4A1GA

The crystal structure of the human bub1 tpr domain in complex with the ki motif of knl1
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
146
structure length
146
Chain Sequence
DTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQAEPREFLQQQYRLFQTRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis Reveals Features of the Spindle Checkpoint Kinase Bub1-Kinetochore Subunit Knl1 Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords MITOTIC CHECKPOINT SERINE/THREONINE-PROTEIN KINASE BUB1
total genus 62
structure length 146
sequence length 146
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08311 Mad3_BUB1_I Mad3/BUB1 homology region 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.430 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4a1gA00
3SI5A 4A1GA 2WVIA 4AEZC 2LAHA
chains in the Genus database with same CATH superfamily
4IULA 4GYWA 2RG8A 3UKRG 3V79K 2IOLA 3FH7A 3FHEA 2WQ6A 4L9PA 3MGBA 3Q9NC 5FZRA 2DYRE 4TUMA 1HG5A 4LG6A 1FT2A 5ENRD 3TWQA 1H6PA 5EX0A 5E75A 4U8HA 1JCQA 4UWFA 4HRLA 4CDMA 3AU5A 3EU9A 1MHQA 4MBGA 3ML9A 4JHKA 4PUCA 3EIQC 2PM7A 3QJZA 4B89A 5M72A 4WNFA 3HRAA 5ENNA 2WVIA 3AAAC 2A5UA 4N3AA 4ABNA 2IONA 4U8VD 3FU0A 5KJKA 3MZLB 5FQ4A 1N0QA 3HXCA 1HFAA 4BSZB 5KJMA 1GW6A 1H2TC 4ZFHA 2HO1A 4YVOA 1OWNA 4L7TA 4XKBA 3EDTB 4GAAA 2VJ8A 3O48A 3ZFWA 3IEGA 3L54A 3ONLA 2DBAA 2JLBA 2QYJA 4K5CA 5EYLA 3APCA 3T5XA 4WNGA 2CFZA 1DCEA 3UTMA 2XS1A 3V30A 3PS6A 4B94A 3B95A 5EILA 4G26A 3CLJA 4CGVA 1Z5SC 2I2OA 1N94A 5CRVA 3S7BA 2MYOA 3DSXA 4WAFA 5H7PA 2IEJA 3R7QA 3TWWA 2XS8A 4OAUC 1OT8A 1UG3A 2NSZA 4U0SA 4L2LA 5AENA 1QNFA 2CG2A 4K03A 3S7FA 4HOTA 2AJAA 3ZPJA 2DZNA 2LO6A 2XPZA 3BU8A 3G2TA 4PS8A 5FT9A 1TNOA 3OXFA 4YDOA 5KCMA 4TRQA 4I1OB 2V0PA 3G2UA 3ZNGA 5G2NA 4JC8A 3CHPA 3LJNA 4DLOA 3LY7A 5ITZF 3I4GA 4HBDA 3FULA 4IN3B 5G05C 4O60A 2XZTG 3QNKA 3ESKA 4B8AA 1EPUA 3HXEA 2J09A 2KCVA 2WB2A 3HYMB 3RRUA 4AY5A 3VLFA 3T5VA 1E90A 3LXUX 2YQ8A 4QFVA 3HXDA 5EKQD 4U96D 5ARGA 2V4HC 3CQCB 4HRMB 2FULA 4BERA 4K5AB 3OXLA 2IF4A 3HXBA 4ILGA 1HF8A 1ELWA 4GA0A 4BTAA 5LFAA 1PC2A 3Q15A 4CZ2D 2RFAA 4RSYA 3FU6A 2IQCA 2LAHA 4FP7A 1K3ZD 5KWDA 2VGYA 3ML8A 4GZDA 4GZ5A 5EX3A 5CMYA 1FCHA 4A3VA 3RAUA 2L6JA 5CBOA 4ILIA 3U64A 4I6JA 4LCTA 2JABA 3AU4A 1TYQG 2BKKB 2VGXB 2KXPC 1KPSB 1ZBPA 4YDEA 1E8YA 3TG5A 2QYUA 5FWQA 3QK0A 1OWLA 3KD7A 3PRZA 1YA0A 4MKTA 3TG4A 1OXJA 1U3CA 3FUJA 4XEIG 2WXPA 4MLPA 5JJ7A 3CEQA 3UM2A 1TR4A 3DSUA 2I6HA 3ABME 2PZIA 3SFYA 2X38A 3LY9A 3ASFA 1UN9A 3CHMA 5G05J 5BW8C 3P1UA 3AG3E 3CK9A 3I4RB 4EHMA 5EIBE 1O5MA 1HS6A 2CFUA 3ZW3A 3EUVA 3HG0D 1N4SA 4N5QA 1HE8A 3ZN3A 5E76A 3UT8A 3UINC 1AP7A 2LSUA 3JQ1A 1LTXA 3FTZA 4KZCA 3ZUVB 3CK8A 3ABLE 3ZYKA 3DEOA 5CCLA 1S63A 3ZYLA 3DXKG 4ANWA 3Q7FA 2L0IA 4GA2A 3EJNA 3LJ3A 3VTYA 5BT1A 3KEZA 2VTBB 4XI9A 3S7JA 4L1BA 2B6CA 1IYGA 5CEDB 3D9IA 2XEEA 3SBTB 3B7BA 3KS2A 4AY6A 3I5PA 5AJDA 5A7DB 3SGHA 3Q7AA 1D9SA 3TAXA 2Y69E 3ZXPA 4U07A 3NZSA 4F7AA 4O1PA 4GMJA 3CSFA 2I1JA 3D9JA 2R03A 4G23A 1S0PA 1FVHA 2WM9A 1MYOA 2NC9A 4DX7D 2R17C 4HI9A 5AAOA 4B0ZA 3SHFA 4N3BA 2VTBA 2YHCA 1N4PA 4GMLA 4N2QA 4Z68A 2XCBA 4J6IA 3G2VA 4EQFA 5BXOA 4DUIA 2HM8A 4PH4B 2WQ7A 5G04C 2OCCE 3CVXA 3RJVA 1N11A 3HIZA 2F37A 2X6JA 3UUXA 2V5QC 4BTBA 5LCWC 1SA4A 5LOZA 5AJLA 2P2CP 3C5RA 1PY1A 3D9MA 3PZ3A 2F0YA 3EHNA 3AG2E 2IJGX 3S7DA 4HOSA 4P29A 3ZKJA 3E4BA 2AXZA 4BY6A 1KT0A 3L82A 5AQBA 3LVRE 4UQZA 2J8SD 3E33A 1WM5A 1V54E 3UM0A 3FTYA 4XX5A 3TXMA 1N9AA 2XGSA 4GTMA 2XRZA 4FA6A 3KSLA 1G3NB 3CSTA 3UT7A 5T8IA 3CIAA 1YYHA 3CHRA 4A1SA 4U0ZA 1JCRA 4YNDA 4FU3A 2XRYA 5FQ8A 4I1AA 3JUIA 3VLEA 2VGXA 4ZHBA 3CKCA 3ASGA 5B1AE 5ENTD 3CVQA 5G04J 4G1TA 4I6GA 5HI7A 4DI3A 3C3QA 3TWSA 4Q69A 4BX9A 2FO7A 5D2MC 4UQXA 4ME2A 3MKQB 4D10C 4EZKA 1UJKA 3L16A 2KCKA 3ZIMA 4Q96A 3AG1E 1TNYA 3Q78A 3V31A 3SFZA 1HXIA 4LNBA 5HQ8A 2WXIA 3Q49B 4WWPA 4ACKA 2C2LA 3U9WA 2M63A 2LNIA 1WG0A 4KZ0A 3ZYMA 3AS8A 2PM6A 1ELKA 3BG0B 3KAEA 4C48B 3JXIA 4GTPA 4G2VA 3CGHA 5LX8A 4AVXA 3C3OA 3UT4A 5CERB 2GRLA 5JJTA 3FFLA 5CECB 3MKRA 2PL2A 5BNWA 2GGFA 5AYWD 1D8EA 3ISMC 3IHYA 3APDA 3LYAA 1LF8A 1DNPA 2MOWA 3TWRA 2J07A 1DCQA 3F6QA 3RRNB 1HX8A 3PUKA 4HOQA 4URKA 3TJPA 3RO2A 1U2VG 2DYSE 5T3RA 2UY1A 3WG7E 2X6FA 5EIDA 2VGEA 3FUIA 1IHGA 3K9IA 1HG2A 1MX4A 1TN7A 5A6CA 5FQ7A 4CDNA 2R02A 1NA3A 2F8XK 5KBAA 1IHBA 3LEWA 3FP3A 2CG3A 4PDXA 1UOHA 3QKYA 3U66A 1Z3XA 2KCLA 5LCWJ 4I43A 1E8XA 3U3WA 5ANRA 4Y6CA 3ZXSA 3APFA 3B7TA 1E8WA 2DIWA 2EIKE 4TXQA 2EIME 3ASDA 4J7WA 1INZA 4AOFA 2VQ2A 4RQIA 4ATZD 3T9KA 3FUKA 2CHWA 5BPPA 4BT8A 4KBQA 3BUAA 5JA4D 1N95A 2XGOA 3UM1A 5B3SE 3RK6A 1DVPA 3D9NA 3ZRHA 3T8KA 4HQDA 3GZ2A 4ANVA 1HZ4A 3CV0A 2WMOA 3B13A 4JVSA 1E8ZA 5D66A 5ENPD 5CCMA 1W3BA 3BQOA 1TNBA 2ETBA 3ZHEB 2GRQB 4NRHB 4JXTA 2AW6A 3DSSA 