4A1GA

The crystal structure of the human bub1 tpr domain in complex with the ki motif of knl1
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
146
structure length
146
Chain Sequence
DTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQAEPREFLQQQYRLFQTRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOTIC CHECKPOINT SERINE/THREONINE-PROTEIN KINASE BUB1
publication title Structural Analysis Reveals Features of the Spindle Checkpoint Kinase Bub1-Kinetochore Subunit Knl1 Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 62
structure length 146
sequence length 146
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08311 Mad3_BUB1_I Mad3/BUB1 homology region 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.430 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4a1gA00
2WVIA 2LAHA 3SI5A 4AEZC 4A1GA
chains in the Genus database with same CATH superfamily
4K0RA 3ENEA 2QFCA 4ZFHA 4HOUA 1IHGA 4FLBA 4HI8A 5JHBA 4WNGA 1JCQA 2ETBA 4ACLA 1H6KA 1HO8A 1BI7B 3NQPA 1YA0A 4B94A 1OUVA 2KBXA 3DEPA 3Q9NC 2VGEA 4U0ZA 5D0OD 2YHEA 3HXDA 3NOCD 1OWLA 3FP3A 3FTWA 2VYIA 1H2TC 1WAO1 3TWRA 4URKA 2V8SE 1N4SA 3CGHA 1NI1A 1QBQA 3SGHA 5FZRA 2WXNA 4L1BA 5H7PA 4UWGA 3ZNGA 4BESA 2ZIRA 4Q94A 3IHVA 3X2QE 3FTYA 1P5QA 3PDNA 2X6JA 3TAXA 2WMOA 3T5VA 1E8YA 3SF4A 4A1GA 2LSUA 3U4TA 5ITZF 4BEPA 5KBAA 2BKGA 3ZU7B 3ESLA 1OWPA 3UM1A 2WM9A 2X6HA 5J90A 4BTAA 3TXMA 3IXEA 2VJ8A 2DVWA 5LFAA 5KNHD 4UI9K 2KCKA 3DSWA 3AS5A 3LY7A 4HB5A 4DX5D 3HDXA 2XS1A 1TNYA 2QZAA 1Y6IA 2XZDG 1IQUA 3ASNE 4AJWA 1K1BA 1Z3YA 3RO2A 5ENRD 1HE8A 2R17C 4HQDA 5FZQA 2GW1A 2AXZA 3B7SA 3MJWA 4YDYA 2H6FA 1KPSB 3JQ0A 4N2SA 2AWIA 1KZOA 3FHEA 4G25A 4D10C 4JHJA 1S0PA 1FVFA 1JUQA 3UT4A 4EHMA 3G2SA 1UG3A 3TWWA 1N11A 2YQ8A 2EIKE 5ENQD 3PZ3A 2VTBA 3QDNA 4MLPA 3IKOB 3SNXA 4YDOA 2QYJA 4U0SA 3IBEA 5LCWJ 2X6FA 3FU6A 3Q49B 1BLXB 4XIFA 4IULA 3TJPA 3I4RB 3SD5A 2VTBB 3MCXA 4A3VA 3MA5A 4E6HA 2PL2A 4GCOA 3SQVA 4JA7A 4OAUC 4WNEA 3G2UA 4I1MA 4L2YA 1ELWA 4JEUA 4XI9A 4RG9A 3OXLA 4EBAG 4MKTA 4LERA 3S2AA 3Q15A 4Y6CA 3ZRHA 5DBKA 3FH8A 1SZ9A 3IV0A 5LOZA 2R02A 4UQZA 5BV0A 3Q9UC 1PC2A 4J8SA 4GMLA 5G05C 3ABME 2DYSE 4GAAA 5BT1A 2BTDA 2IO2C 3NZSA 2OV8A 4MBGA 4N5QA 3TWSA 3B7TA 3AG4E 4CGWA 1N4QA 5CEAA 4K5CA 3UT7A 5G04J 2QY7A 2Y4TA 3F6QA 2KZTA 1X5BA 4AIFA 4HFGA 3ZIMA 1PAQA 3ZN3A 2XENA 5ARGA 4L23A 2KZTB 1UN8A 4TV3A 2YNQA 3QARA 1DCEA 5AQ9A 4CDNA 5FQ8A 1JCRA 2H6HA 1N94A 3UIPC 1O1SA 1HH8A 1K1AA 2RKKA 1UW4B 4HORA 4JPSA 4WUYA 3LJNA 3DPDA 3QWWA 4KMOA 1BI8B 1HXIA 4ILGA 4KZCA 5A23A 4HRLA 2DIWA 3ULYA 3LXUX 2P9NG 5CMYA 2PM6A 2J9QA 3PRZA 3FU5A 2XS8A 3DSXA 4I6EA 4QFVA 4HI9A 3CK8A 5HS0A 3URZA 1OCCE 1N54A 2XQ0A 5KJKA 3UM3A 1FVHA 1BD8A 3FTSA 1OCZE 2FF4A 3DSUA 3QKYA 4N5CA 2X38A 2FO1E 4AXHA 3L17A 1H6PA 1WY6A 1MX2A 1ELRA 2GRQB 3UKUG 3UT8A 5CCMA 3B7UX 4GTMA 1KT0A 4J8DA 2VQ2A 3SBTB 3CQCB 4Y6WA 4DX6D 4AY5A 2VSNA 4HLLA 2JEKA 1H0AA 4ATZD 4NRHB 3FH7A 3Q47B 4YVOA 3FEYA 5AN8A 4F7AA 4JB8P 5ENOD 3ASFA 3E37A 3QWVA 4YNDA 3TG4A 3DBSA 2ILRA 3UKRG 2HE0A 4UWKA 3FUEA 3V30A 1QNFA 2QC9A 3LVRE 2Y1LE 5BV1A 2GRRB 5BW8C 4YDWA 4CCAA 4PUCA 4FHKA 4K03A 2LAIA 1TJFA 2KCVA 2XEVA 1ZB1A 5CRUA 4K5BA 3CLJA 5CEDB 1O5MA 3EDTB 1JWFA 2XEHA 1E8XA 2WB2A 5FQ7A 5BXOA 2E0IA 3PUKA 4HNAD 3T8KA 1MJ0A 2P58C 4EECA 3AS8A 5JJ6A 1HU3A 5FWQA 2WQ6A 4BX9A 4JHRA 4I1AA 3CVWA 5JHAA 3HIZA 2XEEA 1SQMA 2LXLA 3S7DA 5E76A 5AJLA 5LCWC 5LX8A 4XKCA 4O6FA 2VGXA 5FQ6A 3FUKA 2I1KA 4JEHA 3V2OA 3ZW3A 4UI9C 2VGXB 2PZIA 3FULA 4I2WA 4TXQA 4J0UA 2C2LA 3R9MA 3U3WA 3B7RL 3ISMC 3ABKE 4APOA 3GYZA 3L13A 2BF0X 2I6HA 4XI0A 4AOFA 3EHMA 4GTSA 3APCA 4LG6A 4TUUA 4XEIG 4FA6A 3PREA 5J08A 3LPZA 1HG5A 3CSTA 4IN3B 3S7BA 3P1UA 3T5XA 4NQ0A 1E90A 3FUMA 4HOSA 4G2VA 1OCRE 1U3DA 4UUCA 3JUIA 3CVUA 4GTQA 3FTUA 3WG7E 1N4RA 4HXIA 2A4ZA 3CVXA 3CVVA 1N0RA 4DUIA 4WWPA 4AY6A 1UN9A 5B1AE 4GYOA 3HXCA 1TJCA 4RLYA 4B93B 1H2VC 3TL5A 3ZXPA 3RRUA 3PE4A 3KS2A 1QYMA 2J8SD 2BKKB 4NACA 3ULEG 1MX6A 3L22A 5AARA 4RQIA 4CDRA 2VGYA 4DJAA 3ASOE 4BX8A 5AAOA 2NXPA 3NOGD 3NB2A 4DLOA 2RFAA 2F8YA 2VSYA 3RU0A 1V54E 4LCTA 4J8YA 3FU3A 3CK7A 2WPVA 4P29A 5EIDA 3J5PA 4MRUA 1D9SA 1W3BA 4KVMA 1EYHA 3OXGA 5EDSA 4JZYA 1X81A 1MQSA 5CHEE 4EPZA 2HYZA 2XGMA 2CFUA 5EX3A 5CERB 4R7LA 4J8EA 4FC8A 2DYRE 2A5EA 5JJ7A 3DEOA 3JXJA 3PZ1A 2LAHA 1D8EA 2GRMA 2WXFA 2J08A 3UM0A 3SI5A 2FO7A 1LD8A 3MV2B 5A7DB 1IHBA 3S7FA 2CHXA 3EIJA 4GB9A 1EPUA 2CHWA 2XPZA 2GGFA 5IY5E 1U2VG 4N2QA 2EQXA 5HQ8A 5C1DA 3LJ3A 2GRLA 1Q2ZA 3D9JA 2IOSA 3L6AA 1FT2A 4GMJA 2J4BA 4HBDA 2P9KG 5DIZA 3L9TA 3WXXA 3FWVA 4DX2A 3B7BA 3R9AB 3SFYA 3CEQA 4L9PA 4RG6A 3AAAC 3TWXA 3TGOA 3CKCA 2H6GA 3QWPA 2WXKA 3O48A 5T4YA 2V5QC 3VLDA 2L6BA 4C9BB 3SFXA 3TWUA 2FEZA 3TXNA 3D9IA 3MKRA 2XPIA 4GA2A 1YCSB 4GYWA 4GZDA 2RFMA 3PVLA 2MYOA 3GZ2A 