4A1GA

The crystal structure of the human bub1 tpr domain in complex with the ki motif of knl1
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
146
structure length
146
Chain Sequence
DTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQAEPREFLQQQYRLFQTRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis Reveals Features of the Spindle Checkpoint Kinase Bub1-Kinetochore Subunit Knl1 Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords MITOTIC CHECKPOINT SERINE/THREONINE-PROTEIN KINASE BUB1
total genus 62
structure length 146
sequence length 146
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08311 Mad3_BUB1_I Mad3/BUB1 homology region 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.430 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4a1gA00
3SI5A 2LAHA 2WVIA 4AEZC 4A1GA
chains in the Genus database with same CATH superfamily
5B1BE 3PUJA 5HI7A 4JB8P 3Q47B 3UKUG 1MYOA 4G8LA 2IF4A 3ESKA 5AQ9A 5ANLA 2WQ6A 2J8SD 4B8CB 4ACLA 4FU3A 5HKPA 1BLXB 4FJYA 2WXMA 2BKGA 4EQFA 3TL5A 3PDNA 3SZ7A 5HQ8A 4UWGA 2KZTA 2JLBA 4NURA 4CGWA 2X38A 1TN8A 3VLEA 2A5UA 3CR3A 5CEDB 4AVXA 3ULYA 1ELKA 3OXLA 4XEIG 4CGVA 4FADA 2FEZA 5J08A 1TNYA 1OXJA 4L9PA 3NF1A 3ISMC 5ITZF 3PREA 3FY4A 2VGEA 4GTMA 3U3WA 4HXIA 4JC8A 1SQMA 4WUYA 2F0YA 4G26A 3LVQE 1H2TC 3PEVB 3LYAA 1EDUA 3EDTB 2WXHA 2XRYA 4JA9A 1EPUA 1PC2A 1B89A 3ASHA 2I1JA 4JW1A 3RO2A 3D9LA 5LCWC 2WB2A 5FJYA 3HHMA 4HQDA 4XI0A 1KT0A 4R7LA 4DX2A 3CVUA 3JYSA 4KYOB 3MX3A 3T8MA 2XCCA 4HFGA 5JJ6A 4UUCA 3ZYMA 2L0TB 5DBKA 4AOFA 1PY1A 2L0IA 3KSLA 5B1AE 1D9SA 3QJZA 1K1AA 4E6HA 4N3CA 5G55A 4GYOA 1S64A 4YDOA 3NBNB 3MJWA 4MS6A 4U07A 4HRNA 4KZCA 2AXUA 4DRXE 5FTPA 3C98A 3ASFA 1YA0A 4DLOA 4A3VA 4B8AA 3Q78A 2Y4TA 3SBSA 3SI5A 5CEAA 1IHGA 1V55E 1E8WA 1U2VG 5G05C 5AJDA 4CYMD 2UWJG 1D8EA 4BFRA 2OCCE 2B6CA 3TG5A 1IYGA 3E34A 2XEHA 4J0UA 4IULA 3EHRA 3CVWA 4FULA 2I9CA 4I9EA 1TN6A 2IO2C 3E37A 2NXPA 5CRUA 3B7RL 4UQXA 3UUXA 2PQNA 1QYMA 1A17A 4GYWA 4BTAA 3TGOA 3FFLA 5KJNA 5FZSA 1DVPA 4RQIA 3L08A 1FT2A 1K1BA 3MA5A 3MKRA 4UQZA 3BG1B 3UM1A 1P5QA 3SBTB 2KCKA 4TUMA 3D9KA 3S7DA 4I1AA 1YYHA 3BQOA 1HX8A 3DSUA 1SVXA 2QYJA 4EZLA 2KBXA 2C0MA 4ZFHA 4LNBA 2QFCA 3Q9NC 4G24A 3W9GA 2XZDG 1OT8A 2JEKA 2XEEA 5KWDA 3G2SA 2LAIA 3DRAA 3QWWA 4HOQA 1MX4A 3JQ0A 4FHJA 5EIDA 3DSVA 5EX0A 2LO6A 4MLPA 4GTVA 3EIQC 4U96D 1MJ0A 5T4YA 5AIJA 3FP3A 2AVPA 1LD7A 1NL4A 1TNZA 3PZ1A 4LNUD 4BERA 3Q9UC 5ANRA 2ETBA 2ZISA 2QZAA 5D2MC 3LXUX 2P9PG 3B7TA 2UY1A 2Y69E 3CHSA 3PZ2A 3KD7A 2OV8A 3CLJA 1KZPA 1ZBPA 5CERB 3BU8A 1N4PA 1SZAA 2X6JA 4KBQA 3FUFA 4ANXA 2WM9A 3P2BA 4GCOA 3S7JA 3T5VA 3Q75A 2DVWA 3FTVA 3S7BA 4GA1A 3S2AA 3R7QA 4K5AB 4GMJA 5E76A 3R9MA 3ASNE 4BT9A 5IY5E 4IN3B 4A1GA 3Q15A 3QB2A 1TNOA 3RKVA 4B94A 3G2VA 1XGWA 3IBEA 3ABME 3ESLA 2GROB 3KS2A 2P9KG 2J08A 4O1PA 1TNUA 2R5SA 1KZOA 2XPYA 2P9UG 4V3IA 3CK7A 4KVMA 2F8YA 3PZDA 4IRUA 4ANVA 4UWFA 2V8SE 2Y4UA 3GYZA 2J09A 2MRIA 1UN9A 3HG0D 3ZYLA 4AY6A 1K3ZD 2X6KA 3L13A 4HOSA 4A63B 2L9BA 4BESA 5G04C 5FINA 3AG1E 3CHPA 1OCOE 3SNXA 2ZGGA 2WQHA 5CHEE 3FDHA 3J5QB 3ZXSA 5LFAA 3Q4AB 4B89A 3E33A 1GW6A 1Z3XA 1NA3A 2IONA 4WWNA 5FT9A 3MZLB 3Q49B 4TV3A 3RK6A 3GZ1A 1JCRA 4CCAA 3FEYA 3D9JA 3CVLA 1TYQG 2LSUA 3TWTA 3L16A 4WNFA 2WXQA 1NZNA 4A1SA 4GZ5A 1BI8B 5ENSD 3FTUA 4GZCA 5H7PA 4JZYA 1K8KG 3BG0B 3Q7AA 5BW8C 2EIME 3BEEA 5T8IA 3FTYA 4DI4A 5LCWJ 2QY7A 5C2YA 3ZIMA 2NYJA 3AS4A 3SO8A 3ZRHA 3L6AA 3CKBA 3L82A 1OCRE 4CRWA 2WXNA 1O1SA 2HM8A 4HS2A 4PH4B 5D0QD 2VYIA 4BX8A 1HS6A 3EHMA 1N11A 2JABA 1N0RA 3FUDA 4C48B 4U8HA 3SFYA 1OCCE 5A7DB 3HVEB 3RJVA 3CV0A 4A3TA 3KSQA 3CHOA 2LUHA 2AW6A 5EIBE 3R9AB 1WY6A 4HRMB 3F6QA 3SF4A 4AEZC 2H6GA 1N94A 1V54E 1EYHA 1YCSB 4P29A 2GRMA 2J4BA 3W9FA 4ATZD 4X8QA 4DJAA 3AG4E 4APFA 3QC1A 2M63A 2DYRE 4PUCA 3HRAA 3EIJA 4GZ3A 4TXQA 4ABNA 5BV0A 1TJFA 4J6IA 5LP0A 5G05J 4JHKA 3DPDA 2NSZA 4L1BA 1D8DA 3DSWA 3APFA 2IQCA 2GRQB 2IOSA 4LUNU 2RFAA 3FH8A 4PS8A 2LXMA 4AV7A 2ETCA 4U63A 3HXEA 3LVRE 2PNNA 4U7EB 3KEZA 4F6RD 4GTQA 4JL0A 3ZVVA 5AN8A 4GA2A 4K0RA 5LX8A 2ZXWE 2DZOA 1E96B 3TXMA 4NRHB 5CMYA 1OUVA 2E2EA 3B13A 3C72A 2PM6A 1SZ9A 3UMVA 3D9MA 4JPSA 1XNFA 3NQPA 1BPOA 5ARGA 2GRPB 5CCLA 3CHMA 4J8SA 1ZB1A 2OEVA 4GA0A 4DLQA 3I3NA 4RLYA 3ZGQA 4FLHA 4GCNA 2ETAA 3IHVA 2XGOA 4K03A 2XZTG 4ZHBA 4URKA 4YDEA 3IHYA 3LCAA 1UN8A 3MKQB 4L2YA 4GPMA 2I1KA 2WXLA 4UWHA 3PE4A 3CGHA 1FT1A 1SA5A 4M7CA 3AS8A 3D9OA 4KVOA 1H6OA 1QQEA 1U3DA 5EN5D 3P1UA 4B0ZA 2FF4A 2XGSA 4N39A 4J8FA 4I6JA 3I4RB 4J7WA 3TWWA 1INZA 2KZTB 1NA0A 4U0SA 3RRNB 2WXKA 1DCQA 3BUAA 2PL2A 4I2ZA 2OVBA 2GRNB 1KPSB 2XCBA 4YNDA 3RRUA 4WNGA 4AM9A 3T5XA 2IFUA 4E85A 3TAXA 3EJNA 3KAEA 3ML8A 3FUIA 4ME2A 4LEUA 1NP7A 2J07A 2VGXB 3ABKE 4EZJA 4HRLA 3FU5A 4ANUA 1QZ2A 3RSEG 1N9AA 2CHZA 3QWPA 2R2LA 