5KNHD 2IFUA 3J5PA 4CRWA 1X5BA 1SQMA 3URZA 5CBNA 2GRRB 3X2QE 1E7VA 1OWPA 4CYMD 4DJAA 1QZ2A 2WXQA 2V4LA 4G11A 2MRIA 4DI4A 1TN8A 3UKUG 3L08A 4LNGA 1Z3YA 5BV1A 3L13A 2OVFA 4U0UA 5JHBA 2KZTB 1MZCA 1N52A 3QWPA 2OV8A 3SI5A 4BX8A 4WUYA 5DIZA 4G24A 3D9OA 3ZVVA 4LEUA 5B1BE 3CHOA 1KZOA 4APFA 1QBQA 4DPRA 3TWXA 4FJZA 2R5SA 3ULYA 2XQ0A 4XE0A 4I6EA 4C0EA 3PEVB 3PZ2A 2FO1E 2BKGA 4OYSA 2UWJG 3HHMA 3B7RL 2WXGA 4AXHA 4DLQA 3FUHA 4FLHA 3DPYA 4V3IA 2DWZA 3PH0C 2J9QA 1FT1A 3MX3A 2BUGA 2X3MA 5HRYA 4CDRA 1S70B 2XGMA 1K1BA 4JPSA 3JXJA 3W9FA 5G55A 2H6HA 3JCKC 2AVPA 3EU5A 4ANUA 2GRPB 4BSXA 3DWLG 3MYVA 4DRXE 2XCCA 2HR2A 3LDZA 4APOA 2VSNA 4GYYA 4U04A 3PZDA 5EDSA 2XEVA 1HU3A 2J08A 1SVXA 4NIKA 4HXIA 4ATGA 3SFXA 4A63B 5LP0A 2LSVA 2L6BA 1FPPA 2WPVA 4O1OA 4B8CB 2GW1A 3QB2A 3R7RA 4RG9A 3FTSA 4K0RA 2P58C 3FEXA 2OOEA 1JCSA 4F53A 1E96B 4WWNA 3SD5A 5AQ9A 2VSYA 1A5EA 2Y1LE 4G8LA 4G25A 1NZNA 2OEVA 2LAIA 2VSOE 4DX2A 2R59A 3SO8A 4FC8A 5D0QD 4GPMA 4KMOA 4JB8P 2JEKA 3O4ZA 4JHJA 4QQIA 4TXPA 1IQRA 3NB2A 1HO8A 1LD8A 2C0MA 5C2YA 1YCSB 2DZOA 4C0MA 4BWRA 3S2AA 2V8SE 3LCAA 2Q7FA 4FADA 3OXGA 1TJCA 1ELRA 2HYZA 3MV2B 3SBSA 2HE0A 2IO2C 1OWMA 3UQ3A 2P9SG 4R7LA 3CQGB 1D8DA 1MQSA 1SW6A 2LXLA 5AIJA 3P2BA 4LRZA 4GMRA 4JA7A 2P9UG 3MJWA 4XKCA 4DX5D 2I9CA 2RD0A 3T8MA 3DSVA 4J0UA 4M7CA 3FUFA 2P9PG 3ASOE 1K8KG 3AG4E 3ONKA 4LUNU 4LERA 4U7EB 5KJNA 2FEZA 3PDNA 4AIFA 3FH5A 2RFMA 2IO3C 2XPYA 2CHZA 3FUDA 3B7UX 3MEKA 3NAWA 4CEMA 3FDHA 5BXUA 5FIOA 4UWHA 1H19A 4EZJA 3NZUA 1SA5A 2ZXWE 3QC1A 2H6IA 3E34A 4Q94A 3I3NA 4CT4A 1EDUA 1EF1C 4UI9J 5J08A 1SZAA 3UX4A 3PREA 2BF0X 1YMPA 3IKOB 1X81A 4I9CA 1TEZA 1U3DA 3MA5A 2L9BA 2E2EA 4OVVA 1O1RA 2H6GA 5FZQA 3LVQE 4J8YA 5CEAA 3QOUA 4BESA 1OCOE 3ULQA 3NBNB 3E37A 1NI1A 1N4QA 3IXEA 3FEYA 4FULA 2IU1A 3QARA 5CHEE 4JW1A 4AV7A 2X6IA 3ZU7B 4U63A 4GZ6A 4JD2G 4JZYA 4EZLA 4L23A 3DSTA 4UWKA 2EIJE 3DPDA 2WXKA 1KZPA 4XI0A 4GZCA 2WXNA 2XEHA 1ZU2A 2YNQA 1OCZE 1HH8A 1H6OA 3ZEFA 2AWIA 4XZ4A 2PQNA 3HDXA 2B0OE 3PVLA 2YINA 4A1GA 4KT6B 1IQUA 1NA0A 4HLEA 2WXHA 2L0TB 1BLXB 3PZ4A 4HORA 4CGWA 1BI8B 5HKPA 3C72A 3Q73A 2IOSA 4KXKB 2KC7A 1IKND 2R2LA 4ACLA 3CK7A 1LD7A 2OVBA 2ILRA 1O1SA 3ENEA 3TXNA 1H2UA 4BT9A 3KEAA 4DK5A 3L22A 4UI9C 5ENSD 3R9MA 4U8YD 4K5BA 5FZSA 4EPZA 1NP7A 2LXMA 3R9AB 3D9LA 1KT1A 2ETCA 4YVQC 3GYZA 5ENQD 3Q75A 2RKKA 3ASHA 3UXGA 1NFIE 4GCNA 4HFGA 4C9BB 4KYOB 3PUJA 4GA1A 4KVOA 3AS5A 1FVFA 4FLBA 3UIOC 1JWGA 2UY1B 4GTRA 3DSWA 3SY2A 4IYPA 5IY5E 2QFCA 2IY0C 2KATA 3D3MA 3ASNE 4H7YA 1BD8A 3ZGQA 4I9EA 3IV0A 3ZYQA 2ONDA 1VDYA 1EYHA 2J4DA 2F8YA 3LS8A 4HRNA 5FJYA 3G2WA 4E6HA 4G8KA 2CHXA 4JHRA 1TN6A 4JA9A 1V55E 3RU0A 3U4TA 3ABKE 1MJ0A 1TNUA 2EINE 3JQ0A 4N39A 2P9IG 3OAWA 4DX1A 2R05A 3SZ7A 3LPZA 4MRUA 3FUNA 2WXJA 1O1TA 3Q79A 5T4YA 3GW4A 4FHJA 4LSZE 1Q2ZA 4AM9A 4GTQA 2WXMA 3MV3B 4HNAD 1Y6IA 3L9TA 4WWOA 3EIJA 1MX6A 3L6AA 3UPVA 2E0IA 1JPLA 3TWVA 4UQYA 4EBAG 2BTDA 2X6HA 4LNUD 4L2YA 1H2VC 2NXPA 3KSQA 4GU5A 1XGWA 5JHAA 4TUUA 3UI2A 4GTSA 5FTPA 2KM4A 3AJIA 3OTNA 1MX2A 3GZSA 2A5EA 2X6KA 5D0OD 3RIBA 4AJWA 2P9KG 2ZISA 1WAO1 4GTTA 5AARA 4DX6D 1N0RA 2VSXE 4I2ZA 4GTVA 3RKVA 4RVBA 4GZ3A 4HOUA 2MHKA 2VYIA 4X8QA 4I17A 1S64A 1JWFA 3CHSA 2C0LA 4UWGA 3MKQA 4UI9K 3CKBA 3JYSA 1BPOA 4JEHA 3TWTA 3JUEA 3UMVA 4F1SA 1OUVA 4BFRA 3FTUA 5BV0A 3V2OA 1K1AA 4F3VA 5HS0A 2AXVA 4B93B 4HB5A 3FTXA 3NOGD 4RG6A 3NOCD 3WXXA 2PQRA 2A4ZA 2Y4TA 3HVEA 1SZ9A 2PNNA 5ARFA 3TWUA 1OCCE 2KBXA 2Y3AA 1WY6A 5JMND 2XHEA 4UUCA 3CVWA 4GPKA 3ESLA 4TV3A 3FUMA 2WQHA 1WDYA 3PEUB 2QZAA 3DEPA 1JUQA 1KLXA 3GZ1A 2WXLA 2ZGGA 2QC9A 4CT0A 4NURA 1QYMA 4U95D 5EN5D 1BI7B 2Y4UA 2P9LG 4RLYA 3NF1A 1TNZA 2WXOA 2ETAA 3D9HA 1UW4B 1BU9A 3HVEB 1H0AA 3RO3A 4YDWA 5BUZA 2H6FA 3BEEA 2GROB 3AS4A 2XENA 3V2XA 5A23A 3PZ1A 5ENOD 2ZIRA 4H7XA 2NYJA 3VLDA 3E32A 2EQXA 4JL0A 3N71A 3SQVA 1UN8A 4W9RA 5CMWA 3L17A 1N4RA 1ZB1A 3CVPA 2WMNA 4FHKA 4NACA 3SNXA 4E85A 2EILE 2FI7A 2BEDA 1PAQA 3NQPA 2QY7A 4A55A 4J8EA 3FU5A 2Y0BG 3FU3A 4IRUA 3QAQA 1B89A 4HVBA 3CVUA 5FQ6A 3FTWA 1XNFA 1OWOA 4WNEA 3LY8A 3Q9UC 4JEUA 2GRNB 4TXRA 3MCXA 5KNGA 1RZ4A 3QWWA 2FBNA 3ULEG 4HLLA 4MS6A 4CCAA 2V5FA 4N3CA 3CVYA 3C3RA 4J8FA 2GRMA 2DVWA 4KVMA 3HXFA 4A3TA 1AWCB 3PNLB 3W9GA 4OAVB 5FINA 4I1MA 1E7UA 1H6KA 4Y6WA 4GCOA 4BETA 5JJ6A 4O6FA 4PS3A 1A17A 2J4BA 3FY4A 4N2SA 4OVUA 3E30A 3CVNA 3EHMA 1OCRE 1P5QA 4HS2A 5AQAA 3UIPC 5AN8A 2P9NG 1IXVA 5KJLA 3J5QB 4J8DA 3PE3A 1UJJA 1NL4A 3RSEG 2XZDG 5EYPF 2DCPA 2WXFA 3CHQA 4AEZC 2FF4A 3Q4AB 3C98A 5CRUA 5C1DA 4NQ0A 3B7SA 3CR3A 2ZGDA 2I1KA 3FUEA 4WNDA 5DBKA 5J90A 4XIFA 4F1PA 3EHRA 1OY3D 4GTOA 4PS7A 3D9KA 2OEWA 2XPIA 1N54A 4AP2A 3SF4A 3CVLA 1DC2A 3IHVA 2AXUA 3BG1B 3VTXA 3EHQA 2ZU6B 3FH8A 2LUHA 1TJFA 4FJYA 4I2WA 1RW2A 3DBSA 4EBAA 4UWLA 4EECA 3CVVA 2YHEA 3QDNA 3PE4A 3LKUA 3RRMB 3IBEA 4F6RD 1QQEA 3PNTB 4YDYA 4N5CA 4GB9A 3TL5A 2WXRA 1Y8MA 4HI8A 1Z6TA 3Q5MA 3FWVA 3Q47B 4ILHB 3G2SA 1L5JA 4J8SA 3DXMG 3QWVA 4M3OA 3D9PA 3FTVA 3TGOA 3DRAA 2J49A 2KZTA 4BEPA 4ANXA 5ANLA 3ZHEA 5AQ7A 4GYOA 3UM3A
