4A1GA

The crystal structure of the human bub1 tpr domain in complex with the ki motif of knl1
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
146
structure length
146
Chain Sequence
DTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQAEPREFLQQQYRLFQTRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis Reveals Features of the Spindle Checkpoint Kinase Bub1-Kinetochore Subunit Knl1 Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords MITOTIC CHECKPOINT SERINE/THREONINE-PROTEIN KINASE BUB1
total genus 62
structure length 146
sequence length 146
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08311 Mad3_BUB1_I Mad3/BUB1 homology region 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.430 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4a1gA00
3SI5A 2WVIA 4AEZC 2LAHA 4A1GA
chains in the Genus database with same CATH superfamily
2BKKB 3Q4AB 4GZ6A 2P9LG 3B7SA 3FU3A 4BX9A 3D9NA 4UI9J 1UJJA 2WXGA 5BPPA 4GTOA 4LRZA 5LX8A 2FULA 5AJLA 2GRPB 2X6IA 4ILHB 3U9WA 2HM8A 3ASFA 3U66A 4NACA 3FULA 3PUJA 1BI7B 4XI0A 3SFZA 3LJNA 4N3AA 1DCEA 2GGFA 4CT0A 2X3MA 2V4LA 2VGYA 3DEPA 3VLEA 2QYJA 3LXUX 3FDHA 4GPMA 3UXGA 3S7BA 1IHGA 3B7RL 3CQGB 3C3RA 2GRRB 4G23A 4J6IA 4GCOA 1YMPA 2XPZA 3BU8A 4B0ZA 4FADA 4AEZC 4GMLA 4A3TA 4CYMD 4F1PA 3PZDA 2P9PG 2XPYA 3ZPJA 3I4RB 4L7TA 3ASOE 4BEPA 1N4RA 3DRAA 4JHRA 1RZ4A 4N2SA 3T8MA 3TXMA 4B94A 3UTMA 2PM7A 5CECB 4W9RA 4EZJA 1SA4A 1SVXA 4JHKA 4FP7A 1H2TC 1K1AA 1TN7A 1IHBA 5EIDA 3R9MA 2GW1A 1E8WA 4ILGA 3QKYA 5KJNA 4UWLA 3NOGD 4UI9K 3CVPA 5D2MC 1UOHA 3EHQA 1U3DA 3Q78A 3ZU7B 1TNYA 3Q5MA 2E0IA 5KJKA 1NZNA 5FQ8A 4YVOA 1TEZA 4EPZA 4CCAA 2XCCA 2PZIA 4CT4A 2J8SD 3ML9A 3MA5A 3UM3A 2AWIA 2VJ8A 1TJCA 4K5AB 3TG4A 2DYRE 4XKCA 3CEQA 1P5QA 4MBGA 2KM4A 3B13A 4C0EA 1X5BA 4DI3A 1G3NB 3Q9UC 2PQRA 5AQAA 4QFVA 1HG2A 1XGWA 2ZU6B 4EECA 3Q49B 4NQ0A 3QK0A 2ETCA 3FUIA 4JA7A 3JXJA 1EPUA 2IEJA 3EHRA 1PY1A 2DZNA 2DYSE 2Y4UA 3DPDA 5KJMA 2RKKA 3SO8A 2KATA 2EIJE 4C9BB 3FY4A 1FT2A 3NB2A 5J90A 2YHEA 3WG7E 3HG0D 5A7DB 5AQ9A 4HOTA 4JEUA 3Q47B 2J49A 5LP0A 4HS2A 3UMVA 1N52A 3UINC 3FUFA 3DSUA 2UY1B 3BG0B 4JW1A 4FHJA 3I4GA 3CV0A 4JVSA 3R7QA 4AXHA 2IY0C 5LFAA 3NQPA 3S2AA 4ATZD 2XZTG 3ZEFA 3SQVA 2BUGA 3PUKA 3JYSA 3L22A 1Z3XA 2R17C 3GW4A 4NRHB 3EJNA 3W9GA 3LYAA 4PS7A 1NFIE 3C98A 4G2VA 3I3NA 3MYVA 3B7BA 2WQ6A 3B7TA 2LAIA 4WAFA 2HYZA 2WVIA 1DCQA 3FUHA 2M63A 3Q79A 4EBAA 1N4SA 4ANXA 2DBAA 3O48A 3TJPA 3ZFWA 2A5UA 3KEZA 4Y6CA 3V79K 4J8YA 4U63A 2E2EA 3L08A 5CMYA 5FTPA 2IF4A 3E30A 1UG3A 5EYPF 3GYZA 2EINE 2Y3AA 4MLPA 3EDTB 3TWRA 2OVFA 2BF0X 3VLDA 5HQ8A 5AENA 3QWPA 1QBQA 3Q15A 2R05A 2OOEA 3UQ3A 4OYSA 4HI8A 3T9KA 4AIFA 4TV3A 5ANLA 2LUHA 5FJYA 2OV8A 3TXNA 4UWHA 1E8YA 1TYQG 2P2CP 3C72A 4TUMA 4I1OB 1RW2A 1UW4B 4BT8A 2PM6A 3NOCD 3V2XA 3ZHEA 3IBEA 3IXEA 1TR4A 2AXUA 3IV0A 1Q2ZA 4UUCA 3C5RA 1N11A 1HG5A 2FBNA 4BSXA 3BQOA 1MQSA 5C1DA 2P58C 2L6BA 1HU3A 3MKQB 4J8FA 3CK7A 3S7DA 2CHZA 3D9OA 1HX8A 2QZAA 2I1KA 4GTVA 1SZAA 4B8AA 5ENNA 4EZKA 1N9AA 2V5FA 2CG2A 3PZ4A 3BUAA 4JD2G 2IO3C 4IRUA 3OTNA 4RVBA 4PS8A 1JWGA 2KBXA 3CHRA 2KCVA 5KNGA 3FUJA 4L23A 1WM5A 4M7CA 3ZXPA 3J5QB 1JPLA 2L6JA 3ESKA 3EIJA 2YNQA 3SNXA 3QB2A 2FO1E 3E34A 5BT1A 3EIQC 1N4QA 3CHPA 3CHMA 2LXMA 3G2VA 5KCMA 5JJ6A 3RKVA 3RO2A 5CMWA 2AW6A 4G11A 2P9KG 3HVEA 3FH8A 4N2QA 2UY1A 3K9IA 2OEVA 4XEIG 5AQ7A 3APCA 3CKBA 2XGMA 3QJZA 1S70B 1NA3A 3TGOA 5FZQA 4GMJA 4GB9A 2X6HA 1NP7A 3RRNB 2IOSA 3NZUA 5KNHD 5CCMA 1KZPA 4BESA 3RO3A 3CVYA 4IN3B 1ZB1A 2Y69E 2MHKA 3Q9NC 5EDSA 4DX5D 3LVRE 4J8SA 5CEAA 3ZGQA 4KMOA 4C0MA 3AU4A 5BUZA 3AAAC 2Y4TA 3NF1A 2DZOA 4JA9A 2OCCE 3FHEA 2VGXB 1S0PA 4IYPA 4Q69A 2KXPC 1NA0A 3QNKA 2XCBA 1LTXA 4FHKA 3UT8A 2AXVA 3AG2E 5FZSA 5KWDA 3QC1A 1MX2A 2VSOE 1UN9A 3L9TA 2XS1A 3PE3A 3L54A 5CBOA 3FUNA 1A5EA 2YINA 2GRQB 3UM0A 4M3OA 4APOA 2P9NG 3QAQA 4GZDA 2WB2A 5G55A 2MYOA 3PZ3A 4NURA 4N3BA 2NSZA 1TNUA 5FQ4A 5HI7A 3ABKE 2OEWA 1YYHA 3ZYKA 2C2LA 4U95D 2VSYA 3NBNB 3FH7A 5M72A 3GZ1A 4KZ0A 2ETBA 4X8QA 2XRYA 1MHQA 1O1SA 1ZU2A 2WXQA 3D9JA 4F7AA 3ASDA 1AWCB 3QWVA 2XGOA 3FEXA 4AY5A 3FU0A 1DVPA 4G1TA 2DVWA 5JHAA 1QQEA 4CGVA 4FLHA 5CRUA 1BD8A 5G05J 2LSVA 3IKOB 2L0TB 3ABLE 3NAWA 1ELKA 4DX1A 4I9EA 2MRIA 2KZTA 3FTSA 1IQUA 3C3QA 4ANVA 1N95A 2LO6A 3EHNA 2F0YA 2VGEA 3MGBA 4KZCA 1JCSA 5ARGA 4JZYA 2XEVA 4DLOA 3PZ2A 3VLFA 1HFAA 3Q75A 1O1TA 4WWNA 3GZSA 1YA0A 2ILRA 5T8IA 3PE4A 2EIKE 3AG1E 4LERA 4EQFA 2X6KA 4DI4A 5AJDA 1EF1C 4U04A 3BG1B 1D9SA 4ABNA 5AAOA 3CIAA 4PDXA 1OWMA 4TXQA 1OCRE 3PEVB 5HKPA 3D3MA 2WM9A 2CHWA 1U3CA 5EYLA 5B3SE 2EQXA 4HRNA 3FTXA 5FWQA 1V54E 2NC9A 3P1UA 5BV1A 1HF8A 5AIJA 1KLXA 3CVXA 1SA5A 4GTTA 3OXGA 2B6CA 3OXFA 1OWPA 2I6HA 3PH0C 4GTSA 4FJYA 2RFMA 2EIME 3FUDA 4U8HA 4EHMA 3SBTB 1Y6IA 2XZDG 5H7PA 4ZFHA 3X2QE 