2XRYA 3CQGB 4TUMA 5HKPA 3JUEA 1NA3A 3V79K 4LNBA 2J49A 5B1BE 4LNUD 2OCCE 1NFIE 1Z5SC 3IHYA 4U04A 3KSLA 1UOHA 3SFZA 3QB2A 4G24A 2C0LA 5D66A 2HO1A 4HLEA 3C72A 2LXMA 5LP0A 4NURA 3VTXA 1LF8A 5BUZA 2AVPA 2C0MA 3Q7AA 4U95D 2MOWA 3EU9A 3Q79A 1TNUA 2P9SG 1TYQG 4JVSA 2IY0C 2DCPA 2P9UG 3NAWA 2IOLA 5G55A 3EJNA 2WVIA 2AXUA 3W9GA 1S64A 2LSVA 2NSZA 2H6IA 3NF1A 1SA5A 5KCMA 2F37A 2KCLA 2FBNA 3CHOA 3ZEFA 5BNWA 3HYMB 4ANWA 4GU5A 3K9IA 4Q69A 4G1TA 5FJYA 4O60A 4G8KA 1S70B 5HI7A 3R7RA 3DPYA 4F6RD 3FY4A 5ARFA 3RSEG 3D9LA 3I3NA 4I2ZA 3CR3A 1E7UA 3CHSA 4ME2A 4PS3A 4GZ5A 4JHKA 4I9CA 3J5QB 4DX1A 1ZBPA 1E8WA 4CYMD 3UXGA 3MV3B 2EIME 2R59A 1OCOE 3JXIA 3GZSA 5M72A 5AENA 4WAFA 4L2LA 3Q5MA 3UX4A 2EINE 3HHMA 2WMNA 1RZ4A 3QAQA 2X3MA 3CVNA 4FHJA 4EZJA 3CSFA 2FI7A 1RW2A 3DXMG 4GTOA 3N71A 1D8DA 1Y8MA 4OAVB 3TWTA 1WG0A 2WQHA 3FUFA 1UJKA 4M3OA 4G8LA 3RAUA 3PH0C 1OY3D 3PZDA 1MX4A 2R03A 2WQ7A 4BT8A 4C0MA 2JLBA 3U64A 4EQFA 2P9IG 4G23A 3PE3A 3EHRA 3ZYMA 3FUHA 2WXOA 3QC1A 4XX5A 3JYSA 4CT0A 2Y4UA 3ZUVB 1DCQA 2KATA 4EZLA 3MYVA 3FUDA 1O1TA 4GZ3A 4DI4A 3KEZA 2IFUA 3D9PA 4LNGA 3SBSA 4AEZC 1QQEA 2Y0BG 4H7YA 4KXKB 3T9KA 5CMWA 2BUGA 3V2XA 3EIQC 3UTMA 1TNZA 1JPLA 1MZCA 3UMVA 4JD2G 3SO8A 5CBNA 4EZKA 4NIKA 2EILE 1TN8A 1E8ZA 3FDHA 1LTXA 1NL4A 3LDZA 5KJMA 2EIJE 2CFZA 3P2BA 4B8AA 4CDMA 3FTVA 3OTNA 2AXVA 1NA0A 3BU8A 1FT1A 4CT4A 3UQ3A 3HVEB 2RD0A 3W9FA 1IXVA 4JXTA 1N9AA 4XE0A 2OVFA 4U63A 4IYPA 2QYUA 1K8KG 3AJIA 5T8IA 3VLFA 4B0ZA 4U0UA 4U8HA 4ATGA 2R2LA 2M63A 4G26A 3ZHEA 1DNPA 5G05J 3D9MA 2V4HC 4UWHA 2DBAA 3CHMA 4OYSA 2WXMA 1UJJA 5EYLA 4N3BA 4ANUA 5ENTD 1O1RA 2XCCA 2WXPA 5KJLA 3LVQE 4U8VD 3ZHEB 1NZNA 5FINA 3AG3E 3SY2A 1DC2A 2P9PG 4BY6A 2XHEA 5FTPA 2VSOE 1KLXA 4DPRA 3ZXSA 2FULA 4K5AB 3ZYQA 1OWNA 1XGWA 4GA1A 4GPMA 2E2EA 3PZ2A 4ILHB 4AM9A 4GPKA 2LUHA 5FT9A 2OEVA 3DSVA 3GW4A 3ML9A 4GMRA 3AG2E 3LY9A 5AQ7A 3L82A 4YVQC 5BXUA 4IRUA 4JA9A 3CHPA 3E30A 3NBNB 3CK9A 3L08A 4F3VA 3E34A 3CVQA 4GTTA 3FTXA 4B89A 5G04C 4UQYA 3CKBA 3QNKA 3DXKG 4KBQA 2PQRA 2XGOA 3D9HA 3ML8A 4GA0A 4BETA 1OT8A 4F53A 3LKUA 4U96D 1U3CA 3ZFWA 2IQCA 3BEEA 3NZUA 4DI3A 5EX0A 4BERA 4I6GA 3UUXA 3JQ1A 4LUNU 5CRVA 4XKBA 5AQAA 3IEGA 5KNGA 2UY1A 4PS8A 1H2UA 3UM2A 3R7QA 2WXQA 3CHRA 1HS6A 1FCHA 2WXRA 3ZYKA 2J4DA 4GYYA 2UY1B 3D3MA 3CVPA 4I6JA 3UINC 4ACKA 5C2YA 4TXPA 3SHFA 2YINA 4J8FA 3KAEA 3ZGQA 2XZTG 3CVYA 2IONA 2B0OE 1A5EA 4U7EB 3QJZA 4LRZA 2R5SA 1TR4A 1SVXA 4UQXA 4AV7A 2IEJA 1LD7A 4KYOB 4CZ2D 3LS8A 2ZGDA 2RG8A 1HZ4A 1ZU2A 4UWLA 3G2WA 4GZ6A 3ULQA 4F1PA 3CV0A 5D2MC 3O4ZA 3UI2A 3PEVB 3D9NA 2L0IA 4BT9A 2X6IA 3D9OA 5JA4D 3TWQA 3MGBA 4TXRA 3RK6A 3PNLB 4L7TA 1AP7A 1N4PA 3ASGA 2J09A 4HS2A 5KWDA 3HXFA 4CGVA 5JJTA 4BSXA 4BTBA 4GTPA 4DLQA 3Q78A 4DRXE 3ONLA 5CCLA 2KC7A 4BWRA 4PS7A 4I1OB 4X8QA 1N95A 4Z68A 2ETAA 3DRAA 2PM7A 1WDYA 5EKQD 2AJAA 2CG3A 1HG2A 5FZSA 5KJNA 3G2TA 2XPYA 4ANVA 3AU5A 4FP7A 2WXHA 2ZXWE 1VDYA 3FTZA 5EIBE 3SZ7A 3FFLA 4A63B 3Q7FA 1HF8A 1ELKA 1HX8A 4HVBA 4WNFA 2WXLA 3DSTA 3EUVA 5EN5D 5ANRA 1N52A 4J6IA 4N3CA 3MZLB 4ABNA 3GZ1A 2WXGA 2MHKA 3CVLA 2B6CA 3VTYA 2OEWA 4HOTA 4U8YD 4C48B 2DWZA 4FLHA 3HRAA 2V4LA 2XCBA 4G11A 4UI9J 4WWNA 2PNNA 3EU5A 4EBAA 3PEUB 1HFAA 2I2OA 1SA4A 2NYJA 1KT1A 2LO6A 5T3RA 3UIOC 3OAWA 3ZYLA 3RRNB 3Q75A 2R05A 2JABA 4QQIA 1L5JA 2HR2A 5AIJA 1SZAA 4N39A 4CRWA 1EF1C 5ANLA 3MX3A 5A6CA 2OVBA 1PY1A 1N0QA 3FU0A 3LY8A 5B3SE 4PDXA 4JC8A 2CHZA 4LEUA 4ILIA 3U9WA 4KT6B 1DVPA 3KEAA 2L0TB 3ZVVA 3C3OA 3AG1E 3ESKA 4ANXA 3LYAA 3DWLG 4BFRA 4HRMB 2WXIA 2YHCA 3PZ4A 1TNBA 2Q7FA 2V0PA 1E7VA 1SW6A 2DZOA 3FH5A 1XNFA 4OVVA 4W9RA 4UWFA 1YMPA 4E85A 3ZKJA 3ASDA 2LNIA 1EDUA 4GCNA 1IQRA 1IKND 3RJVA 3L54A 4AVXA 3U66A 1BPOA 4A55A 4RVBA 5EILA 4C0EA 5ENNA 5FIOA 4CEMA 1AWCB 2ZGGA 2F0YA 4JL0A 3UPVA 3C98A 4Q96A 3G2VA 2GROB 3V31A 4MS6A 3DSSA 1GW6A 3E32A 4DX7D 1H6OA 4I43A 3ASHA 2GRPB 3TWVA 3CHQA 2GRNB 2MRIA 1TNOA 4TRQA 4I9EA 1WM5A 3JCKC 3KSQA 3HG0D 4M7CA 3TG5A 2XGSA 4U07A 2XRZA 1OWOA 3RRMB 3HXBA 1B89A 3APFA 4F1SA 3FUNA 3Q73A 1H19A 2A5UA 4HRNA 5ENSD 2L6JA 4FJYA 2NC9A 1V55E 3AU4A 1JCSA 3RIBA 1S63A 2ETCA 2P9LG 3RO3A 3APDA 3PS6A 4J7WA 1INZA 1MHQA 1KZPA 1BU9A 2V5FA 4AP2A 2VSXE 3VLEA 1MYOA 4KVOA 1FPPA 4HOQA 2P2CP 3Q4AB 4O1PA 4JW1A 2HM8A 4GTVA 5EYPF 4A1SA 2ZISA 3ZPJA 3FUJA 3E4BA 1Z3XA 3BQOA 4LSZE 3B95A 5JMND 2Y69E 4XZ4A 3FEXA 4KZ0A 3ABLE 3C5RA 3B13A 3C3RA 2CG2A 3S7JA 4B8CB 4O1OA 5AYWD 1JWGA 2J07A 4YDEA 2Y3AA 3BG0B 3EHNA 1E96B 3MKQA 3HVEA 4FU3A 3LCAA 5ENPD 3QK0A 5FQ4A 3I4GA 3KD7A 3MKQB 1Z6TA 4RSYA 4WWOA 4APFA 3BG1B 5CECB 2IF4A 3D9KA 3MEKA 5AQBA 1A17A 3HXEA 1TN7A 2AW6A 3ONKA 3BUAA 2DZNA 4DK5A 4BSZB 3EHQA 1G3NB 3T8MA 3PUJA 4ZHBA 5CBOA 2ZU6B 3CIAA 2KXPC 3E33A 1K3ZD 3RKVA 4FJZA 3AS4A 5D0QD 1YYHA 2KM4A 4V3IA 2L9BA 4OVUA 4I17A 1TEZA 3FUIA 1OWMA 2UWJG 3C3QA 5G2NA 3I5PA 2OOEA 4FULA 2IJGX 3OXFA 2WXJA 1NP7A 3L16A 2I1JA 2PQNA 5AJDA 4A3TA 4N3AA 1TN6A 4WNDA 5E75A 1IYGA 1QZ2A 5HRYA 2X6KA 3PNTB 2I9CA 2IU1A 4GTRA 5BPPA 2IO3C 3LEWA 1OXJA 4FADA 4GZCA 2F8XK 3QOUA 4H7XA 2ONDA 4PH4B 2BEDA
