RMFH 3BN9D 1I8IB 3HC3L 4M5ZH 4KMTH 4S1SL 4BFFA 3GHBL 4UTBH 4FNUA 1AGBB 3RA7L 3TBSA 1FL3A 5C0AB 4ZDHB 1BQSA 3DWTA 4P2YA 2O4EA 2NY4D 2UY7A 4K5OA 1JHLL 2ZWLT 5JPNC 1AQHA 1M1XB 2AXFA 3MRKA 4D9LH 3CPUA 1PMYA 3HFMH 3A47A 5F3BA 3WHE0 3FB7B 1MFCH 2JXMB 1R5WA 3E8UH 1B0GB 3QPQD 1IAIL 3LPOA 4ZS7H 2V5YA 1RZKH 4Z95L 4LLUA 3VXUA 2P26A 4IRJA 3AS3A 3DURA 4HISA 5HHOB 2WKGA 2FJHA 4WK0B 2NW2B 1DL7L 3NH7H 4I88A 2X1WL 3SE3C 5LCVL 2A6IA 1HKLL 1BQHG 5I0WA 5EZOH 4KK9D 3P1VA 2QKIB 1PIGA 2J2ZB 4WU5B 1A1NA 3EDFA 3VD1A 1G87A 3B2XA 4IKIA 4KO9A 3M7OA 1VFMA 4JFFA 2WLHA 4F8TA 1CYXA 4JQIA 3AMKA 4LCIH 3C08L 1T2QL 4LIQE 3TC9A 4O02B 5F1IB 4FFZA 4OZHA 4NQEB 1NGZA 2D3VA 4QF1B 3LZFH 3BVWA 1NBYB 5DHYA 4HUVB 4LCWB 1WGOA 1MW2A 3ABGA 3QWRA 2B59A 4BQ9A 1ZHLA 5T1MA 2LFEA 3T0EA 2F1EA 3MUJA 2XN9E 4MD5B 3CZJA 4GRWF 1JPSH 5AYUL 1N3NA 5GGUB 3UYPB 4ZQTA 2D03L 2X7LB 3TVMD 1RH8A 2R27A 2FZ3A 4X8JB 3MNZB 1E6JL 5E9NA 1PU0A 4JFED 1HYSC 3V5DA 3K4AA 1IGFH 3MGOB 1O5DT 2OMVA 3GI8L 3RB7A 2APVA 2F7PA 5DEZA 2OL3B 4HWUA 5IBUB 1K8IA 3N40F 1IGCL 3HBPA 4FQHA 4BK5A 4GMTH 1BQHA 5E6UB 2J73A 1MF2L 5BV7H 5DYOB 4WK4B 1GW6A 3PAZA 3W2DH 5HVHC 4IMLB 2VDPH 4NRYB 1DQLH 3UTZA 2VM9A 4PRIB 1RULH 4GQRA 1E2WA 2D8KA 1U3NA 3D18A 2P9RA 4FG6D 3PG2A 3LNIA 3OHXB 2G3MA 1FO0L 3L1GA 4ZFGL 1QA9A 1CLCA 4DTGH 4LSQL 5I8OH 1NCWH 3B7YA 4CNIB 5E6RB 1IQWL 2FWOA 5C0DA 4J3BA 1P4UA 4Y5VA 3FUHA 5DJDA 3Q8AA 3ZKMC 4YDJA 5KZCD 2VN3A 1FIEA 1ZA3A 4QHMB 5HHMB 3P2TA 2CCVA 1AXIB 3DXAB 2ARWA 1J8RA 5IJDC 1Y0LB 4IBYA 3TYGH 1FO0H 1I9RH 4MDJB 1NKGA 2D4FA 1H8LA 2AP2A 3RLSA 2A74B 2HYMA 3OLGA 2OV0A 2A9BA 4ENED 2J20A 3CZKA 2E86A 2DWEB 3FB8B 1YY9D 4K3HA 1OT4A 2Q86A 2IV8A 5DD6B 3SYAA 43CAB 2QJDA 4U1HB 2CUAA 3WDHA 5EWIH 1ZEAH 1OGAE 1AXSA 4FG2A 3LVTA 4ZX4A 4DP6X 4JZOA 3QIWC 2GC4C 4KO7A 2CSPA 2XTJD 6TAAA 3HS9A 4JFEA 5DYFA 5KYXA 3T6QC 4K7PX 3TVMA 2GUOB 1HHIB 5CILL 4B9IA 3NIGF 3GO1L 1BXAA 3FUEA 2XWXA 1NLDL 1K4CA 1QSFE 2VTFA 1S7RB 3LKPB 4OJAA 3MQIA 3F6IA 1WEJH 2YGOA 4D3CH 4WF7A 1HSBB 2Q0ZX 4R4FH 4JO2H 3A4DA 1BMZA 5I6XC 4ABVA 2R29A 2H3NA 3DX3A 3WJMB 2R83A 5C1MB 5T5FL 2NLJB 4QI3A 3NIDF 4PVLA 2IQ9H 1FORH 5ANME 4OQTA 5AAWA 2L7UA 3PABB 5H37A 2BIIA 3IJHB 2VDMB 4XNMB 3RVTD 2IWGA 4U7KA 3UAEA 5DGRA 1ZLSL 4UQ2A 2NUPA 2W9EH 3JXAA 4HKZB 2XZQL 4IBZA 3FAXA 1AC0A 5H4YA 1DL7H 3NH7L 1E9PA 1ADQA 1EDQA 2X12A 4YWGL 5ACZB 2WKLA 4NHUA 3WGVB 1TT6A 4LCCB 4C4BA 2OFQA 1F2QA 4N2NA 2QGDA 1A21A 1AR2A 1THAA 2QHLA 4FNLH 4YHNA 3G5YB 3KJ4C 4I5BB 4MSWB 4YBQC 1U58B 2ARJB 2X6MA 3EH4B 3QJFA 2BXYA 4IBSA 1FFPB 2B9BA 3H2PA 3GD1C 4A67A 2G0KA 3W9EB 4B5ZA 5EN2A 2OK0L 2BS9A 4WI7A 3ZTNH 1S7WA 4XP4H 1ED3A 3AG2B 4LESA 1PKOA 5C71A 4P2AA 4UM9B 3O3DA 3MNWB 3RWJB 4LMQE 2ZJSH 5AKVA 3VW3H 1W6LA 4JG5A 2Q8AL 3TASA 3ZBMA 2X1QA 5KS9E 1QABA 4CGUB 3D25B 5FFOA 5HI4C 5T3ZE 1G6RA 4L18A 5D2LA 3FFDA 3DUSB 2PO6B 4AH2A 3WO3B 2VYRE 2G9KA 3ME0B 4Y9EA 1WBYA 3R0NA 5E5MA 3TF4A 1WUNT 4P46B 2RFXA 1A7PL 3HB3B 4RMUA 2XTJE 1P4IL 1O7VA 4ENEC 1KBWA 3WEMA 3KLAB 1SN2A 4JX0A 1WF5A 2DEWX 1T1WA 4JFQB 1WZMA 1ZTXE 4HETA 