5CBNA 2YINA 2WPVA 3DXKG 4HNAD 2GW1A 1FVHA 2EINE 3ZUVB 3LY7A 3JXJA 2YHCA 1Z5SC 3LDZA 4U0UA 5CRVA 3UINC 4FHKA 3LKUA 3CVYA 4GTRA 3V2OA 2X3MA 3JQ1A 4A55A 3AAAC 3JXIA 4GTOA 1BD8A 3PNLB 5BV1A 3MGBA 4HORA 4RVBA 1TN7A 4EHMA 3IEGA 3CHQA 4CDRA 2L6BA 3AG3E 1N4QA 3S7FA 3GZSA 1MQSA 1O1RA 3JUIA 3CVPA 1OWMA 5G04J 4XIFA 5AQBA 2WMOA 4L2LA 3Q73A 2IY0C 3G2TA 4O1OA 2KCLA 3PEUB 1MHQA 2HYZA 3CQGB 3TJPA 3VLDA 3QKYA 5D66A 4GPKA 5BXOA 3L22A 3SQVA 2VTBA 1ELWA 4ATGA 3CK8A 2ILRA 1OY3D 3E30A 4GTTA 1DCEA 1N4RA 2E0IA 4XKBA 4LNGA 5FIOA 1UJJA 3SHFA 2AWIA 4AY5A 4F7AA 4Y6WA 4DPRA 4XE0A 4I9CA 4LG6A 2EILE 4N2SA 4QQIA 2LXLA 4G11A 2WMNA 1HFAA 5E75A 5KBAA 5JJTA 1KLXA 4LSZE 3C3QA 4YVQC 1BI7B 4H7YA 2WXRA 3OAWA 4EPZA 3K9IA 2IU1A 2UY1B 3TWUA 2HE0A 4GYYA 5BNWA 4HVBA 1FVFA 3MEKA 2V4LA 3PH0C 4NACA 3U4TA 3UIPC 1NI1A 5AYWD 4CDNA 3FUMA 3CKCA 1LF8A 3HXBA 1LD8A 4ACKA 4MRUA 2VSOE 2H6FA 2GGFA 3FUEA 3RAUA 2XPZA 5BPPA 3ASOE 4N3AA 1UJKA 2P9SG 4EECA 1FCHA 3ONKA 3TG4A 4GZDA 4UI9K 4BEPA 2Y1LE 4JHJA 3GW4A 4G1TA 4KT6B 3E4BA 3O4ZA 4C9BB 3GZ2A 4JVSA 2XHEA 3UKRG 3PUKA 1IKND 3FTWA 4Z68A 3FTZA 2WQ7A 2XEVA 3D9NA 4UQYA 3QNKA 3TXNA 2VSYA 4RG9A 2J9QA 3C3RA 4DUIA 1IXVA 3G2WA 4GZ6A 3WG7E 3HYMB 2EIKE 3LPZA 4DK5A 4NQ0A 2HR2A 3SY2A 5CBOA 3HDXA 3LEWA 3LS8A 4J8EA 2IJGX 3OTNA 1Z6TA 2EIJE 1DNPA 1ZU2A 4I2WA 4MKTA 4U8VD 3SD5A 4BTBA 2CG3A 5JJ7A 4C0MA 1OWNA 4DI3A 3CHRA 1A5EA 4ANWA 3ZEFA 1KT1A 3CSFA 4GMRA 2YHEA 3ZXPA 2XENA 4CT0A 2BF0X 3FUNA 1H6KA 5BT1A 4I17A 2PM7A 2XRZA 2AXVA 5BXUA 2V0PA 2X6HA 2AJAA 4WWPA 5EILA 4AIFA 3PE3A 3LY8A 2WXOA 2CHWA 5G2NA 3FU0A 3U64A 3EHQA 2KM4A 1HE8A 3PZ4A 5EX3A 2WXJA 1OWOA 4I43A 4BX9A 4YVOA 4CDMA 4Q69A 4DX5D 5ENQD 4G2VA 2WXFA 2XPIA 3PVLA 1PAQA 2WXIA 1TJCA 3MV3B 1HO8A 4FLBA 4UWLA 3MYVA 2I2OA 3IV0A 4U0ZA 3ZHEB 2NC9A 3OXGA 5KNHD 2V4HC 1TR4A 2P58C 5FWQA 3CVXA 3UXGA 4EBAG 3KEAA 3R7RA 4JHRA 2Q7FA 4I6EA 4GTPA 2MHKA 3G2UA 3CVNA 4TRQA 2P9IG 4FJZA 3UTMA 3ZPJA 3AU5A 2Y0BG 3CK9A 2IEJA 4BETA 1AP7A 4HB5A 4PDXA 5C1DA 2LNIA 3SGHA 4Q96A 3FWVA 3ZHEA 1WDYA 2P9NG 3DBSA 2YQ8A 4ILGA 1OWLA 1HG2A 2H6IA 4OYSA 4DX7D 3FTXA 4U8YD 4LERA 1EF1C 3B7UX 4RSYA 2XS1A 4KXKB 4FA6A 3UI2A 4M3OA 1AWCB 4G8KA 4BWRA 1HH8A 3RO3A 1UG3A 4HLLA 1JCQA 3CVQA 4ILHB 5AAOA 3ZKJA 3N71A 3NOCD 4UI9J 2P9LG 2V5QC 4GMLA 3VLFA 4F53A 4O6FA 4C0EA 4BY6A 2CFZA 3SFZA 2CHXA 5ENTD 1TEZA 1W3BA 4WNDA 3MCXA 2DWZA 4XX5A 4JXTA 2X6FA 4JA7A 4ILIA 1N52A 1UW4B 2KXPC 3ZYQA 2AXZA 2RG8A 1E90A 1RZ4A 3T8KA 4BSZB 4HOUA 4IYPA 4UWKA 1U3CA 3ZW3A 1JWFA 5EYPF 1L5JA 1E8YA 4QFVA 5FQ6A 4K5BA 2V5FA 1X81A 2VQ2A 4YDYA 3CVVA 4G23A 3UT8A 3OXFA 4DX6D 1IHBA 3ONLA 2C2LA 3FH7A 4XKCA 4F1PA 4AXHA 3VTXA 3C3OA 4N5QA 1ELRA 2H6HA 4TXPA 1DC2A 5M72A 3JUEA 4OVUA 2RKKA 3NZUA 4PS7A 3UM0A 2LAHA 2BUGA 4F1SA 3CSTA 3ULQA 1Y8MA 3UM3A 3Q79A 4XZ4A 3EUVA 4O60A 3V31A 1JUQA 3RRMB 1S63A 5AJLA 1N4SA 3B7SA 3FUJA 1JWGA 3UM2A 4H7XA 5AQAA 4CT4A 3CEQA 4PS3A 3VTYA 2F37A 4N3BA 5ENRD 2R03A 1H19A 3DEPA 3IKOB 1YMPA 3DXMG 2J4DA 3MV2B 3DPYA 3TWXA 1WM5A 4W9RA 2I6HA 4HI9A 1JPLA 2R17C 1S0PA 3QOUA 4GAAA 1MZCA 2GRRB 3LJ3A 4RG6A 4B93B 1MX6A 3ZYKA 3CIAA 5JMND 3DSSA 3FU6A 3FH5A 1S70B 3DWLG 2KC7A 1HXIA 2B0OE 3QK0A 4APOA 5AQ7A 4JEUA 4HI8A 2BEDA 3ZFWA 2VGYA 4KMOA 2DIWA 4EBAA 4HBDA 2LSVA 4JD2G 2PQRA 1FPPA 2RFMA 4CEMA 4Q94A 3JCKC 1E7VA 3IXEA 1LTXA 3L54A 3FTSA 4WNEA 3V30A 3ABLE 5LOZA 2HO1A 5ARFA 4CZ2D 5CCMA 4EZKA 3V79K 2F8XK 2VTBB 3LY9A 3D9PA 1O5MA 4K5CA 1HG5A 2FO1E 3RU0A 5AENA 1G3NB 1VDYA 3APCA 3AJIA 4U95D 2A4ZA 3T9KA 3HIZA 4U04A 1UOHA 2VSNA 1IQRA 3EHNA 4LRZA 3NOGD 1N0QA 5FZQA 3RIBA 5EDSA 3O48A 3MKQA 5HS0A 2BKKB 2XQ0A 3HXCA 3D3MA 4LCTA 3WXXA 1Y6IA 2C0LA 3ENEA 4HOTA 3B7BA 2J49A 2QC9A 4GTSA 2ZGDA 3ML9A 5AARA 2FO7A 1RW2A 2IOLA 3AS5A 2FULA 2VGXA 5D0OD 5JHBA 3D9IA 4YDWA 3NB2A 2X6IA 3NZSA 3UIOC 3TWSA 2GRLA 4D10C 3DEOA 3X2QE 1IQUA 4TXRA 2FI7A 3I5PA 4XI9A 3QWVA 2R05A 5ENOD 3U9WA 5ENNA 3I4GA 3EU9A 3QDNA 1OWPA 1WG0A 2ZU6B 1NFIE 3Q5MA 2VSXE 1N54A 3TWRA 4MBGA 2DYSE 2P2CP 2MYOA 5KNGA 4BSXA 3PRZA 1H6PA 3PS6A 4HLEA 5FQ7A 4GU5A 3ASGA 4DX1A 4I6GA 3DSTA 3UQ3A 5A23A 5ENPD 2OVFA 3DSXA 3ZN3A 3FHEA 3PZ3A 4OVVA 1QBQA 3LJNA 4GB9A 5KJLA 4FP7A 5FZRA 4Y6CA 1HZ4A 3L9TA 3Q7FA 3ULEG 5KJMA 2WVIA 1Q2ZA 3AU4A 4N2QA 3SFXA 1HU3A 2Y3AA 1JCSA 4G25A 4JEHA 5B3SE 5CECB 4AP2A 2OEWA 5FQ8A 1TNBA 5J90A 3ZNGA 2CG2A 5HRYA 3TWVA 1MX2A 4OAUC 2QYUA 3J5PA 4UI9C 4WWOA 2KCVA 3AG2E 5T3RA 2BTDA 2DCPA 2VJ8A 2ZIRA 2WXGA 5JA4D 3FUKA 2XGMA 2WXPA 5CMWA 2CFUA 5JHAA 3FU3A 2OOEA 4TUUA 2IO3C 4KZ0A 2R02A 4I1MA 3URZA 1E8ZA 1N95A 3FEXA 3UX4A 1H2UA 3QAQA 3EU5A 3UT4A 1SW6A 3UT7A 3B95A 4AJWA 5KCMA 1E8XA 4L7TA 3V2XA 4J8DA 2YNQA 3APDA 2EQXA 3C5RA 2A5EA 2R59A 1H0AA 3ZU7B 3E32A 3UPVA 3HXDA 5A6CA 1E7UA 4L23A 2MOWA 2ONDA 4OAVB 2XS8A 4J8YA 3FULA 2FBNA 1O1TA 5FQ4A 1BU9A 4NIKA 1QNFA 4BT8A 3HXFA 3NAWA 4WAFA 2KATA 3TWQA 5DIZA 2PZIA 1Z3YA 2L6JA 5KJKA 3ASDA 5EYLA 3FUHA 3HVEA 3PNTB 1SA4A 4N5CA 3L17A 1WAO1 3D9HA 3QARA 3CQCB 1H2VC 3U66A 5EKQD 1X5BA 2DBAA 2DZNA 4FC8A 1OCZE 4F3VA 4I1OB 5BUZA 1HF8A 2RD0A