chains in the Genus database with same CATH topology
4K0RA 4CGVA 5JJTA 3ENEA 2QFCA 3Q47B 2KCLA 3FEYA 2FBNA 4YVOA 4BSXA 3CHOA 4BTBA 4HOUA 4F7AA 3ZEFA 5BNWA 1IHGA 3HYMB 4DLQA 3ASFA 4FLBA 3ONLA 5CCLA 2KC7A 4BWRA 5JHBA 4PS7A 4I1OB 3QWVA 4ANWA 4YNDA 4GU5A 3TG4A 3DBSA 3K9IA 2PM7A 2ILRA 5EKQD 4Q69A 4G1TA 5FJYA 4UWKA 2CG3A 1HG2A 5FZSA 3FUEA 5KJNA 3G2TA 4WNGA 1QNFA 3LVRE 2XPYA 1H6KA 4ACLA 3AU5A 4ANVA 5BV1A 1HO8A 2WXHA 4FP7A 5HI7A 3R7RA 1VDYA 5BW8C 3NQPA 1YA0A 3FTZA 4CCAA 4B94A 1OUVA 4PUCA 4FHKA 3FY4A 5ARFA 4U0ZA 4K03A 5D0OD 2YHEA 3SZ7A 2LAIA 1TJFA 3D9LA 3FFLA 1HF8A 3I3NA 1ELKA 1OWLA 4I2ZA 3FP3A 1HX8A 4HVBA 4WNFA 2KCVA 3FTWA 2WXLA 2XEVA 2VYIA 1H2TC 1WAO1 3CR3A 1E7UA 4URKA 2V8SE 3CHSA 3CLJA 4ME2A 4PS3A 4GZ5A 3CGHA 4JHKA 5ANRA 4I9CA 1N52A 4J6IA 3EDTB 1JWFA 1ZBPA 4N3CA 3SGHA 1E8XA 3MZLB 1E8WA 5FQ7A 5FZRA 4ABNA 2WB2A 2WXNA 2E0IA 3GZ1A 3PUKA 2WXGA 2MHKA 3CVLA 2P58C 4EECA 3AS8A 3MV3B 4L1BA 5JJ6A 1HU3A 5FWQA 3VTYA 2WQ6A 4BX9A 2R59A 4UWGA 4HOTA 4FLHA 4Q94A 3IHVA 4JHRA 4I1AA 3FTYA 2V4LA 3GZSA 5M72A 3CVWA 5AENA 1P5QA 3PDNA 4WAFA 5JHAA 2X6JA 4L2LA 3HIZA 3Q5MA 3TAXA 2XCBA 3UX4A 1SQMA 2WMOA 4G11A 4UI9J 4WWNA 4EBAA 3HHMA 3T5VA 3S7DA 2WMNA 5E76A 5AJLA 1E8YA 5LCWC 3QAQA 5LX8A 3PEUB 1HFAA 2I2OA 2X3MA 3CVNA 4FHJA 4O6FA 3CSFA 2VGXA 4XKCA 4EZJA 1KT1A 2LO6A 3FUKA 2FI7A 5FQ6A 5T3RA 3ZYLA 3OAWA 4A1GA 2LSUA 3RRNB 3U4TA 2I1KA 3N71A 4JEHA 1L5JA 2HR2A 5AIJA 3ESLA 1Y8MA 1OWPA 2WQHA 1SZAA 2WM9A 3FUFA 4N39A 4CRWA 3ZW3A 1UJKA 2X6HA 4M3OA 1EF1C 4UI9C 5ANLA 2VGXB 3MX3A 2PZIA 3FULA 5J90A 5A6CA 4I2WA 4J0UA 2C2LA 3U3WA 3B7RL 2OVBA 1PY1A 4APOA 3GYZA 3PH0C 3PZDA 4BTAA 3L13A 2BF0X 3FU0A 4BT8A 4C0MA 3TXMA 2WQ7A 2JLBA 2I6HA 4XI0A 3U64A 2VJ8A 3LY8A 3EHMA 4AOFA 3APCA 4EQFA 4G23A 5LFAA 3PE3A 4TUUA 4FA6A 4UI9K 3PREA 4PDXA 3LPZA 5J08A 1HG5A 2KCKA 3ZYMA 3CSTA 3AS5A 4IN3B 4JC8A 3S7BA 3FUHA 2WXOA 2CHZA 3LY7A 3P1UA 3QC1A 4ILIA 4LEUA 4XX5A 3HDXA 3T5XA 3U9WA 4KT6B 3JYSA 4CT0A 2Y4UA 4NQ0A 1E90A 3FUMA 1Y6IA 4HOSA 4G2VA 1DVPA 2KATA 2L0TB 1IQUA 3ZVVA 1U3DA 3MYVA 3FUDA 4AJWA 4EZLA 1Z3YA 3ESKA 3JUIA 4ANXA 3RO2A 4GZ3A 1HE8A 3LYAA 4DI4A 3CVUA 4BFRA 3FTUA 2R17C 3KEZA 2WXIA 2IFUA 3D9PA 2YHCA 5FZQA 2GW1A 2AXZA 3B7SA 4HXIA 2Q7FA 3MJWA 3SBSA 2V0PA 1E7VA 2A4ZA 3CVXA 4AEZC 3CVVA 3JQ0A 3FH5A 1XNFA 4N2SA 2AWIA 4OVVA 4W9RA 1QQEA 4UWFA 4H7YA 4WWPA 4KXKB 4AY6A 4E85A 3FHEA 4G25A 1UN9A 3ASDA 4D10C 4JHJA 1S0PA 2LNIA 1EDUA 4GCNA 1IQRA 5CMWA 1FVFA 2BUGA 3RJVA 3L54A 4AVXA 3U66A 4GYOA 3EIQC 1TJCA 1JUQA 3UT4A 1BPOA 1H2VC 3TL5A 4A55A 3RRUA 3PE4A 3KS2A 1JPLA 3UMVA 4RVBA 4NACA 3G2SA 4EZKA 4C0EA 1UG3A 5ENNA 2YQ8A 3L22A 1E8ZA 3FDHA 4CEMA 2VTBA 3QDNA 4MLPA 4CDRA 2VGYA 3IKOB 3LDZA 4DJAA 5KJMA 4JL0A 3SNXA 3UPVA 2CFZA 3C98A 4Q96A 3G2VA 3P2BA 4U0SA 3IBEA 4BX8A 5LCWJ 4B8AA 2X6FA 4MS6A 3FU6A 4CDMA 3Q49B 2NXPA 4XIFA 4IULA 3FTVA 1GW6A 3I4RB 3OTNA 3TJPA 3SD5A 4DLOA 2AXVA 2VTBB 1NA0A 4I43A 3MCXA 3ASHA 2VSYA 3CHQA 4CT4A 3UQ3A 3HVEB 2RD0A 2MRIA 3RU0A 4LCTA 4A3VA 4JXTA 3FU3A 4TRQA 4I9EA 1WM5A 3CK7A 3MA5A 4XE0A 4E6HA 2OVFA 2WPVA 3JCKC 2PL2A 4P29A 4U63A 4GCOA 4MRUA 4IYPA 1W3BA 3TG5A 4JA7A 4KVMA 4WNEA 3G2UA 1EYHA 5T8IA 2XGSA 4I1MA 4U07A 3VLFA 3OXGA 5EDSA 4JZYA 4B0ZA 1MQSA 4L2YA 2XRZA 4U0UA 1ELWA 1OWOA 4U8HA 5CHEE 3RRMB 4EPZA 4JEUA 2HYZA 1B89A 2XGMA 4ATGA 4XI9A 3APFA 2CFUA 4RG9A 4F1SA 3FUNA 3OXLA 5EX3A 2M63A 1H19A 4G26A 4EBAG 4MKTA 2A5UA 4R7LA 3ZHEA 4LERA 1DNPA 4J8EA 4FC8A 3D9MA 5G05J 3S2AA 4UWHA 3Q15A 2DBAA 2L6JA 3CHMA 4OYSA 5JJ7A 4Y6CA 2WXMA 1UJJA 4FJYA 4N3BA 3ZRHA 4ANUA 5DBKA 3FH8A 2LAHA 1SZ9A 2NC9A 2XCCA 2WXPA 5KJLA 3AU4A 3IV0A 2GRMA 2WXFA 3LVQE 5LOZA 3RIBA 2J08A 4UQZA 3ZHEB 5BV0A 1NZNA 3RO3A 1PC2A 3APDA 3PS6A 4J8SA 4BY6A 4GMLA 5G05C 3SI5A 2FO7A 2XHEA 5FTPA 2VSOE 1KLXA 3MV2B 5A7DB 4DPRA 3ZXSA 2FULA 2CHXA 4GAAA 3S7FA 1INZA 1MHQA 5BT1A 2BTDA 3ZYQA 3EIJA 4GB9A 2V5FA 4AP2A 1EPUA 2CHWA 2VSXE 2XPZA 1OWNA 1XGWA 2GGFA 2OV8A 3NZSA 4GA1A 2E2EA 3VLEA 3B7TA 4ILHB 4AM9A 4KVOA 4GPKA 4HOQA 4CGWA 3Q4AB 4N2QA 4JW1A 2HM8A 5FT9A 3GW4A 2EQXA 3ML9A 5HQ8A 3SF4A 5C1DA 3UT7A 4A1SA 5G04J 3LY9A 2QY7A 2Y4TA 2KZTA 4YVQC 3FUJA 3ZPJA 3E4BA 4IRUA 1X5BA 3LJ3A 4JA9A 2GRLA 1Z3XA 3CHPA 4AIFA 4HFGA 3ZIMA 3D9JA 3CK9A 1PAQA 3L08A 3ZN3A 2IOSA 5ARGA 4XZ4A 4F3VA 3L6AA 3FEXA 4GMJA 4KZ0A 2J4BA 3CVQA 4L23A 5DIZA 3B13A 3WXXA 3FTXA 4B89A 2KZTB 1UN8A 3FWVA 5G04C 4TV3A 2YNQA 4UQYA 3CKBA 3QNKA 3R9AB 2CG2A 3S7JA 4KBQA 4B8CB 3CEQA 2PQRA 2XGOA 3ML8A 4RG6A 4GA0A 3QARA 5AYWD 1JWGA 3TGOA 4F53A 2J07A 3LKUA 3CKCA 1U3CA 2Y3AA 3BG0B 3EHNA 1E96B 3MKQA 4CDNA 5FQ8A 3ZFWA 3QWPA 2IQCA 2WXKA 