3SY2A 3FH5A 1E7VA 3LS8A 3ML8A 3HXBA 1SZ9A 3FUKA 5KBAA 3UM1A 4O1PA 3HXFA 5BXOA 4CDNA 3RAUA 3R9AB 3TG5A 3UPVA 3UT4A 3NZSA 4FC8A 3CQCB 1PAQA 4F1SA 5DIZA 2JEKA 4G8KA 2QY7A 5E76A 1N54A 4B89A 3SF4A 3HXEA 2FEZA 3CVQA 2PNNA 4GZCA 4IULA 4RLYA 1INZA 2FO7A 3MZLB 3FFLA 4NIKA 4B8CB 4LUNU 4O1OA 2ZGGA 2FI7A 3LEWA 1OCOE 4CDMA 1HO8A 4FU3A 4J7WA 4U0SA 3CVVA 3F6QA 4N5QA 2UWJG 1Z3YA 4H7YA 1AP7A 4Q94A 2H6IA 4G8LA 4I43A 3WXXA 3Q7FA 3UI2A 2WXLA 2I9CA 2P9UG 2ETAA 3I5PA 4L2LA 1HS6A 2F8XK 1PC2A 3CLJA 2DWZA 3KSLA 4KVMA 4I6EA 4E85A 4K5CA 5HRYA 1FCHA 4KT6B 4FULA 4BX8A 5J08A 3E33A 4HBDA 4HOUA 1EYHA 3Q73A 5ENTD 3UT7A 3CVNA 3D9PA 2Q7FA 1OCCE 2L9BA 4K5BA 1N94A 3ASGA 3CKCA 2XENA 5FZRA 3ZKJA 2GRLA 5EX3A 1FVHA 3SFXA 4BWRA 3S7FA 3AS4A 5EX0A 4YDOA 2HO1A 1H6OA 4GYOA 2WXIA 3U64A 4AJWA 4JC8A 3QARA 4KVOA 2V4HC 2Y0BG 3RK6A 2V5QC 2J09A 3HIZA 4HI9A 4L1BA 1YCSB 1ELRA 1WDYA 3LCAA 1FVFA 1OWNA 1SW6A 5ARFA 1H2VC 4JL0A 4QQIA 5D0OD 3VTXA 1WG0A 4J8EA 5A6CA 1O1RA 2VSXE 3KEAA 5JMND 5CBNA 1K8KG 2XS8A 3KD7A 3TWTA 3D9HA 1MX6A 1UN8A 3CK9A 4JPSA 2WXHA 4GAAA 3CGHA 3PVLA 5FINA 2GRMA 1LD8A 2KZTB 4I2ZA 2WMOA 1K1BA 4U0UA 3AS8A 3V2OA 4HVBA 4I2WA 1LD7A 2HR2A 2R59A 3APDA 4HOQA 4AP2A 4HRLA 4FA6A 3CR3A 3PRZA 4UQXA 5G04J 4MRUA 5JHBA 3BEEA 4L2YA 4TXPA 4GA2A 4N5CA 3ZYLA 4KXKB 3ZN3A 4GZ5A 3ESLA 3OXLA 4ILIA 3ONKA 4G24A 4GU5A 5EIBE 4I1AA 1JCRA 3ULQA 2XPIA 1TN8A 3HXDA 2WXRA 3KAEA 4HFGA 4GCNA 3E32A 3LKUA 3W9FA 2YQ8A 4U07A 1TNOA 4GTMA 2YHCA 2FF4A 3UKRG 2QYUA 5D0QD 3CVLA 1NI1A 4CRWA 4BTBA 3D9LA 3TL5A 4U8VD 4CEMA 1IKND 3L16A 1BU9A 3ASHA 2A5EA 4O6FA 3UM2A 4XKBA 5E75A 4D10C 4DX2A 3DSTA 2KC7A 1D8DA 2LSUA 3EU5A 4K03A 2WXNA 2RFAA 3L6AA 3ULYA 3TWSA 1XNFA 5BV0A 5BNWA 2X6JA 3ZXSA 4ATGA 2VGXA 4ME2A 3RRUA 4UI9C 4LSZE 3O4ZA 4ACLA 5ENRD 4WNDA 3ISMC 4RG6A 2CFUA 3LY8A 3RU0A 3AG3E 5FT9A 4HNAD 1GW6A 4YDEA 3RSEG 2EILE 5FIOA 1HZ4A 4RSYA 3PNLB 3PNTB 4OAVB 5ENPD 4LG6A 4OVVA 2RD0A 3TWWA 1IQRA 3G2SA 4DK5A 4H7XA 4CGWA 3AG4E 2XRZA 3LDZA 3ZVVA 2VYIA 2R02A 3ZNGA 5CRVA 4PH4B 4HORA 5T3RA 4XI9A 4OVUA 2P9IG 4GYWA 1S63A 2GROB 2XHEA 5LCWC 3HYMB 2VTBA 3FTVA 5JJTA 3L13A 2RG8A 4DUIA 2R5SA 1N0QA 2V0PA 4U96D 4KYOB 3RRMB 1N4PA 4DJAA 4GZ3A 4UWGA 2J4BA 3KSQA 2WPVA 4ACKA 2X6FA 5JJ7A 2CG3A 4U0ZA 4GTRA 5AARA 1OXJA 3OAWA 5FQ6A 1E90A 3QOUA 3ONLA 2NXPA 2WMNA 3DXKG 3CVUA 2F37A 5KJLA 4JXTA 3MCXA 4J0UA 4GPKA 3CSTA 4BT9A 4BFRA 3UKUG 3PREA 3G2UA 3JUEA 4OAUC 1H19A 2F8YA 2MOWA 2PQNA 4LNUD 2WQ7A 2LXLA 1K3ZD 2L0IA 1TNBA 3T5VA 3DEOA 3PDNA 2BEDA 4N39A 3DBSA 1OT8A 4LNBA 3SBSA 5G2NA 4GA0A 3ZW3A 3PEUB 1OWOA 4HXIA 2AJAA 4RQIA 5CEDB 5AQBA 4UQYA 4Q96A 4AV7A 1OY3D 3LY7A 4G25A 4HLLA 3SHFA 3DPYA 4WWOA 1NL4A 3LVQE 2I1JA 2WXJA 2X38A 5LCWJ 2H6HA 2R2LA 5BXUA 2J9QA 1E8XA 4ZHBA 2C0LA 5HS0A 1KT0A 2H6GA 3V30A 3SGHA 5JA4D 1MYOA 1L5JA 3CK8A 3B7UX 2ZGDA 1QNFA 4AOFA 3ASNE 3HVEB 3CHOA 5CHEE 3AS5A 4AM9A 4Y6WA 3T8KA 1QZ2A 3ZIMA 2LAHA 4WNGA 3JQ0A 3JUIA 4A55A 3GZ2A 3DSXA 3FP3A 4UWKA 2WXMA 5EKQD 3SFYA 3ZUVB 3FTUA 3CHSA 2VSNA 3E4BA 3MKQA 5CCLA 1UJKA 3SZ7A 3D9MA 3Q7AA 3RIBA 5ITZF 4A1SA 5EN5D 4C48B 4JHJA 2CHXA 1VDYA 3U4TA 1OWLA 4AY6A 3KS2A 1MX4A 2QC9A 2NYJA 3D9KA 5B1BE 5G05C 2J08A 3CSFA 4O60A 1E8ZA 3VTYA 4YDYA 3AJIA 3L82A 3TAXA 5ANRA 5AN8A 2Y1LE 4TRQA 3ULEG 3FU6A 4EZLA 1KZOA 5DBKA 4HRMB 2VTBB 1JCQA 3QDNA 1KPSB 3AU5A 1X81A 4TXRA 3D9IA 4GA1A 5IY5E 3FWVA 1LF8A 3G2TA 2IFUA 4FJZA 3JXIA 4GTQA 3T5XA 5T4YA 3CVWA 5AYWD 4HB5A 4WWPA 4R7LA 1FT1A 4I9CA 2AXZA 1HH8A 4LEUA 2BTDA 5C2YA 4A63B 3TWXA 4YDWA 1S64A 4XE0A 2IOLA 2ZIRA 3URZA 3C3OA 4I17A 3APFA 3ZYMA 4N3CA 3R7RA 3SD5A 5EILA 1Z6TA 4WNEA 5ENSD 2WXKA 2CFZA 3EUVA 4DPRA 1H0AA 3FU5A 3FTZA 4G26A 4WNFA 3G2WA 4JB8P 4TUUA 4LNGA 1U2VG 1HE8A 3S7JA 2IO2C 2J07A 4BETA 4Z68A 2ONDA 1JUQA 3FEYA 3PZ1A 4F6RD 3UIOC 4DLQA 1H6KA 4GYYA 1KT1A 2WXPA 3ENEA 4I6JA 4YVQC 4A3VA 4URKA 3QWWA 3UUXA 1E96B 3IHVA 4XIFA 2DIWA 1E7UA 3B95A 5ENQD 1OUVA 1Y8MA 4ANUA 3TWQA 4BY6A 2P9SG 1IYGA 2IU1A 4YNDA 4L9PA 3IEGA 4MS6A 1N0RA 1O5MA 4V3IA 2J4DA 1EDUA 4I1MA 2VQ2A 4E6HA 1WAO1 4GTPA 3TWVA 4HQDA 4A1GA 4APFA 3DXMG 4DX7D 2QFCA 1JWFA 2H6FA 3SI5A 2ZISA 4B93B 3MV2B 4U8YD 4UQZA 4GMRA 5B1AE 4AVXA 3IHYA 4FLBA 2PL2A 1D8EA 3DSVA 4WUYA 4CDRA 3LY9A 5ENOD 4XX5A 3ZRHA 3PS6A 4BERA 1TNZA 2WXOA 2HE0A 1FPPA 2IJGX 2V8SE 4KBQA 4PS3A 3ABME 1SQMA 3LJ3A 3HHMA 4JEHA 1MZCA 1H2UA 3V31A 3J5PA 1TJFA 3MKRA 2LNIA 4J8DA 4DX6D 2KCKA 5FQ7A 1BPOA 3DSWA 1A17A 1DNPA 1WY6A 1TN6A 3EU9A 3ZHEB 2WXFA 2IQCA 1H6PA 3MX3A 2IONA 4F3VA 2GRNB 1MJ0A 2I2OA 4HOSA 1W3BA 2OVBA 1QYMA 1IXVA 4XZ4A 2WQHA 4DRXE 2XQ0A 3JCKC 4LCTA 3CHQA 3HDXA 4MKTA 1Z5SC 2ZXWE 2DCPA 3MV3B 4F53A 1V55E 3E37A 1BLXB 4I6GA 4CZ2D 3JQ1A 5A23A 3FUMA 5CERB 3RJVA 3UIPC 2BKGA 3P2BA 3MEKA 4UWFA 3HXCA 4BSZB 3FTYA 3L17A 3N71A 2XEHA 3TWUA 5D66A 2AVPA 4BTAA 3ZYQA 2B0OE 1ELWA 4PUCA 5G04C 5LOZA 1HXIA 3FUEA 3UX4A 4EBAG 2JLBA 3EHMA 1B89A 4ANWA 3MJWA 3HRAA 4P29A 2KCLA 5BW8C 4K0RA 3U3WA 1OCZE 3DSSA 3FTWA 4RG9A 1ZBPA 2XEEA 1DC2A 1BI8B 4U7EB 4HLEA 2A4ZA 2R03A 2C0MA 2XGSA 3LPZA 3DWLG 2JABA