chains in the Genus database with same CATH topology
5CHEE 3FDHA 4XZ4A 3SHFA 2AWIA 3ZXSA 4AY5A 5LFAA 3Q4AB 4B89A 1JUQA 3PUJA 3RRMB 4F7AA 4Y6WA 5HI7A 4DPRA 3Q47B 5AJLA 4XE0A 1GW6A 1Z3XA 3B7SA 3FUJA 4I9CA 1JWGA 1NA3A 2IONA 4H7XA 4N2SA 2IF4A 4CT4A 3ESKA 3CEQA 4PS3A 4WWNA 3VTYA 5FT9A 5ANLA 2WQ6A 4G11A 4N3BA 4B8CB 2WMNA 1HFAA 3MZLB 4ACLA 1H19A 3Q49B 4TV3A 4FU3A 5E75A 3RK6A 3GZ1A 5JJTA 4FJYA 3IKOB 1KLXA 4CCAA 2WXMA 4YVQC 4EQFA 2J4DA 4H7YA 3PDNA 3SZ7A 3MV2B 3FEYA 3TL5A 5HQ8A 1WM5A 3D9JA 4W9RA 2WXRA 3CVLA 3OAWA 2KZTA 2LSUA 3K9IA 4UWGA 4EPZA 2I6HA 2JLBA 3L16A 4WNFA 2WXQA 1NZNA 2IU1A 2UY1B 4NURA 1JPLA 4A1SA 2R17C 1S0PA 4GZ5A 3QOUA 4GAAA 4CGWA 2X38A 3FTUA 4GZCA 3LJ3A 4RG6A 3VLEA 4JZYA 4GYYA 5BNWA 2A5UA 3CR3A 3BG0B 3ZYKA 4HVBA 3CIAA 5BW8C 4AVXA 3BEEA 1FVFA 3MEKA 5T8IA 3FTYA 2V4LA 4DI4A 5LCWJ 3PH0C 1ELKA 3OXLA 2QY7A 5C2YA 3ZIMA 3AS4A 4NACA 3U4TA 4CGVA 3ZRHA 4FADA 3L6AA 2FEZA 3FU6A 5J08A 3FH5A 3CKBA 2KC7A 5AYWD 4CDNA 1HXIA 3FUMA 3QK0A 3CKCA 1LF8A 4CRWA 3NF1A 2WXNA 2HM8A 4HS2A 4PH4B 4APOA 3PREA 5D0QD 3FY4A 4ACKA 4MRUA 2VYIA 2VSOE 4BX8A 3U3WA 4HXIA 4JEUA 2GGFA 3FUEA 1HS6A 2VGYA 3ZFWA 4JC8A 4KMOA 2XPZA 2DIWA 3EHMA 5BPPA 1SQMA 4WUYA 4EBAA 4G26A 3LVQE 4N3AA 1UJKA 2LSVA 1H2TC 3PEVB 2PQRA 3LYAA 1EDUA 3EDTB 4EECA 3FUDA 1FCHA 3ONKA 2WXHA 2XRYA 4JA9A 3TG4A 4GZDA 4U8HA 4UI9K 4JHJA 1EPUA 1PC2A 3GW4A 1B89A 3ASHA 4G1TA 4KT6B 5A7DB 3E4BA 3O4ZA 3HVEB 2I1JA 4JW1A 3GZ2A 3RJVA 3RO2A 4C9BB 4CEMA 3D9LA 4JVSA 2XHEA 4Q94A 5LCWC 3CV0A 5FJYA 2WB2A 3JCKC 1E7VA 3HHMA 4A3TA 3L54A 3PUKA 3FTSA 3CHOA 4XI0A 1KT0A 4R7LA 2AW6A 4WNEA 3R9AB 1WY6A 3CVUA 3FTWA 3JYSA 4KYOB 3FTZA 3MX3A 3SF4A 3T8MA 2XCCA 5LOZA 2WQ7A 4HFGA 2HO1A 2XEVA 3D9NA 4AEZC 5ARFA 5JJ6A 5CCMA 4EZKA 3ZYMA 4UQYA 2VTBB 2L0TB 1EYHA 3LY9A 3D9PA 5DBKA 4P29A 2GRMA 2J4BA 4AOFA 3QNKA 1PY1A 1HG5A 2L0IA 4DJAA 3RU0A 4APFA 3QC1A 3TXNA 2M63A 5AENA 3QJZA 1VDYA 2VSYA 4PUCA 3APCA 3EIJA 4GZ3A 2A4ZA 4RG9A 4ABNA 3HIZA 2J9QA 4E6HA 4N3CA 5G55A 4U04A 4GYOA 5BV0A 2VSNA 1TJFA 1IQRA 3EHNA 3G2WA 4GZ6A 4J6IA 4LRZA 5LP0A 3MJWA 4MS6A 3HYMB 4U07A 3LPZA 5G05J 5FZQA 3RIBA 5EDSA 4KZCA 4DK5A 4JHKA 3DPDA 3O48A 3MKQA 2AXUA 4NQ0A 2NSZA 5FTPA 3C98A 3ASFA 2HR2A 4L1BA 3HDXA 2XQ0A 3APFA 2IQCA 3D3MA 3LEWA 2IOSA 3LS8A 1YA0A 4LUNU 4J8EA 4DLOA 4LCTA 4A3VA 4B8AA 2IJGX 3FH8A 3OTNA 4PS8A 1Z6TA 3WXXA 2Y4TA 1Y6IA 2C0LA 3ENEA 4AV7A 4HOTA 1DNPA 2J49A 1ZU2A 4I2WA 4U63A 4MKTA 3SD5A 3SBSA 3LVRE 4BTBA 3SI5A 3ML9A 3KEZA 2CG3A 2FO7A 5JJ7A 4C0MA 1OWNA 4JL0A 4DI3A 1IHGA 3CHRA 4ANWA 2IOLA 1KT1A 3ZEFA 1E8WA 3AS5A 3CSFA 3ZVVA 5G05C 2FULA 2VGXA 2YHEA 5D0OD 5JHBA 5AJDA 3D9IA 4CT0A 4GA2A 4K0RA 2BF0X 5LX8A 3FUNA 1H6KA 2X6IA 3NZSA 5BT1A 2UWJG 4I17A 4BFRA 1E96B 2PM7A 2XRZA 2AXVA 3TG5A 3TXMA 1IYGA 4NRHB 2GRLA 2V0PA 2X6HA 4J0UA 5CMYA 4D10C 1OUVA 1IQUA 4IULA 2FI7A 2E2EA 3I5PA 3B13A 3CVWA 4WWPA 2PM6A 4FULA 1SZ9A 4XI9A 3QWVA 3UMVA 3D9MA 4JPSA 4AIFA 2I9CA 3PE3A 3U9WA 5ENNA 3LY8A 4I9EA 1XNFA 3I4GA 3QDNA 2NXPA 1OWPA 2WXOA 3NQPA 1BPOA 2CHWA 5ARGA 3B7RL 5CCLA 3CHMA 4J8SA 3FU0A 4UQXA 4GA0A 5G2NA 3UUXA 2ZU6B 3U64A 4DLQA 3I3NA 2KM4A 1HE8A 2PQNA 5EX3A 2WXJA 3ZGQA 1A17A 4GYWA 1OWOA 4FLHA 4BTAA 3FFLA 3TGOA 3Q5MA 5KJNA 4I43A 2VSXE 5FZSA 1DVPA 1N54A 4GCNA 3IHVA 2XGOA 3L08A 4K03A 4BX9A 4YVOA 4BSXA 3MA5A 4CDMA 3MKRA 3PRZA 4UQZA 4Q69A 1UJJA 4URKA 4G2VA 2WXFA 3PS6A 2XPIA 3PVLA 1PAQA 4HLEA 5FQ7A 2WXIA 3BG1B 3IHYA 3LCAA 4GU5A 3ASGA 1UN8A 1P5QA 3MKQB 4I6GA 3UQ3A 3SBTB 1TJCA 2KCKA 3MV3B 1HO8A 4L2YA 5A23A 2OVFA 2I1KA 4FLBA 2WXLA 4UWLA 4UWHA 3PE4A 3MYVA 3ZN3A 3CGHA 3D9KA 3FHEA 4OVVA 2I2OA 3IV0A 3AS8A 3D9OA 4GB9A 4U0ZA 5KJLA 3ZHEB 4FP7A 3S7DA 4KVOA 4I1AA 5FZRA 1QQEA 2NC9A 4Y6CA 1HZ4A 3OXGA 1HX8A 1U3DA 2P58C 3P1UA 4B0ZA 5FWQA 2FF4A 2XGSA 5KJMA 2WVIA 4N39A 4J8FA 3CVXA 4EBAG 4EZLA 4I6JA 3I4RB 3AU4A 3R7RA 4N2QA 2C0MA 4JHRA 1INZA 2QFCA 2Q7FA 1HU3A 2Y3AA 4G25A 4I6EA 4JEHA 4G24A 2KZTB 2MHKA 3G2UA 4AP2A 1NA0A 3CVNA 4TRQA 4U0SA 3RRNB 2JEKA 4FJZA 5FQ8A 3G2SA 2WXKA 5J90A 3ZPJA 3AU5A 2LAIA 2PL2A 3CK9A 4I2ZA 2CG2A 2OVBA 2XCBA 4PDXA 3QWWA 4YNDA 4HOQA 2LNIA 3SGHA 4UI9C 3RRUA 4WNGA 4WWOA 5C1DA 4AM9A 3JQ0A 4FHJA 3T5XA 4Q96A 3FWVA 2IFUA 2KCVA 3ZHEA 4E85A 3DBSA 4ILGA 2YQ8A 5EX0A 5T3RA 2LO6A 1OWLA 2BTDA 4MLPA 3EIQC 1HG2A 3EJNA 3KAEA 2DCPA 3TAXA 2VJ8A 5T4YA 5AIJA 3FP3A 2AVPA 4OYSA 3ML8A 3FUIA 3FTXA 2WXGA 4LERA 3FUKA 1EF1C 4ME2A 3B7UX 1NP7A 2J07A 4LEUA 2XGMA 2VGXB 4RSYA 5ANRA 2WXPA 5CMWA 2CFUA 4EZJA 4KXKB 4FA6A 3FU5A 4ANUA 5JHAA 1QZ2A 3FU3A 2OOEA 4TUUA 4M3OA 2CHZA 3LXUX 4KZ0A 3QWPA 4I1MA 4BWRA 3URZA 1HH8A 2YINA 2WPVA 3B7TA 2UY1A 