1RVFL 2Q2LA 3RVUC 4QTIH 3CBJB 4NQDD 1P6AB 4DOHE 1OTSD 3QA3B 4TRPH 5E8NB 4GG6B 1MCSA 4GUPB 5B39G 1WWCA 2Y1ZA 3OKNB 3MODH 3FBKA 5GGSB 2CLZA 3IDXL 4OCLC 2Q6WB 3PQYE 1HZLA 4L0ZA 3BDBA 5HHVL 1HHGA 4OLZL 1T5KA 1VHPA 3K5SA 4IK6A 2R0LL 5GSRA 5I5RA 2MCAA 2EYRB 1DJSA 1R3IL 5HP5A 3ZKSD 4YPGA 1ETZA 2XKSA 2EVFA 1HEZB 1HESA 1S46A 4G5AA 5GRXG 5HGAA 3PIQB 1QFWM 2ENYA 4PJCE 4S0SD 3UL4A 5C97A 2VC2H 5DQ9B 2OMYB 2PPFA 1MHCB 4JFPA 2HRPH 3CK0L 3T6WA 4JL1A 3U7YL 4OJFL 3DI3B 4DUXA 4P3DB 4H1LH 3R19A 5ID0B 5C0CD 3QUGA 4NNXA 5F9OL 4GW5B 2EIBA 1HK6A 1ACZA 1WZKA 1JMZA 2O5NA 2X1XR 1F4YL 1KBBA 2BZDA 3JWOH 2MOQA 5D5ME 2X6VA 4H20H 4L2YA 5K9QI 5A2KH 4NNPH 4Q6IA 3G5XA 1ETA1 2AMGA 4QD2E 3DHPA 3S3SA 2BRRL 4W4NA 5CLYA 2TRYA 2DYPB 1WLHA 3BAYA 3PWPE 3PJSA 5F9WB 3ZE1F 1QW8A 3SDDD 5CLWA 4AYFA 2XIDA 4LLDB 3FO0H 3ZE1B 1NBZB 1GMIA 5H94A 3DX7A 1J48A 3NP3A 1CBVH 1JHTA 2HPTA 5A7EA 2D9QB 5IMMA 2YK1L 2Y06H 1PL3A 5DJYA 2VDNB 1AKJA 1NANI 3DIVA 3T0EC 4CC0A 3MZGB 1J1OH 4QHLB 2XG5B 4V2BA 4L9LB 2ZYRA 3QDME 2MRYA 5KSUB 1UCBH 5GHWL 2VQ4A 4P4RA 5DD3H 1SXAA 5JPNA 5D6DA 3QUKA 2KQNA 5HJGA 5GZOA 5D1XD 4UWQB 4M5ZL 4S1SH 3FS9A 4JRXE 1ZGLB 2HX7A 4H0HB 5KN5A 1EX0A 1T1XB 3QPKA 4OZGB 1JN6A 5HTSA 4AXWA 1KG0A 3GSXA 3S36L 4TPRL 4WFGD 4OZFB 1HFUA 3WMQA 4HS6A 3OZLA 3GS7A 5DJZB 3WIFA 3QO1A 3D85B 1QD0A 5AW9B 1MHHA 1QSFA 3IPFA 2FT7A 5DLMH 5HHPB 3O2WL 4G8EA 3BSZL 2EVIA 1GAFL 1IAIH 3AACA 1ANUA 5AW6B 4DUWA 4LASH 1LO4L 2G4GA 5DURD 3TTSA 1KCUH 3VI3B 1YZZA 1J0YA 3VM5A 4XODA 3KYKL 2ICES 1S9YA 1NJ9A 2R8SH 2UXGA 1MZZA 3ESNA 2AKRB 4EI6B 3C5ZD 1KPUA 5CGYC 4HK3N 1AHKA 4M1GH 1AVAA 1A4JB 3SDXF 4YBHA 3MXVH 4JZNA 4Y2DC 4JUSA 2FEDC 2VUOA 3UC0H 1XF4B 5GSVA 2WOBA 1N0XH 3BN3B 1BQ5A 5B3NA 5I82A 3MRLB 1OPGL 3AT0A 3LIZA 4U4BA 1JBJA 4G8AC 1P7BA 1E9OB 4OCYL 2VDLB 2EDLA 5HI3C 2VAJA 1AFVL 1CE1H 1DJIA 3L3KB 2BSTA 2IANE 1RY7B 3HRZC 4L9LA 4N0CD 1EMTH 1QNIA 5E2JA 5ESVB 4YDIL 4UMSA 5IJKA 1ZLWH 3BP5B 1YEJH 1JNHA 2BNRA 2ISDA 1QHOA 2YRPA 3RIAK 5L8LB 3PXHA 4QRAA 4RCAA 3Q7JA 4LNRA 3HZMA 1AO7D 4U33A 3VG9C 3NCEB 1XCQA 4MAUH 5I1AA 3NUKA 3VTMA 5M94B 1UA7A 3F6JA 3HNSL 1KV3A 4I87A 3T0BA 4RFNB 1DJXA 4LU5L 1ZANL 2D7NA 1M56B 3ROOB 2JQZA 3WENA 3EHBB 1IC4H 4OV5B 2VB5A 5I71C 4R9HA 2XSKA 3OKDA 5C8JB 4L9DA 3K8KA 4PG9B 2V2TA 4A6YA 1I9JH 2RH0A 4XP1L 2CRMA 2ZUUA 3WAKA 2CJSA 2X70B 2AVGA 4G8FB 5EMYA 1KTBA 3TEXA 2J57A 2OQJB 1OCZB 5EUOA 1UATA 1KLGB 5DVNA 4EI0A 3BKCH 4HXAL 4LSUL 4S10A 5CBEB 3WO4B 1MCOL 5F7NC 5E1AB 3M8OH 2JWYA 2Q1EA 3FCGA 1JF1A 5I5IA 3D69A 5K69A 2BJML 1CLZH 1P69B 3KMDA 4L2LA 5KS9B 5DJ6B 5KBMA 5GSRB 4KXAA 1U41A 4LPXA 3F04A 1ZDQA 2PWHA 4Y8DC 4CSPA 3DO3A 1PSKL 3BT2L 4XO9A 1BEYH 4R97B 4A6YH 4QNPE 1XR9A 1I9EA 1WWBX 2RGSA 3G5VA 2QLVB 1CDJA 3QCUL 4WFFE 3MX0A 4BXSV 4GUPA 2R69H 4ZO9A 1GGUA 5AVVB 1PNCA 3PGCB 3RL1A 5IVXE 2PW2A 5L0QB 3FHAA 1JZ3A 2LAGB 3CHXA 1JWUA 3RUGB 3ZDYE 4DIXA 1D9KB 1HL8A 3CXHK 5GZND 3MREA 4J7RA 4UAOC 3WHXA 3RPBA 3EOTH 3GBNH 3AW5A 5KOMC 3RE0A 3SDCA 4AY0A 2A7BA 1R3KA 1T04B 1H3UA 2ZUSA 3G6AB 4I18A 4IRJD 4JB9L 4NO0D 