4A1GA

The crystal structure of the human bub1 tpr domain in complex with the ki motif of knl1
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
146
structure length
146
Chain Sequence
b'DTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQAEPREFLQQQYRLFQTRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOTIC CHECKPOINT SERINE/THREONINE-PROTEIN KINASE BUB1
publication title Structural Analysis Reveals Features of the Spindle Checkpoint Kinase Bub1-Kinetochore Subunit Knl1 Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 62
structure length 146
sequence length 146
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08311 Mad3_BUB1_I Mad3/BUB1 homology region 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.430 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4a1gA00
4A1GA 4AEZC 2LAHA 2WVIA 3SI5A
chains in the Genus database with same CATH superfamily
1E7UA 3FH5A 2EQXA 3Q7FA 4DUIA 3SBTB 3PEUB 2V0PA 4FULA 4D10C 4TV3A 3LDZA 4XZ4A 3HXEA 5JHAA 2BUGA 3TWSA 2OVFA 2IF4A 3UM0A 4ATZD 4UWGA 3MGBA 5T4YA 2E0IA 4XE0A 3GZ2A 4ANXA 2ZXWE 3D9MA 2RG8A 5CEAA 5A6CA 3QOUA 2XRYA 3JUEA 4JZYA 3D9NA 3C3QA 3DSSA 4JD2G 2P9LG 3PRZA 3TL5A 2P58C 1E96B 5AQ7A 1QYMA 3HIZA 5FQ4A 1SZ9A 3FFLA 5LP0A 3HG0D 1KT1A 1OT8A 3QDNA 5ITZF 1HS6A 2R17C 3EHMA 1QQEA 3L82A 5FZSA 3C98A 2DZOA 5ENNA 2VGEA 2VGXA 3CKBA 2WXHA 3ASHA 1WG0A 4CYMD 1U3CA 4PS8A 2XRZA 4A3TA 4EBAG 1Y8MA 1H6OA 1LD8A 4K5BA 4UWLA 3SI5A 4U0SA 1H19A 5BNWA 3DEPA 5EIDA 4KVOA 3TXMA 1QBQA 1MQSA 3UMVA 1V54E 2H6HA 1FVFA 1OWPA 4A63B 3BUAA 3FTYA 4HRNA 2A5EA 3HYMB 2YNQA 4HXIA 5CMWA 1OXJA 4NIKA 4GMRA 2I1JA 4CT4A 2NYJA 1E8ZA 5FT9A 2P9NG 4WNGA 2WXRA 4ZFHA 4JA7A 4Y6WA 2J4BA 5LCWJ 3U64A 