chains in the Genus database with same CATH topology
4BSXA 1KT0A 3Q4AB 1MQSA 4GZ6A 5C1DA 4KVMA 3SGHA 2P58C 4I6EA 4E85A 1HU3A 3MKQB 3B7SA 4J8FA 3CK7A 3FU3A 4BX9A 1FCHA 3D9NA 4UI9J 3S7DA 2CHZA 4KT6B 3D9OA 4FULA 1HX8A 1L5JA 1UJJA 3CK8A 3B7UX 2I1KA 4BX8A 2WXGA 5J08A 1QNFA 1SZAA 4AOFA 5BPPA 4B8AA 5ENNA 4LRZA 4EZKA 5LX8A 2FULA 2V5FA 2CG2A 3HVEB 5AJLA 3CHOA 2X6IA 4ILHB 4IRUA 3OTNA 4HOUA 5CHEE 1EYHA 4RVBA 3U9WA 4PS8A 3UT7A 3AS5A 1JWGA 4Y6WA 4AM9A 1QZ2A 2HM8A 3ASFA 3CHRA 2KCVA 3CVNA 3D9PA 3ZIMA 2Q7FA 3U66A 2LAHA 4WNGA 3FUJA 4L23A 1WM5A 4NACA 3JQ0A 3JUIA 4A55A 3FULA 2L9BA 3ASGA 3CKCA 3GZ2A 5FZRA 3FP3A 1JPLA 2GRLA 2L6JA 3ESKA 1FVHA 3PUJA 4XI0A 5EX3A 3SFZA 4BWRA 3S7FA 3AS4A 3EIJA 2YNQA 5EX0A 4UWKA 2HO1A 4N3AA 3SNXA 3QB2A 4GYOA 2WXMA 2WXIA 2GGFA 5EKQD 4CT0A 2X3MA 5BT1A 3EIQC 3U64A 2V4LA 3CHPA 3FTUA 3CHMA 3CHSA 4AJWA 4JC8A 2VGYA 2VSNA 3VLEA 3E4BA 3MKQA 3G2VA 3QARA 4KVOA 5KCMA 5JJ6A 5CCLA 1UJKA 3RKVA 3LXUX 3FDHA 3RO2A 3SZ7A 3RK6A 2J09A 3D9MA 3HIZA 5CMWA 3RIBA 4L1BA 3S7BA 1ELRA 1IHGA 2AW6A 3B7RL 4A1SA 4G11A 3CQGB 3HVEA 3FH8A 4N2QA 3LCAA 4JHJA 2CHXA 1VDYA 4G23A 3U4TA 1OWLA 4AY6A 1FVFA 3KS2A 4J6IA 4GCOA 1OWNA 2UY1A 3D9KA 3K9IA 5ARFA 2XPZA 1H2VC 4B0ZA 4JL0A 5G05C 4FADA 2J08A 3APCA 3CKBA 5D0OD 2XGMA 3CSFA 3QJZA 4AEZC 1E8ZA 3VTXA 1NA3A 4J8EA 3TGOA 5A6CA 3VTYA 4GMLA 5FZQA 4A3TA 2VSXE 4GMJA 3PZDA 2XPYA 3KD7A 4GB9A 3ZPJA 2X6HA 3TAXA 1NP7A 1UN8A 3CK9A 5ANRA 3RRNB 4TRQA 3I4RB 4L7TA 4JPSA 2IOSA 2WXHA 3FU6A 3NZUA 4GAAA 5CCMA 4EZLA 4JHRA 3CGHA 5DBKA 2VTBB 3PVLA 3QDNA 3RO3A 4N2SA 3T8MA 3TXMA 4B94A 2GRMA 3AU5A 3CVYA 4IN3B 2KZTB 2PM7A 4W9RA 4EZJA 2MHKA 5EDSA 3LVRE 4J8SA 4I2ZA 3ZGQA 4JHKA 3D9IA 2WMOA 4FP7A 4KMOA 4GA1A 4U0UA 3FWVA 4C0MA 3AU4A 1LF8A 3AS8A 3G2TA 4HVBA 4I2WA 2IFUA 5BUZA 4FJZA 2HR2A 2R59A 3APDA 4HOQA 4AP2A 1H2TC 3T5XA 5T4YA 3CVWA 2Y4TA 3NF1A 5AYWD 4FA6A 4JA9A 3FHEA 2GW1A 2VGXB 4WWPA 1S0PA 3CR3A 3PRZA 4IYPA 4UQXA 4Q69A 1E8WA 1NA0A 3QNKA 4ILGA 4R7LA 2XCBA 3QKYA 5G04J 4FHKA 5KJNA 4I9CA 4MRUA 5JHBA 2AXZA 1HH8A 3BEEA 4LEUA 4L2YA 4UWLA 2BTDA 3UT8A 2AXVA 5C2YA 4GA2A 5FZSA 4N5CA 3ZYLA 4KXKB 3ZN3A 4UI9K 3CVPA 3QC1A 4GZ5A 4XE0A 2VSOE 1UN9A 3ESLA 2IOLA 3OXLA 3URZA 4I17A 1U3DA 4ILIA 3ONKA 3APFA 4G24A 4GU5A 3ZYMA 4N3CA 4I1AA 3PE3A 3Q5MA 3R7RA 3ULQA 2E0IA 3SD5A 3L54A 1Z6TA 2XPIA 5KJKA 1NZNA 5FQ8A 4WNEA 4YVOA 3FUNA 1TEZA 2YINA 4EPZA 4CCAA 2XCCA 2WXKA 2WXRA 4M3OA 2PZIA 3KAEA 2CFZA 4CT4A 4APOA 4DPRA 3ML9A 1H0AA 3FU5A 3FTZA 3MA5A 3QAQA 4G26A 3G2WA 4HFGA 4TUUA 4GCNA 4WNFA 2AWIA 4GZDA 3LKUA 2WB2A 2YQ8A 4U07A 2VJ8A 1HE8A 1TJCA 3S7JA 2YHCA 3TG4A 2J07A 2ONDA 2FF4A 1JUQA 5G55A 3FEYA 5D0QD 3CVLA 4XKCA 3CEQA 4CRWA 4DLQA 4BTBA 4NURA 4N3BA 3D9LA 1P5QA 2NSZA 3TL5A 5FQ4A 1H6KA 5HI7A 4CEMA 4GYYA 3L16A 1KT1A 2WXPA 2KM4A 3ENEA 3B13A 4I6JA 1X5BA 4YVQC 4C0EA 4DI3A 3ASHA 4A3VA 4URKA 3QWWA 3UUXA 1E96B 3IHVA 4XIFA 4O6FA 2DIWA 3ZYKA 4XKBA 5E75A 2PQRA 2C2LA 4D10C 4QFVA 1E7UA 2VSYA 2KC7A 1HG2A 1OUVA 2ZU6B 1XGWA 1Y8MA 3FH7A 3GZ1A 4ANUA 4EECA 5M72A 3Q49B 4NQ0A 3QK0A 3FUIA 4JA7A 2LSUA 4BY6A 4KZ0A 1EPUA 2XRYA 4K03A 1MHQA 1PY1A 2IU1A 1IYGA 1ZU2A 2WXQA 3D9JA 2WXNA 3ASDA 2Y4UA 4F7AA 3DPDA 5KJMA 3L6AA 3QWVA 4YNDA 1XNFA 2XGOA 2KATA 5BV0A 3FEXA 4AY5A 5BNWA 2X6JA 3FU0A 3IEGA 4MS6A 4C9BB 4V3IA 3ZXSA 3FY4A 2J4DA 5J90A 1EDUA 1DVPA 2YHEA 4ATGA 2VGXA 4I1MA 4ME2A 3RRUA 2VQ2A 4G1TA 4E6HA 1WAO1 4UI9C 5JHAA 1QQEA 4CGVA 5A7DB 3O4ZA 4FLHA 4A1GA 4APFA 4ACLA 4HOTA 4JEUA 3Q47B 5G05J 2J49A 4WNDA 5LP0A 2QFCA 1JWFA 4RG6A 2LSVA 3IKOB 2L0TB 4HS2A 2CFUA 3UMVA 3LY8A 3RU0A 3SI5A 3MV2B 1N52A 1ELKA 3FUFA 5FT9A 1GW6A 2UY1B 3BG0B 2MRIA 4I9EA 2KZTA 3FTSA 1IQUA 4JW1A 1HZ4A 4UQZA 4FHJA 4RSYA 3PNLB 3PNTB 3I4GA 4AVXA 4ANVA 3IHYA 2LO6A 3CV0A 2PL2A 4FLBA 4JVSA 4OVVA 2RD0A 4WUYA 3EHNA 1IQRA 3R7QA 4AXHA 4CDRA 3G2SA 3MGBA 4KZCA 3LY9A 4H7XA 4DK5A 4CGWA 2XRZA 4XX5A 3ZRHA 3PS6A 3LDZA 5ARGA 5LFAA 3ZVVA 2WXOA 2VYIA 3NQPA 2XEVA 4JZYA 4DLOA 3S2AA 3VLFA 2IJGX 1HFAA 4WWNA 2V8SE 4KBQA 4PS3A 3LJ3A 1SQMA 1YA0A 3GZSA 4PH4B 4HORA 5T3RA 2ILRA 5T8IA 4XI9A 3HHMA 3PE4A 4JEHA 1H2UA 4OVUA 4GYWA 3ZEFA 1TJFA 3MKRA 2BUGA 4LERA 2XHEA 2LNIA 5LCWC 3HYMB 4J8DA 4EQFA 2KCKA 3PUKA 5FQ7A 2VTBA 1BPOA 2X6KA 3FTVA 3JYSA 5JJTA 3L22A 3L13A 2RG8A 4DI4A 5AJDA 1EF1C 1Z3XA 3BG1B 4U04A 2R17C 2R5SA 3GW4A 1A17A 1DNPA 4NRHB 4ABNA 3EJNA 3CIAA 1WY6A 4PDXA 1OWMA 3ZHEB 2V0PA 3LYAA 2WXFA 4PS7A 4KYOB 3RRMB 3PEVB 3C98A 2IQCA 3D3MA 3MX3A 4DJAA 2IONA 4G2VA 4F3VA 3I3NA 3MYVA 2WM9A 2I2OA 2CHWA 1U3CA 4HOSA 2WQ6A 4GZ3A 1W3BA 2OVBA 2EQXA 4UWGA 3B7TA 3FTXA 5FWQA 2J4BA 2LAIA 2NC9A 2HYZA 4WAFA 3P1UA 