4DCQB 4OZIE 2W07A 5D2LB 2XC8A 4NI3A 5E51A 3ES6B 1FNEA 3OKDB 2FBJH 1THCA 2AEWA 3QIBA 3PWNA 1A6TA 4X7CC 4MJIB 1NWOA 2A1WH 2Y1YA 4JRYE 2WXPA 4Z77A 2IGFL 5EEZA 4BSWB 3QPXH 4EZMA 2DWTA 2ZOUA 3ZHFA 3IB4A 4F2EA 3U0TB 4DP1X 5I1AB 3ZYIA 2C3VB 1H0DA 3ATAA 3LHPH 3NTCL 3NIDE 1P6FA 2Q8BH 4I2XE 3VFPB 2ZUQB 1A9EA 1OWWA 2BNRB 2G60L 4JK0D 4NUQA 5I1JL 2Y06L 1CICC 2GJ6B 1I8KB 1F6FB 1LEIB 5F7HA 4IW4C 4M48L 3RY4A 5IVXB 3ZKQD 1Z3RA 3FTWA 2R0WL 2VL5B 1E9PB 1IFHL 4Q7DA 1NMAL 5LGHL 4YFEA 2P28B 3KPRB 3C5SB 3L3HB 1DEEB 1OB1B 4O2EA 3A6BH 2IGTA 4J3SA 1AQ8A 3MRHB 1OANA 2P7TA 2WIIA 2KHAA 5J11B 2AFNA 1BZEA 3WN6A 1OTTD 1OKEA 3DNKA 2I5YL 5E8OA 1NMBH 4Z76B 3U25A 1URIA 2BP0A 1IGJA 4Z95H 4G82A 1J86A 2RQ8A 2VZ1A 4XP9L 2JKXA 2ZUQC 4PJFF 1QBLL 4HBCH 3CFJB 1VRSA 2MNWA 3V4PB 5DURB 5DJCA 1D5IH 4PY8I 3H0TB 1UXLA 4R7XA 3TBCA 3L5XH 1Y1UA 3FXIC 3C9NB 4ZMZA 4Y7OC 5AOJA 2GJRA 4N8CL 4U1GB 5FM4A 1M05A 3D3VB 3VDAA 3OXSA 4M1CD 2P8MB 4HD9A 3ZGIA 2C9VA 2ITFA 3VI3A 4Y9FA 3SOBH 2WWKO 2XOTA 3BAIA 1JGDA 3D06A 5DJ0A 2ZOWA 1JZ4A 1H6EA 3VFUB 5PCYA 5FYKL 2AF2A 4UMGA 1QLEL 1DBAL 4PJGF 5B38A 1UEMA 3D85A 4JDVB 3GHPA 4XX5A 5FLVA 1UM4H 5DVKA 3VDCA 4KH2A 4FZ8H 1EAJA 5JNYB 3Q6FA 3PWUA 5IEKB 1EEUA 2I60L 3L5JA 3RTQC 4K3DL 5DHMC 3REWA 5JLZB 4LLYB 1USQA 3VW3L 2GTQA 3DTDA 1IKFL 4JRYD 3HPLB 3PXJA 2E7CA 4A38A 5L2KE 1QPXA 1Y18B 3PGDB 3UCRA 3BP4B 1QLEH 3O4LA 1AOHA 1N4XL 2VQ1A 4JQXA 4ESKA 2X4PB 1SMOA 4FYQA 1CF8H 4PLJC 4U31A 1XB8A 1SOQA 2IH1A 1T6BX 5B4MD 3SDDB 3WJLC 4QHMA 4X6BB 4JPSA 4G6KH 4WWKB 5K9KB 1H3PL 4S1RL 5DJ8B 4BFNA 1XB6A 3E2HB 2DQCL 3ARRA 1ICTA 4XE5B 1NBZA 4NX0A 1EZVX 5EU6E 4JFWA 2AXHA 3OHXA 1BFOB 4KQ4H 2YXVA 1T2JA 4EBQL 3ZR5A 2IDFA 3BWAA 3R7QA 1AI1L 3HPJB 1RFDL 4CU7A 2F58L 3UPCA 2HFEB 1UWGL 4YK4B 5FO8B 2DLHA 1KIQA 2O72A 2C4FT 4MNGA 3CE1A 2WMPB 4R97C 2R29L 3AWGA 4QNPF 1ES0A 2EH8H 3X3FH 5CHNA 3F7YA 1OZUA 2F58H 3HE6C 3MV7B 4N1HB 4HSCX 2K8MA 4D3CL 2NT1A 3TCLA 2WUBL 4HSQA 4JFPB 5D7EA 7PCYA 1AANA 2WM0A 4PWEA 1T0NB 2X7LA 5D7JD 3UDWC 1AGDA 1RFDH 3PIQA 1AS8A 3WTUA 1JTPA 2H3KA 3F58H 5DHEA 4YS4A 3PV7A 3W0WB 2W94A 2OMXB 3OJDB 4LE8A 2E9WA 4LFHG 5EF3A 4G8GD 1M2OA 3DBXA 1S7SB 1TVBB 4XE0A 2QQNL 3MRPA 5IQ9A 4H25B 1HHGB 4OT1H 4N3UA 4ZS6D 4Z7OB 4FLHA 1AAJA 3MUY1 2C9QA 2H5UA 5F6HJ 3IDMB 4G7VH 1KBKA 4HEME 2Z31A 3DGCR 1HHKA 3Q43A 1O7SA 4MHHG 3HBGA 2QDWA 4BZ2L 5C09D 1ZD6A 2DQDH 5TE6H 4DVRH 2F5BH 4PCTA 1A6ZA 1UCTA 4L3EE 2YA0A 3L4XA 2UY6B 4K9JA 4NS0A 2NW2A 2WYTA 3LB6D 4F3FB 3WY2A 1U6AL 4IQHA 5KVFH 1QLEB 3DKHA 4MNQE 4N22A 5K5YA 1I7UB 5DK2A 3VWKC 3NCFB 2G3XA 1EXGA 2VDOB 5B7EA 3UTSA 3V0GA 3B3BA 1E2ZA 2HLAB 2R2BB 4L3EA 4Z7WE 3UIYA 5B8CC 3K0YA 3SKJH 5CIPH 1NEZG 2AEQH 4FKKA 1QSFD 5DHVB 3VI4B 5ID0A 1W72B 2YPVH 1C08A 2E7DA 1UACL 2NY6D 1URZA 2QFPA 1MCJA 3DROB 3C2AH 1NOAA 4FQQA 4HT1L 1ZT4A 2XKUA 5JW4Q 4PG2C 1DQKA 2KLTA 1X9LA 2PCPB 4HYTB 5E9DB 5HDQH 4IBWA 4QDGA 1U8PA 1CTNA 5CEYB 4GXUM 2BNQA 3GHEH 3FN3A 1DQDL 2X6BA 4JLRB 3QYMA 2O1AA 1E3ZA 5FCUL 4K3EL 4AW7A 2YPKA 2R1WA 1YHPA 2AJXH 4HEPG 4M43L 3QWOA 1LXMA 4GOSA 3ZIYA 