4BSXA 5LCWC 3QWPA 2EIME 3L6AA 2L0IA 2IOLA 1N4PA 2WXFA 4RLYA 1BI8B 3W9GA 1SA4A 4GCOA 1Q2ZA 4HQDA 1OUVA 4NRHB 2KCVA 3EHNA 4HORA 3ULQA 4KZ0A 2KXPC 1Z3XA 3FUEA 5T3RA 3FUKA 4HS2A 3ZW3A 4A1GA 4LRZA 2LAIA 2HR2A 4XX5A 4J8DA 1S70B 1TNBA 3FY4A 5AQ9A 2CG2A 3MV2B 5BV1A 4FU3A 1FCHA 4K5AB 3L13A 2GW1A 3BU8A 5J08A 2AJAA 3RO3A 1EPUA 3RIBA 3S7BA 1DVPA 3HVEA 4JHJA 4GCNA 3RRNB 1PAQA 3FUJA 2J9QA 2FEZA 3EHRA 3CKCA 2XZTG 5AJDA 1N54A 1W3BA 4XI0A 4BSZB 2VYIA 4BFRA 4KT6B 4DX1A 3B7RL 5LX8A 2J49A 4TXRA 3CVUA 1A17A 2FO7A 3UM1A 3G2SA 4XKCA 5EX3A 3TWUA 2PL2A 2XS1A 1MJ0A 5BXOA 2Y4TA 4KVMA 2P9UG 3AG1E 3VTYA 3CK7A 4PDXA 4B93B 2CHXA 2JABA 1D8EA 5AAOA 2GROB 4RG9A 4AEZC 4JEHA 4WNFA 2V8SE 4URKA 4U0UA 3QJZA 1H2TC 4CDMA 1JPLA 4A1SA 2DYRE 2CG3A 3ONLA 4I17A 3E37A 1SQMA 5D2MC 2ZIRA 5JJ7A 2CFZA 4GA1A 4BEPA 3OAWA 5B1AE 5D0OD 3B13A 2B0OE 2OVBA 2WXMA 3T8KA 1INZA 4ANWA 4CGVA 4DLOA 1O1TA 3ESLA 2J07A 1TNYA 3Q7AA 3KAEA 3TG5A 2E2EA 3HXBA 3FU0A 1TNUA 2Y4UA 4ATGA 4RSYA 5BPPA 4BX8A 1E8WA 3QC1A 4N3AA 5A7DB 5KJNA 1EF1C 3FTZA 2FBNA 4HOSA 3HVEB 5CBNA 3SF4A 5HKPA 3OTNA 3UTMA 3F6QA 3LEWA 4DI3A 3FTVA 1KT0A 2MOWA 3CQCB 1NI1A 1JCSA 5AQAA 4XIFA 5FQ7A 2PM6A 3JQ0A 2XQ0A 3VTXA 2I9CA 3IKOB 4EHMA 3QB2A 5ENRD 3TG4A 1GW6A 3OXGA 4A3VA 4FP7A 1HE8A 4N2QA 1K3ZD 1WDYA 3MA5A 3CK9A 4GPMA 4LSZE 4X8QA 5J90A 4LNUD 3SBSA 3DSWA 3L22A 2UY1B 3FU6A 4K5CA 3LPZA 2MYOA 3L16A 4M3OA 1ZU2A 1N52A 3NOGD 5FINA 3SFZA 4N3BA 1OWMA 2XCCA 4HOTA 3ZYLA 3MV3B 3KSQA 2X3MA 3SZ7A 5EILA 3ZXSA 2KM4A 4BY6A 1N95A 1ELKA 3FTWA 1UW4B 2IO3C 3G2UA 4YDYA 3C3RA 3SNXA 3UKRG 4FC8A 3QAQA 4AJWA 2BKGA 1QZ2A 3KEZA 4YDOA 3JUIA 1JCQA 5FZQA 4YVOA 4GTMA 3E33A 5KJLA 4GMJA 2Y1LE 1IXVA 3UT8A 3Q4AB 2M63A 2C2LA 3DWLG 3EDTB 3PZ4A 3TJPA 3D9LA 