2GW1A 1FVHA 3CHSA 1E8ZA 3FEXA 3RO3A 3KD7A 3UX4A 1UG3A 2OV8A 3CLJA 3LY7A 1H2UA 3QAQA 2YHCA 3CVQA 4ILHB 3N71A 3LDZA 4U0UA 4UI9J 3UT4A 1ZBPA 3UT7A 4GMLA 3VLFA 4F53A 4AJWA 4O6FA 5KCMA 4C0EA 1SZAA 2X6JA 4KBQA 1E8XA 3FUFA 4ANXA 4L7TA 2WM9A 4BY6A 2CFZA 3SFZA 3P2BA 2YNQA 2CHXA 3APDA 4GCOA 4FHKA 4J8DA 3S7JA 2EQXA 3LKUA 1TEZA 3T5VA 3CVYA 1W3BA 2R59A 1H0AA 4WNDA 3MCXA 3UPVA 2X3MA 4XX5A 5A6CA 3FTVA 3S7BA 4GA1A 4JXTA 3JQ1A 3S2AA 3R7QA 4A55A 1E7UA 4L23A 2X6FA 4GMJA 4JA7A 5E76A 2MOWA 2ONDA 4ILIA 3PNLB 5BV1A 3MGBA 3FULA 4HORA 4BT9A 1N52A 4RVBA 1UW4B 3IEGA 3Q15A 4IN3B 4A1GA 3CHQA 3QB2A 4CDRA 3ZYQA 3RKVA 4B94A 3G2VA 2AXZA 2FBNA 1XGWA 2RG8A 3IBEA 3ESLA 3S7FA 1E90A 3GZSA 3KS2A 5FQ4A 1MQSA 3JUIA 3CVPA 2J08A 1OWMA 5G04J 4XIFA 2WMOA 4L2LA 2R5SA 1QNFA 2XPYA 4HOUA 4IYPA 4UWKA 4V3IA 1U3CA 3ZW3A 1JWFA 4BT8A 1L5JA 3CK7A 1E8YA 4KVMA 4QFVA 5FQ6A 2V5FA 2VQ2A 4WAFA 3G2TA 2KCLA 3PZDA 3PEUB 2KATA 3CVVA 4G23A 1MHQA 4IRUA 2HYZA 5DIZA 2PZIA 3OXFA 3UT8A 4ANVA 4UWFA 3CQGB 2V8SE 1Z3YA 2L6JA 5KJKA 2Y4UA 3TJPA 3ASDA 3ONLA 3FUHA 3VLDA 3GYZA 2J09A 2C2LA 2MRIA 3HVEA 3QKYA 3FH7A 3PNTB 4GPKA 4XKCA 4N5CA 3L17A 1WAO1 3QARA 4AXHA 3CQCB 3VTXA 1UN9A 3L22A 1H2VC 1ELRA 3ZYLA 3U66A 4AY6A 2VTBA 5EKQD 1X5BA 2X6KA 1ELWA 3L13A 4HOSA 5M72A 3CK8A 4OVUA 4ATGA 2DBAA 2ILRA 4FC8A 3NZUA 2L9BA 4PS7A 4F3VA 4I1OB 5G04C 2LAHA 3CHPA 2E0IA 5BUZA 3SNXA 2BUGA 4XKBA 2WQHA 1HF8A 4F1SA 2RD0A 3CSTA 3ULQA 1Y8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SI5 A;  2LAH A;  2WVI A;  4AEZ C;  4A1G A; 
#chains in the Genus database with same CATH topology
 5B1B E;  3PUJ A;  5HI7 A;  4JB8 P;  3Q47 B;  3UKU G;  1MYO A;  4G8L A;  2IF4 A;  3ESK A;  5AQ9 A;  5ANL A;  2WQ6 A;  2J8S D;  4B8C B;  4ACL A;  4FU3 A;  5HKP A;  1BLX B;  4FJY A;  2WXM A;  2BKG A;  4EQF A;  3TL5 A;  3PDN A;  3SZ7 A;  5HQ8 A;  4UWG A;  2KZT A;  2JLB A;  4NUR A;  4CGW A;  2X38 A;  1TN8 A;  3VLE A;  2A5U A;  3CR3 A;  5CED B;  4AVX A;  3ULY A;  1ELK A;  3OXL A;  4XEI G;  4CGV A;  4FAD A;  2FEZ A;  5J08 A;  1TNY A;  1OXJ A;  4L9P A;  3NF1 A;  3ISM C;  5ITZ F;  3PRE A;  3FY4 A;  2VGE A;  4GTM A;  3U3W A;  4HXI A;  4JC8 A;  1SQM A;  4WUY A;  2F0Y A;  4G26 A;  3LVQ E;  1H2T C;  3PEV B;  3LYA A;  1EDU A;  3EDT B;  2WXH A;  2XRY A;  4JA9 A;  1EPU A;  1PC2 A;  1B89 A;  3ASH A;  2I1J A;  4JW1 A;  3RO2 A;  3D9L A;  5LCW C;  2WB2 A;  5FJY A;  3HHM A;  4HQD A;  4XI0 A;  1KT0 A;  4R7L A;  4DX2 A;  3CVU A;  3JYS A;  4KYO B;  3MX3 A;  3T8M A;  2XCC A;  4HFG A;  5JJ6 A;  4UUC A;  3ZYM A;  2L0T B;  5DBK A;  4AOF A;  1PY1 A;  2L0I A;  3KSL A;  5B1A E;  1D9S A;  3QJZ A;  1K1A A;  4E6H A;  4N3C A;  5G55 A;  4GYO A;  1S64 A;  4YDO A;  3NBN B;  3MJW A;  4MS6 A;  4U07 A;  4HRN A;  4KZC A;  2AXU A;  4DRX E;  5FTP A;  3C98 A;  3ASF A;  1YA0 A;  4DLO A;  4A3V A;  4B8A A;  3Q78 A;  2Y4T A;  3SBS A;  3SI5 A;  5CEA A;  1IHG A;  1V55 E;  1E8W A;  1U2V G;  5G05 C;  5AJD A;  4CYM D;  2UWJ G;  1D8E A;  4BFR A;  2OCC E;  2B6C A;  3TG5 A;  1IYG A;  3E34 A;  2XEH A;  4J0U A;  4IUL A;  3EHR A;  3CVW A;  4FUL A;  2I9C A;  4I9E A;  1TN6 A;  2IO2 C;  3E37 A;  2NXP A;  5CRU A;  3B7R L;  4UQX A;  3UUX A;  2PQN A;  1QYM A;  1A17 A;  4GYW A;  4BTA A;  3TGO A;  3FFL A;  5KJN A;  5FZS A;  1DVP A;  4RQI A;  3L08 A;  1FT2 A;  1K1B A;  3MA5 A;  3MKR A;  4UQZ A;  3BG1 B;  3UM1 A;  1P5Q A;  3SBT B;  2KCK A;  4TUM A;  3D9K A;  3S7D A;  4I1A A;  1YYH A;  3BQO A;  1HX8 A;  3DSU A;  1SVX A;  2QYJ A;  4EZL A;  2KBX A;  2C0M A;  4ZFH A;  4LNB A;  2QFC A;  3Q9N C;  4G24 A;  3W9G A;  2XZD G;  1OT8 A;  2JEK A;  2XEE A;  5KWD A;  3G2S A;  2LAI A;  3DRA A;  3QWW A;  4HOQ A;  1MX4 A;  3JQ0 A;  4FHJ A;  5EID A;  3DSV A;  5EX0 A;  2LO6 A;  4MLP A;  4GTV A;  3EIQ C;  4U96 D;  1MJ0 A;  5T4Y A;  5AIJ A;  3FP3 A;  2AVP A;  1LD7 A;  1NL4 A;  1TNZ A;  3PZ1 A;  4LNU D;  4BER A;  3Q9U C;  5ANR A;  2ETB A;  2ZIS A;  2QZA A;  5D2M C;  3LXU X;  2P9P G;  3B7T A;  2UY1 A;  2Y69 E;  3CHS A;  3PZ2 A;  3KD7 A;  2OV8 A;  3CLJ A;  1KZP A;  1ZBP A;  5CER B;  3BU8 A;  1N4P A;  1SZA A;  2X6J A;  4KBQ A;  3FUF A;  4ANX A;  2WM9 A;  3P2B A;  4GCO A;  3S7J A;  3T5V A;  3Q75 A;  2DVW A;  3FTV A;  3S7B A;  4GA1 A;  3S2A A;  3R7Q A;  4K5A B;  4GMJ A;  5E76 A;  3R9M A;  3ASN E;  4BT9 A;  5IY5 E;  4IN3 B;  4A1G A;  3Q15 A;  3QB2 A;  1TNO A;  3RKV A;  4B94 A;  3G2V A;  1XGW A;  3IBE A;  3ABM E;  3ESL A;  2GRO B;  3KS2 A;  2P9K G;  2J08 A;  4O1P A;  1TNU A;  2R5S A;  1KZO A;  2XPY A;  2P9U G;  4V3I A;  3CK7 A;  4KVM A;  2F8Y A;  3PZD A;  4IRU A;  4ANV A;  4UWF A;  2V8S E;  2Y4U A;  3GYZ A;  2J09 A;  2MRI A;  1UN9 A;  3HG0 D;  3ZYL A;  4AY6 A;  1K3Z D;  2X6K A;  3L13 A;  4HOS A;  4A63 B;  2L9B A;  4BES A;  5G04 C;  5FIN A;  3AG1 