2NY4B 3VXQA 3L08A 1AYOA 3TJEL 2R7EA 2AQTA 1WIPA 4JDZB 4K5NA 2Q20A 4ONOA 4V2CB 5EU3B 3ZZSA 1BD2B 3GGWA 2CR3A 3O3BB 3BGFB 3BIBX 4FAAB 3HRZB 1I8MB 5DFVD 1EVTC 2EECA 4EUPB 1TJIL 2Q8BL 1TU2B 1KCRH 1VFBA 5LJYH 5DZ9A 4OLWL 2Y2TA 4DEPB 2VXQA 3GI8H 5DSCA 1YNLH 2J8UB 2VWEC 4PJ8B 4WV1B 3KAAA 2BOBA 4Y5XB 4IU2B 4MMZB 1EAQA 2X6AA 3KGRA 4UNIA 4YDZA 4OR1A 1YECH 3EO0A 4DPCX 2HVJB 2AVFA 3BRDA 5I1EH 3MRBB 3SDAA 1PF3A 2BIMA 3BIKB 3TVMB 2ATPB 2D4DA 1OCWH 3DVFA 3QJOA 4P2RD 4AL8C 3VFMA 4AQEA 3EFOA 2WZ0A 1FUNA 4KI5C 3P9LB 2FE0A 5ICYB 4MBOA 1QUPA 2WWOA 2YA2A 4FTVD 4FHKA 4AL8L 3IBEA 4R4BA 3WO4C 3G6JF 3W0WE 3JV6A 1J87A 5DZAA 2PPDA 3M46A 4Y5YC 2XJLA 4Q6YA 3G6JB 5CR8A 2XVKA 4M5TA 2C1OA 2A77H 2GIMA 3NDZE 4OGXH 5IROD 4B50A 2VM4A 5EZLA 2Q86B 5KW9H 2APBA 1ZJAA 3K46A 5DVMA 2I26N 3ZXAC 3SKMB 3FUIA 3RWDB 4FA8A 1TKWA 1XEDA 2WNXA 3D0LA 3O2DA 1YEFL 4HS8H 1OGSA 3KPNB 5IT2H 1U8NA 2NXZB 2W0FB 1Y0LA 2YQ2A 2BFVL 3D2UD 5C0AD 3ROLB 4PR5A 5I74B 3NIGB 3MV8B 1DEDA 3D4CA 2QR0B 1IZJA 4TNWF 4ANXA 1RUPL 2MMXA 2F74A 1KJMB 2ENSA 1HSAA 4JZJA 5JZ7C 3VX1A 3A67L 1MAJA 2QVTA 5C0DB 4B41A 4CNIA 2VMDA 5E4OA 3EFFA 2AI0L 4F7MA 2B77A 3IGAB 4P2OD 1BX2A 1QFWI 3GMQB 3V95A 4JG0H 4KK9C 2O6FA 3CVIH 3SE9H 5IOPB 1Z5HA 4M6NL 4N0FB 4NWUL 2XRAL 4B9FA 4C55A 1MFBL 1ULVA 4QLRA 1N4XH 3ARWA 2FD6H 4PD4J 3OSKA 1Q94A 5GJTH 1O9WA 1BQHB 1U42A 1A9BB 1F2XK 1O7DE 5KZCB 1LE9B 2XWTA 2Y36H 4ZNEE 2X40A 2APFA 5TDNB 4ZAKB 2XPYA 3AGWA 3PHOA 2OMVB 4NXKA 3UTPD 4PB9L 1JZ7A 4JJOA 4UDTA 1S7VB 1FQ9C 3MA9H 1SY6H 4L1LA 3SYPA 1J8KA 3JUZA 2ATAA 4L4VE 4P5KA 2DW5A 3C6LB 3L2MA 1O5PA 4K9EC 1X7QB 3FOMB 3T0EB 3TT1L 2HLFC 4HSAC 4DGIH 3F7VB 4O51B 3KJ4B 3MO1B 4WLCA 1OARH 2VLKA 3BGMB 2W88A 1IC7H 2PO6C 2WAHA 4Y88A 3N9GL 1WC7B 2KLSA 2VKXA 4FDWA 2ZKHL 4N0YL 4PJDB 3WNIA 4KY1H 3JVFC 2X5PA 5FHAH 4JFDE 1KJ2B 2BP8B 4N2GA 4F57L 4J28A 5GGVH 4LCYA 4JG1L 4XGZB 1MNUH 4JFHE 1R3LA 3IDNB 1QFUH 4QXUL 3CSYA 1A4BA 2APWA 4YDMA 4WKZA 1HQRB 1BF8A 2JI3A 3EJRA 2VISB 1D5ZB 4JR9H 1D5ZA 6CGTA 2EINB 4RMSA 1L9QA 3HMXH 3F7PC 3JTTA 1B4JH 4EQ3A 3UZEC 4FOMA 2V7HA 5K1VA 2CBPA 2DQJH 3D05A 2E6JA 4OQTL 4X0NA 5DF0A 1J8SA 4GUOA 3TNNA 3NSXA 4WUUE 4WFGE 5F9JA 2V8MA 1NCIA 4PAZA 1FIGH 5T3XH 3TCXA 5MEQA 5D7IA 4K7PY 2AJSL 4FQ2H 3D6GA 4S2SB 1BJ8A 3KBPA 4M7ZB 4XBGB 5DMJB 1DVFD 4DHLA 3BJLA 1T20A 1KUMA 5DUML 4BJLA 3EDKA 1NFAA 3X3GL 4CU6A 3DX4A 1T5XB 3HC2A 2A9CA 1IKFH 5J1AB 1GCFA 2F19H 4Z18A 4R5XA 3MRRB 3RJQB 1RVFH 5F9WC 1XF2A 1F11B 2K7PA 3B9VA 2BHYA 1MXDA 2WKOF 2YD6A 3Q01A 3E38A 5BVPL 5CJXA 2FBOJ 3GM0A 4XMLL 4F15B 2LU3A 5J1AA 1JGVH 2E47A 5TDNA 1T5XA 4KVNL 5ERWA 1WFMA 1LO3L 3VNYA 2WLYA 5F7FA 1BXVA 5DTFB 4JPKH 5KJ4A 3VA6A 1C5BH 3W37A 5E70A 2Z4QB 3GIZL 1QQDB 1MCDA 3QUYA 1UCBL 5FA4B 2Z65C 3DIFB 3OR6A 3KJ6L 4UUJB 3V52H 5MEQB 3I9GH 1KOAA 1CURA 1ET8A 3QUHA 3MCG1 1IFRA 5CINH 2AANA 6FABH 2ZJSL 3H9SB 3VE0B 4DZBA 1DBML 1K5NA 1FHNA 1CI5A 1GYAA 1YVLA 3GSQA 1PAZA 4XPBH 4KVNH 2PYEE 3RGVA 5EDXA 4GG8A 1JNNL 2E27L 4NKMA 1SOSA 3CCHB 4KKAC 5D5MF 2J88H 2K9FB 4N5UA 2BCKB 1FLTX 3QULA 5IB4A 