4G8LA 2J8SD 4TRQA 3ASFA 3Q79A 4JHRA 3NF1A 2VJ8A 4C48B 3GYZA 3I3NA 4AY5A 1N4SA 5AARA 1HO8A 2WM9A 4DX2A 3FWVA 1NA0A 5ENQD 4YDEA 2WXQA 3UI2A 4RVBA 5BUZA 3MYVA 2QZAA 4HBDA 4ACLA 1UJKA 1SA5A 3BG0B 3FTUA 2ONDA 3UUXA 1OCZE 4UWHA 5AJLA 3MCXA 3CQGB 4HVBA 3BG1B 4HI9A 1DNPA 5HS0A 2CHWA 3C5RA 5KWDA 4B89A 1D8DA 4O60A 3S7FA 3DEOA 1H6PA 4CDRA 4KYOB 4AM9A 2RD0A 3DPYA 5BXUA 3UXGA 2R03A 4GZ5A 4G25A 3CVQA 1K1BA 1JWGA 3PZ1A 1E8YA 1TJFA 2A4ZA 1N0QA 3T5VA 3SO8A 3V31A 1N11A 2BF0X 4N5QA 3ASDA 3ZPJA 3ULEG 2XGMA 5BV0A 1N9AA 1X5BA 3DRAA 2QYJA 5FIOA 3HRAA 3FULA 3CV0A 3G2VA 3CLJA 2I2OA 2KATA 2WXLA 3PVLA 1IYGA 2VSYA 4L1BA 3D9IA 4MBGA 3ESKA 4MKTA 1HH8A 5KBAA 2IEJA 2DYSE 4U0ZA 3CHSA 5CECB 2Q7FA 1TJCA 2R59A 1BU9A 2IOSA 3LKUA 2IY0C 3KD7A 2VSXE 2GRLA 5FJYA 2KZTB 3SD5A 2EILE 3ZU7B 3I5PA 4H7YA 3PEVB 2KCLA 4J8SA 3FEXA 3MKQB 1WM5A 1ZB1A 2P9PG 2X38A 5ENOD 5KJKA 3CK8A 2FULA 4E6HA 4JC8A 4JVSA 2WXIA 2YINA 3PE3A 1WAO1 1PY1A 2VTBB 3LY9A 3TAXA 2GRRB 1FT2A 4OAVB 3P2BA 1E90A 4UI9J 3FP3A 4KZCA 5C1DA 1KZPA 3SHFA 4UI9C 3CHQA 2AXVA 3HXFA 4EBAA 3MEKA 1HZ4A 3CVLA 3APCA 2MHKA 3UT7A 5ANRA 4EZLA 2PQRA 4G24A 4CCAA 2VGYA 1EYHA 5KJMA 4B8AA 1NZNA 3MX3A 1OCOE 3TWRA 4BERA 1ELRA 1TN7A 1UG3A 4GTTA 4IULA 4LERA 1KLXA 4OVUA 3BQOA 4E85A 3MZLB 4J0UA 4G2VA 3FU3A 3RO2A 2L0TB 4GA2A 3RSEG 3DSTA 3QWVA 4YVQC 3ZXPA 1YA0A 2HO1A 4PUCA 5EKQD 5CCLA 4GTPA 3U3WA 3O48A 2C0LA 5JJ6A 4HI8A 4Q69A 2EINE 4QQIA 3FTXA 3IV0A 4N3CA 4N2SA 5EIBE 2JEKA 3ZYKA 2X6HA 1V55E 3ABLE 2LXMA 3QWWA 3EIJA 3UT4A 3FHEA 3B7SA 3FUDA 3ENEA 2GRQB 5DBKA 2X6JA 3QNKA 4LUNU 3ZGQA 2XPZA 1D9SA 1O1SA 1HU3A 2V5QC 3CVVA 4IYPA 3ZVVA 3PUJA 4U95D 1K1AA 2PNNA 2UWJG 4DI4A 2PM7A 4I6JA 1KPSB 2WXGA 2XEEA 2JLBA 2ETAA 4AXHA 1FT1A 3I4RB 3Q9NC 