chains in the Genus database with same CATH topology
4IULA 1Y6IA 2YHCA 4GYWA 4GMLA 4WWOA 4N2QA 2RG8A 4BSXA 3EIJA 3L6AA 2XCBA 4J6IA 3MYVA 3G2VA 4EQFA 2HM8A 4PH4B 2IOLA 3FH7A 3FHEA 2WQ6A 2XCCA 2HR2A 3LDZA 3UPVA 2E0IA 1JPLA 3MGBA 4APOA 2WQ7A 2VSNA 4GYYA 4U04A 3PZDA 5EDSA 5G04C 3CVXA 4UQYA 4EBAG 2BTDA 2X6HA 4L2YA 5FZRA 3RJVA 3HIZA 1H2VC 1HG5A 2NXPA 1HU3A 2X6JA 2XEVA 4GU5A 3UUXA 1XGWA 2J08A 5JHAA 4BTBA 5EX0A 4HXIA 4ATGA 4TUUA 5E75A 5LP0A 5LCWC 4U8HA 2LSVA 5LOZA 2WPVA 4UWFA 5AJLA 4CDMA 4B8CB 3AU5A 2GW1A 5FTPA 1PY1A 2KM4A 3D9MA 1MHQA 3QB2A 3OTNA 3GZSA 4RG9A 3R7RA 3EHNA 3FTSA 2X6KA 4K0RA 2P58C 3FEXA 3ML9A 4JHKA 2OOEA 5D0OD 2IJGX 3RIBA 4AJWA 3S7DA 4PUCA 4F53A 4HOSA 1E96B 3EIQC 2PM7A 4P29A 3QJZA 4B89A 5M72A 1WAO1 4WNFA 5ENNA 2VSXE 2WVIA 4WWNA 3E4BA 3SD5A 4I2ZA 2AXZA 2VSYA 4BY6A 2A5UA 4N3AA 3RKVA 1KT0A 4ABNA 2IONA 3FU0A 4G25A 4RVBA 5KJKA 4GZ3A 3MZLB 2MHKA 4HOUA 5FQ4A 1HFAA 5KJMA 1NZNA 1GW6A 3LVRE 1H2TC 4UQZA 2LAIA 2VSOE 2VYIA 1WM5A 2R59A 4FC8A 2HO1A 5D0QD 4I17A 4YVOA 1JWFA 3FTYA 4KMOA 1OWNA 4L7TA 4XKBA 3EDTB 4XX5A 4GAAA 3TXMA 3CHSA 2C0LA 2JEKA 4UWGA 3O4ZA 2VJ8A 3O48A 3MKQA 3ZFWA 4UI9K 2XGSA 2XRZA 3CKBA 4JHJA 3JYSA 4FA6A 1BPOA 4JEHA 1IQRA 1HO8A 3CSTA 3IEGA 3L54A 3ONLA 2DBAA 3UT7A 2JLBA 3UMVA 4F1SA 1OUVA 2C0MA 4BFRA 5C2YA 3FTUA 5BV0A 5T8IA 3APCA 3T5XA 4WNGA 3CIAA 4F3VA 2CFZA 4C0MA 2AXVA 4BWRA 3FTXA 3S2AA 2V8SE 3LCAA 3CHRA 4RG6A 4A1SA 3PS6A 4U0ZA 3WXXA 2Q7FA 4B94A 2PQRA 2A4ZA 2Y4TA 4FADA 3HVEA 3OXGA 1SZ9A 4G26A 3CLJA 4CGVA 1TJCA 4YNDA 4FU3A 5ARFA 1ELRA 2XRYA 2HYZA 2I2OA 3MV2B 5FQ8A 3SBSA 2Y3AA 3JUIA 4I1AA 3VLEA 3S7BA 1WY6A 1OWMA 2XHEA 2VGXA 4R7LA 3CQGB 3UQ3A 3CVWA 1MQSA 4GPKA 4WAFA 3ESLA 4TV3A 3CKCA 3FUMA 3R7QA 2WQHA 3P2BA 5AIJA 4LRZA 3ASGA 4JA7A 3CVQA 3MJWA 4XKCA 1UG3A 2I9CA 2NSZA 5G04J 4G1TA 4I6GA 5HI7A 3PEUB 4DI3A 2RD0A 3T8MA 4J0UA 3FUFA 4U0SA 4L2LA 4Q69A 1QNFA 2CG2A 4K03A 3S7FA 5AENA 4HOTA 1JUQA 4BX9A 1KLXA 2FO7A 3GZ1A 4UQXA 3ONKA 4ME2A 2WXLA 3ZPJA 3MKQB 4LUNU 4D10C 4LERA 5KJNA 2FEZA 2LO6A 3PDNA 2XPZA 4CT0A 4NURA 3G2TA 4PS8A 4AIFA 2Y4UA 3FH5A 5FT9A 4EZKA 1UJKA 2XPYA 2CHZA 3L16A 2KCKA 3B7UX 3FUDA 3OXFA 3MEKA 3NF1A 3ZIMA 4CEMA 2WXOA 3FDHA 4Q96A 5KCMA 4TRQA 4I1OB 1UW4B 2V0PA 3G2UA 3HVEB 5G2NA 4JC8A 4UWHA 3SFZA 1H0AA 3RO3A 3CHPA 4DLOA 1HXIA 1H19A 5HQ8A 4EZJA 3NZUA 2WXIA 3Q49B 3LY7A 5BUZA 3I4GA 3QC1A 3BEEA 4WWPA 4ACKA 2C2LA 3AS4A 3FULA 4Q94A 3I3NA 4CT4A 4IN3B 5G05C 3U9WA 1EDUA 1EF1C 2M63A 4UI9J 5J08A 3QNKA 3ESKA 4B8AA 1EPUA 5A23A 2LNIA 2J09A 2KCVA 4H7XA 4KZ0A 3AS8A 3ZYMA 2WB2A 1SZAA 3UX4A 3PREA 3VLDA 2EQXA 2BF0X 3HYMB 4JL0A 3IKOB 2PM6A 3N71A 1ELKA 3BG0B 1UN8A 3RRUA 4I9CA 3KAEA 4AY5A 3VLFA 3T5VA 4G2VA 1U3DA 3MA5A 3CGHA 4W9RA 1TEZA 1E90A 2L9BA 2E2EA 3LXUX 5CMWA 5LX8A 2YQ8A 3L17A 4QFVA 4OVVA 5EKQD 3CVPA 5ARGA 2WMNA 4FHKA 3UT4A 4AVXA 3CQCB 4NACA 3SNXA 2FULA 2GRLA 4E85A 5JJTA 3FFLA 3OXLA 2FI7A 5FZQA 1PAQA 2IF4A 4ILGA 3NQPA 3LVQE 2QY7A 3MKRA 1HF8A 4A55A 1ELWA 2PL2A 5BNWA 3QOUA 4GA0A 4BTAA 5LFAA 2GGFA 1PC2A 5AYWD 3ULQA 3IHYA 3Q15A 3APDA 3LYAA 1LF8A 4J8EA 3FU5A 1DNPA 4RSYA 2MOWA 2J07A 3FU3A 3FU6A 2IQCA 2LAHA 4FP7A 4IRUA 3QAQA 2VGYA 3FEYA 4FULA 3ML8A 2IU1A 1B89A 1HX8A 3PUKA 3QARA 4GZDA 4GZ5A 5CHEE 4JW1A 5EX3A 3RRNB 4HOQA 4AV7A 4HVBA 4URKA 3CVUA 5FQ6A 2X6IA 3RO2A 3FTWA 3TJPA 4U63A 5CMYA 4GZ6A 5T3RA 1FCHA 4JZYA 4A3VA 1XNFA 2UY1A 1OWOA 2L6JA 4WNEA 3LY8A 2X6FA 4EZLA 4L23A 4UWKA 4ILIA 4JEUA 3DPDA 2WXKA 1IHGA 3FUIA 3U64A 3K9IA 1HG2A 5A6CA 4I6JA 3MCXA 4XI0A 4GZCA 4LCTA 5FQ7A 3QWWA 2FBNA 4CDNA 3AU4A 2WXNA 1NA3A 1ZU2A 2YNQA 2VGXB 4MS6A 4CCAA 2V5FA 4N3CA 1HH8A 3LEWA 3FP3A 3ZEFA 2CG3A 4PDXA 1ZBPA 2AWIA 4XZ4A 3CVYA 2PQNA 3HDXA 4J8FA 1E8YA 3TG5A 2GRMA 2YINA 3QKYA 5FWQA 4A1GA 3QK0A 3U66A 1OWLA 1Z3XA 4KT6B 4KVMA 1IQUA 3KD7A 3PRZA 1YA0A 1NA0A 4HLEA 2KCLA 4MKTA 4A3TA 5LCWJ 3TG4A 2WXHA 2L0TB 4I43A 1E8XA 3U3WA 3PNLB 4HORA 1U3CA 3FUJA 4CGWA 5ANRA 2IOSA 2WXPA 4Y6CA 3ZXSA 4MLPA 4KXKB 5JJ7A 3APFA 3CEQA 3B7TA 1E7UA 1E8WA 4I1MA 1H6KA 4Y6WA 2KC7A 2I6HA 4GCOA 2DIWA 5JJ6A 4O6FA 4PS3A 4ACLA 3CK7A 2PZIA 1A17A 2J4BA 2OVBA 3ASDA 3FY4A 2ILRA 4N2SA 4OVUA 3ENEA 3TXNA 1H2UA 3CVNA 4BT9A 2X38A 3EHMA 1INZA 4DK5A 3LY9A 2VQ2A 4AOFA 3ASFA 3L22A 4UI9C 1P5QA 1UN9A 3FUKA 2CHWA 3CHMA 5G05J 4BT8A 5BPPA 4KBQA 5BW8C 3P1UA 4HS2A 2XGOA 5FZSA 4EPZA 3RK6A 1DVPA 3D9NA 3ZRHA 1NP7A 3CK9A 3I4RB 3GZ2A 3R9AB 5KJLA 4ANVA 1HS6A 1HZ4A 2CFUA 3CV0A 3B13A 3D9LA 2WMOA 3PE3A 1UJJA 1KT1A 4J8DA 4JVSA 3ZW3A 4YVQC 1E8ZA 5CCMA 3GYZA 1W3BA 1HE8A 2DCPA 3ZN3A 3ZHEB 2WXFA 5E76A 3ASHA 3UT8A 3CHQA 4NRHB 4AEZC 2FF4A 4GCNA 4HFGA 