E;  3CHP A;  1OCO E;  3SNX A;  2ZGG A;  2WQH A;  5CHE E;  3FDH A;  3J5Q B;  3ZXS A;  5LFA A;  3Q4A B;  4B89 A;  3E33 A;  1GW6 A;  1Z3X A;  1NA3 A;  2ION A;  4WWN A;  5FT9 A;  3MZL B;  3Q49 B;  4TV3 A;  3RK6 A;  3GZ1 A;  1JCR A;  4CCA A;  3FEY A;  3D9J A;  3CVL A;  1TYQ G;  2LSU A;  3TWT A;  3L16 A;  4WNF A;  2WXQ A;  1NZN A;  4A1S A;  4GZ5 A;  1BI8 B;  5ENS D;  3FTU A;  4GZC A;  5H7P A;  4JZY A;  1K8K G;  3BG0 B;  3Q7A A;  5BW8 C;  2EIM E;  3BEE A;  5T8I A;  3FTY A;  4DI4 A;  5LCW J;  2QY7 A;  5C2Y A;  3ZIM A;  2NYJ A;  3AS4 A;  3SO8 A;  3ZRH A;  3L6A A;  3CKB A;  3L82 A;  1OCR E;  4CRW A;  2WXN A;  1O1S A;  2HM8 A;  4HS2 A;  4PH4 B;  5D0Q D;  2VYI A;  4BX8 A;  1HS6 A;  3EHM A;  1N11 A;  2JAB A;  1N0R A;  3FUD A;  4C48 B;  4U8H A;  3SFY A;  1OCC E;  5A7D B;  3HVE B;  3RJV A;  3CV0 A;  4A3T A;  3KSQ A;  3CHO A;  2LUH A;  2AW6 A;  5EIB E;  3R9A B;  1WY6 A;  4HRM B;  3F6Q A;  3SF4 A;  4AEZ C;  2H6G A;  1N94 A;  1V54 E;  1EYH A;  1YCS B;  4P29 A;  2GRM A;  2J4B A;  3W9F A;  4ATZ D;  4X8Q A;  4DJA A;  3AG4 E;  4APF A;  3QC1 A;  2M63 A;  2DYR E;  4PUC A;  3HRA A;  3EIJ A;  4GZ3 A;  4TXQ A;  4ABN A;  5BV0 A;  1TJF A;  4J6I A;  5LP0 A;  5G05 J;  4JHK A;  3DPD A;  2NSZ A;  4L1B A;  1D8D A;  3DSW A;  3APF A;  2IQC A;  2GRQ B;  2IOS A;  4LUN U;  2RFA A;  3FH8 A;  4PS8 A;  2LXM A;  4AV7 A;  2ETC A;  4U63 A;  3HXE A;  3LVR E;  2PNN A;  4U7E B;  3KEZ A;  4F6R D;  4GTQ A;  4JL0 A;  3ZVV A;  5AN8 A;  4GA2 A;  4K0R A;  5LX8 A;  2ZXW E;  2DZO A;  1E96 B;  3TXM A;  4NRH B;  5CMY A;  1OUV A;  2E2E A;  3B13 A;  3C72 A;  2PM6 A;  1SZ9 A;  3UMV A;  3D9M A;  4JPS A;  1XNF A;  3NQP A;  1BPO A;  5ARG A;  2GRP B;  5CCL A;  3CHM A;  4J8S A;  1ZB1 A;  2OEV A;  4GA0 A;  4DLQ A;  3I3N A;  4RLY A;  3ZGQ A;  4FLH A;  4GCN A;  2ETA A;  3IHV A;  2XGO A;  4K03 A;  2XZT G;  4ZHB A;  4URK A;  4YDE A;  3IHY A;  3LCA A;  1UN8 A;  3MKQ B;  4L2Y A;  4GPM A;  2I1K A;  2WXL A;  4UWH A;  3PE4 A;  3CGH A;  1FT1 A;  1SA5 A;  4M7C A;  3AS8 A;  3D9O A;  4KVO A;  1H6O A;  1QQE A;  1U3D A;  5EN5 D;  3P1U A;  4B0Z A;  2FF4 A;  2XGS A;  4N39 A;  4J8F A;  4I6J A;  3I4R B;  4J7W A;  3TWW A;  1INZ A;  2KZT B;  1NA0 A;  4U0S A;  3RRN B;  2WXK A;  1DCQ A;  3BUA A;  2PL2 A;  4I2Z A;  2OVB A;  2GRN B;  1KPS B;  2XCB A;  4YND A;  3RRU A;  4WNG A;  4AM9 A;  3T5X A;  2IFU A;  4E85 A;  3TAX A;  3EJN A;  3KAE A;  3ML8 A;  3FUI A;  4ME2 A;  4LEU A;  1NP7 A;  2J07 A;  2VGX B;  3ABK E;  4EZJ A;  4HRL A;  3FU5 A;  4ANU A;  1QZ2 A;  3RSE G;  1N9A A;  2CHZ A;  3QWP A;  2R2L A;  5CBN A;  2YIN A;  2WPV A;  3DXK G;  4HNA D;  2GW1 A;  1FVH A;  2EIN E;  3ZUV B;  3LY7 A;  3JXJ A;  2YHC A;  1Z5S C;  3LDZ A;  4U0U A;  5CRV A;  3UIN C;  4FHK A;  3LKU A;  3CVY A;  4GTR A;  3V2O A;  2X3M A;  3JQ1 A;  4A55 A;  3AAA C;  3JXI A;  4GTO A;  1BD8 A;  3PNL B;  5BV1 A;  3MGB A;  4HOR A;  4RVB A;  1TN7 A;  4EHM A;  3IEG A;  3CHQ A;  4CDR A;  2L6B A;  3AG3 E;  1N4Q A;  3S7F A;  3GZS A;  1MQS A;  1O1R A;  3JUI A;  3CVP A;  1OWM A;  5G04 J;  4XIF A;  5AQB A;  2WMO A;  4L2L A;  3Q73 A;  2IY0 C;  3G2T A;  4O1O A;  2KCL A;  3PEU B;  1MHQ A;  2HYZ A;  3CQG B;  3TJP A;  3VLD A;  3QKY A;  5D66 A;  4GPK A;  5BXO A;  3L22 A;  3SQV A;  2VTB A;  1ELW A;  4ATG A;  3CK8 A;  2ILR A;  1OY3 D;  3E30 A;  4GTT A;  1DCE A;  1N4R A;  2E0I A;  4XKB A;  4LNG A;  5FIO A;  1UJJ A;  3SHF A;  2AWI A;  4AY5 A;  4F7A A;  4Y6W A;  4DPR A;  4XE0 A;  4I9C A;  4LG6 A;  2EIL E;  4N2S A;  4QQI A;  2LXL A;  4G11 A;  2WMN A;  1HFA A;  5E75 A;  5KBA A;  5JJT A;  1KLX A;  4LSZ E;  3C3Q A;  4YVQ C;  1BI7 B;  4H7Y A;  2WXR A;  3OAW A;  4EPZ A;  3K9I A;  2IU1 A;  2UY1 B;  3TWU A;  2HE0 A;  4GYY A;  5BNW A;  4HVB A;  1FVF A;  3MEK A;  2V4L A;  3PH0 C;  4NAC A;  3U4T A;  3UIP C;  1NI1 A;  5AYW D;  4CDN A;  3FUM A;  3CKC A;  1LF8 A;  3HXB A;  1LD8 A;  4ACK A;  4MRU A;  2VSO E;  2H6F A;  2GGF A;  3FUE A;  3RAU A;  2XPZ A;  5BPP A;  3ASO E;  4N3A A;  1UJK A;  2P9S G;  4EEC A;  1FCH A;  3ONK A;  3TG4 A;  4GZD A;  4UI9 K;  4BEP A;  2Y1L E;  4JHJ A;  3GW4 A;  4G1T A;  4KT6 B;  3E4B A;  3O4Z A;  4C9B B;  3GZ2 A;  4JVS A;  2XHE A;  3UKR G;  3PUK A;  1IKN D;  3FTW A;  4Z68 A;  3FTZ A;  2WQ7 A;  2XEV A;  3D9N A;  4UQY A;  3QNK A;  3TXN A;  2VSY A;  4RG9 A;  2J9Q A;  3C3R A;  4DUI A;  1IXV A;  3G2W A;  4GZ6 A;  3WG7 E;  3HYM B;  2EIK E;  3LPZ A;  4DK5 A;  4NQ0 A;  2HR2 A;  3SY2 A;  5CBO A;  3HDX A;  3LEW A;  3LS8 A;  4J8E A;  2IJG X;  3OTN A;  1Z6T A;  2EIJ E;  1DNP A;  1ZU2 A;  4I2W A;  4MKT A;  4U8V D;  3SD5 A;  4BTB A;  2CG3 A;  5JJ7 A;  4C0M A;  1OWN A;  4DI3 A;  3CHR A;  1A5E A;  4ANW A;  3ZEF A;  1KT1 A;  3CSF A;  4GMR A;  2YHE A;  3ZXP A;  2XEN A;  4CT0 A;  2BF0 