5BV1A 1HF8A 5AIJA 4XZ4A 1KLXA 3CVXA 2WQHA 2WPVA 2WVIA 2XQ0A 4ACKA 3OXGA 3JCKC 4LCTA 2X6FA 3OXFA 3FUHA 1OWPA 2CG3A 3CHQA 2I6HA 2M63A 3HDXA 3PH0C 4MKTA 4U0ZA 2DCPA 3MV3B 4FJYA 4F53A 4I6GA 3JQ1A 3OAWA 5FQ6A 5A23A 3FUMA 3FUDA 1E90A 4EBAA 3QOUA 3ONLA 4U8HA 2NXPA 3SBTB 1Y6IA 2WMNA 4ANXA 3RJVA 2DBAA 3CVUA 3O48A 3TJPA 3P2BA 3ZFWA 3MEKA 2A5UA 5KJLA 4JXTA 3KEZA 4Y6CA 4UWFA 3MCXA 4J0UA 4GPKA 3CSTA 4BT9A 4U63A 3FH5A 1E7VA 4BFRA 2E2EA 3LS8A 3FTYA 3ML8A 3L08A 1SZ9A 3L17A 3N71A 3FUKA 3PREA 5CMYA 5FTPA 3G2UA 4CDNA 2IF4A 1UG3A 3R9AB 3GYZA 1H19A 2MOWA 2AVPA 3TG5A 3UT4A 4BTAA 3NZSA 3UPVA 4FC8A 2Y3AA 4MLPA 3CQCB 1PAQA 3EDTB 3ZYQA 4F1SA 2PQNA 5DIZA 2OVFA 1ELWA 2JEKA 2WQ7A 2BF0X 4PUCA 5G04C 5LOZA 1HXIA 2QY7A 5E76A 1N54A 2L0IA 3VLDA 3FUEA 5HQ8A 3UX4A 4B89A 5AENA 4EBAG 3QWPA 3SF4A 3T5VA 2FEZA 3Q15A 5JJ7A 3CVQA 2JLBA 3PDNA 4GZCA 4IULA 4N39A 2OOEA 3DBSA 3UQ3A 3EHMA 1B89A 4OYSA 1INZA 4ANWA 3MJWA 2FO7A 3MZLB 3FFLA 4P29A 4B8CB 4AIFA 4LUNU 2KCLA 5G2NA 4TV3A 4GA0A 3SBSA 5ANLA 3ZW3A 3PEUB 5FJYA 3LEWA 2FI7A 1OWOA 4HXIA 2OV8A 5BW8C 4K0RA 4CDMA 1HO8A 3TXNA 4UWHA 1E8YA 4UQYA 3U3WA 4Q96A 4FU3A 4AV7A 3FTWA 4U0SA 3CVVA 3LY7A 4G25A 4RG9A 1ZBPA 4I1OB 2UWJG 1Z3YA 4H7YA 3SHFA 1UW4B 4Q94A 4WWOA 4BT8A 2PM6A 3LVQE 4I43A 3WXXA 2I1JA 2WXJA 2X38A 3ZHEA 4HLEA 3IBEA 5LCWJ 2A4ZA 2WXLA 2I9CA 2C0MA 2AXUA 3IV0A 2J9QA 1E8XA 3I5PA 2XGSA 4L2LA 1HS6A 3LPZA 2C0LA 1HG5A 1PC2A 2FBNA 3CLJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SI5 A;  2WVI A;  4AEZ C;  2LAH A;  4A1G A; 
#chains in the Genus database with same CATH topology
 2BKK B;  3Q4A B;  4GZ6 A;  2P9L G;  3B7S A;  3FU3 A;  4BX9 A;  3D9N A;  4UI9 J;  1UJJ A;  2WXG A;  5BPP A;  4GTO A;  4LRZ A;  5LX8 A;  2FUL A;  5AJL A;  2GRP B;  2X6I A;  4ILH B;  3U9W A;  2HM8 A;  3ASF A;  3U66 A;  4NAC A;  3FUL A;  3PUJ A;  1BI7 B;  4XI0 A;  3SFZ A;  3LJN A;  4N3A A;  1DCE A;  2GGF A;  4CT0 A;  2X3M A;  2V4L A;  2VGY A;  3DEP A;  3VLE A;  2QYJ A;  3LXU X;  3FDH A;  4GPM A;  3UXG A;  3S7B A;  1IHG A;  3B7R L;  3CQG B;  3C3R A;  2GRR B;  4G23 A;  4J6I A;  4GCO A;  1YMP A;  2XPZ A;  3BU8 A;  4B0Z A;  4FAD A;  4AEZ C;  4GML A;  4A3T A;  4CYM D;  4F1P A;  3PZD A;  2P9P G;  2XPY A;  3ZPJ A;  3I4R B;  4L7T A;  3ASO E;  4BEP A;  1N4R A;  3DRA A;  4JHR A;  1RZ4 A;  4N2S A;  3T8M A;  3TXM A;  4B94 A;  3UTM A;  2PM7 A;  5CEC B;  4W9R A;  4EZJ A;  1SA4 A;  1SVX A;  4JHK A;  4FP7 A;  1H2T C;  1K1A A;  1TN7 A;  1IHB A;  5EID A;  3R9M A;  2GW1 A;  1E8W A;  4ILG A;  3QKY A;  5KJN A;  4UWL A;  3NOG D;  4UI9 K;  3CVP A;  5D2M C;  1UOH A;  3EHQ A;  1U3D A;  3Q78 A;  3ZU7 B;  1TNY A;  3Q5M A;  2E0I A;  5KJK A;  1NZN A;  5FQ8 A;  4YVO A;  1TEZ A;  4EPZ A;  4CCA A;  2XCC A;  2PZI A;  4CT4 A;  2J8S D;  3ML9 A;  3MA5 A;  3UM3 A;  2AWI A;  2VJ8 A;  1TJC A;  4K5A B;  3TG4 A;  2DYR E;  4XKC A;  3CEQ A;  1P5Q A;  4MBG A;  2KM4 A;  3B13 A;  4C0E A;  1X5B A;  4DI3 A;  1G3N B;  3Q9U C;  2PQR A;  5AQA A;  4QFV A;  1HG2 A;  1XGW A;  2ZU6 B;  4EEC A;  3Q49 B;  4NQ0 A;  3QK0 A;  2ETC A;  3FUI A;  4JA7 A;  3JXJ A;  1EPU A;  2IEJ A;  3EHR A;  1PY1 A;  2DZN A;  2DYS E;  2Y4U A;  3DPD A;  5KJM A;  2RKK A;  3SO8 A;  2KAT A;  2EIJ E;  4C9B B;  3FY4 A;  1FT2 A;  3NB2 A;  5J90 A;  2YHE A;  3WG7 E;  3HG0 D;  5A7D B;  5AQ9 A;  4HOT A;  4JEU A;  3Q47 B;  2J49 A;  5LP0 A;  4HS2 A;  3UMV A;  1N52 A;  3UIN C;  3FUF A;  3DSU A;  2UY1 B;  3BG0 B;  4JW1 A;  4FHJ A;  3I4G A;  3CV0 A;  4JVS A;  3R7Q A;  4AXH A;  2IY0 C;  5LFA A;  3NQP A;  3S2A A;  4ATZ D;  2XZT G;  3ZEF A;  3SQV A;  2BUG A;  3PUK A;  3JYS A;  3L22 A;  1Z3X A;  2R17 C;  3GW4 A;  4NRH B;  3EJN A;  3W9G A;  3LYA A;  4PS7 A;  1NFI E;  3C98 A;  4G2V A;  3I3N A;  3MYV A;  3B7B A;  2WQ6 A;  3B7T A;  2LAI A;  4WAF A;  2HYZ A;  2WVI A;  1DCQ A;  3FUH A;  2M63 A;  3Q79 A;  4EBA A;  1N4S A;  4ANX A;  2DBA A;  3O48 A;  3TJP A;  3ZFW A;  2A5U A;  3KEZ A;  4Y6C A;  3V79 K;  4J8Y A;  4U63 A;  2E2E A;  3L08 A;  5CMY A;  5FTP A;  2IF4 A;  3E30 A;  1UG3 A;  5EYP F;  3GYZ A;  2EIN E;  2Y3A A;  4MLP A;  3EDT B;  3TWR A;  2OVF A;  2BF0 X;  3VLD A;  5HQ8 A;  5AEN A;  3QWP A;  1QBQ A;  3Q15 A;  2R05 A;  2OOE A;  3UQ3 A;  4OYS A;  4HI8 A;  3T9K A;  4AIF A;  4TV3 A;  5ANL A;  2LUH A;  5FJY A;  2OV8 A;  3TXN A;  4UWH A;  1E8Y A;  1TYQ G;  2P2C P;  3C72 A;  4TUM A;  4I1O B;  1RW2 A;  1UW4 B;  4BT8 A;  2PM6 A;  3NOC D;  3V2X A;  3ZHE A;  3IBE A;  3IXE A;  1TR4 A;  2AXU A;  3IV0 A;  1Q2Z A;  4UUC A;  3C5R A;  1N11 A;  1HG5 A;  2FBN A;  4BSX A;  3BQO A;  1MQS A;  5C1D A;  2P58 C;  2L6B A;  1HU3 A;  3MKQ B;  4J8F A;  3CK7 A;  3S7D A;  2CHZ A;  3D9O A;  1HX8 A;  2QZA A;  2I1K A;  4GTV A;  1SZA A;  4B8A A;  5ENN A;  4EZK A;  1N9A A;  2V5F A;  2CG2 