4JXTA 3Q4AB 3C98A 4C9BB 2AW6A 4KYOB 2LSUA 3JQ1A 3PUJA 5C1DA 4NQ0A 3FTZA 4GA1A 3B7SA 3CR3A 2IFUA 4KZCA 2I1KA 4KVOA 3AS5A 1X5BA 4CRWA 1SQMA 3CK8A 3FUEA 3ZYKA 1FVFA 4FLBA 3URZA 4WNDA 1JWGA 2UY1B 5DBKA 5J90A 4XIFA 5CCLA 3ZYLA 4IYPA 1OWPA 1E7VA 4DJAA 1QZ2A 2WXQA 2V4LA 4ANWA 2L0IA 4G11A 2MRIA 4PS7A 3D9KA 2QFCA 4GA2A 4DI4A 3EJNA 3LJ3A 2XPIA 3L08A 3VTYA 1N54A 2KATA 4AP2A 1Z3YA 5BV1A 5BT1A 3SF4A 3KEZA 3D3MA 3CVLA 3L13A 2OVFA 2VTBB 3IHVA 4H7YA 2AXUA 3BG1B 4I9EA 3IV0A 4U0UA 3VTXA 3ZGQA 3ZYQA 4XI9A 2ZU6B 3FH8A 3S7JA 1TJFA 2KZTB 1VDYA 1EYHA 2ONDA 1N52A 3QWPA 4FJYA 4I2WA 4L1BA 5JHBA 2OV8A 3SI5A 2J4DA 4WUYA 4BX8A 5DIZA 4G24A 3D9OA 3DBSA 3LS8A 3ZVVA 1IYGA 4LEUA 5FJYA 3G2WA 3D9IA 4EBAA 3CHOA 4APFA 4E6HA 4DPRA 4FJZA 4UWLA 2R5SA 2CHXA 4EECA 3SBTB 3CVVA 2YHEA 3KS2A 3QDNA 3I5PA 2XQ0A 4XE0A 3PE4A 5AJDA 5A7DB 4I6EA 3SGHA 4JHRA 4C0EA 3PEVB 4JA9A 3LKUA 3RRMB 4OYSA 2UWJG 3TAXA 3HHMA 3IBEA 3RU0A 3B7RL 3U4TA 1QQEA 2WXGA 3PNTB 4U07A 4AXHA 3JQ0A 4N5CA 4DLQA 4GB9A 3TL5A 4ANUA 3FUHA 4FLHA 4N39A 2WXRA 3OAWA 4V3IA 1Y8MA 3PH0C 1Z6TA 2J9QA 3NZSA 3Q5MA 4F7AA 3FWVA 3Q47B 4ILHB 3MX3A 3SZ7A 3LPZA 4MRUA 3FUNA 4GMJA 2BUGA 3G2SA 3CSFA 1L5JA 2X3MA 2I1JA 3D9JA 4J8SA 4M3OA 3QWVA 4CDRA 3D9PA 2WXJA 2XGMA 4G23A 3FTVA 5T4YA 3GW4A 4JPSA 4FHJA 3TGOA 4AY6A 5G55A 1S0PA 3JCKC 1FVHA 2WM9A 2J49A 2NC9A 2KZTA 2AVPA 4AM9A 2R17C 4B0ZA 2WXMA 3MV3B 4ANXA 5ANLA 3ZHEA 3SHFA 3PVLA 4N3BA 4GYOA 2VTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SI5 A;  4A1G A;  2WVI A;  4AEZ C;  2LAH A; 
#chains in the Genus database with same CATH topology
 4IUL A;  4GYW A;  2RG8 A;  3UKR G;  3V79 K;  2IOL A;  3FH7 A;  3FHE A;  2WQ6 A;  4L9P A;  3MGB A;  3Q9N C;  5FZR A;  2DYR E;  4TUM A;  1HG5 A;  4LG6 A;  1FT2 A;  5ENR D;  3TWQ A;  1H6P A;  5EX0 A;  5E75 A;  4U8H A;  1JCQ A;  4UWF A;  4HRL A;  4CDM A;  3AU5 A;  3EU9 A;  1MHQ A;  4MBG A;  3ML9 A;  4JHK A;  4PUC A;  3EIQ C;  2PM7 A;  3QJZ A;  4B89 A;  5M72 A;  4WNF A;  3HRA A;  5ENN A;  2WVI A;  3AAA C;  2A5U A;  4N3A A;  4ABN A;  2ION A;  4U8V D;  3FU0 A;  5KJK A;  3MZL B;  5FQ4 A;  1N0Q A;  3HXC A;  1HFA A;  4BSZ B;  5KJM A;  1GW6 A;  1H2T C;  4ZFH A;  2HO1 A;  4YVO A;  1OWN A;  4L7T A;  4XKB A;  3EDT B;  4GAA A;  2VJ8 A;  3O48 A;  3ZFW A;  3IEG A;  3L54 A;  3ONL A;  2DBA A;  2JLB A;  2QYJ A;  4K5C A;  5EYL A;  3APC A;  3T5X A;  4WNG A;  2CFZ A;  1DCE A;  3UTM A;  2XS1 A;  3V30 A;  3PS6 A;  4B94 A;  3B95 A;  5EIL A;  4G26 A;  3CLJ A;  4CGV A;  1Z5S C;  2I2O A;  1N94 A;  5CRV A;  3S7B A;  2MYO A;  3DSX A;  4WAF A;  5H7P A;  2IEJ A;  3R7Q A;  3TWW A;  2XS8 A;  4OAU C;  1OT8 A;  1UG3 A;  2NSZ A;  4U0S A;  4L2L A;  5AEN A;  1QNF A;  2CG2 A;  4K03 A;  3S7F A;  4HOT A;  2AJA A;  3ZPJ A;  2DZN A;  2LO6 A;  2XPZ A;  3BU8 A;  3G2T A;  4PS8 A;  5FT9 A;  1TNO A;  3OXF A;  4YDO A;  5KCM A;  4TRQ A;  4I1O B;  2V0P A;  3G2U A;  3ZNG A;  5G2N A;  4JC8 A;  3CHP A;  3LJN A;  4DLO A;  3LY7 A;  5ITZ F;  3I4G A;  4HBD A;  3FUL A;  4IN3 B;  5G05 C;  4O60 A;  2XZT G;  3QNK A;  3ESK A;  4B8A A;  1EPU A;  3HXE A;  2J09 A;  2KCV A;  2WB2 A;  3HYM B;  3RRU A;  4AY5 A;  3VLF A;  3T5V A;  1E90 A;  3LXU X;  2YQ8 A;  4QFV A;  3HXD A;  5EKQ D;  4U96 D;  5ARG A;  2V4H C;  3CQC B;  4HRM B;  2FUL A;  4BER A;  4K5A B;  3OXL A;  2IF4 A;  3HXB A;  4ILG A;  1HF8 A;  1ELW A;  4GA0 A;  4BTA A;  5LFA A;  1PC2 A;  3Q15 A;  4CZ2 D;  2RFA A;  4RSY A;  3FU6 A;  2IQC A;  2LAH A;  4FP7 A;  1K3Z D;  5KWD A;  2VGY A;  3ML8 A;  4GZD A;  4GZ5 A;  5EX3 A;  5CMY A;  1FCH A;  4A3V A;  3RAU A;  2L6J A;  5CBO A;  4ILI A;  3U64 A;  4I6J A;  4LCT A;  2JAB A;  3AU4 A;  1TYQ G;  2BKK B;  2VGX B;  2KXP C;  1KPS B;  1ZBP A;  4YDE A;  1E8Y A;  3TG5 A;  2QYU A;  5FWQ A;  3QK0 A;  1OWL A;  3KD7 A;  3PRZ A;  1YA0 A;  4MKT A;  3TG4 A;  1OXJ A;  1U3C A;  3FUJ A;  4XEI G;  2WXP A;  4MLP A;  5JJ7 A;  3CEQ A;  3UM2 A;  1TR4 A;  3DSU A;  2I6H A;  3ABM E;  2PZI A;  3SFY A;  2X38 A;  3LY9 A;  3ASF A;  1UN9 A;  3CHM A;  5G05 J;  5BW8 C;  3P1U A;  3AG3 E;  3CK9 A;  3I4R B;  4EHM A;  5EIB E;  1O5M A;  1HS6 A;  2CFU A;  3ZW3 A;  3EUV A;  3HG0 D;  1N4S A;  4N5Q A;  1HE8 A;  3ZN3 A;  5E76 A;  3UT8 A;  3UIN C;  1AP7 A;  2LSU A;  3JQ1 A;  1LTX A;  3FTZ A;  4KZC A;  3ZUV B;  3CK8 A;  3ABL E;  3ZYK A;  3DEO A;  5CCL A;  1S63 A;  3ZYL A;  3DXK G;  4ANW A;  3Q7F A;  2L0I A;  4GA2 A;  3EJN A;  3LJ3 A;  3VTY A;  5BT1 A;  3KEZ A;  2VTB B;  4XI9 A;  3S7J A;  4L1B A;  2B6C A;  1IYG A;  5CED B;  3D9I A;  2XEE A;  3SBT B;  3B7B A;  3KS2 A;  4AY6 A;  3I5P A;  5AJD A;  5A7D B;  3SGH A;  3Q7A A;  1D9S A;  3TAX A;  2Y69 E;  3ZXP A;  4U07 A;  3NZS A;  4F7A A;  4O1P A;  4GMJ A;  3CSF A;  2I1J A;  3D9J A;  2R03 A;  4G23 A;  1S0P A;  1FVH A;  2WM9 