1CFVH 2VISA 1Q9LB 2B3IA 4LARL 1T1YB 3WSQL 3STLA 1LO0L 4XMVA 3WY3A 2XPGB 3CDYA 4MNQB 1E4XH 4PI0A 1AQMA 3T1FB 1OAYL 3H56A 3KBFA 3JV0A 3QXWA 4PBVC 3RWFB 2VM3A 4I3SL 2D0GA 4N24A 5DWPA 5BMFH 4JPIB 3B8SA 3CK0H 3J07A 4LPYA 3ZDXE 4OW6A 1LO2L 5I74C 3SE4A 1JYVA 3BW9A 4NM4H 1JXFA 1WRFA 3OX8B 1QRNE 4N87A 2VAAA 3BFQG 4E41B 5I0ZA 2VDNL 1X7QA 4S1QL 1ZLVH 1TTRA 2NZ1A 3KVPA 5HJBA 2QT6A 4XO4A 5LAPA 3UZVA 3D07A 3MV9D 4LBEB 3NTCH 1UA3A 4P5KB 3F5WB 5C6WH 4AG4L 2WXLA 4Z7VB 5JIIA 3L3OB 4I9XA 2VO5A 4QYOB 2BIPA 4NKIL 2EICA 5B39B 4LDEB 4Z7VF 2VQUA 3ULSB 2I85A 4E41E 5ITBL 1SVBA 2XN0A 4HWNA 1CBVL 1JPEA 4N3TA 1LE9A 1Z5YD 1ND0A 3PGFH 1TMCB 3LZOA 1F41A 2OPCA 4PJAF 4X7DC 1VFBB 2B4CH 3EJSA 3SODB 3NIGE 1RP9A 1UJ3B 3HN3A 1KLFB 1QI4A 4HIEA 1RJLB 1KZYA 2AJZB 3H85A 4H8UA 4NNPL 2YLHA 1CD8A 3O3BA 4LB8A 2C26A 3NGBC 1WUZA 2VLJD 5GRUH 1LWHA 4QRFA 4U1NA 5TGBB 4D8PA 5KBKA 4U2ZA 1Q9KB 2Z4QA 2R0ZH 3N1QC 3NSCA 4H26B 3VNZA 1SLUA 1N67A 1B88A 2R1WB 3QZLA 5HDLA 1CI3M 1F3DH 4KRPC 2IOIA 2NR6C 2WXHA 1YNTB 1NFDB 3G5WA 3TBYB 4EVNB 1CLVA 5CEYA 2AZUA 3CDCA 1NFDF 4BQCA 3O6LH 3GQFA 3VB9A 1I1AC 1OAXL 1VAHA 2BVPB 1JMXA 5SWZE 5I75C 4FQQB 2VCOA 3C6LD 4JAMA 2X88A 2H0EA 2CGRL 3S4SA 2NMSA 1NDGB 5IT2L 4LKXA 4UCFA 1C08B 4L48A 1J8HD 4KJPC 1FAIH 4YHOL 2QADC 3MV11 3BOVA 3LEXA 5ACLA 3QRGL 3R7RA 2J5WA 2ADYA 3HUJF 4YWGH 3NBNA 1GS7A 2XTSA 4IMKC 3SQOH 2Z7UA 4F27A 4GQQA 1U8LA 4R2GC 4IOFD 4JKKA 2Y6TE 1IGCH 4RQQA 3RNKB 1IRAY 3LS5H 4BRJA 3P73B 1BLIA 5EBMA 4FA6A 5IKCA 2DYPD 4WUKL 1CGSL 2BP3A 5A2AA 1DUYB 2IJ0C 1A6VH 4PJ8A 3FUFA 4UAHA 4L5FL 2X4UA 4ZOAA 4IRZA 1FVEA 2OW7A 1G7QB 2MCPH 1ONQA 3FO2B 2H32B 3RPIB 3IBOA 5JO5A 1TU2A 3F8UB 5GS3A 4PJIA 2VMEA 1X7SA 5FUCC 2Q8AH 4ZZFA 4WO4C 2YBRB 3N85H 4K7FB 3AT8A 3K74B 3L1EA 3T0WA 2DRUA 4OCXL 5DD3L 4DZ8A 3GI9L 3THMH 1OQXA 4ABQA 1WC7A 2EH7L 1PCXA 2JIXA 1CQYA 1T4WA 1NGPH 2XPZA 2VDQL 5AVQB 1FG2B 4GH7B 4WHTB 3C8KA 3F7VA 3HG2A 4R26H 3FAWA 4PV9B 1T21A 1UGNA 3VI4E 4Q52A 3TBWA 4WW2F 4KKBD 1FA4A 1X9RA 4XXDA 1HNGA 4BH8B 2BNQB 4LVOB 5BV7B 1U8PB 2J1YA 1MDTA 2ROYA 3V0DA 2E46A 2IC2A 2UV3A 5D6CB 5TD4A 1YUKB 2EVHA 1RZ8B 1L4IA 3SGDI 2I9TA 3KWTA 4PJDE 1ZT4B 4AKPA 1D7BA 3SDCC 1P2CA 4JKMA 1GPOH 4ZAKA 2EDKA 1CFNA 4M1GL 2EYTA 2Y7QB 3PAVA 3KPLB 3R4RA 4NZUL 4EEEA 3CVHL 3RFZB 4JFYB 2ZCHL 1BLNB 3EW3B 4ZD3H 1GY1A 5B7FA 5D93C 2TRHA 4BGDA 3V52L 3ZE2E 4AJWA 2PKDA 3GXNA 3F2LA 3M17A 1DQJA 4JFDA 4M62H 4N6RB 3UTSB 5JQHC 4JFEE 4Y8AA 5A1AA 4XN7A 3EFFB 2BSED 3RWCB 1KEGL 2YQ3A 5E2TL 4OM1L 1M7IA 4JFVA 1MI5B 4PJ7E 1RUKL 5DJ8A 1S7UB 1BG1A 4I3GA 4JFTA 1PZ2A 2R2EB 4P2CG 4WO4A 1F02I 2NYZA 2CJUH 5FHBH 1U8CB 4XMLH 1NMCC 2WQUA 3E80A 3GRWA 5LXGH 5ESQA 2QBWA 3OMZA 1UWXH 4HZLB 3RVWD 3CSPA 2WXOA 1NQBA 3PV6B 4WGWB 1EA9C 2BPBA 1GY2A 2QTVA 3BVXA 3INUL 3QUYC 4M61B 3KBHE 1ET7A 3ARFB 1CIDA 1ZA6B 3TNMA 4GUCA 5BVJA 4NKOB 1XGPB 2Z31B 4N8UA 1QI5A 3C6SB 1YAIA 3EADA 4M7JH 4WJG3 2VE6B 5IQMA 5ELIA 4WWNA 4KRPB 4S1DC 3P0YL 4XH2B 3WFDH 1S9VB 1BG9A 4DN4L 1MCIA 1ITCA 2ALAA 1T6VN 2HT3C 5EHFA 3G6JA 4P5MB 1CIUA 1IGYA 3OR7B 