5IY5E 3DSUA 3ZNGA 2UY1A 3V30A 2HYZA 3LS8A 1NL4A 2J09A 3CHOA 2OEWA 1AP7A 4CEMA 4O6FA 3FUFA 5CEDB 5HI7A 3UX4A 3TWXA 3HXCA 2ETBA 1AWCB 4GZ3A 2EIKE 2FI7A 5AYWD 4EECA 2VSOE 3IBEA 2NSZA 1OWLA 4DX5D 3PREA 4ILIA 4HFGA 3LVRE 3V2OA 5CMYA 3AJIA 1HG5A 3ABKE 4LNBA 2QY7A 3U9WA 3TWWA 4J6IA 4KBQA 4HRMB 4KMOA 2XENA 2P9KG 4UUCA 3ZHEB 2WQ7A 3O4ZA 4YNDA 2MRIA 3NZUA 2IFUA 4UWKA 3S2AA 4B94A 5AN8A 1LTXA 2XGOA 5JHBA 4C0EA 3Q15A 4AIFA 3EIQC 5CRUA 1BPOA 2YHCA 3CEQA 2LXLA 1Y6IA 2OOEA 4F1PA 1IQRA 3TXNA 2XZDG 5HQ8A 3WG7E 5E75A 3DBSA 2AXZA 1XNFA 2X6FA 4U8HA 1ELWA 3ZUVB 1Z5SC 1DC2A 4W9RA 4B0ZA 3UIOC 3AU5A 3Q75A 3E30A 4EZKA 3T5XA 2ZISA 2R2LA 4BT8A 2BTDA 4CGWA 5ARGA 2YHEA 4F1SA 2GRNB 3NZSA 4FLBA 5EYPF 3FEYA 1BI7B 1DCQA 3ZYMA 4GAAA 3FH7A 3W9FA 3OXLA 4JA9A 4F6RD 2Y3AA 1A5EA 4I1MA 4R7LA 3D9PA 2FF4A 3FUIA 3V2XA 1OWOA 3UQ3A 4J8YA 4FA6A 4N5CA 4U96D 4GZCA 5AQBA 4WWNA 2LAHA 5D0QD 3RAUA 3PE4A 4JW1A 1UN8A 2NC9A 3D9HA 3L54A 4JHKA 3R9MA 3QKYA 4OVVA 2XGSA 3CHPA 4M7CA 3FH8A 3ML9A 5G55A 4JB8P 3RU0A 1WY6A 3EJNA 5CBOA 3IEGA 1MX6A 3PZDA 4B8CB 5ENSD 4DK5A 3JYSA 3DSXA 3CIAA 3FTSA 4ILHB 4YDWA 3FUHA 2WXOA 3L9TA 1NA3A 2RFMA 1SW6A 3JQ1A 2H6IA 2XPIA 3ABME 1RW2A 3T8MA 2LUHA 2DWZA 1RZ4A 4FHJA 4I1AA 1N4RA 5G04J 3IHVA 3AG3E 3R7RA 2ETCA 3PNTB 4LEUA 3HDXA 5G04C 2R02A 2KZTA 4ACKA 3RJVA 3MKRA 4FADA 5AIJA 2BEDA 3SQVA 4GPKA 3J5PA 3MKQA 1ZBPA 3V79K 3CR3A 4MS6A 3TWTA 1S64A 2CFUA 3WXXA 4UQYA 3D9OA 1BLXB 2F8YA 3B95A 2WMOA 4XI9A 3RRUA 1HF8A 4LNGA 1O5MA 2VTBA 3CVXA 3NB2A 3IHYA 5DIZA 3CSFA 2XEVA 3S7DA 4FLHA 3RKVA 2WQHA 5G05J 5T8IA 1NP7A 2A5UA 4L2YA 5G05C 5EDSA 4UQZA 2WB2A 2L6BA 4HRLA 4MLPA 3PH0C 5EX0A 2ZGDA 3EU5A 1XGWA 3ZKJA 4GYYA 2X6KA 3D3MA 1TR4A 5ENTD 1B89A 3CVYA 3ASOE 1UN9A 3SFYA 2AVPA 