X;  3FUN A;  1H6K A;  5BT1 A;  4I17 A;  2PM7 A;  2XRZ A;  2AXV A;  5BXU A;  2V0P A;  2X6H A;  2AJA A;  4WWP A;  5EIL A;  4AIF A;  3PE3 A;  3LY8 A;  2WXO A;  2CHW A;  5G2N A;  3FU0 A;  3U64 A;  3EHQ A;  2KM4 A;  1HE8 A;  3PZ4 A;  5EX3 A;  2WXJ A;  1OWO A;  4I43 A;  4BX9 A;  4YVO A;  4CDM A;  4Q69 A;  4DX5 D;  5ENQ D;  4G2V A;  2WXF A;  2XPI A;  3PVL A;  1PAQ A;  2WXI A;  1TJC A;  3MV3 B;  1HO8 A;  4FLB A;  4UWL A;  3MYV A;  2I2O A;  3IV0 A;  4U0Z A;  3ZHE B;  2NC9 A;  3OXG A;  5KNH D;  2V4H C;  1TR4 A;  2P58 C;  5FWQ A;  3CVX A;  3UXG A;  4EBA G;  3KEA A;  3R7R A;  4JHR A;  2Q7F A;  4I6E A;  4GTP A;  2MHK A;  3G2U A;  3CVN A;  4TRQ A;  2P9I G;  4FJZ A;  3UTM A;  3ZPJ A;  3AU5 A;  2Y0B G;  3CK9 A;  2IEJ A;  4BET A;  1AP7 A;  4HB5 A;  4PDX A;  5C1D A;  2LNI A;  3SGH A;  4Q96 A;  3FWV A;  3ZHE A;  1WDY A;  2P9N G;  3DBS A;  2YQ8 A;  4ILG A;  1OWL A;  1HG2 A;  2H6I A;  4OYS A;  4DX7 D;  3FTX A;  4U8Y D;  4LER A;  1EF1 C;  3B7U X;  4RSY A;  2XS1 A;  4KXK B;  4FA6 A;  3UI2 A;  4M3O A;  1AWC B;  4G8K A;  4BWR A;  1HH8 A;  3RO3 A;  1UG3 A;  4HLL A;  1JCQ A;  3CVQ A;  4ILH B;  5AAO A;  3ZKJ A;  3N71 A;  3NOC D;  4UI9 J;  2P9L G;  2V5Q C;  4GML A;  3VLF A;  4F53 A;  4O6F A;  4C0E A;  4BY6 A;  2CFZ A;  3SFZ A;  2CHX A;  5ENT D;  1TEZ A;  1W3B A;  4WND A;  3MCX A;  2DWZ A;  4XX5 A;  4JXT A;  2X6F A;  4JA7 A;  4ILI A;  1N52 A;  1UW4 B;  2KXP C;  3ZYQ A;  2AXZ A;  2RG8 A;  1E90 A;  1RZ4 A;  3T8K A;  4BSZ B;  4HOU A;  4IYP A;  4UWK A;  1U3C A;  3ZW3 A;  1JWF A;  5EYP F;  1L5J A;  1E8Y A;  4QFV A;  5FQ6 A;  4K5B A;  2V5F A;  1X81 A;  2VQ2 A;  4YDY A;  3CVV A;  4G23 A;  3UT8 A;  3OXF A;  4DX6 D;  1IHB A;  3ONL A;  2C2L A;  3FH7 A;  4XKC A;  4F1P A;  4AXH A;  3VTX A;  3C3O A;  4N5Q A;  1ELR A;  2H6H A;  4TXP A;  1DC2 A;  5M72 A;  3JUE A;  4OVU A;  2RKK A;  3NZU A;  4PS7 A;  3UM0 A;  2LAH A;  2BUG A;  4F1S A;  3CST A;  3ULQ A;  1Y8M A;  3UM3 A;  3Q79 A;  4XZ4 A;  3EUV A;  4O60 A;  3V31 A;  1JUQ A;  3RRM B;  1S63 A;  5AJL A;  1N4S A;  3B7S A;  3FUJ A;  1JWG A;  3UM2 A;  4H7X A;  5AQA A;  4CT4 A;  3CEQ A;  4PS3 A;  3VTY A;  2F37 A;  4N3B A;  5ENR D;  2R03 A;  1H19 A;  3DEP A;  3IKO B;  1YMP A;  3DXM G;  2J4D A;  3MV2 B;  3DPY A;  3TWX A;  1WM5 A;  4W9R A;  2I6H A;  4HI9 A;  1JPL A;  2R17 C;  1S0P A;  3QOU A;  4GAA A;  1MZC A;  2GRR B;  3LJ3 A;  4RG6 A;  4B93 B;  1MX6 A;  3ZYK A;  3CIA A;  5JMN D;  3DSS A;  3FU6 A;  3FH5 A;  1S70 B;  3DWL G;  2KC7 A;  1HXI A;  2B0O E;  3QK0 A;  4APO A;  5AQ7 A;  4JEU A;  4HI8 A;  2BED A;  3ZFW A;  2VGY A;  4KMO A;  2DIW A;  4EBA A;  4HBD A;  2LSV A;  4JD2 G;  2PQR A;  1FPP A;  2RFM A;  4CEM A;  4Q94 A;  3JCK C;  1E7V A;  3IXE A;  1LTX A;  3L54 A;  3FTS A;  4WNE A;  3V30 A;  3ABL E;  5LOZ A;  2HO1 A;  5ARF A;  4CZ2 D;  5CCM A;  4EZK A;  3V79 K;  2F8X K;  2VTB B;  3LY9 A;  3D9P A;  1O5M A;  4K5C A;  1HG5 A;  2FO1 E;  3RU0 A;  5AEN A;  1G3N B;  1VDY A;  3APC A;  3AJI A;  4U95 D;  2A4Z A;  3T9K A;  3HIZ A;  4U04 A;  1UOH A;  2VSN A;  1IQR A;  3EHN A;  4LRZ A;  3NOG D;  1N0Q A;  5FZQ A;  3RIB A;  5EDS A;  3O48 A;  3MKQ A;  5HS0 A;  2BKK B;  2XQ0 A;  3HXC A;  3D3M A;  4LCT A;  3WXX A;  1Y6I A;  2C0L A;  3ENE A;  4HOT A;  3B7B A;  2J49 A;  2QC9 A;  4GTS A;  2ZGD A;  3ML9 A;  5AAR A;  2FO7 A;  1RW2 A;  2IOL A;  3AS5 A;  2FUL A;  2VGX A;  5D0O D;  5JHB A;  3D9I A;  4YDW A;  3NB2 A;  2X6I A;  3NZS A;  3UIO C;  3TWS A;  2GRL A;  4D10 C;  3DEO A;  3X2Q E;  1IQU A;  4TXR A;  2FI7 A;  3I5P A;  4XI9 A;  3QWV A;  2R05 A;  5ENO D;  3U9W A;  5ENN A;  3I4G A;  3EU9 A;  3QDN A;  1OWP A;  1WG0 A;  2ZU6 B;  1NFI E;  3Q5M A;  2VSX E;  1N54 A;  3TWR A;  4MBG A;  2DYS E;  2P2C P;  2MYO A;  5KNG A;  4BSX A;  3PRZ A;  1H6P A;  3PS6 A;  4HLE A;  5FQ7 A;  4GU5 A;  3ASG A;  4DX1 A;  4I6G A;  3DST A;  3UQ3 A;  5A23 A;  5ENP D;  2OVF A;  3DSX A;  3ZN3 A;  3FHE A;  3PZ3 A;  4OVV A;  1QBQ A;  3LJN A;  4GB9 A;  5KJL A;  4FP7 A;  5FZR A;  4Y6C A;  1HZ4 A;  3L9T A;  3Q7F A;  3ULE G;  5KJM A;  2WVI A;  1Q2Z A;  3AU4 A;  4N2Q A;  3SFX A;  1HU3 A;  2Y3A A;  1JCS A;  4G25 A;  4JEH A;  5B3S E;  5CEC B;  4AP2 A;  2OEW A;  5FQ8 A;  1TNB A;  5J90 A;  3ZNG A;  2CG2 A;  5HRY A;  3TWV A;  1MX2 A;  4OAU C;  2QYU A;  3J5P A;  4UI9 C;  4WWO A;  2KCV A;  3AG2 E;  5T3R A;  2BTD A;  2DCP A;  2VJ8 A;  2ZIR A;  2WXG A;  5JA4 D;  3FUK A;  2XGM A;  2WXP A;  5CMW A;  2CFU A;  5JHA A;  3FU3 A;  2OOE A;  4TUU A;  2IO3 C;  4KZ0 A;  2R02 A;  4I1M A;  3URZ A;  1E8Z A;  1N95 A;  3FEX A;  3UX4 A;  1H2U A;  3QAQ A;  3EU5 A;  3UT4 A;  1SW6 A;  3UT7 A;  3B95 A;  4AJW A;  5KCM A;  1E8X A;  4L7T A;  3V2X A;  4J8D A;  2YNQ A;  3APD A;  2EQX A;  3C5R A;  2A5E A;  2R59 A;  1H0A A;  3ZU7 B;  3E32 A;  3UPV A;  3HXD A;  5A6C A;  1E7U A;  4L23 A;  2MOW A;  2OND A;  4OAV B;  2XS8 A;  4J8Y A;  3FUL A;  2FBN A;  1O1T A;  5FQ4 A;  1BU9 A;  4NIK A;  1QNF A;  4BT8 A;  3HXF A;  3NAW A;  4WAF A;  2KAT A;  3TWQ A;  5DIZ A;  2PZI A;  1Z3Y A;  2L6J A;  5KJK A;  3ASD A;  5EYL A;  3FUH A;  3HVE A;  3PNT B;  1SA4 A;  4N5C A;  3L17 A;  1WAO 1;  3D9H A;  3QAR A;  3CQC B;  1H2V C;  3U66 A;  5EKQ D;  1X5B A;  2DBA A;  2DZN A;  4FC8 A;  1OCZ E;  4F3V A;  4I1O B;  5BUZ A;  1HF8 A;  2RD0 A; 