A;  1MYO A;  2NC9 A;  4DX7 D;  2R17 C;  4HI9 A;  5AAO A;  4B0Z A;  3SHF A;  4N3B A;  2VTB A;  2YHC A;  1N4P A;  4GML A;  4N2Q A;  4Z68 A;  2XCB A;  4J6I A;  3G2V A;  4EQF A;  5BXO A;  4DUI A;  2HM8 A;  4PH4 B;  2WQ7 A;  5G04 C;  2OCC E;  3CVX A;  3RJV A;  1N11 A;  3HIZ A;  2F37 A;  2X6J A;  3UUX A;  2V5Q C;  4BTB A;  5LCW C;  1SA4 A;  5LOZ A;  5AJL A;  2P2C P;  3C5R A;  1PY1 A;  3D9M A;  3PZ3 A;  2F0Y A;  3EHN A;  3AG2 E;  2IJG X;  3S7D A;  4HOS A;  4P29 A;  3ZKJ A;  3E4B A;  2AXZ A;  4BY6 A;  1KT0 A;  3L82 A;  5AQB A;  3LVR E;  4UQZ A;  2J8S D;  3E33 A;  1WM5 A;  1V54 E;  3UM0 A;  3FTY A;  4XX5 A;  3TXM A;  1N9A A;  2XGS A;  4GTM A;  2XRZ A;  4FA6 A;  3KSL A;  1G3N B;  3CST A;  3UT7 A;  5T8I A;  3CIA A;  1YYH A;  3CHR A;  4A1S A;  4U0Z A;  1JCR A;  4YND A;  4FU3 A;  2XRY A;  5FQ8 A;  4I1A A;  3JUI A;  3VLE A;  2VGX A;  4ZHB A;  3CKC A;  3ASG A;  5B1A E;  5ENT D;  3CVQ A;  5G04 J;  4G1T A;  4I6G A;  5HI7 A;  4DI3 A;  3C3Q A;  3TWS A;  4Q69 A;  4BX9 A;  2FO7 A;  5D2M C;  4UQX A;  4ME2 A;  3MKQ B;  4D10 C;  4EZK A;  1UJK A;  3L16 A;  2KCK A;  3ZIM A;  4Q96 A;  3AG1 E;  1TNY A;  3Q78 A;  3V31 A;  3SFZ A;  1HXI A;  4LNB A;  5HQ8 A;  2WXI A;  3Q49 B;  4WWP A;  4ACK A;  2C2L A;  3U9W A;  2M63 A;  2LNI A;  1WG0 A;  4KZ0 A;  3ZYM A;  3AS8 A;  2PM6 A;  1ELK A;  3BG0 B;  3KAE A;  4C48 B;  3JXI A;  4GTP A;  4G2V A;  3CGH A;  5LX8 A;  4AVX A;  3C3O A;  3UT4 A;  5CER B;  2GRL A;  5JJT A;  3FFL A;  5CEC B;  3MKR A;  2PL2 A;  5BNW A;  2GGF A;  5AYW D;  1D8E A;  3ISM C;  3IHY A;  3APD A;  3LYA A;  1LF8 A;  1DNP A;  2MOW A;  3TWR A;  2J07 A;  1DCQ A;  3F6Q A;  3RRN B;  1HX8 A;  3PUK A;  4HOQ A;  4URK A;  3TJP A;  3RO2 A;  1U2V G;  2DYS E;  5T3R A;  2UY1 A;  3WG7 E;  2X6F A;  5EID A;  2VGE A;  3FUI A;  1IHG A;  3K9I A;  1HG2 A;  1MX4 A;  1TN7 A;  5A6C A;  5FQ7 A;  4CDN A;  2R02 A;  1NA3 A;  2F8X K;  5KBA A;  1IHB A;  3LEW A;  3FP3 A;  2CG3 A;  4PDX A;  1UOH A;  3QKY A;  3U66 A;  1Z3X A;  2KCL A;  5LCW J;  4I43 A;  1E8X A;  3U3W A;  5ANR A;  4Y6C A;  3ZXS A;  3APF A;  3B7T A;  1E8W A;  2DIW A;  2EIK E;  4TXQ A;  2EIM E;  3ASD A;  4J7W A;  1INZ A;  4AOF A;  2VQ2 A;  4RQI A;  4ATZ D;  3T9K A;  3FUK A;  2CHW A;  5BPP A;  4BT8 A;  4KBQ A;  3BUA A;  5JA4 D;  1N95 A;  2XGO A;  3UM1 A;  5B3S E;  3RK6 A;  1DVP A;  3D9N A;  3ZRH A;  3T8K A;  4HQD A;  3GZ2 A;  4ANV A;  1HZ4 A;  3CV0 A;  2WMO A;  3B13 A;  4JVS A;  1E8Z A;  5D66 A;  5ENP D;  5CCM A;  1W3B A;  3BQO A;  1TNB A;  2ETB A;  3ZHE B;  2GRQ B;  4NRH B;  4JXT A;  2AW6 A;  3DSS A;  5KNH D;  2IFU A;  3J5P A;  4CRW A;  1X5B A;  1SQM A;  3URZ A;  5CBN A;  2GRR B;  3X2Q E;  1E7V A;  1OWP A;  4CYM D;  4DJA A;  1QZ2 A;  2WXQ A;  2V4L A;  4G11 A;  2MRI A;  4DI4 A;  1TN8 A;  3UKU G;  3L08 A;  4LNG A;  1Z3Y A;  5BV1 A;  3L13 A;  2OVF A;  4U0U A;  5JHB A;  2KZT B;  1MZC A;  1N52 A;  3QWP A;  2OV8 A;  3SI5 A;  4BX8 A;  4WUY A;  5DIZ A;  4G24 A;  3D9O A;  3ZVV A;  4LEU A;  5B1B E;  3CHO A;  1KZO A;  4APF A;  1QBQ A;  4DPR A;  3TWX A;  4FJZ A;  2R5S A;  3ULY A;  2XQ0 A;  4XE0 A;  4I6E A;  4C0E A;  3PEV B;  3PZ2 A;  2FO1 E;  2BKG A;  4OYS A;  2UWJ G;  3HHM A;  3B7R L;  2WXG A;  4AXH A;  4DLQ A;  3FUH A;  4FLH A;  3DPY A;  4V3I A;  2DWZ A;  3PH0 C;  2J9Q A;  1FT1 A;  3MX3 A;  2BUG A;  2X3M A;  5HRY A;  4CDR A;  1S70 B;  2XGM A;  1K1B A;  4JPS A;  3JXJ A;  3W9F A;  5G55 A;  2H6H A;  3JCK C;  2AVP A;  3EU5 A;  4ANU A;  2GRP B;  4BSX A;  3DWL G;  3MYV A;  4DRX E;  2XCC A;  2HR2 A;  3LDZ A;  4APO A;  2VSN A;  4GYY A;  4U04 A;  3PZD A;  5EDS A;  2XEV A;  1HU3 A;  2J08 A;  1SVX A;  4NIK A;  4HXI A;  4ATG A;  3SFX A;  4A63 B;  5LP0 A;  2LSV A;  2L6B A;  1FPP A;  2WPV A;  4O1O A;  4B8C B;  2GW1 A;  3QB2 A;  3R7R A;  4RG9 A;  3FTS A;  4K0R A;  2P58 C;  3FEX A;  2OOE A;  1JCS A;  4F53 A;  1E96 B;  4WWN A;  3SD5 A;  5AQ9 A;  2VSY A;  1A5E A;  2Y1L E;  4G8L A;  4G25 A;  1NZN A;  2OEV A;  2LAI A;  2VSO E;  4DX2 A;  2R59 A;  3SO8 A;  4FC8 A;  5D0Q D;  4GPM A;  4KMO A;  4JB8 P;  2JEK A;  3O4Z A;  4JHJ A;  4QQI A;  4TXP A;  1IQR A;  3NB2 A;  1HO8 A;  1LD8 A;  2C0M A;  5C2Y A;  1YCS B;  2DZO A;  4C0M A;  4BWR A;  3S2A A;  2V8S E;  3LCA A;  2Q7F A;  4FAD A;  3OXG A;  1TJC A;  1ELR A;  2HYZ A;  3MV2 B;  3SBS A;  2HE0 A;  2IO2 C;  1OWM A;  3UQ3 A;  2P9S G;  4R7L A;  3CQG B;  1D8D A;  1MQS A;  1SW6 A;  2LXL A;  5AIJ A;  3P2B A;  4LRZ A;  4GMR A;  4JA7 A;  2P9U G;  3MJW A;  4XKC A;  4DX5 D;  2I9C A;  2RD0 A;  3T8M A;  3DSV A;  4J0U A;  4M7C A;  3FUF A;  2P9P G;  3ASO E;  1K8K G;  3AG4 E;  3ONK A;  4LUN U;  4LER A;  4U7E B;  5KJN A;  2FEZ A;  3PDN A;  4AIF A;  3FH5 A;  2RFM A;  2IO3 C;  2XPY A;  2CHZ A;  3FUD A;  3B7U X;  3MEK A;  3NAW