4L4JA 5A6LA 2DLEA 1E4JA 2ERJB 5GGTL 2A9NH 2YBGA 3APFA 4XPHH 4EOWL 1FGVH 4B7IA 5KSBA 4JFUA 1S9WB 1U8HB 4BWUA 3V5KA 4YVNA 5KSAA 1ACXA 3CX2A 3ABZA 4NPKA 3VFMB 1YRKA 4AQEB 1L9TA 5FUOH 2BDNL 1DVFB 3GJFB 4XPTL 4M43H 1OP3K 4DH2A 3V6FA 3MRBA 3SDAB 2GFBA 2APTA 2BVOB 3QR2A 3ZVVA 4G5ZL 1M05B 4LLQA 3MV7A 3FH8A 3VRIB 4X7TB 2XN2A 2FRGP 4NNYB 4F33A 5FKPB 5IMKB 1WFOA 1HI6B 2XG4A 2JH2A 5FGRA 4EIBA 2VXQH 4R4ND 1UWXK 3EJYC 2FT8A 3MOQA 4PJGB 2KDYA 1CK0H 4X6CE 1EZUA 5D70L 3TZVB 4TQIA 4FXLA 3UBFA 3VYNA 4Q9QL 1IGJB 1V05A 1S8DB 5E08H 3OAZK 4YGVA 3TV8A 3O11A 1MWAA 3VGFA 5I1CL 2FHFA 1UQSB 2CO2A 4L8BA 5BS0B 2P7TB 2NY3C 5PAZA 3L17A 3OTTA 4HPYL 4BA0A 1I1FB 4ZQKB 5JW3H 1IEBA 4MMXA 4Y4HD 1PTZA 4NP4L 4X4XB 3KPRA 1KC5L 2ARJQ 2EEXA 4KI5F 1I7TA 1VEMA 1C8QA 2FB4H 3KGSA 3DRTB 3JV5A 4Y2DA 4KZEH 1A8JH 1CJYA 1YY8A 5BRZD 1DVYA 1CD0A 4K7PL 3GMPA 3L7EB 4U1IB 4NN6C 3H9HA 3WDIA 1ZE3C 4BSJA 3HN8A 4GUQA 4PRHD 2WCGA 2YN5A 2I07A 4CW1A 5J3HC 2CO6A 3VH8A 5CN2A 2APSA 5D4IA 4JO2L 5M95B 1MFDH 1CDGA 2EDHA 3BEVA 5D2NB 5D2LE 1KPVB 1SM3L 3L9BA 3Q0HA 2Y4SA 4G6FB 4IOFC 1Z9SB 2X53A 3H2WA 2ZXGA 1G7JB 4Z7QE 1PX3A 5GGVY 5DR5L 3O2DH 4LCIL 3GO1H 4M4PA 2PW1A 4CADB 4HS3A 6PAZA 4HU2A 4HOMA 2GJZA 3OKMA 1RURH 5INCB 2R2BA 3FPXA 4GO9A 1NIFA 4UV4H 1B6UA 2YXFA 3ZHNA 3MOBL 4DCQA 5E8EB 4QUOA 1R3KB 1JZIA 3PY9A 2JI1A 3GBML 1X9QA 5AW8B 4N9GA 3RAJL 1P7KA 2NTFA 1AS6A 1A5FH 3MREB 3CUPB 1V3JA 1XF1A 2PR9A 3ECQA 1G7IA 3AC0A 4BH7B 1U0QA 1NL0L 4PW9A 4LP5A 3H3BC 2A73B 2YFOA 1GYVA 3BE1H 3VD7A 2LTQC 1T7YA 2XQYK 3DV6A 3PUUA 3MLYH 4GLRH 4ZPTA 3V4PA 3VMNA 4RRPG 3OC8A 3A24A 2PXYC 4BFIA 4ODBD 2IXQA 3W5MA 4ZAKC 2WZPD 2GK2A 5KVGH 4MHHI 4D9RE 3MXWL 4BKLA 4IOIA 4P23D 4HBCL 4HAFA 2YQGA 4R8WH 3TWCH 2QQLL 3ZO9A 5JXAH 5KYWB 1Z9MA 5IQ9B 5SX4I 1NL0H 3EBHA 4LKCB 4U6HB 3FO0L 4FL4C 1G9NH 3KLLA 2YEQA 1KB5H 1RMFL 2A9MH 2IAMC 3HC3H 5FW6A 2HT4D 5JIKA 4RNRA 5C0FA 1GTFA 1ZGLM 2K6WA 2DL2A 4TUOA 4U1JA 1LVEA 3IFOB 1UWEH 2WXNA 4P59L 5A2JH 2HFFA 4W9ZA 4DTGL 1EJFA 1I8KA 5ICZA 5EU6A 2WBWB 1MAMH 1EEZB 1FNFA 1P53A 4F7KA 5I8EA 3ZE2B 5ITFA 5HYJA 4HWEL 2V6HA 4PJBA 3V4VH 3CWGA 2BMKA 4LEOB 5HYQB 4XCEA 2ZNXA 5SX5K 3L81A 3P0VH 2C3XA 2J56A 4HBQA 2ICEC 4PS8A 2WMPA 4C56B 1N8OE 2F15A 3QDMB 4APQB 4UOW1 4XPTH 4CJ0A 3BLKA 3WD5H 2VC2L 5D1QD 1VLXA 5F9AC 1V8HA 3FT9A 3PU7A 4J39A 3RU8L 3BVTA 1NBVL 2FHCA 3WKYA 1JGEB 1IBGL 2JK5B 5AW2B 3QPXL 1BFOA 1NAKL 5EOQL 3BI9X 1CFMA 1AP2B 2KT6A 1TJGH 3D33A 3NCJL 1UASA 5C0ND 3QJZA 1UM4L 2NX5D 3NSYA 5C0BD 4PJBB 1F58L 2WVVA 3DTXB 1FCCA 3P0YH 1CFSB 3J8F7 3QNXA 4RBPH 4OLYH 1FSKB 3O8XA 2PNDA 2X4SA 4X4YB 4K3GA 4C56E 3W56A 3RX5A 2MKLC 4ES8A 1ITBB 3L3KA 3DC0A 4Q0XL 1A6UH 1JYWA 1QLRB 1V7NH 4PJ5E 1J0ZA 1U8KA 1WGVA 2DMHA 3VB8A 2WYZA 2XACC 1Y18A 3PGDA 4N0RA 4KH9A 4J12A 3ULVD 4DW2L 2KDGA 3UEZA 3BDYL 4JM2B 4G8GE 2QGCA 2F7OA 3ATDA 2HT3D 5DA4A 3SY0B 5JLZA 4DEPC 2D73A 4JDTL 4XB7A 2ZPKH 4GKOA 4OM1H 1BVKA 1CCZA 4Z7UE 3MV7D 4GRMB 3W39A 5EBWB 4Z78B 1KWKA 3BAEL 1MQKH 3EGSB 3X3GH 3SHSA 2ICWI 1HNYA 4MA3A 1LMKA 1SF3A 2YOCA 1BQRA 4HC1L 3ZUCA 