A;  3PZ4 A;  3BUA A;  4JD2 G;  2IO3 C;  4IRU A;  3OTN A;  4RVB A;  4PS8 A;  1JWG A;  2KBX A;  3CHR A;  2KCV A;  5KNG A;  3FUJ A;  4L23 A;  1WM5 A;  4M7C A;  3ZXP A;  3J5Q B;  1JPL A;  2L6J A;  3ESK A;  3EIJ A;  2YNQ A;  3SNX A;  3QB2 A;  2FO1 E;  3E34 A;  5BT1 A;  3EIQ C;  1N4Q A;  3CHP A;  3CHM A;  2LXM A;  3G2V A;  5KCM A;  5JJ6 A;  3RKV A;  3RO2 A;  5CMW A;  2AW6 A;  4G11 A;  2P9K G;  3HVE A;  3FH8 A;  4N2Q A;  2UY1 A;  3K9I A;  2OEV A;  4XEI G;  5AQ7 A;  3APC A;  3CKB A;  2XGM A;  3QJZ A;  1S70 B;  1NA3 A;  3TGO A;  5FZQ A;  4GMJ A;  4GB9 A;  2X6H A;  1NP7 A;  3RRN B;  2IOS A;  3NZU A;  5KNH D;  5CCM A;  1KZP A;  4BES A;  3RO3 A;  3CVY A;  4IN3 B;  1ZB1 A;  2Y69 E;  2MHK A;  3Q9N C;  5EDS A;  4DX5 D;  3LVR E;  4J8S A;  5CEA A;  3ZGQ A;  4KMO A;  4C0M A;  3AU4 A;  5BUZ A;  3AAA C;  2Y4T A;  3NF1 A;  2DZO A;  4JA9 A;  2OCC E;  3FHE A;  2VGX B;  1S0P A;  4IYP A;  4Q69 A;  2KXP C;  1NA0 A;  3QNK A;  2XCB A;  1LTX A;  4FHK A;  3UT8 A;  2AXV A;  3AG2 E;  5FZS A;  5KWD A;  3QC1 A;  1MX2 A;  2VSO E;  1UN9 A;  3L9T A;  2XS1 A;  3PE3 A;  3L54 A;  5CBO A;  3FUN A;  1A5E A;  2YIN A;  2GRQ B;  3UM0 A;  4M3O A;  4APO A;  2P9N G;  3QAQ A;  4GZD A;  2WB2 A;  5G55 A;  2MYO A;  3PZ3 A;  4NUR A;  4N3B A;  2NSZ A;  1TNU A;  5FQ4 A;  5HI7 A;  3ABK E;  2OEW A;  1YYH A;  3ZYK A;  2C2L A;  4U95 D;  2VSY A;  3NBN B;  3FH7 A;  5M72 A;  3GZ1 A;  4KZ0 A;  2ETB A;  4X8Q A;  2XRY A;  1MHQ A;  1O1S A;  1ZU2 A;  2WXQ A;  3D9J A;  4F7A A;  3ASD A;  1AWC B;  3QWV A;  2XGO A;  3FEX A;  4AY5 A;  3FU0 A;  1DVP A;  4G1T A;  2DVW A;  5JHA A;  1QQE A;  4CGV A;  4FLH A;  5CRU A;  1BD8 A;  5G05 J;  2LSV A;  3IKO B;  2L0T B;  3ABL E;  3NAW A;  1ELK A;  4DX1 A;  4I9E A;  2MRI A;  2KZT A;  3FTS A;  1IQU A;  3C3Q A;  4ANV A;  1N95 A;  2LO6 A;  3EHN A;  2F0Y A;  2VGE A;  3MGB A;  4KZC A;  1JCS A;  5ARG A;  4JZY A;  2XEV A;  4DLO A;  3PZ2 A;  3VLF A;  1HFA A;  3Q75 A;  1O1T A;  4WWN A;  3GZS A;  1YA0 A;  2ILR A;  5T8I A;  3PE4 A;  2EIK E;  3AG1 E;  4LER A;  4EQF A;  2X6K A;  4DI4 A;  5AJD A;  1EF1 C;  4U04 A;  3BG1 B;  1D9S A;  4ABN A;  5AAO A;  3CIA A;  4PDX A;  1OWM A;  4TXQ A;  1OCR E;  3PEV B;  5HKP A;  3D3M A;  2WM9 A;  2CHW A;  1U3C A;  5EYL A;  5B3S E;  2EQX A;  4HRN A;  3FTX A;  5FWQ A;  1V54 E;  2NC9 A;  3P1U A;  5BV1 A;  1HF8 A;  5AIJ A;  1KLX A;  3CVX A;  1SA5 A;  4GTT A;  3OXG A;  2B6C A;  3OXF A;  1OWP A;  2I6H A;  3PH0 C;  4GTS A;  4FJY A;  2RFM A;  2EIM E;  3FUD A;  4U8H A;  4EHM A;  3SBT B;  1Y6I A;  2XZD G;  5H7P A;  4ZFH A;  3X2Q E;  3SY2 A;  3FH5 A;  1E7V A;  3LS8 A;  3ML8 A;  3HXB A;  1SZ9 A;  3FUK A;  5KBA A;  3UM1 A;  4O1P A;  3HXF A;  5BXO A;  4CDN A;  3RAU A;  3R9A B;  3TG5 A;  3UPV A;  3UT4 A;  3NZS A;  4FC8 A;  3CQC B;  1PAQ A;  4F1S A;  5DIZ A;  2JEK A;  4G8K A;  2QY7 A;  5E76 A;  1N54 A;  4B89 A;  3SF4 A;  3HXE A;  2FEZ A;  3CVQ A;  2PNN A;  4GZC A;  4IUL A;  4RLY A;  1INZ A;  2FO7 A;  3MZL B;  3FFL A;  4NIK A;  4B8C B;  4LUN U;  4O1O A;  2ZGG A;  2FI7 A;  3LEW A;  1OCO E;  4CDM A;  1HO8 A;  4FU3 A;  4J7W A;  4U0S A;  3CVV A;  3F6Q A;  4N5Q A;  2UWJ G;  1Z3Y A;  4H7Y A;  1AP7 A;  4Q94 A;  2H6I A;  4G8L A;  4I43 A;  3WXX A;  3Q7F A;  3UI2 A;  2WXL A;  2I9C A;  2P9U G;  2ETA A;  3I5P A;  4L2L A;  1HS6 A;  2F8X K;  1PC2 A;  3CLJ A;  2DWZ A;  3KSL A;  4KVM A;  4I6E A;  4E85 A;  4K5C A;  5HRY A;  1FCH A;  4KT6 B;  4FUL A;  4BX8 A;  5J08 A;  3E33 A;  4HBD A;  4HOU A;  1EYH A;  3Q73 A;  5ENT D;  3UT7 A;  3CVN A;  3D9P A;  2Q7F A;  1OCC E;  2L9B A;  4K5B A;  1N94 A;  3ASG A;  3CKC A;  2XEN A;  5FZR A;  3ZKJ A;  2GRL A;  5EX3 A;  1FVH A;  3SFX A;  4BWR A;  3S7F A;  3AS4 A;  5EX0 A;  4YDO A;  2HO1 A;  1H6O A;  4GYO A;  2WXI A;  3U64 A;  4AJW A;  4JC8 A;  3QAR A;  4KVO A;  2V4H C;  2Y0B G;  3RK6 A;  2V5Q C;  2J09 A;  3HIZ A;  4HI9 A;  4L1B A;  1YCS B;  1ELR A;  1WDY A;  3LCA A;  1FVF A;  1OWN A;  1SW6 A;  5ARF A;  1H2V C;  4JL0 A;  4QQI A;  5D0O D;  3VTX A;  1WG0 A;  4J8E A;  5A6C A;  1O1R A;  2VSX E;  3KEA A;  5JMN D;  5CBN A;  1K8K G;  2XS8 A;  3KD7 A;  3TWT A;  3D9H A;  1MX6 A;  1UN8 A;  3CK9 A;  4JPS A;  2WXH A;  4GAA A;  3CGH A;  3PVL A;  5FIN A;  2GRM A;  1LD8 A;  2KZT B;  4I2Z A;  2WMO A;  1K1B A;  4U0U A;  3AS8 A;  3V2O A;  4HVB A;  4I2W A;  1LD7 A;  2HR2 A;  2R59 A;  3APD A;  4HOQ A;  4AP2 A;  4HRL A;  4FA6 A;  3CR3 A;  3PRZ A;  4UQX A;  5G04 J;  4MRU A;  5JHB A;  3BEE A;  4L2Y A;  4TXP A;  4GA2 A;  4N5C A;  3ZYL A;  4KXK B;  3ZN3 A;  4GZ5 A;  3ESL A;  3OXL A;  4ILI A;  3ONK A;  4G24 A;  4GU5 A;  5EIB E;  4I1A A;  1JCR A;  3ULQ A;  2XPI A;  1TN8 A;  3HXD A;  2WXR A;  3KAE A;  4HFG A;  4GCN A;  3E32 A;  3LKU A;  3W9F A;  2YQ8 A;  4U07 A;  1TNO