4HLEA 1KZOA 2RKKA 4ANVA 4AOFA 1MX4A 4BTAA 3E32A 4U04A 4GYOA 2IO2C 1E7VA 1TN8A 4FJZA 4JEUA 4DJAA 2FO1E 1BD8A 3UIPC 4GTQA 3L17A 2PQNA 4DX6D 4TUMA 4I2WA 3URZA 3D9KA 4GTVA 5CERB 3AS5A 4WNEA 2OCCE 1O1RA 3GZ1A 4J7WA 4APOA 4WWOA 1UJJA 3ML8A 1H2VC 3EHQA 2J08A 3SGHA 3DXMG 4FHKA 4Z68A 2VSNA 1L5JA 1S0PA 3JXIA 3Q78A 1MX2A 3HXDA 4TXQA 3TWQA 1OWNA 1SZAA 1JUQA 2V4LA 3KEAA 2DIWA 3S7JA 4F3VA 4L7TA 1NFIE 4I9EA 4QFVA 5D66A 4U07A 3PNLB 5FQ8A 2HE0A 2V4HC 4GZDA 1MZCA 2AWIA 3ZFWA 5JA4D 3QK0A 5BW8C 1HFAA 5C2YA 2BKKB 3PUKA 4J8FA 2IU1A 4LG6A 4NURA 2OV8A 3TGOA 2XEHA 5CCMA 1U2VG 2YQ8A 3G2TA 2R5SA 4G23A 4UQXA 1TEZA 4CDNA 3D9JA 3AAAC 5FZRA 5KNGA 2LSUA 3CVWA 3ASGA 2OEVA 2L9BA 1IHBA 2Y69E 3NAWA 4U8VD 4C0MA 1H6KA 3ZHEA 5FWQA 4GU5A 1N94A 3GZSA 4BESA 5CRVA 3LJNA 1H0AA 1HG2A 5HRYA 4TUUA 4KXKB 2F0YA 4OAUC 3U4TA 3VLFA 1JCRA 2I1KA 4Q94A 1S63A 4L2LA 2VQ2A 4C9BB 4Y6CA 2WPVA 5H7PA 3EUVA 3PZ3A 4CRWA 1MYOA 4F53A 4AVXA 5ARFA 4F7AA 1EDUA 1G3NB 4EPZA 1QNFA 2RFAA 4XEIG 5E76A 4GTSA 4JXTA 3I4GA 2VGXB 3SY2A 4G26A 2CHZA 2DCPA 4BTBA 2R05A 3B7TA 5EYLA 2EIJE 2PZIA 4K03A 3R9AB 3DXKG 3UM2A 4ILGA 4BWRA 3AG2E 3APDA 1Z3YA 4WAFA 4BT9A 4WNDA 2WXNA 2GGFA 2LO6A 4APFA 1FVHA 4DPRA 4UI9K 4HOQA 1TNZA 3Q47B 4K0RA 5A23A 3U66A 4L9PA 5M72A 3UM3A 4A55A 4PS3A 3TWVA 3ZRHA 1YMPA 2QC9A 4H7XA 2XCBA 3P1UA 2P9SG 3PS6A 1N4QA 4GMLA 2ZGGA 4JL0A 3CVNA 4N39A 1IKND 3LJ3A 4XKBA 1MHQA 3SFXA 4AV7A 2DBAA 5B1BE 4O1PA 1K8KG 4PS7A 2GRMA 3C72A 3LCAA 4I6GA 4Q96A 3G2WA 3AG4E 3Q9UC 3J5QB 3ASNE 1TNOA 2QFCA 3IXEA 3C3OA 4RQIA 3FUMA 2WVIA 2NXPA 1UOHA 2LNIA 2WXPA 1OCCE 4V3IA 5FQ6A 2X6IA 3DSVA 2XS8A 2IQCA 2KC7A 3ZIMA 1IHGA 2DVWA 3JCKC 1SVXA 1LD7A 5B3SE 1N0RA 3AS4A 4GA0A 4WWPA 5KNHD 4I1OB 1H2UA 3FUNA 1HX8A 3VLDA 