1S9YB 5HYSA 4QY8A 5CBEA 3CUPA 2BSCA 3T2QA 5IHZA 5KW9L 1K4DA 1W2KT 5TE6L 3ZTNL 4ZMYA 5DS2A 3MRMB 4L3ED 1HINL 5E56A 3TFKC 1C16B 3JQOB 1GZHA 2X1OA 2D0FA 5F6IC 3FQRA 32C2B 3U30B 4PG9A 3CFIC 1MWAH 3HLAA 4JE4B 2V2TB 3ILQD 5I5JA 4JO4H 2AK4B 4M5YH 1S5HA 3N91A 1BQUA 3T3PF 1AC6A 2J72A 4CRPA 3U6RA 2JJWA 4OLUL 1MRCH 2IDQA 4G42B 4JN2A 4XXCC 4FI8A 1KBGH 1MOEA 2RCSH 2ZX8A 4HUUB 4OZGA 2PUQT 4UT6L 5FYLH 3QJVB 1IC4L 2VW6A 1KGYE 2ZXQA 3RGVD 3GEWB 1JPSL 3NSJA 1WHOA 1V3KA 3QWRD 5TQ0H 3C5SA 2MCMA 3FTVA 5ESVA 2ZKWA 1BAGA 3IAGC 1TSRA 3SE6A 4LSDA 4FN0A 4HOZA 2HB0A 3CHPA 5DVOA 2CAKA 3P54A 3A21A 1FG9C 3QDGB 1AH1A 3PL6A 5DJYB 2DLFH 3VRLE 2EEFA 4N5EC 4XC1H 2JQMA 4QRQB 4EPSA 3AGVA 3CFNA 3KS0J 3WFBL 1TCMA 2DBLL 4FLSA 3VI3E 1L3NA 1DJGA 1JJUA 2MCPL 1FLRL 1HL5A 3TF7C 4G6FD 1IBBA 2PETA 3MTXA 3MCYA 1OD9A 2WLLA 3ARQA 4XBEH 4I2XB 3GKWL 3GPEA 4F2MB 4KPHL 1XAUA 5HGDA 2X4OA 3TTYA 4URKA 4DP5X 3B2DC 3MLRH 4TF4A 3FU6A 4WUKH 1SJVA 3G5XB 4KQ4L 3U4EB 3VXOA 5KSBE 1VZIA 3LRLA 5C7XL 1A6TB 1JXKA 2IBZX 2CK0L 2K7QA 3UCQA 3O3EA 4GW5A 4NNYA 4N1CA 3VVWA 3DGDA 5DEGB 5IJCC 3RIFF 1I3RA 4G6KL 4HHAB 2EDMA 5DZLA 2GFBB 3U9PL 4BA8A 5JYLA 35C8H 4TVPD 4PJHF 4WGKA 2CO7A 1GHFL 2AJ3B 1J8HE 3H54A 4FFWD 4DN3H 4LSTL 1XQ4A 1I9RL 3FHQA 1UXWA 4P3WA 1QSFB 15C8H 5EEVA 4LASL 1BF2A 3FCTA 4OVUA 5ICXA 1Q0XH 1KFAH 1U9KA 2ED9A 4KTDH 3UGXA 2LLLA 4LOUD 1QATA 4YHMH 4RA0C 3W0WD 4C59B 1JK9A 2DMBA 1T1XA 3N1MC 2GY7B 3OL2A 2CLZB 2FTAA 1L9RA 3OKNA 3EYFB 4PJDF 1JG9A 1O0VA 3C6SA 4JFZH 4JQIL 2VZ3A 3FSOA 4MS6A 3GSNA 1SY6L 4E9SA 1TJMA 3EBIA 1J0KA 5B8CB 4TTGA 4G6AC 1JZGA 4UTAH 1AIZA 1MCPH 4IJ3B 3VFGL 1MIEL 4F8LA 5CXPA 1L6ZA 4RMBA 1Z66A 2JB6B 1TTCA 3PGFL 4TVPH 4C56D 1YEGH 3U1SL 1BJMA 5DLML 4HPOH 4NQCB 1B9KA 1CQKA 3NESA 1VGEL 2K70A 2WVVB 4CC4A 1RK0B 4OT1L 4P23B 4IRSA 3BQUC 1RI8A 3UABA 3U9UB 1P1VA 2EE2A 2NX5E 4R96B 3ESOA 4ETQA 3B2UD 2MHAB 4F7EB 4P2OB 1AD9A 3BYTA 5LWYH 2OTUB 3BWSA 4F93B 1V10A 1QZ1A 2KKQA 3IPEA 4GEIA 3CFKB 1MFAH 3ARGC 3II3A 5AUMA 3RVXD 3DV4B 4NXSA 4YSTA 1UADC 4JFYA 2FH6A 2H9GA 4DEUA 3N6YA 3QDMA 1T89C 2ZAGA 2CMRL 2IQAA 3FCSA 4BCZA 4DGVH 4A04A 1PGRB 4YUEH 2IDUA 1RZIB 3KXFB 1AMXA 4RGMC 1DQIA 4MLIA 2Y1VA 4ZNCD 3LN5B 4FMKA 5DS8A 4QEGA 3CN0A 3MLTB 3SOTA 4G8IB 4X4ZA 1I1RA 1QSED 4QO1A 7FABL 1S9KC 1QEWB 4U6VH 4LCCA 4U1JB 1UC6A 2BSTB 2BC4B 2HA1A 4XOAA 1JPGB 3WKML 3MUUA 2Z1PA 3FH7A 1LNUB 2HG0A 1Q9WA 1HE8A 2ZP8A 1E9OA 4JKPL 3RKDC 2NY1B 4KZDH 1G0YR 3WELA 4GI6A 4XTRC 1WO2A 2W9LA 4FXKA 2FEEL 4XCCH 2M83A 2NNCA 3VU2A 4O5LH 4N0UB 4L23A 3L7FB 1T03H 3VFWB 5EBLA 4XVUC 4MXQD 5HHXL 1L6PA 2IWEA 4M03A 3IVKB 4JDTH 4JZNB 4BFIB 4JVUA 3WXWH 5CEXB 2K9UA 3FFCE 3KDMB 4IIQC 2JLLA 1H9DA 4GXUN 1Q1JH 4P9MH 3RG1C 3L3DA 3REVB 2A38A 1U95A 1K4CB 1AHMA 3KLAA 2YD7A 3WS6C 2Y07L 1QFWH 3P73A 1WFIA 2QSTA 3E2HC 1A7OL 3E0GA 3S8WA 4XMXA 2FUTA 4PY8J 1DN0B 2X10A 4JQVC 3PREA 1AZCA 5I0XA 4L1TA 2OR8A 4LRNL 2I60H 4WNJA 1XF3B 3ME0A 4PGDB 3BWZA 2L7EA 3FFDB 4G8EB 2GJ6E 1CXEA 1HJCA 3G6DL 3HNVL 1JGUL 2ZWNA 3UO1H 1J1XH 3BDXA 4H40A 4ZX6A 4GBXC 3QCVH 