A;  4GTM A;  2YHC A;  2FF4 A;  3UKR G;  2QYU A;  5D0Q D;  3CVL A;  1NI1 A;  4CRW A;  4BTB A;  3D9L A;  3TL5 A;  4U8V D;  4CEM A;  1IKN D;  3L16 A;  1BU9 A;  3ASH A;  2A5E A;  4O6F A;  3UM2 A;  4XKB A;  5E75 A;  4D10 C;  4DX2 A;  3DST A;  2KC7 A;  1D8D A;  2LSU A;  3EU5 A;  4K03 A;  2WXN A;  2RFA A;  3L6A A;  3ULY A;  3TWS A;  1XNF A;  5BV0 A;  5BNW A;  2X6J A;  3ZXS A;  4ATG A;  2VGX A;  4ME2 A;  3RRU A;  4UI9 C;  4LSZ E;  3O4Z A;  4ACL A;  5ENR D;  4WND A;  3ISM C;  4RG6 A;  2CFU A;  3LY8 A;  3RU0 A;  3AG3 E;  5FT9 A;  4HNA D;  1GW6 A;  4YDE A;  3RSE G;  2EIL E;  5FIO A;  1HZ4 A;  4RSY A;  3PNL B;  3PNT B;  4OAV B;  5ENP D;  4LG6 A;  4OVV A;  2RD0 A;  3TWW A;  1IQR A;  3G2S A;  4DK5 A;  4H7X A;  4CGW A;  3AG4 E;  2XRZ A;  3LDZ A;  3ZVV A;  2VYI A;  2R02 A;  3ZNG A;  5CRV A;  4PH4 B;  4HOR A;  5T3R A;  4XI9 A;  4OVU A;  2P9I G;  4GYW A;  1S63 A;  2GRO B;  2XHE A;  5LCW C;  3HYM B;  2VTB A;  3FTV A;  5JJT A;  3L13 A;  2RG8 A;  4DUI A;  2R5S A;  1N0Q A;  2V0P A;  4U96 D;  4KYO B;  3RRM B;  1N4P A;  4DJA A;  4GZ3 A;  4UWG A;  2J4B A;  3KSQ A;  2WPV A;  4ACK A;  2X6F A;  5JJ7 A;  2CG3 A;  4U0Z A;  4GTR A;  5AAR A;  1OXJ A;  3OAW A;  5FQ6 A;  1E90 A;  3QOU A;  3ONL A;  2NXP A;  2WMN A;  3DXK G;  3CVU A;  2F37 A;  5KJL A;  4JXT A;  3MCX A;  4J0U A;  4GPK A;  3CST A;  4BT9 A;  4BFR A;  3UKU G;  3PRE A;  3G2U A;  3JUE A;  4OAU C;  1H19 A;  2F8Y A;  2MOW A;  2PQN A;  4LNU D;  2WQ7 A;  2LXL A;  1K3Z D;  2L0I A;  1TNB A;  3T5V A;  3DEO A;  3PDN A;  2BED A;  4N39 A;  3DBS A;  1OT8 A;  4LNB A;  3SBS A;  5G2N A;  4GA0 A;  3ZW3 A;  3PEU B;  1OWO A;  4HXI A;  2AJA A;  4RQI A;  5CED B;  5AQB A;  4UQY A;  4Q96 A;  4AV7 A;  1OY3 D;  3LY7 A;  4G25 A;  4HLL A;  3SHF A;  3DPY A;  4WWO A;  1NL4 A;  3LVQ E;  2I1J A;  2WXJ A;  2X38 A;  5LCW J;  2H6H A;  2R2L A;  5BXU A;  2J9Q A;  1E8X A;  4ZHB A;  2C0L A;  5HS0 A;  1KT0 A;  2H6G A;  3V30 A;  3SGH A;  5JA4 D;  1MYO A;  1L5J A;  3CK8 A;  3B7U X;  2ZGD A;  1QNF A;  4AOF A;  3ASN E;  3HVE B;  3CHO A;  5CHE E;  3AS5 A;  4AM9 A;  4Y6W A;  3T8K A;  1QZ2 A;  3ZIM A;  2LAH A;  4WNG A;  3JQ0 A;  3JUI A;  4A55 A;  3GZ2 A;  3DSX A;  3FP3 A;  4UWK A;  2WXM A;  5EKQ D;  3SFY A;  3ZUV B;  3FTU A;  3CHS A;  2VSN A;  3E4B A;  3MKQ A;  5CCL A;  1UJK A;  3SZ7 A;  3D9M A;  3Q7A A;  3RIB A;  5ITZ F;  4A1S A;  5EN5 D;  4C48 B;  4JHJ A;  2CHX A;  1VDY A;  3U4T A;  1OWL A;  4AY6 A;  3KS2 A;  1MX4 A;  2QC9 A;  2NYJ A;  3D9K A;  5B1B E;  5G05 C;  2J08 A;  3CSF A;  4O60 A;  1E8Z A;  3VTY A;  4YDY A;  3AJI A;  3L82 A;  3TAX A;  5ANR A;  5AN8 A;  2Y1L E;  4TRQ A;  3ULE G;  3FU6 A;  4EZL A;  1KZO A;  5DBK A;  4HRM B;  2VTB B;  1JCQ A;  3QDN A;  1KPS B;  3AU5 A;  1X81 A;  4TXR A;  3D9I A;  4GA1 A;  5IY5 E;  3FWV A;  1LF8 A;  3G2T A;  2IFU A;  4FJZ A;  3JXI A;  4GTQ A;  3T5X A;  5T4Y A;  3CVW A;  5AYW D;  4HB5 A;  4WWP A;  4R7L A;  1FT1 A;  4I9C A;  2AXZ A;  1HH8 A;  4LEU A;  2BTD A;  5C2Y A;  4A63 B;  3TWX A;  4YDW A;  1S64 A;  4XE0 A;  2IOL A;  2ZIR A;  3URZ A;  3C3O A;  4I17 A;  3APF A;  3ZYM A;  4N3C A;  3R7R A;  3SD5 A;  5EIL A;  1Z6T A;  4WNE A;  5ENS D;  2WXK A;  2CFZ A;  3EUV A;  4DPR A;  1H0A A;  3FU5 A;  3FTZ A;  4G26 A;  4WNF A;  3G2W A;  4JB8 P;  4TUU A;  4LNG A;  1U2V G;  1HE8 A;  3S7J A;  2IO2 C;  2J07 A;  4BET A;  4Z68 A;  2OND A;  1JUQ A;  3FEY A;  3PZ1 A;  4F6R D;  3UIO C;  4DLQ A;  1H6K A;  4GYY A;  1KT1 A;  2WXP A;  3ENE A;  4I6J A;  4YVQ C;  4A3V A;  4URK A;  3QWW A;  3UUX A;  1E96 B;  3IHV A;  4XIF A;  2DIW A;  1E7U A;  3B95 A;  5ENQ D;  1OUV A;  1Y8M A;  4ANU A;  3TWQ A;  4BY6 A;  2P9S G;  1IYG A;  2IU1 A;  4YND A;  4L9P A;  3IEG A;  4MS6 A;  1N0R A;  1O5M A;  4V3I A;  2J4D A;  1EDU A;  4I1M A;  2VQ2 A;  4E6H A;  1WAO 1;  4GTP A;  3TWV A;  4HQD A;  4A1G A;  4APF A;  3DXM G;  4DX7 D;  2QFC A;  1JWF A;  2H6F A;  3SI5 A;  2ZIS A;  4B93 B;  3MV2 B;  4U8Y D;  4UQZ A;  4GMR A;  5B1A E;  4AVX A;  3IHY A;  4FLB A;  2PL2 A;  1D8E A;  3DSV A;  4WUY A;  4CDR A;  3LY9 A;  5ENO D;  4XX5 A;  3ZRH A;  3PS6 A;  4BER A;  1TNZ A;  2WXO A;  2HE0 A;  1FPP A;  2IJG X;  2V8S E;  4KBQ A;  4PS3 A;  3ABM E;  1SQM A;  3LJ3 A;  3HHM A;  4JEH A;  1MZC A;  1H2U A;  3V31 A;  3J5P A;  1TJF A;  3MKR A;  2LNI A;  4J8D A;  4DX6 D;  2KCK A;  5FQ7 A;  1BPO A;  3DSW A;  1A17 A;  1DNP A;  1WY6 A;  1TN6 A;  3EU9 A;  3ZHE B;  2WXF A;  2IQC A;  1H6P A;  3MX3 A;  2ION A;  4F3V A;  2GRN B;  1MJ0 A;  2I2O A;  4HOS A;  1W3B A;  2OVB A;  1QYM A;  1IXV A;  4XZ4 A;  2WQH A;  4DRX E;  2XQ0 A;  3JCK C;  4LCT A;  3CHQ A;  3HDX A;  4MKT A;  1Z5S C;  2ZXW E;  2DCP A;  3MV3 B;  4F53 A;  1V55 E;  3E37 A;  1BLX B;  4I6G A;  4CZ2 D;  3JQ1 A;  5A23 A;  3FUM A;  5CER B;  3RJV A;  3UIP C;  2BKG A;  3P2B A;  3MEK A;  4UWF A;  3HXC A;  4BSZ B;  3FTY A;  3L17 A;  3N71 A;  2XEH A;  3TWU A;  5D66 A;  2AVP A;  4BTA A;  3ZYQ A;  2B0O E;  1ELW A;  4PUC A;  5G04 C;  5LOZ A;  1HXI A;  3FUE A;  3UX4 A;  4EBA G;  2JLB A;  3EHM A;  1B89 A;  4ANW A;  3MJW A;  3HRA A;  4P29 A;  2KCL A;  5BW8 C;  4K0R A;  3U3W A;  1OCZ E;  3DSS A;  3FTW A;  4RG9 A;  1ZBP A;  2XEE A;  1DC2 A;  1BI8 B;  4U7E B;  4HLE A;  2A4Z A;  2R03 A;  2C0M A;  2XGS A;  3LPZ A;  3DWL G;  2JAB A; 