4G1TA 5LOZA 2C0MA 5LFAA 3GW4A 4FJYA 2WXJA 3ONKA 4GB9A 3ZEFA 2P2CP 2ILRA 2L6JA 3ISMC 2H6FA 1P5QA 4U7EB 1OY3D 3RK6A 4ANUA 3ULYA 4BX9A 1PC2A 1FPPA 4I43A 3LVQE 4JPSA 4LCTA 2WXKA 2DZNA 3Q5MA 3NQPA 3PDNA 4MRUA 4HNAD 2P9IG 2XHEA 4GZ6A 1X81A 2AW6A 3B7UX 1Z6TA 3KSLA 3HHMA 2KBXA 3UPVA 5KCMA 4OYSA 4I2ZA 4PH4B 2V5FA 2Y0BG 1LF8A 4IN3B 4ME2A 4DLQA 3FDHA 5FTPA 1IQUA 5ANLA 1YCSB 4DX7D 2ZU6B 3MJWA 5AENA 3EU9A 3CGHA 4CZ2D 1TN6A 4AY6A 2WMNA 2XPYA 1VDYA 3LY8A 3ZN3A 4UWFA 3UINC 4NQ0A 3AU4A 5BT1A 3CHRA 4G8KA 3Q49B 1YYHA 4I6EA 3CHMA 2WQ6A 3L08A 3BEEA 3LYAA 2H6GA 3B7BA 4O1OA 2F8XK 4U8YD 3NOCD 3OXFA 1TYQG 3LY7A 4HOUA 4G11A 2I6HA 5EN5D 4I9CA 3QARA 4ZHBA 1U3DA 3K9IA 4GTOA 3RRMB 2QYUA 2B6CA 2F37A 2J4DA 3Q73A 4L23A 3DPDA 2HM8A 4NACA 4ABNA 2AXUA 3R7QA 3T9KA 2KCKA 3N71A 3NBNB 4J8EA 4P29A 1OCRE 3X2QE 4BETA 3CVPA 3VLEA 1DCEA 3LXUX 3FU5A 4GYWA 2IJGX 2IONA 3UKUG 4HLLA 4CT0A 3KS2A 5ENPD 5G2NA 1JWFA 5JMND 4RG6A 2LSVA 3E34A 3CSTA 4EQFA 4EZJA 4HB5A 4DRXE 3AS8A 2GRPB 4AP2A 4TXPA 4U63A 3ZYQA 1HXIA 1E8XA 4IRUA 3E4BA 5JJTA 3APFA 3JXJA 5CHEE 4WUYA 3PZ2A 4GTRA
chains in the Genus database with same CATH topology
5HI7A 1N52A 2OV8A 3TGOA 5CCMA 1E7UA 3UX4A 3FH5A 2EQXA 2YQ8A 3G2TA 2R5SA 4G23A 4UQXA 1TEZA 3SBTB 4CDNA 3D9JA 3PEUB 4GZ3A 2V0PA 4FULA 4D10C 2FI7A 3SFZA 4TV3A 3LDZA 4XZ4A 4N3BA 5AYWD 4EECA 5FZRA 2LSUA 2VSOE 3IBEA 3CVWA 3ASGA 2NSZA 5JHAA 2BUGA 2L9BA 1OWLA 1OWMA 3PREA 2XCCA 4HOTA 2OVFA 3ZYLA 4ILIA 4HFGA 2IF4A 3MV3B 3LVRE 5CMYA 2X3MA 4UWGA 3SZ7A 1HG5A 3ZXSA 2KM4A 2QY7A 3MGBA 5T4YA 2E0IA 4C0MA 1H6KA 3U9WA 4BY6A 4XE0A 4J6IA 3ZHEA 3GZ2A 1ELKA 3FTWA 1UW4B 3G2UA 4KBQA 4ANXA 3D9MA 4KMOA 5FWQA 2RG8A 3ZHEB 4GU5A 2WQ7A 3GZSA 3O4ZA 4YNDA 2MRIA 3NZUA 2IFUA 3SNXA 