2A9DA 4OGYL 3NIDB 1BEXA 3EYOA 2XI9A 4YQXH 5DD6A 1KG0B 4LKXB 5CCKL 3L3GA 4LL4A 3B1UA 3ZSTA 3IRCA 3RU8H 3RFZC 2Y0SA 1ZPUA 1P5UB 5E24E 3M07A 5E5LA 3BKJH 2DI8A 1CFBA 2M26A 3MUZ1 4OIIH 1NOLA 3DX2A 5ACZA 4QPEA 5IQNA 2XV6B 1JI1A 1MAML 5D93B 4TUKH 3K8LA 4HGWA 8PAZA 2NUPB 2OX5B 3O0LA 4KDVA 4Y5VB 4LEBA 3DX7B 4PGBB 3QUYD 4OIAA 4QLWA 4KKRA 1E9QB 5C0GA 5CJBA 4KUCF 5CUSH 1QA9B 4L8SC 5L7XL 2LV4A 4DPBX 3LKOA 5EO9A 1ZIAA 4X4ME 4J6IA 1CICB 2GY5A 4ELMB 4PRIA 5AB0A 4PREB 4XHQA 1R4XA 5H2BA 4XO8A 3TZVA 3TWCL 1DSFL 1UZ8B 1HSBA 4AJVA 3QARA 1ZGLP 4JFXA 4A68A 5FKPA 2UX7A 3P2DA 1NGYB 4XCYA 2OL3A 1VKXB 4ERSL 4YUEL 2DQDL 3LKNB 1TYRA 2FDBP 2O5XH 1ZT7B 3GFUA 2GUOA 3KW7A 2ERJC 4X8JA 5DQ9A 3S98A 5C0BA 4YDKL 1MSPA 2HT4C 3AADB 2GB2A 3D85D 4UQEA 3QFJB 4K8RH 4ZO6A 2Z8VC 5AVZB 3DDGA 4MD5A 2X4NA 3QBTB 1U33A 3F3HA 1FVDB 1PDKB 4NENA 5EU7E 3EOAA 3FMGH 1P4LA 4WHDA 4G6MH 3WTXA 3OX8A 2R69A 5HYFA 1GJUA 3R18A 1K3ZA 1YYMH 2P5ED 1K85A 5IG7A 5GS2H 3EOTL 5MHSE 2J1WA 1A66A 4LPVA 5JW4M 1Q0XL 4BFOA 2DN7A 5C2BL 1LK2B 2G2PA 3LH8A 4G9FA 4APXA 3TONA 4FA7B 2XQYA 2Z92B 2XICA 4ZTPH 2AQSA 3ZDXB 1BM3H 3C5JA 3ZPDA 1Q9LA 1QUNA 1K72A 1KCUL 1IU1A 2CHZA 5B1KA 1WE5A 3H3PH 2R2EA 1RIHH 4WO4B 5AQ0A 1MUJA 5D1XA 2ZOKA 3MLSL 4NWTL 2O5ZL 1DBAH 4IRJB 1BQKA 4JMNA 4LLUB 3EH1A 4B9CA 1SHSA 4RBPK 2FSEA 1OWRM 3V79C 4YXLL 3KXFE 2OSWA 1J1PL 1RIHL 2ZTBA 2MFNA 4QOKD 1J12A 4YSOA 4J2XA 2XZQH 1VPOH 2X3CA 2XV2A 3L8QA 4XN8A 4XVTL 5F7LB 3BPCA 3LPFA 5IFHH 3UTZB 2UVFA 4NRYA 1CT8A 1KB9K 4GYBA 4WENB 3MNWA 4IOSD 4E9TA 1TYJA 2GG1A 2IPUK 2OR9L 3OMAB 2UXTA 5C0AA 4A7GF 5BV7C 5FA3B 4YXKL 2Y7QA 3S5ZA 1O6SB 3HN5A 2EACA 5DMKB 4RIRB 4X7SL 2BIOA 3UTTB 1MF2H 4IEFB 1Z6JT 5BV7L 2C8NA 1A8ZA 4YE4H 1RZ8A 1MFEH 5E6IC 4JANA 3H7LA 1IGML 1RZJL 2FJUB 4QGTA 3SBQA 1OSYA 4BH8A 5IF0B 4XXDB 1MCNA 4P06A 5FFGA 4Y16A 2D7QA 1BWMA 2RMNA 4PCYA 2Z9TA 4XBEL 1T20B 1KB5A 3MV9B 5EC1B 1DP0A 1R5VA 2ORBH 5AG9A 3ISWA 4YSDA 2YEVB 3PQYD 5LN8A 1SEBB 4JKLA 4M8UA 1RULL 1PG7W 1OGTB 5FFLA 3CDGA 5ES4B 3GWJA 1BFVH 2OMWA 5F9JB 4GMTL 2XDHA 1R9FA 4XNBA 1XGTB 4JPVH 3VWJD 1JV2A 4JM4H 1HH9A 2DIBA 4PWFA 3ABLB 4WAFA 3RURA 1JI2A 4L29B 3TIDB 1DO5A 2HTLC 5T1LA 5ANMA 1OGAA 1VIWA 2G2RA 2V5TA 4AYID 1MN4A 1DBJL 1S7RA 1X5AA 3LKPA 3D3VD 4TULH 3B37A 1SDYA 3S5LA 2HRPL 5TK4A 4OZ4B 2A6IB 3EDEA 1ZWIA 2L4OA 3TYGL 4FFVC 2AK1L 1JK8A 1RZGB 5L2JB 5AW0B 1SUJA 3KPRD 4B53A 3NMEA 1DN2A 5F70A 1MFVA 1RZKC 3NJFA 5C08E 3GMRB 2CDGA 5DJAA 1R3IH 3IF1A 4WWKD 2R0LH 4J3WA 1T83C 3A4EA 3FB7A 4E68A 4DETA 2CPCA 3CFDA 4KBPA 1OM3L 3AG4B 4FNSA 1SF5A 4KC3B 3P9MA 4FEIA 4UT6A 4YXLH 3RVUD 3QG6A 3W82A 1ET5A 1MG3C 3OLDA 1U8IA 1FDLH 2DTSA 4PV8B 1AGBA 3OAYK 1PD1A 1A0QL 4U3SB 4MD0A 1WA2X 4OF8A 5HJDA 4JAMB 5BZWA 4FQXA 3TO4C 1IEAA 5IMOB 1KNOB 5D96B 3GMNB 1XGYH 2BSSA 5T1DH 1KEML 1VJSA 1OALA 5E7BA 3VGAB 5DD1H 3QXVA 3D0AA 1UXMA 3RPKA 2YEZB 5IBLC 3VYPA 5J12B 2XWTB 4RAUB 1PCSA 1T6WA 4IMKA 4P4KD 1OP5H 1JGUH 4LAQL 5ALBL 4HX1B 2KBGA 5E2WL 2BNQE 2B4CC 4KRMB 2IDTA 4DERA 2ZT9C 1QSEB 3I6GB 3KYMB 4KROC 1YQ2A 3QHFH 4ODWA 1UEYA