3BEEA 3HVEA 3NZUA 4DI3A 3O48A 4FU3A 5EX0A 5T4YA 3LCAA 3VLDA 4I6GA 3UUXA 1HH8A 4C9BB 3JQ1A 4LUNU 1UW4B 3QK0A 4JPSA 4WUYA 4XKBA 5FQ4A 3I4GA 4HORA 3DPDA 3KD7A 1Z6TA 3MKQB 3QWWA 4RSYA 4WWOA 3IEGA 2FEZA 4KMOA 3TXNA 3BG1B 3D9IA 1HXIA 3MKRA 4ILGA 4APFA 2UY1A 4PS8A 4KZCA 2XPIA 2IF4A 1H2UA 4GA2A 3R7QA 3D9KA 2WXQA 5A23A 3MEKA 4GYWA 3CHRA 1HS6A 1A17A 2DIWA 1FCHA 4GZDA 3PVLA 2AW6A 2WXRA 3ONKA 3ZYKA 3LXUX 2J4DA 4GYYA 5CMYA 4DK5A 2PM6A 2UY1B 2XRYA 3D3MA 3GZ2A 3CQGB 3CVPA 4I6JA 2J9QA 3PRZA 3FU5A 3T8MA 4ACKA 4I6EA 4QFVA 5C2YA 1NA3A 3PUJA 3SHFA 2YINA 2ZU6B 3CK8A 3URZA 2XQ0A 1N54A 5KJKA 3CIAA 2J49A 4J8FA 3KAEA 3ZGQA 1FVHA 3RKVA 3CVYA 2IONA 4FJZA 3AS4A 3QJZA 3IHYA 4LRZA 5D0QD 4U04A 2KM4A 2R5SA 3FTSA 4V3IA 2L9BA 4OVUA 4UQXA 4AV7A 4I17A 1TEZA 2FF4A 3FUIA 1OWMA 3QKYA 4N5CA 2X38A 3SFZA 2UWJG 3QB2A 4KYOB 4AXHA 4G24A 2C0LA 3LS8A 5G2NA 3I5PA 2RG8A 1HZ4A 2OOEA 1ZU2A 4UWLA 2HO1A 3G2WA 3L17A 4HLEA 4GZ6A 3ULQA 1WY6A 5LP0A 4NURA 3VTXA 1LF8A 4FULA 2IJGX 3OXFA 1ELRA 5BUZA 2AVPA 2WXJA 1NP7A 2C0MA 2I1JA 3CV0A 3L16A 3O4ZA 2MOWA 2PQNA 5AJDA 3PEVB 4A3TA 4N3AA 3UT8A 3D9NA 4WNDA 5E75A 5CCMA 1IYGA 1QZ2A 3B7UX 1KT0A 4J8DA 2L0IA 4JVSA 2VQ2A 2X6IA 2X6KA 3D9OA 4BT9A 3PNTB 2DCPA 2I9CA 2IU1A 2IOLA 5BPPA 3SBTB 3MGBA 5G55A 3EJNA 2WVIA 2AXUA 3CQCB 3LEWA 3PNLB 4Y6WA 3RK6A 4L7TA 2LSVA 2NSZA 4FADA 4GZCA 3ASGA 3NF1A 4AY5A 2VSNA 2J09A 3QOUA 4H7XA 2ONDA 2JEKA 1H0AA 4HS2A 5KCMA 4PH4B 4NRHB 3FH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WVI A;  2LAH A;  3SI5 A;  4AEZ C;  4A1G A; 
#chains in the Genus database with same CATH topology
 4K0R A;  3ENE A;  2QFC A;  4ZFH A;  4HOU A;  1IHG A;  4FLB A;  4HI8 A;  5JHB A;  4WNG A;  1JCQ A;  2ETB A;  4ACL A;  1H6K A;  1HO8 A;  1BI7 B;  3NQP A;  1YA0 A;  4B94 A;  1OUV A;  2KBX A;  3DEP A;  3Q9N C;  2VGE A;  4U0Z A;  5D0O D;  2YHE A;  3HXD A;  3NOC D;  1OWL A;  3FP3 A;  3FTW A;  2VYI A;  1H2T C;  1WAO 1;  3TWR A;  4URK A;  2V8S E;  1N4S A;  3CGH A;  1NI1 A;  1QBQ A;  3SGH A;  5FZR A;  2WXN A;  4L1B A;  5H7P A;  4UWG A;  3ZNG A;  4BES A;  2ZIR A;  4Q94 A;  3IHV A;  3X2Q E;  3FTY A;  1P5Q A;  3PDN A;  2X6J A;  3TAX A;  2WMO A;  3T5V A;  1E8Y A;  3SF4 A;  4A1G A;  2LSU A;  3U4T A;  5ITZ F;  4BEP A;  5KBA A;  2BKG A;  3ZU7 B;  3ESL A;  1OWP A;  3UM1 A;  2WM9 A;  2X6H A;  5J90 A;  4BTA A;  3TXM A;  3IXE A;  2VJ8 A;  2DVW A;  5LFA A;  5KNH D;  4UI9 K;  2KCK A;  3DSW A;  3AS5 A;  3LY7 A;  4HB5 A;  4DX5 D;  3HDX A;  2XS1 A;  1TNY A;  2QZA A;  1Y6I A;  2XZD G;  1IQU A;  3ASN E;  4AJW A;  1K1B A;  1Z3Y A;  3RO2 A;  5ENR D;  1HE8 A;  2R17 C;  4HQD A;  5FZQ A;  2GW1 A;  2AXZ A;  3B7S A;  3MJW A;  4YDY A;  2H6F A;  1KPS B;  3JQ0 A;  4N2S A;  2AWI A;  1KZO A;  3FHE A;  4G25 A;  4D10 C;  4JHJ A;  1S0P A;  1FVF A;  1JUQ A;  3UT4 A;  4EHM A;  3G2S A;  1UG3 A;  3TWW A;  1N11 A;  2YQ8 A;  2EIK E;  5ENQ D;  3PZ3 A;  2VTB A;  3QDN A;  4MLP A;  3IKO B;  3SNX A;  4YDO A;  2QYJ A;  4U0S A;  3IBE A;  5LCW J;  2X6F A;  3FU6 A;  3Q49 B;  1BLX B;  4XIF A;  4IUL A;  3TJP A;  3I4R B;  3SD5 A;  2VTB B;  3MCX A;  4A3V A;  3MA5 A;  4E6H A;  2PL2 A;  4GCO A;  3SQV A;  4JA7 A;  4OAU C;  4WNE A;  3G2U A;  4I1M A;  4L2Y A;  1ELW A;  4JEU A;  4XI9 A;  4RG9 A;  3OXL A;  4EBA G;  4MKT A;  4LER A;  3S2A A;  3Q15 A;  4Y6C A;  3ZRH A;  5DBK A;  3FH8 A;  1SZ9 A;  3IV0 A;  5LOZ A;  2R02 A;  4UQZ A;  5BV0 A;  3Q9U C;  1PC2 A;  4J8S A;  4GML A;  5G05 C;  3ABM E;  2DYS E;  4GAA A;  5BT1 A;  2BTD A;  2IO2 C;  3NZS A;  2OV8 A;  4MBG A;  4N5Q A;  3TWS A;  3B7T A;  3AG4 E;  4CGW A;  1N4Q A;  5CEA A;  4K5C A;  3UT7 A;  5G04 J;  2QY7 A;  2Y4T A;  3F6Q A;  2KZT A;  1X5B A;  4AIF A;  4HFG A;  3ZIM A;  1PAQ A;  3ZN3 A;  2XEN A;  5ARG A;  4L23 A;  2KZT B;  1UN8 A;  4TV3 A;  2YNQ A;  3QAR A;  1DCE A;  5AQ9 A;  4CDN A;  5FQ8 A;  1JCR A;  2H6H A;  1N94 A;  3UIP C;  1O1S A;  1HH8 A;  1K1A A;  2RKK A;  1UW4 B;  4HOR A;  4JPS A;  4WUY A;  3LJN A;  3DPD A;  3QWW A;  4KMO A;  1BI8 B;  1HXI A;  4ILG A;  4KZC A;  5A23 A;  4HRL A;  2DIW A;  3ULY A;  3LXU X;  2P9N G;  5CMY A;  2PM6 A;  2J9Q A;  3PRZ A;  3FU5 A;  2XS8 A;  3DSX A;  4I6E A;  4QFV A;  4HI9 A;  3CK8 A;  5HS0 A;  3URZ A;  1OCC E;  1N54 A;  2XQ0 A;  5KJK A;  3UM3 A;  1FVH A;  1BD8 A;  3FTS A;  1OCZ E;  2FF4 A;  3DSU A;  3QKY A;  4N5C A;  2X38 A;  2FO1 E;  4AXH A;  3L17 A;  1H6P A;  1WY6 A;  1MX2 A;  1ELR A;  2GRQ B;  3UKU G;  3UT8 A;  5CCM A;  3B7U X;  4GTM A;  1KT0 A;  4J8D A;  2VQ2 A;  3SBT B;  3CQC B;  4Y6W A;  4DX6 D;  4AY5 A;  2VSN A;  4HLL A;  2JEK A;  1H0A A;  4ATZ D;  4NRH B;  3FH7 A;  3Q47 B;  4YVO A;  3FEY A;  5AN8 A;  4F7A A;  4JB8 P;  5ENO D;  3ASF A;  3E37 A;  3QWV A;  4YND A;  3TG4 A;  3DBS A;  2ILR A;  3UKR G;  2HE0 A;  4UWK A;  