#chains in the Genus database with same CATH homology
 4BSX A;  1KT0 A;  3Q4A B;  1MQS A;  4GZ6 A;  5C1D A;  4KVM A;  3SGH A;  2P58 C;  4I6E A;  4E85 A;  1HU3 A;  3MKQ B;  3B7S A;  4J8F A;  3CK7 A;  3FU3 A;  4BX9 A;  1FCH A;  3D9N A;  4UI9 J;  3S7D A;  2CHZ A;  4KT6 B;  3D9O A;  4FUL A;  1HX8 A;  1L5J A;  1UJJ A;  3CK8 A;  3B7U X;  2I1K A;  4BX8 A;  2WXG A;  5J08 A;  1QNF A;  1SZA A;  4AOF A;  5BPP A;  4B8A A;  5ENN A;  4LRZ A;  4EZK A;  5LX8 A;  2FUL A;  2V5F A;  2CG2 A;  3HVE B;  5AJL A;  3CHO A;  2X6I A;  4ILH B;  4IRU A;  3OTN A;  4HOU A;  5CHE E;  1EYH A;  4RVB A;  3U9W A;  4PS8 A;  3UT7 A;  3AS5 A;  1JWG A;  4Y6W A;  4AM9 A;  1QZ2 A;  2HM8 A;  3ASF A;  3CHR A;  2KCV A;  3CVN A;  3D9P A;  3ZIM A;  2Q7F A;  3U66 A;  2LAH A;  4WNG A;  3FUJ A;  4L23 A;  1WM5 A;  4NAC A;  3JQ0 A;  3JUI A;  4A55 A;  3FUL A;  2L9B A;  3ASG A;  3CKC A;  3GZ2 A;  5FZR A;  3FP3 A;  1JPL A;  2GRL A;  2L6J A;  3ESK A;  1FVH A;  3PUJ A;  4XI0 A;  5EX3 A;  3SFZ A;  4BWR A;  3S7F A;  3AS4 A;  3EIJ A;  2YNQ A;  5EX0 A;  4UWK A;  2HO1 A;  4N3A A;  3SNX A;  3QB2 A;  4GYO A;  2WXM A;  2WXI A;  2GGF A;  5EKQ D;  4CT0 A;  2X3M A;  5BT1 A;  3EIQ C;  3U64 A;  2V4L A;  3CHP A;  3FTU A;  3CHM A;  3CHS A;  4AJW A;  4JC8 A;  2VGY A;  2VSN A;  3VLE A;  3E4B A;  3MKQ A;  3G2V A;  3QAR A;  4KVO A;  5KCM A;  5JJ6 A;  5CCL A;  1UJK A;  3RKV A;  3LXU X;  3FDH A;  3RO2 A;  3SZ7 A;  3RK6 A;  2J09 A;  3D9M A;  3HIZ A;  5CMW A;  3RIB A;  4L1B A;  3S7B A;  1ELR A;  1IHG A;  2AW6 A;  3B7R L;  4A1S A;  4G11 A;  3CQG B;  3HVE A;  3FH8 A;  4N2Q A;  3LCA A;  4JHJ A;  2CHX A;  1VDY A;  4G23 A;  3U4T A;  1OWL A;  4AY6 A;  1FVF A;  3KS2 A;  4J6I A;  4GCO A;  1OWN A;  2UY1 A;  3D9K A;  3K9I A;  5ARF A;  2XPZ A;  1H2V C;  4B0Z A;  4JL0 A;  5G05 C;  4FAD A;  2J08 A;  3APC A;  3CKB A;  5D0O D;  2XGM A;  3CSF A;  3QJZ A;  4AEZ C;  1E8Z A;  3VTX A;  1NA3 A;  4J8E A;  3TGO A;  5A6C A;  3VTY A;  4GML A;  5FZQ A;  4A3T A;  2VSX E;  4GMJ A;  3PZD A;  2XPY A;  3KD7 A;  4GB9 A;  3ZPJ A;  2X6H A;  3TAX A;  1NP7 A;  1UN8 A;  3CK9 A;  5ANR A;  3RRN B;  4TRQ A;  3I4R B;  4L7T A;  4JPS A;  2IOS A;  2WXH A;  3FU6 A;  3NZU A;  4GAA A;  5CCM A;  4EZL A;  4JHR A;  3CGH A;  5DBK A;  2VTB B;  3PVL A;  3QDN A;  3RO3 A;  4N2S A;  3T8M A;  3TXM A;  4B94 A;  2GRM A;  3AU5 A;  3CVY A;  4IN3 B;  2KZT B;  2PM7 A;  4W9R A;  4EZJ A;  2MHK A;  5EDS A;  3LVR E;  4J8S A;  4I2Z A;  3ZGQ A;  4JHK A;  3D9I A;  2WMO A;  4FP7 A;  4KMO A;  4GA1 A;  4U0U A;  3FWV A;  4C0M A;  3AU4 A;  1LF8 A;  3AS8 A;  3G2T A;  4HVB A;  4I2W A;  2IFU A;  5BUZ A;  4FJZ A;  2HR2 A;  2R59 A;  3APD A;  4HOQ A;  4AP2 A;  1H2T C;  3T5X A;  5T4Y A;  3CVW A;  2Y4T A;  3NF1 A;  5AYW D;  4FA6 A;  4JA9 A;  3FHE A;  2GW1 A;  2VGX B;  4WWP A;  1S0P A;  3CR3 A;  3PRZ A;  4IYP A;  4UQX A;  4Q69 A;  1E8W A;  1NA0 A;  3QNK A;  4ILG A;  4R7L A;  2XCB A;  3QKY A;  5G04 J;  4FHK A;  5KJN A;  4I9C A;  4MRU A;  5JHB A;  2AXZ A;  1HH8 A;  3BEE A;  4LEU A;  4L2Y A;  4UWL A;  2BTD A;  3UT8 A;  2AXV A;  5C2Y A;  4GA2 A;  5FZS A;  4N5C A;  3ZYL A;  4KXK B;  3ZN3 A;  4UI9 K;  3CVP A;  3QC1 A;  4GZ5 A;  4XE0 A;  2VSO E;  1UN9 A;  3ESL A;  2IOL A;  3OXL A;  3URZ A;  4I17 A;  1U3D A;  4ILI A;  3ONK A;  3APF A;  4G24 A;  4GU5 A;  3ZYM A;  4N3C A;  4I1A A;  3PE3 A;  3Q5M A;  3R7R A;  3ULQ A;  2E0I A;  3SD5 A;  3L54 A;  1Z6T A;  2XPI A;  5KJK A;  1NZN A;  5FQ8 A;  4WNE A;  4YVO A;  3FUN A;  1TEZ A;  2YIN A;  4EPZ A;  4CCA A;  2XCC A;  2WXK A;  2WXR A;  4M3O A;  2PZI A;  3KAE A;  2CFZ A;  4CT4 A;  4APO A;  4DPR A;  3ML9 A;  1H0A A;  3FU5 A;  3FTZ A;  3MA5 A;  3QAQ A;  4G26 A;  3G2W A;  4HFG A;  4TUU A;  4GCN A;  4WNF A;  2AWI A;  4GZD A;  3LKU A;  2WB2 A;  2YQ8 A;  4U07 A;  2VJ8 A;  1HE8 A;  1TJC A;  3S7J A;  2YHC A;  3TG4 A;  2J07 A;  2OND A;  2FF4 A;  1JUQ A;  5G55 A;  3FEY A;  5D0Q D;  3CVL A;  4XKC A;  3CEQ A;  4CRW A;  4DLQ A;  4BTB A;  4NUR A;  4N3B A;  3D9L A;  1P5Q A;  2NSZ A;  3TL5 A;  5FQ4 A;  1H6K A;  5HI7 A;  4CEM A;  4GYY A;  3L16 A;  1KT1 A;  2WXP A;  2KM4 A;  3ENE A;  3B13 A;  4I6J A;  1X5B A;  4YVQ C;  4C0E A;  4DI3 A;  3ASH A;  4A3V A;  4URK A;  3QWW A;  3UUX A;  1E96 B;  