#chains in the Genus database with same CATH homology
 5CHE E;  3FDH A;  4XZ4 A;  3SHF A;  2AWI A;  3ZXS A;  4AY5 A;  5LFA A;  3Q4A B;  4B89 A;  1JUQ A;  3PUJ A;  3RRM B;  4F7A A;  4Y6W A;  5HI7 A;  4DPR A;  3Q47 B;  5AJL A;  4XE0 A;  1GW6 A;  1Z3X A;  3B7S A;  3FUJ A;  4I9C A;  1JWG A;  1NA3 A;  2ION A;  4H7X A;  4N2S A;  2IF4 A;  4CT4 A;  3ESK A;  3CEQ A;  4PS3 A;  4WWN A;  3VTY A;  5FT9 A;  5ANL A;  2WQ6 A;  4G11 A;  4N3B A;  4B8C B;  2WMN A;  1HFA A;  3MZL B;  4ACL A;  1H19 A;  3Q49 B;  4TV3 A;  4FU3 A;  5E75 A;  3RK6 A;  3GZ1 A;  5JJT A;  4FJY A;  3IKO B;  1KLX A;  4CCA A;  2WXM A;  4YVQ C;  4EQF A;  2J4D A;  4H7Y A;  3PDN A;  3SZ7 A;  3MV2 B;  3FEY A;  3TL5 A;  5HQ8 A;  1WM5 A;  3D9J A;  4W9R A;  2WXR A;  3CVL A;  3OAW A;  2KZT A;  2LSU A;  3K9I A;  4UWG A;  4EPZ A;  2I6H A;  2JLB A;  3L16 A;  4WNF A;  2WXQ A;  1NZN A;  2IU1 A;  2UY1 B;  4NUR A;  1JPL A;  4A1S A;  2R17 C;  1S0P A;  4GZ5 A;  3QOU A;  4GAA A;  4CGW A;  2X38 A;  3FTU A;  4GZC A;  3LJ3 A;  4RG6 A;  3VLE A;  4JZY A;  4GYY A;  5BNW A;  2A5U A;  3CR3 A;  3BG0 B;  3ZYK A;  4HVB A;  3CIA A;  5BW8 C;  4AVX A;  3BEE A;  1FVF A;  3MEK A;  5T8I A;  3FTY A;  2V4L A;  4DI4 A;  5LCW J;  3PH0 C;  1ELK A;  3OXL A;  2QY7 A;  5C2Y A;  3ZIM A;  3AS4 A;  4NAC A;  3U4T A;  4CGV A;  3ZRH A;  4FAD A;  3L6A A;  2FEZ A;  3FU6 A;  5J08 A;  3FH5 A;  3CKB A;  2KC7 A;  5AYW D;  4CDN A;  1HXI A;  3FUM A;  3QK0 A;  3CKC A;  1LF8 A;  4CRW A;  3NF1 A;  2WXN A;  2HM8 A;  4HS2 A;  4PH4 B;  4APO A;  3PRE A;  5D0Q D;  3FY4 A;  4ACK A;  4MRU A;  2VYI A;  2VSO E;  4BX8 A;  3U3W A;  4HXI A;  4JEU A;  2GGF A;  3FUE A;  1HS6 A;  2VGY A;  3ZFW A;  4JC8 A;  4KMO A;  2XPZ A;  2DIW A;  3EHM A;  5BPP A;  1SQM A;  4WUY A;  4EBA A;  4G26 A;  3LVQ E;  4N3A A;  1UJK A;  2LSV A;  1H2T C;  3PEV B;  2PQR A;  3LYA A;  1EDU A;  3EDT B;  4EEC A;  3FUD A;  1FCH A;  3ONK A;  2WXH A;  2XRY A;  4JA9 A;  3TG4 A;  4GZD A;  4U8H A;  4UI9 K;  4JHJ A;  1EPU A;  1PC2 A;  3GW4 A;  1B89 A;  3ASH A;  4G1T A;  4KT6 B;  5A7D B;  3E4B A;  3O4Z A;  3HVE B;  2I1J A;  4JW1 A;  3GZ2 A;  3RJV A;  3RO2 A;  4C9B B;  4CEM A;  3D9L A;  4JVS A;  2XHE A;  4Q94 A;  5LCW C;  3CV0 A;  5FJY A;  2WB2 A;  3JCK C;  1E7V A;  3HHM A;  4A3T A;  3L54 A;  3PUK A;  3FTS A;  3CHO A;  4XI0 A;  1KT0 A;  4R7L A;  2AW6 A;  4WNE A;  3R9A B;  1WY6 A;  3CVU A;  3FTW A;  3JYS A;  4KYO B;  3FTZ A;  3MX3 A;  3SF4 A;  3T8M A;  2XCC A;  5LOZ A;  2WQ7 A;  4HFG A;  2HO1 A;  2XEV A;  3D9N A;  4AEZ C;  5ARF A;  5JJ6 A;  5CCM A;  4EZK A;  3ZYM A;  4UQY A;  2VTB B;  2L0T B;  1EYH A;  3LY9 A;  3D9P A;  5DBK A;  4P29 A;  2GRM A;  2J4B A;  4AOF A;  3QNK A;  1PY1 A;  1HG5 A;  2L0I A;  4DJA A;  3RU0 A;  4APF A;  3QC1 A;  3TXN A;  2M63 A;  5AEN A;  3QJZ A;  1VDY A;  2VSY A;  4PUC A;  3APC A;  3EIJ A;  4GZ3 A;  2A4Z A;  4RG9 A;  4ABN A;  3HIZ A;  2J9Q A;  4E6H A;  4N3C A;  5G55 A;  4U04 A;  4GYO A;  5BV0 A;  2VSN A;  1TJF A;  1IQR A;  3EHN A;  3G2W A;  4GZ6 A;  4J6I A;  4LRZ A;  5LP0 A;  3MJW A;  4MS6 A;  3HYM B;  4U07 A;  3LPZ A;  5G05 J;  5FZQ A;  3RIB A;  5EDS A;  4KZC A;  4DK5 A;  4JHK A;  3DPD A;  3O48 A;  3MKQ A;  2AXU A;  4NQ0 A;  2NSZ A;  5FTP A;  3C98 A;  3ASF A;  2HR2 A;  4L1B A;  3HDX A;  2XQ0 A;  3APF A;  2IQC A;  3D3M A;  3LEW A;  2IOS A;  3LS8 A;  1YA0 A;  4LUN U;  4J8E A;  4DLO A;  4LCT A;  4A3V A;  4B8A A;  2IJG X;  3FH8 A;  3OTN A;  4PS8 A;  1Z6T A;  3WXX A;  2Y4T A;  1Y6I A;  2C0L A;  3ENE A;  4AV7 A;  4HOT A;  1DNP A;  2J49 A;  1ZU2 A;  4I2W A;  4U63 A;  4MKT A;  3SD5 A;  3SBS A;  3LVR E;  4BTB A;  3SI5 A;  3ML9 A;  3KEZ A;  2CG3 A;  2FO7 A;  5JJ7 A;  4C0M A;  1OWN A;  4JL0 A;  4DI3 A;  1IHG A;  3CHR A;  4ANW A;  2IOL A;  1KT1 A;  3ZEF A;  1E8W A;  3AS5 A;  3CSF A;  3ZVV A;  5G05 C;  2FUL A;  2VGX A;  2YHE A;  5D0O D;  5JHB A;  5AJD A;  3D9I A;  4CT0 A;  4GA2 A;  4K0R A;  2BF0 X;  5LX8 A;  3FUN A;  1H6K A;  2X6I A;  3NZS A;  5BT1 A;  2UWJ G;  4I17 A;  4BFR A;  1E96 B;  2PM7 A;  2XRZ A;  2AXV A;  3TG5 A;  3TXM A;  1IYG A;  4NRH B;  2GRL A;  2V0P A;  2X6H A;  4J0U A;  5CMY A;  4D10 C;  1OUV A;  1IQU A;  4IUL A;  2FI7 A;  2E2E A;  3I5P A;  3B13 A;  3CVW A;  4WWP A;  2PM6 A;  