3FUE A;  3V30 A;  1QNF A;  2QC9 A;  3LVR E;  2Y1L E;  5BV1 A;  2GRR B;  5BW8 C;  4YDW A;  4CCA A;  4PUC A;  4FHK A;  4K03 A;  2LAI A;  1TJF A;  2KCV A;  2XEV A;  1ZB1 A;  5CRU A;  4K5B A;  3CLJ A;  5CED B;  1O5M A;  3EDT B;  1JWF A;  2XEH A;  1E8X A;  2WB2 A;  5FQ7 A;  5BXO A;  2E0I A;  3PUK A;  4HNA D;  3T8K A;  1MJ0 A;  2P58 C;  4EEC A;  3AS8 A;  5JJ6 A;  1HU3 A;  5FWQ A;  2WQ6 A;  4BX9 A;  4JHR A;  4I1A A;  3CVW A;  5JHA A;  3HIZ A;  2XEE A;  1SQM A;  2LXL A;  3S7D A;  5E76 A;  5AJL A;  5LCW C;  5LX8 A;  4XKC A;  4O6F A;  2VGX A;  5FQ6 A;  3FUK A;  2I1K A;  4JEH A;  3V2O A;  3ZW3 A;  4UI9 C;  2VGX B;  2PZI A;  3FUL A;  4I2W A;  4TXQ A;  4J0U A;  2C2L A;  3R9M A;  3U3W A;  3B7R L;  3ISM C;  3ABK E;  4APO A;  3GYZ A;  3L13 A;  2BF0 X;  2I6H A;  4XI0 A;  4AOF A;  3EHM A;  4GTS A;  3APC A;  4LG6 A;  4TUU A;  4XEI G;  4FA6 A;  3PRE A;  5J08 A;  3LPZ A;  1HG5 A;  3CST A;  4IN3 B;  3S7B A;  3P1U A;  3T5X A;  4NQ0 A;  1E90 A;  3FUM A;  4HOS A;  4G2V A;  1OCR E;  1U3D A;  4UUC A;  3JUI A;  3CVU A;  4GTQ A;  3FTU A;  3WG7 E;  1N4R A;  4HXI A;  2A4Z A;  3CVX A;  3CVV A;  1N0R A;  4DUI A;  4WWP A;  4AY6 A;  1UN9 A;  5B1A E;  4GYO A;  3HXC A;  1TJC A;  4RLY A;  4B93 B;  1H2V C;  3TL5 A;  3ZXP A;  3RRU A;  3PE4 A;  3KS2 A;  1QYM A;  2J8S D;  2BKK B;  4NAC A;  3ULE G;  1MX6 A;  3L22 A;  5AAR A;  4RQI A;  4CDR A;  2VGY A;  4DJA A;  3ASO E;  4BX8 A;  5AAO A;  2NXP A;  3NOG D;  3NB2 A;  4DLO A;  2RFA A;  2F8Y A;  2VSY A;  3RU0 A;  1V54 E;  4LCT A;  4J8Y A;  3FU3 A;  3CK7 A;  2WPV A;  4P29 A;  5EID A;  3J5P A;  4MRU A;  1D9S A;  1W3B A;  4KVM A;  1EYH A;  3OXG A;  5EDS A;  4JZY A;  1X81 A;  1MQS A;  5CHE E;  4EPZ A;  2HYZ A;  2XGM A;  2CFU A;  5EX3 A;  5CER B;  4R7L A;  4J8E A;  4FC8 A;  2DYR E;  2A5E A;  5JJ7 A;  3DEO A;  3JXJ A;  3PZ1 A;  2LAH A;  1D8E A;  2GRM A;  2WXF A;  2J08 A;  3UM0 A;  3SI5 A;  2FO7 A;  1LD8 A;  3MV2 B;  5A7D B;  1IHB A;  3S7F A;  2CHX A;  3EIJ A;  4GB9 A;  1EPU A;  2CHW A;  2XPZ A;  2GGF A;  5IY5 E;  1U2V G;  4N2Q A;  2EQX A;  5HQ8 A;  5C1D A;  3LJ3 A;  2GRL A;  1Q2Z A;  3D9J A;  2IOS A;  3L6A A;  1FT2 A;  4GMJ A;  2J4B A;  4HBD A;  2P9K G;  5DIZ A;  3L9T A;  3WXX A;  3FWV A;  4DX2 A;  3B7B A;  3R9A B;  3SFY A;  3CEQ A;  4L9P A;  4RG6 A;  3AAA C;  3TWX A;  3TGO A;  3CKC A;  2H6G A;  3QWP A;  2WXK A;  3O48 A;  5T4Y A;  2V5Q C;  3VLD A;  2L6B A;  4C9B B;  3SFX A;  3TWU A;  2FEZ A;  3TXN A;  3D9I A;  3MKR A;  2XPI A;  4GA2 A;  1YCS B;  4GYW A;  4GZD A;  2RFM A;  3PVL A;  2MYO A;  3GZ2 A;  2XRY A;  3CQG B;  4TUM A;  5HKP A;  3JUE A;  1NA3 A;  3V79 K;  4LNB A;  2J49 A;  5B1B E;  4LNU D;  2OCC E;  1NFI E;  1Z5S C;  3IHY A;  4U04 A;  3KSL A;  1UOH A;  3SFZ A;  3QB2 A;  4G24 A;  2C0L A;  5D66 A;  2HO1 A;  4HLE A;  3C72 A;  2LXM A;  5LP0 A;  4NUR A;  3VTX A;  1LF8 A;  5BUZ A;  2AVP A;  2C0M A;  3Q7A A;  4U95 D;  2MOW A;  3EU9 A;  3Q79 A;  1TNU A;  2P9S G;  1TYQ G;  4JVS A;  2IY0 C;  2DCP A;  2P9U G;  3NAW A;  2IOL A;  5G55 A;  3EJN A;  2WVI A;  2AXU A;  3W9G A;  1S64 A;  2LSV A;  2NSZ A;  2H6I A;  3NF1 A;  1SA5 A;  5KCM A;  2F37 A;  2KCL A;  2FBN A;  3CHO A;  3ZEF A;  5BNW A;  3HYM B;  4ANW A;  4GU5 A;  3K9I A;  4Q69 A;  4G1T A;  5FJY A;  4O60 A;  4G8K A;  1S70 B;  5HI7 A;  3R7R A;  3DPY A;  4F6R D;  3FY4 A;  5ARF A;  3RSE G;  3D9L A;  3I3N A;  4I2Z A;  3CR3 A;  1E7U A;  3CHS A;  4ME2 A;  4PS3 A;  4GZ5 A;  4JHK A;  4I9C A;  3J5Q B;  4DX1 A;  1ZBP A;  1E8W A;  4CYM D;  3UXG A;  3MV3 B;  2EIM E;  2R59 A;  1OCO E;  3JXI A;  3GZS A;  5M72 A;  5AEN A;  4WAF A;  4L2L A;  3Q5M A;  3UX4 A;  2EIN E;  3HHM A;  2WMN A;  1RZ4 A;  3QAQ A;  2X3M A;  3CVN A;  4FHJ A;  4EZJ A;  3CSF A;  2FI7 A;  1RW2 A;  3DXM G;  4GTO A;  3N71 A;  1D8D A;  1Y8M A;  4OAV B;  3TWT A;  1WG0 A;  2WQH A;  3FUF A;  1UJK A;  4M3O A;  4G8L A;  3RAU A;  3PH0 C;  1OY3 D;  3PZD A;  1MX4 A;  2R03 A;  2WQ7 A;  4BT8 A;  4C0M A;  2JLB A;  3U64 A;  4EQF A;  2P9I G;  4G23 A;  3PE3 A;  3EHR A;  3ZYM A;  3FUH A;  2WXO A;  3QC1 A;  4XX5 A;  3JYS A;  4CT0 A;  2Y4U A;  3ZUV B;  1DCQ A;  2KAT A;  4EZL A;  3MYV A;  3FUD A;  1O1T A;  4GZ3 A;  4DI4 A;  3KEZ A;  2IFU A;  3D9P A;  4LNG A;  3SBS A;  4AEZ C;  1QQE A;  2Y0B G;  4H7Y A;  4KXK B;  3T9K A;  5CMW A;  2BUG A;  3V2X A;  3EIQ C;  3UTM A;  1TNZ A;  1JPL A;  1MZC A;  3UMV A;  4JD2 G;  3SO8 A;  5CBN A;  4EZK A;  4NIK A;  2EIL E;  1TN8 A;  1E8Z A;  3FDH A;  1LTX A;  1NL4 A;  3LDZ A;  5KJM A;  2EIJ E;  2CFZ A;  3P2B A;  4B8A A;  4CDM A;  3FTV A;  3OTN A;  2AXV A;  1NA0 A;  3BU8 A;  1FT1 A;  4CT4 A;  3UQ3 A;  3HVE B;  2RD0 A;  3W9F A;  1IXV A;  4JXT A;  1N9A A;  4XE0 A;  2OVF A;  4U63 A;  4IYP A;  2QYU A;  1K8K G;  3AJI A;  5T8I A;  