3IHV A;  4XIF A;  4O6F A;  2DIW A;  3ZYK A;  4XKB A;  5E75 A;  2PQR A;  2C2L A;  4D10 C;  4QFV A;  1E7U A;  2VSY A;  2KC7 A;  1HG2 A;  1OUV A;  2ZU6 B;  1XGW A;  1Y8M A;  3FH7 A;  3GZ1 A;  4ANU A;  4EEC A;  5M72 A;  3Q49 B;  4NQ0 A;  3QK0 A;  3FUI A;  4JA7 A;  2LSU A;  4BY6 A;  4KZ0 A;  1EPU A;  2XRY A;  4K03 A;  1MHQ A;  1PY1 A;  2IU1 A;  1IYG A;  1ZU2 A;  2WXQ A;  3D9J A;  2WXN A;  3ASD A;  2Y4U A;  4F7A A;  3DPD A;  5KJM A;  3L6A A;  3QWV A;  4YND A;  1XNF A;  2XGO A;  2KAT A;  5BV0 A;  3FEX A;  4AY5 A;  5BNW A;  2X6J A;  3FU0 A;  3IEG A;  4MS6 A;  4C9B B;  4V3I A;  3ZXS A;  3FY4 A;  2J4D A;  5J90 A;  1EDU A;  1DVP A;  2YHE A;  4ATG A;  2VGX A;  4I1M A;  4ME2 A;  3RRU A;  2VQ2 A;  4G1T A;  4E6H A;  1WAO 1;  4UI9 C;  5JHA A;  1QQE A;  4CGV A;  5A7D B;  3O4Z A;  4FLH A;  4A1G A;  4APF A;  4ACL A;  4HOT A;  4JEU A;  3Q47 B;  5G05 J;  2J49 A;  4WND A;  5LP0 A;  2QFC A;  1JWF A;  4RG6 A;  2LSV A;  3IKO B;  2L0T B;  4HS2 A;  2CFU A;  3UMV A;  3LY8 A;  3RU0 A;  3SI5 A;  3MV2 B;  1N52 A;  1ELK A;  3FUF A;  5FT9 A;  1GW6 A;  2UY1 B;  3BG0 B;  2MRI A;  4I9E A;  2KZT A;  3FTS A;  1IQU A;  4JW1 A;  1HZ4 A;  4UQZ A;  4FHJ A;  4RSY A;  3PNL B;  3PNT B;  3I4G A;  4AVX A;  4ANV A;  3IHY A;  2LO6 A;  3CV0 A;  2PL2 A;  4FLB A;  4JVS A;  4OVV A;  2RD0 A;  4WUY A;  3EHN A;  1IQR A;  3R7Q A;  4AXH A;  4CDR A;  3G2S A;  3MGB A;  4KZC A;  3LY9 A;  4H7X A;  4DK5 A;  4CGW A;  2XRZ A;  4XX5 A;  3ZRH A;  3PS6 A;  3LDZ A;  5ARG A;  5LFA A;  3ZVV A;  2WXO A;  2VYI A;  3NQP A;  2XEV A;  4JZY A;  4DLO A;  3S2A A;  3VLF A;  2IJG X;  1HFA A;  4WWN A;  2V8S E;  4KBQ A;  4PS3 A;  3LJ3 A;  1SQM A;  1YA0 A;  3GZS A;  4PH4 B;  4HOR A;  5T3R A;  2ILR A;  5T8I A;  4XI9 A;  3HHM A;  3PE4 A;  4JEH A;  1H2U A;  4OVU A;  4GYW A;  3ZEF A;  1TJF A;  3MKR A;  2BUG A;  4LER A;  2XHE A;  2LNI A;  5LCW C;  3HYM B;  4J8D A;  4EQF A;  2KCK A;  3PUK A;  5FQ7 A;  2VTB A;  1BPO A;  2X6K A;  3FTV A;  3JYS A;  5JJT A;  3L22 A;  3L13 A;  2RG8 A;  4DI4 A;  5AJD A;  1EF1 C;  1Z3X A;  3BG1 B;  4U04 A;  2R17 C;  2R5S A;  3GW4 A;  1A17 A;  1DNP A;  4NRH B;  4ABN A;  3EJN A;  3CIA A;  1WY6 A;  4PDX A;  1OWM A;  3ZHE B;  2V0P A;  3LYA A;  2WXF A;  4PS7 A;  4KYO B;  3RRM B;  3PEV B;  3C98 A;  2IQC A;  3D3M A;  3MX3 A;  4DJA A;  2ION A;  4G2V A;  4F3V A;  3I3N A;  3MYV A;  2WM9 A;  2I2O A;  2CHW A;  1U3C A;  4HOS A;  2WQ6 A;  4GZ3 A;  1W3B A;  2OVB A;  2EQX A;  4UWG A;  3B7T A;  3FTX A;  5FWQ A;  2J4B A;  2LAI A;  2NC9 A;  2HYZ A;  4WAF A;  3P1U A;  5BV1 A;  1HF8 A;  5AIJ A;  4XZ4 A;  1KLX A;  3CVX A;  2WQH A;  2WPV A;  2WVI A;  2XQ0 A;  4ACK A;  3OXG A;  3JCK C;  4LCT A;  2X6F A;  3OXF A;  3FUH A;  1OWP A;  2CG3 A;  3CHQ A;  2I6H A;  2M63 A;  3HDX A;  3PH0 C;  4MKT A;  4U0Z A;  2DCP A;  3MV3 B;  4FJY A;  4F53 A;  4I6G A;  3JQ1 A;  3OAW A;  5FQ6 A;  5A23 A;  3FUM A;  3FUD A;  1E90 A;  4EBA A;  3QOU A;  3ONL A;  4U8H A;  2NXP A;  3SBT B;  1Y6I A;  2WMN A;  4ANX A;  3RJV A;  2DBA A;  3CVU A;  3O48 A;  3TJP A;  3P2B A;  3ZFW A;  3MEK A;  2A5U A;  5KJL A;  4JXT A;  3KEZ A;  4Y6C A;  4UWF A;  3MCX A;  4J0U A;  4GPK A;  3CST A;  4BT9 A;  4U63 A;  3FH5 A;  1E7V A;  4BFR A;  2E2E A;  3LS8 A;  3FTY A;  3ML8 A;  3L08 A;  1SZ9 A;  3L17 A;  3N71 A;  3FUK A;  3PRE A;  5CMY A;  5FTP A;  3G2U A;  4CDN A;  2IF4 A;  1UG3 A;  3R9A B;  3GYZ A;  1H19 A;  2MOW A;  2AVP A;  3TG5 A;  3UT4 A;  4BTA A;  3NZS A;  3UPV A;  4FC8 A;  2Y3A A;  4MLP A;  3CQC B;  1PAQ A;  3EDT B;  3ZYQ A;  4F1S A;  2PQN A;  5DIZ A;  2OVF A;  1ELW A;  2JEK A;  2WQ7 A;  2BF0 X;  4PUC A;  5G04 C;  5LOZ A;  1HXI A;  2QY7 A;  5E76 A;  1N54 A;  2L0I A;  3VLD A;  3FUE A;  5HQ8 A;  3UX4 A;  4B89 A;  5AEN A;  4EBA G;  3QWP A;  3SF4 A;  3T5V A;  2FEZ A;  3Q15 A;  5JJ7 A;  3CVQ A;  2JLB A;  3PDN A;  4GZC A;  4IUL A;  4N39 A;  2OOE A;  3DBS A;  3UQ3 A;  3EHM A;  1B89 A;  4OYS A;  1INZ A;  4ANW A;  3MJW A;  2FO7 A;  3MZL B;  3FFL A;  4P29 A;  4B8C B;  4AIF A;  4LUN U;  2KCL A;  5G2N A;  4TV3 A;  4GA0 A;  3SBS A;  5ANL A;  3ZW3 A;  3PEU B;  5FJY A;  3LEW A;  2FI7 A;  1OWO A;  4HXI A;  2OV8 A;  5BW8 C;  4K0R A;  4CDM A;  1HO8 A;  3TXN A;  4UWH A;  1E8Y A;  4UQY A;  3U3W A;  4Q96 A;  4FU3 A;  4AV7 A;  3FTW A;  4U0S A;  3CVV A;  3LY7 A;  4G25 A;  4RG9 A;  1ZBP A;  4I1O B;  2UWJ G;  1Z3Y A;  4H7Y A;  3SHF A;  1UW4 B;  4Q94 A;  4WWO A;  4BT8 A;  2PM6 A;  3LVQ E;  4I43 A;  3WXX A;  2I1J A;  2WXJ A;  2X38 A;  3ZHE A;  4HLE A;  3IBE A;  5LCW J;  2A4Z A;  2WXL A;  2I9C A;  2C0M A;  2AXU A;  3IV0 A;  2J9Q A;  1E8X A;  3I5P A;  2XGS A;  4L2L A;  1HS6 A;  3LPZ A;  2C0L A;  1HG5 A;  1PC2 A;  2FBN A;  3CLJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...