A;  4CEM A;  3FDH A;  5BXU A;  5FIO A;  4UWH A;  1H19 A;  4EZJ A;  3NZU A;  1SA5 A;  2ZXW E;  3QC1 A;  2H6I A;  3E34 A;  4Q94 A;  3I3N A;  4CT4 A;  1EDU A;  1EF1 C;  4UI9 J;  5J08 A;  1SZA A;  3UX4 A;  3PRE A;  2BF0 X;  1YMP A;  3IKO B;  1X81 A;  4I9C A;  1TEZ A;  1U3D A;  3MA5 A;  2L9B A;  2E2E A;  4OVV A;  1O1R A;  2H6G A;  5FZQ A;  3LVQ E;  4J8Y A;  5CEA A;  3QOU A;  4BES A;  1OCO E;  3ULQ A;  3NBN B;  3E37 A;  1NI1 A;  1N4Q A;  3IXE A;  3FEY A;  4FUL A;  2IU1 A;  3QAR A;  5CHE E;  4JW1 A;  4AV7 A;  2X6I A;  3ZU7 B;  4U63 A;  4GZ6 A;  4JD2 G;  4JZY A;  4EZL A;  4L23 A;  3DST A;  4UWK A;  2EIJ E;  3DPD A;  2WXK A;  1KZP A;  4XI0 A;  4GZC A;  2WXN A;  2XEH A;  1ZU2 A;  2YNQ A;  1OCZ E;  1HH8 A;  1H6O A;  3ZEF A;  2AWI A;  4XZ4 A;  2PQN A;  3HDX A;  2B0O E;  3PVL A;  2YIN A;  4A1G A;  4KT6 B;  1IQU A;  1NA0 A;  4HLE A;  2WXH A;  2L0T B;  1BLX B;  3PZ4 A;  4HOR A;  4CGW A;  1BI8 B;  5HKP A;  3C72 A;  3Q73 A;  2IOS A;  4KXK B;  2KC7 A;  1IKN D;  2R2L A;  4ACL A;  3CK7 A;  1LD7 A;  2OVB A;  2ILR A;  1O1S A;  3ENE A;  3TXN A;  1H2U A;  4BT9 A;  3KEA A;  4DK5 A;  3L22 A;  4UI9 C;  5ENS D;  3R9M A;  4U8Y D;  4K5B A;  5FZS A;  4EPZ A;  1NP7 A;  2LXM A;  3R9A B;  3D9L A;  1KT1 A;  2ETC A;  4YVQ C;  3GYZ A;  5ENQ D;  3Q75 A;  2RKK A;  3ASH A;  3UXG A;  1NFI E;  4GCN A;  4HFG A;  4C9B B;  4KYO B;  3PUJ A;  4GA1 A;  4KVO A;  3AS5 A;  1FVF A;  4FLB A;  3UIO C;  1JWG A;  2UY1 B;  4GTR A;  3DSW A;  3SY2 A;  4IYP A;  5IY5 E;  2QFC A;  2IY0 C;  2KAT A;  3D3M A;  3ASN E;  4H7Y A;  1BD8 A;  3ZGQ A;  4I9E A;  3IV0 A;  3ZYQ A;  2OND A;  1VDY A;  1EYH A;  2J4D A;  2F8Y A;  3LS8 A;  4HRN A;  5FJY A;  3G2W A;  4E6H A;  4G8K A;  2CHX A;  4JHR A;  1TN6 A;  4JA9 A;  1V55 E;  3RU0 A;  3U4T A;  3ABK E;  1MJ0 A;  1TNU A;  2EIN E;  3JQ0 A;  4N39 A;  2P9I G;  3OAW A;  4DX1 A;  2R05 A;  3SZ7 A;  3LPZ A;  4MRU A;  3FUN A;  2WXJ A;  1O1T A;  3Q79 A;  5T4Y A;  3GW4 A;  4FHJ A;  4LSZ E;  1Q2Z A;  4AM9 A;  4GTQ A;  2WXM A;  3MV3 B;  4HNA D;  1Y6I A;  3L9T A;  4WWO A;  3EIJ A;  1MX6 A;  3L6A A;  3UPV A;  2E0I A;  1JPL A;  3TWV A;  4UQY A;  4EBA G;  2BTD A;  2X6H A;  4LNU D;  4L2Y A;  1H2V C;  2NXP A;  3KSQ A;  4GU5 A;  1XGW A;  5JHA A;  4TUU A;  3UI2 A;  4GTS A;  5FTP A;  2KM4 A;  3AJI A;  3OTN A;  1MX2 A;  3GZS A;  2A5E A;  2X6K A;  5D0O D;  3RIB A;  4AJW A;  2P9K G;  2ZIS A;  1WAO 1;  4GTT A;  5AAR A;  4DX6 D;  1N0R A;  2VSX E;  4I2Z A;  4GTV A;  3RKV A;  4RVB A;  4GZ3 A;  4HOU A;  2MHK A;  2VYI A;  4X8Q A;  4I17 A;  1S64 A;  1JWF A;  3CHS A;  2C0L A;  4UWG A;  3MKQ A;  4UI9 K;  3CKB A;  3JYS A;  1BPO A;  4JEH A;  3TWT A;  3JUE A;  3UMV A;  4F1S A;  1OUV A;  4BFR A;  3FTU A;  5BV0 A;  3V2O A;  1K1A A;  4F3V A;  5HS0 A;  2AXV A;  4B93 B;  4HB5 A;  3FTX A;  3NOG D;  4RG6 A;  3NOC D;  3WXX A;  2PQR A;  2A4Z A;  2Y4T A;  3HVE A;  1SZ9 A;  2PNN A;  5ARF A;  3TWU A;  1OCC E;  2KBX A;  2Y3A A;  1WY6 A;  5JMN D;  2XHE A;  4UUC A;  3CVW A;  4GPK A;  3ESL A;  4TV3 A;  3FUM A;  2WQH A;  1WDY A;  3PEU B;  2QZA A;  3DEP A;  1JUQ A;  1KLX A;  3GZ1 A;  2WXL A;  2ZGG A;  2QC9 A;  4CT0 A;  4NUR A;  1QYM A;  4U95 D;  5EN5 D;  1BI7 B;  2Y4U A;  2P9L G;  4RLY A;  3NF1 A;  1TNZ A;  2WXO A;  2ETA A;  3D9H A;  1UW4 B;  1BU9 A;  3HVE B;  1H0A A;  3RO3 A;  4YDW A;  5BUZ A;  2H6F A;  3BEE A;  2GRO B;  3AS4 A;  2XEN A;  3V2X A;  5A23 A;  3PZ1 A;  5ENO D;  2ZIR A;  4H7X A;  2NYJ A;  3VLD A;  3E32 A;  2EQX A;  4JL0 A;  3N71 A;  3SQV A;  1UN8 A;  4W9R A;  5CMW A;  3L17 A;  1N4R A;  1ZB1 A;  3CVP A;  2WMN A;  4FHK A;  4NAC A;  3SNX A;  4E85 A;  2EIL E;  2FI7 A;  2BED A;  1PAQ A;  3NQP A;  2QY7 A;  4A55 A;  4J8E A;  3FU5 A;  2Y0B G;  3FU3 A;  4IRU A;  3QAQ A;  1B89 A;  4HVB A;  3CVU A;  5FQ6 A;  3FTW A;  1XNF A;  1OWO A;  4WNE A;  3LY8 A;  3Q9U C;  4JEU A;  2GRN B;  4TXR A;  3MCX A;  5KNG A;  1RZ4 A;  3QWW A;  2FBN A;  3ULE G;  4HLL A;  4MS6 A;  4CCA A;  2V5F A;  4N3C A;  3CVY A;  3C3R A;  4J8F A;  2GRM A;  2DVW A;  4KVM A;  3HXF A;  4A3T A;  1AWC B;  3PNL B;  3W9G A;  4OAV B;  5FIN A;  4I1M A;  1E7U A;  1H6K A;  4Y6W A;  4GCO A;  4BET A;  5JJ6 A;  4O6F A;  4PS3 A;  1A17 A;  2J4B A;  3FY4 A;  4N2S A;  4OVU A;  3E30 A;  3CVN A;  3EHM A;  1OCR E;  1P5Q A;  4HS2 A;  5AQA A;  3UIP C;  5AN8 A;  2P9N G;  1IXV A;  5KJL A;  3J5Q B;  4J8D A;  3PE3 A;  1UJJ A;  1NL4 A;  3RSE G;  2XZD G;  5EYP F;  2DCP A;  2WXF A;  3CHQ A;  4AEZ C;  2FF4 A;  3Q4A B;  3C98 A;  5CRU A;  5C1D A;  4NQ0 A;  3B7S A;  3CR3 A;  2ZGD A;  2I1K A;  3FUE A;  4WND A;  5DBK A;  5J90 A;  4XIF A;  4F1P A;  3EHR A;  1OY3 D;  4GTO A;  4PS7 A;  3D9K A;  2OEW A;  2XPI A;  1N54 A;  4AP2 A;  3SF4 A;  3CVL A;  1DC2 A;  3IHV A;  2AXU A;  3BG1 B;  3VTX A;  3EHQ A;  2ZU6 B;  3FH8 A;  2LUH A;  1TJF A;  4FJY A;  4I2W A;  1RW2 A;  3DBS A;  4EBA A;  4UWL A;  4EEC A;  3CVV A;  2YHE A;  3QDN A;  3PE4 A;  3LKU A;  3RRM B;  3IBE A;  4F6R D;  1QQE A;  3PNT B;  4YDY A;  4N5C A;  4GB9 A;  3TL5 A;  2WXR A;  1Y8M A;  4HI8 A;  1Z6T A;  3Q5M A;  3FWV A;  3Q47 B;  4ILH B;  3G2S A;  1L5J A;  4J8S A;  3DXM G;  3QWV A;  4M3O A;  3D9P A;  3FTV A;  3TGO A;  3DRA A;  2J49 A;  2KZT A;  4BEP A;  4ANX A;  5ANL A;  3ZHE A;  5AQ7 A;  4GYO A;  3UM3 A; 