3VLF A;  4B0Z A;  4U0U A;  4U8H A;  4ATG A;  2R2L A;  2M63 A;  4G26 A;  3ZHE A;  1DNP A;  5G05 J;  3D9M A;  2V4H C;  4UWH A;  2DBA A;  3CHM A;  4OYS A;  2WXM A;  1UJJ A;  5EYL A;  4N3B A;  4ANU A;  5ENT D;  1O1R A;  2XCC A;  2WXP A;  5KJL A;  3LVQ E;  4U8V D;  3ZHE B;  1NZN A;  5FIN A;  3AG3 E;  3SY2 A;  1DC2 A;  2P9P G;  4BY6 A;  2XHE A;  5FTP A;  2VSO E;  1KLX A;  4DPR A;  3ZXS A;  2FUL A;  4K5A B;  3ZYQ A;  1OWN A;  1XGW A;  4GA1 A;  4GPM A;  2E2E A;  3PZ2 A;  4ILH B;  4AM9 A;  4GPK A;  2LUH A;  5FT9 A;  2OEV A;  3DSV A;  3GW4 A;  3ML9 A;  4GMR A;  3AG2 E;  3LY9 A;  5AQ7 A;  3L82 A;  4YVQ C;  5BXU A;  4IRU A;  4JA9 A;  3CHP A;  3E30 A;  3NBN B;  3CK9 A;  3L08 A;  4F3V A;  3E34 A;  3CVQ A;  4GTT A;  3FTX A;  4B89 A;  5G04 C;  4UQY A;  3CKB A;  3QNK A;  3DXK G;  4KBQ A;  2PQR A;  2XGO A;  3D9H A;  3ML8 A;  4GA0 A;  4BET A;  1OT8 A;  4F53 A;  3LKU A;  4U96 D;  1U3C A;  3ZFW A;  2IQC A;  3BEE A;  3NZU A;  4DI3 A;  5EX0 A;  4BER A;  4I6G A;  3UUX A;  3JQ1 A;  4LUN U;  5CRV A;  4XKB A;  5AQA A;  3IEG A;  5KNG A;  2UY1 A;  4PS8 A;  1H2U A;  3UM2 A;  3R7Q A;  2WXQ A;  3CHR A;  1HS6 A;  1FCH A;  2WXR A;  3ZYK A;  2J4D A;  4GYY A;  2UY1 B;  3D3M A;  3CVP A;  4I6J A;  3UIN C;  4ACK A;  5C2Y A;  4TXP A;  3SHF A;  2YIN A;  4J8F A;  3KAE A;  3ZGQ A;  2XZT G;  3CVY A;  2ION A;  2B0O E;  1A5E A;  4U7E B;  3QJZ A;  4LRZ A;  2R5S A;  1TR4 A;  1SVX A;  4UQX A;  4AV7 A;  2IEJ A;  1LD7 A;  4KYO B;  4CZ2 D;  3LS8 A;  2ZGD A;  2RG8 A;  1HZ4 A;  1ZU2 A;  4UWL A;  3G2W A;  4GZ6 A;  3ULQ A;  4F1P A;  3CV0 A;  5D2M C;  3O4Z A;  3UI2 A;  3PEV B;  3D9N A;  2L0I A;  4BT9 A;  2X6I A;  3D9O A;  5JA4 D;  3TWQ A;  3MGB A;  4TXR A;  3RK6 A;  3PNL B;  4L7T A;  1AP7 A;  1N4P A;  3ASG A;  2J09 A;  4HS2 A;  5KWD A;  3HXF A;  4CGV A;  5JJT A;  4BSX A;  4BTB A;  4GTP A;  4DLQ A;  3Q78 A;  4DRX E;  3ONL A;  5CCL A;  2KC7 A;  4BWR A;  4PS7 A;  4I1O B;  4X8Q A;  1N95 A;  4Z68 A;  2ETA A;  3DRA A;  2PM7 A;  1WDY A;  5EKQ D;  2AJA A;  2CG3 A;  1HG2 A;  5FZS A;  5KJN A;  3G2T A;  2XPY A;  4ANV A;  3AU5 A;  4FP7 A;  2WXH A;  2ZXW E;  1VDY A;  3FTZ A;  5EIB E;  3SZ7 A;  3FFL A;  4A63 B;  3Q7F A;  1HF8 A;  1ELK A;  1HX8 A;  4HVB A;  4WNF A;  2WXL A;  3DST A;  3EUV A;  5EN5 D;  5ANR A;  1N52 A;  4J6I A;  4N3C A;  3MZL B;  4ABN A;  3GZ1 A;  2WXG A;  2MHK A;  3CVL A;  2B6C A;  3VTY A;  2OEW A;  4HOT A;  4U8Y D;  4C48 B;  2DWZ A;  4FLH A;  3HRA A;  2V4L A;  2XCB A;  4G11 A;  4UI9 J;  4WWN A;  2PNN A;  3EU5 A;  4EBA A;  3PEU B;  1HFA A;  2I2O A;  1SA4 A;  2NYJ A;  1KT1 A;  2LO6 A;  5T3R A;  3UIO C;  3OAW A;  3ZYL A;  3RRN B;  3Q75 A;  2R05 A;  2JAB A;  4QQI A;  1L5J A;  2HR2 A;  5AIJ A;  1SZA A;  4N39 A;  4CRW A;  1EF1 C;  5ANL A;  3MX3 A;  5A6C A;  2OVB A;  1PY1 A;  1N0Q A;  3FU0 A;  3LY8 A;  5B3S E;  4PDX A;  4JC8 A;  2CHZ A;  4LEU A;  4ILI A;  3U9W A;  4KT6 B;  1DVP A;  3KEA A;  2L0T B;  3ZVV A;  3C3O A;  3AG1 E;  3ESK A;  4ANX A;  3LYA A;  3DWL G;  4BFR A;  4HRM B;  2WXI A;  2YHC A;  3PZ4 A;  1TNB A;  2Q7F A;  2V0P A;  1E7V A;  1SW6 A;  2DZO A;  3FH5 A;  1XNF A;  4OVV A;  4W9R A;  4UWF A;  1YMP A;  4E85 A;  3ZKJ A;  3ASD A;  2LNI A;  1EDU A;  4GCN A;  1IQR A;  1IKN D;  3RJV A;  3L54 A;  4AVX A;  3U66 A;  1BPO A;  4A55 A;  4RVB A;  5EIL A;  4C0E A;  5ENN A;  5FIO A;  4CEM A;  1AWC B;  2ZGG A;  2F0Y A;  4JL0 A;  3UPV A;  3C98 A;  4Q96 A;  3G2V A;  2GRO B;  3V31 A;  4MS6 A;  3DSS A;  1GW6 A;  3E32 A;  4DX7 D;  1H6O A;  4I43 A;  3ASH A;  2GRP B;  3TWV A;  3CHQ A;  2GRN B;  2MRI A;  1TNO A;  4TRQ A;  4I9E A;  1WM5 A;  3JCK C;  3KSQ A;  3HG0 D;  4M7C A;  3TG5 A;  2XGS A;  4U07 A;  2XRZ A;  1OWO A;  3RRM B;  3HXB A;  1B89 A;  3APF A;  4F1S A;  3FUN A;  3Q73 A;  1H19 A;  2A5U A;  4HRN A;  5ENS D;  2L6J A;  4FJY A;  2NC9 A;  1V55 E;  3AU4 A;  1JCS A;  3RIB A;  1S63 A;  2ETC A;  2P9L G;  3RO3 A;  3APD A;  3PS6 A;  4J7W A;  1INZ A;  1MHQ A;  1KZP A;  1BU9 A;  2V5F A;  4AP2 A;  2VSX E;  3VLE A;  1MYO A;  4KVO A;  1FPP A;  4HOQ A;  2P2C P;  3Q4A B;  4O1P A;  4JW1 A;  2HM8 A;  4GTV A;  5EYP F;  4A1S A;  2ZIS A;  3ZPJ A;  3FUJ A;  3E4B A;  1Z3X A;  3BQO A;  4LSZ E;  3B95 A;  5JMN D;  2Y69 E;  4XZ4 A;  3FEX A;  4KZ0 A;  3ABL E;  3C5R A;  3B13 A;  3C3R A;  2CG2 A;  3S7J A;  4B8C B;  4O1O A;  5AYW D;  1JWG A;  2J07 A;  4YDE A;  2Y3A A;  3BG0 B;  3EHN A;  1E96 B;  3MKQ A;  3HVE A;  4FU3 A;  3LCA A;  5ENP D;  3QK0 A;  5FQ4 A;  3I4G A;  3KD7 A;  3MKQ B;  1Z6T A;  4RSY A;  4WWO A;  4APF A;  3BG1 B;  5CEC B;  2IF4 A;  3D9K A;  3MEK A;  5AQB A;  1A17 A;  3HXE A;  1TN7 A;  2AW6 A;  3ONK A;  3BUA A;  2DZN A;  4DK5 A;  4BSZ B;  3EHQ A;  1G3N B;  3T8M A;  3PUJ A;  4ZHB A;  5CBO A;  2ZU6 B;  3CIA A;  2KXP C;  3E33 A;  1K3Z D;  3RKV A;  4FJZ A;  3AS4 A;  5D0Q D;  1YYH A;  2KM4 A;  4V3I A;  2L9B A;  4OVU A;  4I17 A;  1TEZ A;  3FUI A;  1OWM A;  2UWJ G;  3C3Q A;  5G2N A;  3I5P A;  2OOE A;  4FUL A;  2IJG X;  3OXF A;  2WXJ A;  1NP7 A;  3L16 A;  2I1J A;  2PQN A;  5AJD A;  4A3T A;  4N3A A;  1TN6 A;  4WND A;  5E75 A;  1IYG A;  1QZ2 A;  5HRY A;  2X6K A;  3PNT B;  2I9C A;  2IU1 A;  4GTR A;  5BPP A;  2IO3 C;  3LEW A;  1OXJ A;  4FAD A;  4GZC A;  2F8X K;  3QOU A;  4H7X A;  2OND A;  4PH4 B;  2BED A; 