4FUL A;  1SZ9 A;  4XI9 A;  3QWV A;  3UMV A;  3D9M A;  4JPS A;  4AIF A;  2I9C A;  3PE3 A;  3U9W A;  5ENN A;  3LY8 A;  4I9E A;  1XNF A;  3I4G A;  3QDN A;  2NXP A;  1OWP A;  2WXO A;  3NQP A;  1BPO A;  2CHW A;  5ARG A;  3B7R L;  5CCL A;  3CHM A;  4J8S A;  3FU0 A;  4UQX A;  4GA0 A;  5G2N A;  3UUX A;  2ZU6 B;  3U64 A;  4DLQ A;  3I3N A;  2KM4 A;  1HE8 A;  2PQN A;  5EX3 A;  2WXJ A;  3ZGQ A;  1A17 A;  4GYW A;  1OWO A;  4FLH A;  4BTA A;  3FFL A;  3TGO A;  3Q5M A;  5KJN A;  4I43 A;  2VSX E;  5FZS A;  1DVP A;  1N54 A;  4GCN A;  3IHV A;  2XGO A;  3L08 A;  4K03 A;  4BX9 A;  4YVO A;  4BSX A;  3MA5 A;  4CDM A;  3MKR A;  3PRZ A;  4UQZ A;  4Q69 A;  1UJJ A;  4URK A;  4G2V A;  2WXF A;  3PS6 A;  2XPI A;  3PVL A;  1PAQ A;  4HLE A;  5FQ7 A;  2WXI A;  3BG1 B;  3IHY A;  3LCA A;  4GU5 A;  3ASG A;  1UN8 A;  1P5Q A;  3MKQ B;  4I6G A;  3UQ3 A;  3SBT B;  1TJC A;  2KCK A;  3MV3 B;  1HO8 A;  4L2Y A;  5A23 A;  2OVF A;  2I1K A;  4FLB A;  2WXL A;  4UWL A;  4UWH A;  3PE4 A;  3MYV A;  3ZN3 A;  3CGH A;  3D9K A;  3FHE A;  4OVV A;  2I2O A;  3IV0 A;  3AS8 A;  3D9O A;  4GB9 A;  4U0Z A;  5KJL A;  3ZHE B;  4FP7 A;  3S7D A;  4KVO A;  4I1A A;  5FZR A;  1QQE A;  2NC9 A;  4Y6C A;  1HZ4 A;  3OXG A;  1HX8 A;  1U3D A;  2P58 C;  3P1U A;  4B0Z A;  5FWQ A;  2FF4 A;  2XGS A;  5KJM A;  2WVI A;  4N39 A;  4J8F A;  3CVX A;  4EBA G;  4EZL A;  4I6J A;  3I4R B;  3AU4 A;  3R7R A;  4N2Q A;  2C0M A;  4JHR A;  1INZ A;  2QFC A;  2Q7F A;  1HU3 A;  2Y3A A;  4G25 A;  4I6E A;  4JEH A;  4G24 A;  2KZT B;  2MHK A;  3G2U A;  4AP2 A;  1NA0 A;  3CVN A;  4TRQ A;  4U0S A;  3RRN B;  2JEK A;  4FJZ A;  5FQ8 A;  3G2S A;  2WXK A;  5J90 A;  3ZPJ A;  3AU5 A;  2LAI A;  2PL2 A;  3CK9 A;  4I2Z A;  2CG2 A;  2OVB A;  2XCB A;  4PDX A;  3QWW A;  4YND A;  4HOQ A;  2LNI A;  3SGH A;  4UI9 C;  3RRU A;  4WNG A;  4WWO A;  5C1D A;  4AM9 A;  3JQ0 A;  4FHJ A;  3T5X A;  4Q96 A;  3FWV A;  2IFU A;  2KCV A;  3ZHE A;  4E85 A;  3DBS A;  4ILG A;  2YQ8 A;  5EX0 A;  5T3R A;  2LO6 A;  1OWL A;  2BTD A;  4MLP A;  3EIQ C;  1HG2 A;  3EJN A;  3KAE A;  2DCP A;  3TAX A;  2VJ8 A;  5T4Y A;  5AIJ A;  3FP3 A;  2AVP A;  4OYS A;  3ML8 A;  3FUI A;  3FTX A;  2WXG A;  4LER A;  3FUK A;  1EF1 C;  4ME2 A;  3B7U X;  1NP7 A;  2J07 A;  4LEU A;  2XGM A;  2VGX B;  4RSY A;  5ANR A;  2WXP A;  5CMW A;  2CFU A;  4EZJ A;  4KXK B;  4FA6 A;  3FU5 A;  4ANU A;  5JHA A;  1QZ2 A;  3FU3 A;  2OOE A;  4TUU A;  4M3O A;  2CHZ A;  3LXU X;  4KZ0 A;  3QWP A;  4I1M A;  4BWR A;  3URZ A;  1HH8 A;  2YIN A;  2WPV A;  3B7T A;  2UY1 A;  2GW1 A;  1FVH A;  3CHS A;  1E8Z A;  3FEX A;  3RO3 A;  3KD7 A;  3UX4 A;  1UG3 A;  2OV8 A;  3CLJ A;  3LY7 A;  1H2U A;  3QAQ A;  2YHC A;  3CVQ A;  4ILH B;  3N71 A;  3LDZ A;  4U0U A;  4UI9 J;  3UT4 A;  1ZBP A;  3UT7 A;  4GML A;  3VLF A;  4F53 A;  4AJW A;  4O6F A;  5KCM A;  4C0E A;  1SZA A;  2X6J A;  4KBQ A;  1E8X A;  3FUF A;  4ANX A;  4L7T A;  2WM9 A;  4BY6 A;  2CFZ A;  3SFZ A;  3P2B A;  2YNQ A;  2CHX A;  3APD A;  4GCO A;  4FHK A;  4J8D A;  3S7J A;  2EQX A;  3LKU A;  1TEZ A;  3T5V A;  3CVY A;  1W3B A;  2R59 A;  1H0A A;  4WND A;  3MCX A;  3UPV A;  2X3M A;  4XX5 A;  5A6C A;  3FTV A;  3S7B A;  4GA1 A;  4JXT A;  3JQ1 A;  3S2A A;  3R7Q A;  4A55 A;  1E7U A;  4L23 A;  2X6F A;  4GMJ A;  4JA7 A;  5E76 A;  2MOW A;  2OND A;  4ILI A;  3PNL B;  5BV1 A;  3MGB A;  3FUL A;  4HOR A;  4BT9 A;  1N52 A;  4RVB A;  1UW4 B;  3IEG A;  3Q15 A;  4IN3 B;  4A1G A;  3CHQ A;  3QB2 A;  4CDR A;  3ZYQ A;  3RKV A;  4B94 A;  3G2V A;  2AXZ A;  2FBN A;  1XGW A;  2RG8 A;  3IBE A;  3ESL A;  3S7F A;  1E90 A;  3GZS A;  3KS2 A;  5FQ4 A;  1MQS A;  3JUI A;  3CVP A;  2J08 A;  1OWM A;  5G04 J;  4XIF A;  2WMO A;  4L2L A;  2R5S A;  1QNF A;  2XPY A;  4HOU A;  4IYP A;  4UWK A;  4V3I A;  1U3C A;  3ZW3 A;  1JWF A;  4BT8 A;  1L5J A;  3CK7 A;  1E8Y A;  4KVM A;  4QFV A;  5FQ6 A;  2V5F A;  2VQ2 A;  4WAF A;  3G2T A;  2KCL A;  3PZD A;  3PEU B;  2KAT A;  3CVV A;  4G23 A;  1MHQ A;  4IRU A;  2HYZ A;  5DIZ A;  2PZI A;  3OXF A;  3UT8 A;  4ANV A;  4UWF A;  3CQG B;  2V8S E;  1Z3Y A;  2L6J A;  5KJK A;  2Y4U A;  3TJP A;  3ASD A;  3ONL A;  3FUH A;  3VLD A;  3GYZ A;  2J09 A;  2C2L A;  2MRI A;  3HVE A;  3QKY A;  3FH7 A;  3PNT B;  4GPK A;  4XKC A;  4N5C A;  3L17 A;  1WAO 1;  3QAR A;  4AXH A;  3CQC B;  3VTX A;  1UN9 A;  3L22 A;  1H2V C;  1ELR A;  3ZYL A;  3U66 A;  4AY6 A;  2VTB A;  5EKQ D;  1X5B A;  2X6K A;  1ELW A;  3L13 A;  4HOS A;  5M72 A;  3CK8 A;  4OVU A;  4ATG A;  2DBA A;  2ILR A;  4FC8 A;  3NZU A;  2L9B A;  4PS7 A;  4F3V A;  4I1O B;  5G04 C;  2LAH A;  3CHP A;  2E0I A;  5BUZ A;  3SNX A;  2BUG A;  4XKB A;  2WQH A;  1HF8 A;  4F1S A;  2RD0 A;  3CST A;  3ULQ A;  1Y8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...