#chains in the Genus database with same CATH homology
 4IUL A;  1Y6I A;  2YHC A;  4GYW A;  4GML A;  4WWO A;  4N2Q A;  2RG8 A;  4BSX A;  3EIJ A;  3L6A A;  2XCB A;  4J6I A;  3MYV A;  3G2V A;  4EQF A;  2HM8 A;  4PH4 B;  2IOL A;  3FH7 A;  3FHE A;  2WQ6 A;  2XCC A;  2HR2 A;  3LDZ A;  3UPV A;  2E0I A;  1JPL A;  3MGB A;  4APO A;  2WQ7 A;  2VSN A;  4GYY A;  4U04 A;  3PZD A;  5EDS A;  5G04 C;  3CVX A;  4UQY A;  4EBA G;  2BTD A;  2X6H A;  4L2Y A;  5FZR A;  3RJV A;  3HIZ A;  1H2V C;  1HG5 A;  2NXP A;  1HU3 A;  2X6J A;  2XEV A;  4GU5 A;  3UUX A;  1XGW A;  2J08 A;  5JHA A;  4BTB A;  5EX0 A;  4HXI A;  4ATG A;  4TUU A;  5E75 A;  5LP0 A;  5LCW C;  4U8H A;  2LSV A;  5LOZ A;  2WPV A;  4UWF A;  5AJL A;  4CDM A;  4B8C B;  3AU5 A;  2GW1 A;  5FTP A;  1PY1 A;  2KM4 A;  3D9M A;  1MHQ A;  3QB2 A;  3OTN A;  3GZS A;  4RG9 A;  3R7R A;  3EHN A;  3FTS A;  2X6K A;  4K0R A;  2P58 C;  3FEX A;  3ML9 A;  4JHK A;  2OOE A;  5D0O D;  2IJG X;  3RIB A;  4AJW A;  3S7D A;  4PUC A;  4F53 A;  4HOS A;  1E96 B;  3EIQ C;  2PM7 A;  4P29 A;  3QJZ A;  4B89 A;  5M72 A;  1WAO 1;  4WNF A;  5ENN A;  2VSX E;  2WVI A;  4WWN A;  3E4B A;  3SD5 A;  4I2Z A;  2AXZ A;  2VSY A;  4BY6 A;  2A5U A;  4N3A A;  3RKV A;  1KT0 A;  4ABN A;  2ION A;  3FU0 A;  4G25 A;  4RVB A;  5KJK A;  4GZ3 A;  3MZL B;  2MHK A;  4HOU A;  5FQ4 A;  1HFA A;  5KJM A;  1NZN A;  1GW6 A;  3LVR E;  1H2T C;  4UQZ A;  2LAI A;  2VSO E;  2VYI A;  1WM5 A;  2R59 A;  4FC8 A;  2HO1 A;  5D0Q D;  4I17 A;  4YVO A;  1JWF A;  3FTY A;  4KMO A;  1OWN A;  4L7T A;  4XKB A;  3EDT B;  4XX5 A;  4GAA A;  3TXM A;  3CHS A;  2C0L A;  2JEK A;  4UWG A;  3O4Z A;  2VJ8 A;  3O48 A;  3MKQ A;  3ZFW A;  4UI9 K;  2XGS A;  2XRZ A;  3CKB A;  4JHJ A;  3JYS A;  4FA6 A;  1BPO A;  4JEH A;  1IQR A;  1HO8 A;  3CST A;  3IEG A;  3L54 A;  3ONL A;  2DBA A;  3UT7 A;  2JLB A;  3UMV A;  4F1S A;  1OUV A;  2C0M A;  4BFR A;  5C2Y A;  3FTU A;  5BV0 A;  5T8I A;  3APC A;  3T5X A;  4WNG A;  3CIA A;  4F3V A;  2CFZ A;  4C0M A;  2AXV A;  4BWR A;  3FTX A;  3S2A A;  2V8S E;  3LCA A;  3CHR A;  4RG6 A;  4A1S A;  3PS6 A;  4U0Z A;  3WXX A;  2Q7F A;  4B94 A;  2PQR A;  2A4Z A;  2Y4T A;  4FAD A;  3HVE A;  3OXG A;  1SZ9 A;  4G26 A;  3CLJ A;  4CGV A;  1TJC A;  4YND A;  4FU3 A;  5ARF A;  1ELR A;  2XRY A;  2HYZ A;  2I2O A;  3MV2 B;  5FQ8 A;  3SBS A;  2Y3A A;  3JUI A;  4I1A A;  3VLE A;  3S7B A;  1WY6 A;  1OWM A;  2XHE A;  2VGX A;  4R7L A;  3CQG B;  3UQ3 A;  3CVW A;  1MQS A;  4GPK A;  4WAF A;  3ESL A;  4TV3 A;  3CKC A;  3FUM A;  3R7Q A;  2WQH A;  3P2B A;  5AIJ A;  4LRZ A;  3ASG A;  4JA7 A;  3CVQ A;  3MJW A;  4XKC A;  1UG3 A;  2I9C A;  2NSZ A;  5G04 J;  4G1T A;  4I6G A;  5HI7 A;  3PEU B;  4DI3 A;  2RD0 A;  3T8M A;  4J0U A;  3FUF A;  4U0S A;  4L2L A;  4Q69 A;  1QNF A;  2CG2 A;  4K03 A;  3S7F A;  5AEN A;  4HOT A;  1JUQ A;  4BX9 A;  1KLX A;  2FO7 A;  3GZ1 A;  4UQX A;  3ONK A;  4ME2 A;  2WXL A;  3ZPJ A;  3MKQ B;  4LUN U;  4D10 C;  4LER A;  5KJN A;  2FEZ A;  2LO6 A;  3PDN A;  2XPZ A;  4CT0 A;  4NUR A;  3G2T A;  4PS8 A;  4AIF A;  2Y4U A;  3FH5 A;  5FT9 A;  4EZK A;  1UJK A;  2XPY A;  2CHZ A;  3L16 A;  2KCK A;  3B7U X;  3FUD A;  3OXF A;  3MEK A;  3NF1 A;  3ZIM A;  4CEM A;  2WXO A;  3FDH A;  4Q96 A;  5KCM A;  4TRQ A;  4I1O B;  1UW4 B;  2V0P A;  3G2U A;  3HVE B;  5G2N A;  4JC8 A;  4UWH A;  3SFZ A;  1H0A A;  3RO3 A;  3CHP A;  4DLO A;  1HXI A;  1H19 A;  5HQ8 A;  4EZJ A;  3NZU A;  2WXI A;  3Q49 B;  3LY7 A;  5BUZ A;  3I4G A;  3QC1 A;  3BEE A;  4WWP A;  4ACK A;  2C2L A;  3AS4 A;  3FUL A;  4Q94 A;  3I3N A;  4CT4 A;  4IN3 B;  5G05 C;  3U9W A;  1EDU A;  1EF1 C;  2M63 A;  4UI9 J;  5J08 A;  3QNK A;  3ESK A;  4B8A A;  1EPU A;  5A23 A;  2LNI A;  2J09 A;  2KCV A;  4H7X A;  4KZ0 A;  3AS8 A;  3ZYM A;  2WB2 A;  1SZA A;  3UX4 A;  3PRE A;  3VLD A;  2EQX A;  2BF0 X;  3HYM B;  4JL0 A;  3IKO B;  2PM6 A;  3N71 A;  1ELK A;  3BG0 B;  1UN8 A;  3RRU A;  4I9C A;  3KAE A;  4AY5 A;  3VLF A;  3T5V A;  4G2V A;  1U3D A;  3MA5 A;  3CGH A;  4W9R A;  1TEZ A;  1E90 A;  2L9B A;  2E2E A;  3LXU X;  5CMW A;  5LX8 A;  2YQ8 A;  3L17 A;  4QFV A;  4OVV A;  5EKQ D;  3CVP A;  5ARG A;  2WMN A;  4FHK A;  3UT4 A;  4AVX A;  3CQC B;  4NAC A;  3SNX A;  2FUL A;  2GRL A;  