#chains in the Genus database with same CATH homology
 4K0R A;  4CGV A;  5JJT A;  3ENE A;  2QFC A;  3Q47 B;  2KCL A;  3FEY A;  2FBN A;  4YVO A;  4BSX A;  3CHO A;  4BTB A;  4HOU A;  4F7A A;  3ZEF A;  5BNW A;  1IHG A;  3HYM B;  4DLQ A;  3ASF A;  4FLB A;  3ONL A;  5CCL A;  2KC7 A;  4BWR A;  5JHB A;  4PS7 A;  4I1O B;  3QWV A;  4ANW A;  4YND A;  4GU5 A;  3TG4 A;  3DBS A;  3K9I A;  2PM7 A;  2ILR A;  5EKQ D;  4Q69 A;  4G1T A;  5FJY A;  4UWK A;  2CG3 A;  1HG2 A;  5FZS A;  3FUE A;  5KJN A;  3G2T A;  4WNG A;  1QNF A;  3LVR E;  2XPY A;  1H6K A;  4ACL A;  3AU5 A;  4ANV A;  5BV1 A;  1HO8 A;  2WXH A;  4FP7 A;  5HI7 A;  3R7R A;  1VDY A;  5BW8 C;  3NQP A;  1YA0 A;  3FTZ A;  4CCA A;  4B94 A;  1OUV A;  4PUC A;  4FHK A;  3FY4 A;  5ARF A;  4U0Z A;  4K03 A;  5D0O D;  2YHE A;  3SZ7 A;  2LAI A;  1TJF A;  3D9L A;  3FFL A;  1HF8 A;  3I3N A;  1ELK A;  1OWL A;  4I2Z A;  3FP3 A;  1HX8 A;  4HVB A;  4WNF A;  2KCV A;  3FTW A;  2WXL A;  2XEV A;  2VYI A;  1H2T C;  1WAO 1;  3CR3 A;  1E7U A;  4URK A;  2V8S E;  3CHS A;  3CLJ A;  4ME2 A;  4PS3 A;  4GZ5 A;  3CGH A;  4JHK A;  5ANR A;  4I9C A;  1N52 A;  4J6I A;  3EDT B;  1JWF A;  1ZBP A;  4N3C A;  3SGH A;  1E8X A;  3MZL B;  1E8W A;  5FQ7 A;  5FZR A;  4ABN A;  2WB2 A;  2WXN A;  2E0I A;  3GZ1 A;  3PUK A;  2WXG A;  2MHK A;  3CVL A;  2P58 C;  4EEC A;  3AS8 A;  3MV3 B;  4L1B A;  5JJ6 A;  1HU3 A;  5FWQ A;  3VTY A;  2WQ6 A;  4BX9 A;  2R59 A;  4UWG A;  4HOT A;  4FLH A;  4Q94 A;  3IHV A;  4JHR A;  4I1A A;  3FTY A;  2V4L A;  3GZS A;  5M72 A;  3CVW A;  5AEN A;  1P5Q A;  3PDN A;  4WAF A;  5JHA A;  2X6J A;  4L2L A;  3HIZ A;  3Q5M A;  3TAX A;  2XCB A;  3UX4 A;  1SQM A;  2WMO A;  4G11 A;  4UI9 J;  4WWN A;  4EBA A;  3HHM A;  3T5V A;  3S7D A;  2WMN A;  5E76 A;  5AJL A;  1E8Y A;  5LCW C;  3QAQ A;  5LX8 A;  3PEU B;  1HFA A;  2I2O A;  2X3M A;  3CVN A;  4FHJ A;  4O6F A;  3CSF A;  2VGX A;  4XKC A;  4EZJ A;  1KT1 A;  2LO6 A;  3FUK A;  2FI7 A;  5FQ6 A;  5T3R A;  3ZYL A;  3OAW A;  4A1G A;  2LSU A;  3RRN B;  3U4T A;  2I1K A;  3N71 A;  4JEH A;  1L5J A;  2HR2 A;  5AIJ A;  3ESL A;  1Y8M A;  1OWP A;  2WQH A;  1SZA A;  2WM9 A;  3FUF A;  4N39 A;  4CRW A;  3ZW3 A;  1UJK A;  2X6H A;  4M3O A;  1EF1 C;  4UI9 C;  5ANL A;  2VGX B;  3MX3 A;  2PZI A;  3FUL A;  5J90 A;  5A6C A;  4I2W A;  4J0U A;  2C2L A;  3U3W A;  3B7R L;  2OVB A;  1PY1 A;  4APO A;  3GYZ A;  3PH0 C;  3PZD A;  4BTA A;  3L13 A;  2BF0 X;  3FU0 A;  4BT8 A;  4C0M A;  3TXM A;  2WQ7 A;  2JLB A;  2I6H A;  4XI0 A;  3U64 A;  2VJ8 A;  3LY8 A;  3EHM A;  4AOF A;  3APC A;  4EQF A;  4G23 A;  5LFA A;  3PE3 A;  4TUU A;  4FA6 A;  4UI9 K;  3PRE A;  4PDX A;  3LPZ A;  5J08 A;  1HG5 A;  2KCK A;  3ZYM A;  3CST A;  3AS5 A;  4IN3 B;  4JC8 A;  3S7B A;  3FUH A;  2WXO A;  2CHZ A;  3LY7 A;  3P1U A;  3QC1 A;  4ILI A;  4LEU A;  4XX5 A;  3HDX A;  3T5X A;  3U9W A;  4KT6 B;  3JYS A;  4CT0 A;  2Y4U A;  4NQ0 A;  1E90 A;  3FUM A;  1Y6I A;  4HOS A;  4G2V A;  1DVP A;  2KAT A;  2L0T B;  1IQU A;  3ZVV A;  1U3D A;  3MYV A;  3FUD A;  4AJW A;  4EZL A;  1Z3Y A;  3ESK A;  3JUI A;  4ANX A;  3RO2 A;  4GZ3 A;  1HE8 A;  3LYA A;  4DI4 A;  3CVU A;  4BFR A;  3FTU A;  2R17 C;  3KEZ A;  2WXI A;  2IFU A;  3D9P A;  2YHC A;  5FZQ A;  2GW1 A;  2AXZ A;  3B7S A;  4HXI A;  2Q7F A;  3MJW A;  3SBS A;  2V0P A;  1E7V A;  2A4Z A;  3CVX A;  4AEZ C;  3CVV A;  3JQ0 A;  3FH5 A;  1XNF A;  4N2S A;  2AWI A;  4OVV A;  4W9R A;  1QQE A;  4UWF A;  4H7Y A;  4WWP A;  4KXK B;  4AY6 A;  4E85 A;  3FHE A;  4G25 A;  1UN9 A;  3ASD A;  4D10 C;  4JHJ A;  1S0P A;  2LNI A;  1EDU A;  4GCN A;  1IQR A;  5CMW A;  1FVF A;  2BUG A;  3RJV A;  3L54 A;  4AVX A;  3U66 A;  4GYO A;  3EIQ C;  1TJC A;  1JUQ A;  3UT4 A;  1BPO A;  1H2V C;  3TL5 A;  4A55 A;  3RRU A;  3PE4 A;  3KS2 A;  1JPL A;  3UMV A;  4RVB A;  4NAC A;  3G2S A;  4EZK A;  4C0E A;  1UG3 A;  5ENN A;  2YQ8 A;  3L22 A;  1E8Z A;  3FDH A;  4CEM A;  2VTB A;  3QDN A;  4MLP A;  4CDR A;  2VGY A;  3IKO B;  3LDZ A;  4DJA A;  5KJM A;  4JL0 A;  3SNX A;  3UPV A;  2CFZ A;  3C98 A;  4Q96 A;  3G2V A;  3P2B A;  4U0S A;  3IBE A;  4BX8 A;  5LCW J;  4B8A A;  2X6F A;  4MS6 A;  3FU6 A;  4CDM A;  3Q49 B;  2NXP A;  4XIF A;  4IUL A;  3FTV A;  1GW6 A;  3I4R B;  3OTN A;  3TJP A;  3SD5 A;  4DLO A;  2AXV A;  2VTB B;  1NA0 A;  4I43 A;  3MCX A;  3ASH A;  2VSY A;  3CHQ A;  4CT4 A;  3UQ3 A;  3HVE B;  2RD0 A;  2MRI A;  3RU0 A;  4LCT A;  4A3V A;  4JXT A;  3FU3 A;  4TRQ A;  4I9E A;  1WM5 A;  3CK7 A;  3MA5 A;  4XE0 A;  4E6H A;  2OVF A;  2WPV A;  3JCK C;  2PL2 A;  4P29 A;  4U63 A;  4GCO A;  4MRU A;  4IYP A;  1W3B A;  3TG5 A;  4JA7 A;  4KVM A;  4WNE A;  3G2U A;  1EYH A;  5T8I A;  2XGS A;  4I1M A;  4U07 A;  3VLF A;  3OXG A;  5EDS A;  4JZY A;  4B0Z A;  1MQS A;  4L2Y A;  2XRZ A;  4U0U A;  1ELW A;  1OWO A;  4U8H A;  5CHE E;  3RRM B;  4EPZ A;  4JEU A;  2HYZ A;  1B89 A;  2XGM A;  4ATG A;  4XI9 A;  3APF A;  2CFU A;  4RG9 A;  4F1S A;  3FUN A;  3OXL A;  5EX3 A;  2M63 A;  1H19 A;  4G26 A;  4EBA G;  4MKT A;  2A5U A;  4R7L A;  3ZHE A;  4LER A;  1DNP A;  4J8E A;  4FC8 A;  3D9M A;  5G05 J;  3S2A A;  4UWH A;  3Q15 A;  2DBA A;  2L6J A;  3CHM A;  4OYS A;  5JJ7 A;  4Y6C A;  2WXM A;  1UJJ A;  4FJY A;  4N3B A;  3ZRH A;  4ANU A;  5DBK A;  3FH8 A;  2LAH A;  1SZ9 A;  2NC9 A;  2XCC A;  2WXP A;  5KJL A;  3AU4 A;  3IV0 A;  2GRM A;  2WXF A;  3LVQ E;  5LOZ A;  3RIB A;  2J08 A;  4UQZ A;  3ZHE B;  5BV0 A;  1NZN A;  3RO3 A;  1PC2 A;  3APD A;  3PS6 A;  4J8S A;  4BY6 A;  4GML A;  5G05 C;  3SI5 A;  2FO7 A;  2XHE A;  5FTP A;  2VSO E;  1KLX A;  3MV2 B;  5A7D B;  4DPR A;  3ZXS A;  2FUL A;  2CHX A;  4GAA A;  3S7F A;  1INZ A;  1MHQ A;  5BT1 A;  2BTD A;  3ZYQ A;  3EIJ A;  4GB9 A;  2V5F A;  4AP2 A;  1EPU A;  2CHW A;  2VSX E;  2XPZ A;  1OWN A;  1XGW A;  2GGF A;  2OV8 A;  3NZS A;  4GA1 A;  2E2E A;  3VLE A;  3B7T A;  4ILH B;  4AM9 A;  4KVO A;  4GPK A;  4HOQ A;  4CGW A;  3Q4A B;  4N2Q A;  4JW1 A;  2HM8 A;  5FT9 A;  3GW4 A;  2EQX A;  3ML9 A;  5HQ8 A;  3SF4 A;  5C1D A;  3UT7 A;  4A1S A;  5G04 J;  3LY9 A;  2QY7 A;  2Y4T A;  2KZT A;  4YVQ C;  3FUJ A;  3ZPJ A;  3E4B A;  4IRU A;  1X5B A;  3LJ3 A;  4JA9 A;  2GRL A;  1Z3X A;  3CHP A;  4AIF A;  4HFG A;  3ZIM A;  3D9J A;  3CK9 A;  1PAQ A;  3L08 A;  3ZN3 A;  2IOS A;  5ARG A;  4XZ4 A;  4F3V A;  3L6A A;  3FEX A;  4GMJ A;  4KZ0 A;  2J4B A;  3CVQ A;  4L23 A;  5DIZ A;  3B13 A;  3WXX A;  3FTX A;  4B89 A;  2KZT B;  1UN8 A;  3FWV A;  5G04 C;  4TV3 A;  2YNQ A;  4UQY A;  3CKB A;  3QNK A;  3R9A B;  2CG2 A;  3S7J A;  4KBQ A;  4B8C B;  3CEQ A;  2PQR A;  2XGO A;  3ML8 A;  4RG6 A;  4GA0 A;  3QAR A;  5AYW D;  1JWG A;  3TGO A;  4F53 A;  2J07 A;  3LKU A;  3CKC A;  1U3C A;  2Y3A A;  3BG0 B;  3EHN A;  1E96 B;  3MKQ A;  4CDN A;  5FQ8 A;  3ZFW A;  3QWP A;  2IQC A;  2WXK A;  3BEE A;  3HVE A;  3NZU A;  4DI3 A;  3O48 A;  4FU3 A;  5EX0 A;  5T4Y A;  3LCA A;  3VLD A;  4I6G A;  3UUX A;  1HH8 A;  4C9B B;  3JQ1 A;  4LUN U;  1UW4 B;  3QK0 A;  4JPS A;  4WUY A;  4XKB A;  5FQ4 A;  3I4G A;  4HOR A;  3DPD A;  3KD7 A;  1Z6T A;  3MKQ B;  3QWW A;  4RSY A;  4WWO A;  3IEG A;  2FEZ A;  4KMO A;  3TXN A;  3BG1 B;  3D9I A;  1HXI A;  3MKR A;  4ILG A;  4APF A;  2UY1 A;  4PS8 A;  4KZC A;  2XPI A;  2IF4 A;  1H2U A;  4GA2 A;  3R7Q A;  3D9K A;  2WXQ A;  5A23 A;  3MEK A;  4GYW A;  3CHR A;  1HS6 A;  1A17 A;  2DIW A;  1FCH A;  4GZD A;  3PVL A;  2AW6 A;  2WXR A;  3ONK A;  3ZYK A;  3LXU X;  2J4D A;  4GYY A;  5CMY A;  4DK5 A;  2PM6 A;  2UY1 B;  2XRY A;  3D3M A;  3GZ2 A;  3CQG B;  3CVP A;  4I6J A;  2J9Q A;  3PRZ A;  3FU5 A;  3T8M A;  4ACK A;  4I6E A;  4QFV A;  5C2Y A;  1NA3 A;  3PUJ A;  3SHF A;  2YIN A;  2ZU6 B;  3CK8 A;  3URZ A;  2XQ0 A;  1N54 A;  5KJK A;  3CIA A;  2J49 A;  4J8F A;  3KAE A;  3ZGQ A;  1FVH A;  3RKV A;  3CVY A;  2ION A;  4FJZ A;  3AS4 A;  3QJZ A;  3IHY A;  4LRZ A;  5D0Q D;  4U04 A;  2KM4 A;  2R5S A;  3FTS A;  4V3I A;  2L9B A;  4OVU A;  4UQX A;  4AV7 A;  4I17 A;  1TEZ A;  2FF4 A;  3FUI A;  1OWM A;  3QKY A;  4N5C A;  2X38 A;  3SFZ A;  2UWJ G;  3QB2 A;  4KYO B;  4AXH A;  4G24 A;  2C0L A;  3LS8 A;  5G2N A;  3I5P A;  2RG8 A;  1HZ4 A;  2OOE A;  1ZU2 A;  4UWL A;  2HO1 A;  3G2W A;  3L17 A;  4HLE A;  4GZ6 A;  3ULQ A;  1WY6 A;  5LP0 A;  4NUR A;  3VTX A;  1LF8 A;  4FUL A;  2IJG X;  3OXF A;  1ELR A;  5BUZ A;  2AVP A;  2WXJ A;  1NP7 A;  2C0M A;  2I1J A;  3CV0 A;  3L16 A;  3O4Z A;  2MOW A;  2PQN A;  5AJD A;  3PEV B;  4A3T A;  4N3A A;  3UT8 A;  3D9N A;  4WND A;  5E75 A;  5CCM A;  1IYG A;  1QZ2 A;  3B7U X;  1KT0 A;  4J8D A;  2L0I A;  4JVS A;  2VQ2 A;  2X6I A;  2X6K A;  3D9O A;  4BT9 A;  3PNT B;  2DCP A;  2I9C A;  2IU1 A;  2IOL A;  5BPP A;  3SBT B;  3MGB A;  5G55 A;  3EJN A;  2WVI A;  2AXU A;  3CQC B;  3LEW A;  3PNL B;  4Y6W A;  3RK6 A;  4L7T A;  2LSV A;  2NSZ A;  4FAD A;  4GZC A;  3ASG A;  3NF1 A;  4AY5 A;  2VSN A;  2J09 A;  3QOU A;  4H7X A;  2OND A;  2JEK A;  1H0A A;  4HS2 A;  5KCM A;  4PH4 B;  4NRH B;  3FH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...