4E85 A;  5JJT A;  3FFL A;  3OXL A;  2FI7 A;  5FZQ A;  1PAQ A;  2IF4 A;  4ILG A;  3NQP A;  3LVQ E;  2QY7 A;  3MKR A;  1HF8 A;  4A55 A;  1ELW A;  2PL2 A;  5BNW A;  3QOU A;  4GA0 A;  4BTA A;  5LFA A;  2GGF A;  1PC2 A;  5AYW D;  3ULQ A;  3IHY A;  3Q15 A;  3APD A;  3LYA A;  1LF8 A;  4J8E A;  3FU5 A;  1DNP A;  4RSY A;  2MOW A;  2J07 A;  3FU3 A;  3FU6 A;  2IQC A;  2LAH A;  4FP7 A;  4IRU A;  3QAQ A;  2VGY A;  3FEY A;  4FUL A;  3ML8 A;  2IU1 A;  1B89 A;  1HX8 A;  3PUK A;  3QAR A;  4GZD A;  4GZ5 A;  5CHE E;  4JW1 A;  5EX3 A;  3RRN B;  4HOQ A;  4AV7 A;  4HVB A;  4URK A;  3CVU A;  5FQ6 A;  2X6I A;  3RO2 A;  3FTW A;  3TJP A;  4U63 A;  5CMY A;  4GZ6 A;  5T3R A;  1FCH A;  4JZY A;  4A3V A;  1XNF A;  2UY1 A;  1OWO A;  2L6J A;  4WNE A;  3LY8 A;  2X6F A;  4EZL A;  4L23 A;  4UWK A;  4ILI A;  4JEU A;  3DPD A;  2WXK A;  1IHG A;  3FUI A;  3U64 A;  3K9I A;  1HG2 A;  5A6C A;  4I6J A;  3MCX A;  4XI0 A;  4GZC A;  4LCT A;  5FQ7 A;  3QWW A;  2FBN A;  4CDN A;  3AU4 A;  2WXN A;  1NA3 A;  1ZU2 A;  2YNQ A;  2VGX B;  4MS6 A;  4CCA A;  2V5F A;  4N3C A;  1HH8 A;  3LEW A;  3FP3 A;  3ZEF A;  2CG3 A;  4PDX A;  1ZBP A;  2AWI A;  4XZ4 A;  3CVY A;  2PQN A;  3HDX A;  4J8F A;  1E8Y A;  3TG5 A;  2GRM A;  2YIN A;  3QKY A;  5FWQ A;  4A1G A;  3QK0 A;  3U66 A;  1OWL A;  1Z3X A;  4KT6 B;  4KVM A;  1IQU A;  3KD7 A;  3PRZ A;  1YA0 A;  1NA0 A;  4HLE A;  2KCL A;  4MKT A;  4A3T A;  5LCW J;  3TG4 A;  2WXH A;  2L0T B;  4I43 A;  1E8X A;  3U3W A;  3PNL B;  4HOR A;  1U3C A;  3FUJ A;  4CGW A;  5ANR A;  2IOS A;  2WXP A;  4Y6C A;  3ZXS A;  4MLP A;  4KXK B;  5JJ7 A;  3APF A;  3CEQ A;  3B7T A;  1E7U A;  1E8W A;  4I1M A;  1H6K A;  4Y6W A;  2KC7 A;  2I6H A;  4GCO A;  2DIW A;  5JJ6 A;  4O6F A;  4PS3 A;  4ACL A;  3CK7 A;  2PZI A;  1A17 A;  2J4B A;  2OVB A;  3ASD A;  3FY4 A;  2ILR A;  4N2S A;  4OVU A;  3ENE A;  3TXN A;  1H2U A;  3CVN A;  4BT9 A;  2X38 A;  3EHM A;  1INZ A;  4DK5 A;  3LY9 A;  2VQ2 A;  4AOF A;  3ASF A;  3L22 A;  4UI9 C;  1P5Q A;  1UN9 A;  3FUK A;  2CHW A;  3CHM A;  5G05 J;  4BT8 A;  5BPP A;  4KBQ A;  5BW8 C;  3P1U A;  4HS2 A;  2XGO A;  5FZS A;  4EPZ A;  3RK6 A;  1DVP A;  3D9N A;  3ZRH A;  1NP7 A;  3CK9 A;  3I4R B;  3GZ2 A;  3R9A B;  5KJL A;  4ANV A;  1HS6 A;  1HZ4 A;  2CFU A;  3CV0 A;  3B13 A;  3D9L A;  2WMO A;  3PE3 A;  1UJJ A;  1KT1 A;  4J8D A;  4JVS A;  3ZW3 A;  4YVQ C;  1E8Z A;  5CCM A;  3GYZ A;  1W3B A;  1HE8 A;  2DCP A;  3ZN3 A;  3ZHE B;  2WXF A;  5E76 A;  3ASH A;  3UT8 A;  3CHQ A;  4NRH B;  4AEZ C;  2FF4 A;  4GCN A;  4HFG A;  4JXT A;  3Q4A B;  3C98 A;  4C9B B;  2AW6 A;  4KYO B;  2LSU A;  3JQ1 A;  3PUJ A;  5C1D A;  4NQ0 A;  3FTZ A;  4GA1 A;  3B7S A;  3CR3 A;  2IFU A;  4KZC A;  2I1K A;  4KVO A;  3AS5 A;  1X5B A;  4CRW A;  1SQM A;  3CK8 A;  3FUE A;  3ZYK A;  1FVF A;  4FLB A;  3URZ A;  4WND A;  1JWG A;  2UY1 B;  5DBK A;  5J90 A;  4XIF A;  5CCL A;  3ZYL A;  4IYP A;  1OWP A;  1E7V A;  4DJA A;  1QZ2 A;  2WXQ A;  2V4L A;  4ANW A;  2L0I A;  4G11 A;  2MRI A;  4PS7 A;  3D9K A;  2QFC A;  4GA2 A;  4DI4 A;  3EJN A;  3LJ3 A;  2XPI A;  3L08 A;  3VTY A;  1N54 A;  2KAT A;  4AP2 A;  1Z3Y A;  5BV1 A;  5BT1 A;  3SF4 A;  3KEZ A;  3D3M A;  3CVL A;  3L13 A;  2OVF A;  2VTB B;  3IHV A;  4H7Y A;  2AXU A;  3BG1 B;  4I9E A;  3IV0 A;  4U0U A;  3VTX A;  3ZGQ A;  3ZYQ A;  4XI9 A;  2ZU6 B;  3FH8 A;  3S7J A;  1TJF A;  2KZT B;  1VDY A;  1EYH A;  2OND A;  1N52 A;  3QWP A;  4FJY A;  4I2W A;  4L1B A;  5JHB A;  2OV8 A;  3SI5 A;  2J4D A;  4WUY A;  4BX8 A;  5DIZ A;  4G24 A;  3D9O A;  3DBS A;  3LS8 A;  3ZVV A;  1IYG A;  4LEU A;  5FJY A;  3G2W A;  3D9I A;  4EBA A;  3CHO A;  4APF A;  4E6H A;  4DPR A;  4FJZ A;  4UWL A;  2R5S A;  2CHX A;  4EEC A;  3SBT B;  3CVV A;  2YHE A;  3KS2 A;  3QDN A;  3I5P A;  2XQ0 A;  4XE0 A;  3PE4 A;  5AJD A;  5A7D B;  4I6E A;  3SGH A;  4JHR A;  4C0E A;  3PEV B;  4JA9 A;  3LKU A;  3RRM B;  4OYS A;  2UWJ G;  3TAX A;  3HHM A;  3IBE A;  3RU0 A;  3B7R L;  3U4T A;  1QQE A;  2WXG A;  3PNT B;  4U07 A;  4AXH A;  3JQ0 A;  4N5C A;  4DLQ A;  4GB9 A;  3TL5 A;  4ANU A;  3FUH A;  4FLH A;  4N39 A;  2WXR A;  3OAW A;  4V3I A;  1Y8M A;  3PH0 C;  1Z6T A;  2J9Q A;  3NZS A;  3Q5M A;  4F7A A;  3FWV A;  3Q47 B;  4ILH B;  3MX3 A;  3SZ7 A;  3LPZ A;  4MRU A;  3FUN A;  4GMJ A;  2BUG A;  3G2S A;  3CSF A;  1L5J A;  2X3M A;  2I1J A;  3D9J A;  4J8S A;  4M3O A;  3QWV A;  4CDR A;  3D9P A;  2WXJ A;  2XGM A;  4G23 A;  3FTV A;  5T4Y A;  3GW4 A;  4JPS A;  4FHJ A;  3TGO A;  4AY6 A;  5G55 A;  1S0P A;  3JCK C;  1FVH A;  2WM9 A;  2J49 A;  2NC9 A;  2KZT A;  2AVP A;  4AM9 A;  2R17 C;  4B0Z A;  2WXM A;  3MV3 B;  4ANX A;  5ANL A;  3ZHE A;  3SHF A;  3PVL A;  4N3B A;  4GYO A;  2VTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...