4UWKA 3S2AA 4FC8A 4B94A 3QAQA 4AJWA 5A6CA 3KEZA 1QZ2A 2XGOA 3QOUA 2XRYA 3JUIA 5JHBA 4JZYA 5FZQA 1H0AA 4WUYA 4YVOA 4C0EA 1HG2A 3D9NA 3Q15A 4TUUA 4AIFA 3EIQC 4KXKB 3PRZA 5KJLA 3U4TA 3TL5A 1BPOA 2YHCA 2P58C 3VLFA 4GMJA 3CEQA 2I1KA 1E96B 4Q94A 3UT8A 3Q4AB 1Y6IA 2M63A 3HIZA 4L2LA 2OOEA 2VQ2A 2C2LA 5FQ4A 1IQRA 4C9BB 4Y6CA 3TXNA 2WPVA 1SZ9A 5HQ8A 3EDTB 3FFLA 3TJPA 4CRWA 3D9LA 5LP0A 1KT1A 5E75A 3DBSA 2AXZA 1XNFA 2X6FA 3QDNA 4U8HA 4F53A 4TRQA 1HS6A 1ELWA 3ASFA 2R17C 4JHRA 3EHMA 3NF1A 4AVXA 5ARFA 1QQEA 5FZSA 4W9RA 4B0ZA 4F7AA 1EDUA 2VJ8A 3C98A 4EPZA 3AU5A 1QNFA 5ENNA 3GYZA 4EZKA 3T5XA 3I3NA 4AY5A 5E76A 2VGXA 4JXTA 4BT8A 1HO8A 3CKBA 2BTDA 4CGWA 2WXHA 2WM9A 3I4GA 5ARGA 2VGXB 2YHEA 3ASHA 3FWVA 1NA0A 1U3CA 2CHZA 2DCPA 4G26A 4F1SA 4BTBA 2WXQA 4PS8A 3NZSA 4FLBA 2XRZA 3B7TA 3FEYA 4A3TA 4EBAG 1Y8MA 2PZIA 4RVBA 5BUZA 3MYVA 4K03A 3R9AB 4ACLA 1UJKA 4UWLA 3SI5A 4U0SA 3BG0B 1H19A 5BNWA 3ZYMA 3FTUA 4ILGA 4BWRA 4KVOA 3TXMA 2ONDA 4GAAA 3FH7A 3UUXA 1MQSA 3OXLA 4JA9A 4UWHA 3APDA 3UMVA 1Z3YA 4WAFA 4BT9A 4WNDA 5AJLA 3MCXA 2WXNA 1FVFA 1OWPA 3CQGB 4HVBA 2Y3AA 3BG1B 1DNPA 4I1MA 2GGFA 2LO6A 2CHWA 3FTYA 4APFA 1FVHA 4R7LA 4B89A 4DPRA 3S7FA 3D9PA 4UI9K 2FF4A 3FUIA 4HOQA 3HYMB 3Q47B 4K0RA 1OWOA 4CDRA 5A23A 3U66A 2YNQA 3UQ3A 4HXIA 4KYOB 5CMWA 5M72A 4AM9A 4FA6A 2RD0A 4A55A 2I1JA 4N5CA 4PS3A 4CT4A 1E8ZA 3ZRHA 5FT9A 4GZCA 4WWNA 2LAHA 5D0QD 3PE4A 4H7XA 2XCBA 3P1UA 4WNGA 2WXRA 4JA7A 3PS6A 4GMLA 2J4BA 4GZ5A 1UN8A 4JW1A 4JL0A 4Y6WA 5LCWJ 2NC9A 4G25A 3CVNA 3U64A 3CVQA 3L54A 4BSXA 4N39A 1JWGA 4JHKA 5LCWC 3QWPA 1E8YA 1TJFA 2A4ZA 3LJ3A 3QKYA 4XKBA 1MHQA 3T5VA 4OVVA 3L6AA 4AV7A 2XGSA 2DBAA 3CHPA 2L0IA 3FH8A 2IOLA 2WXFA 3ML9A 4PS7A 2BF0X 2GRMA 5G55A 3ASDA 3ZPJA 3LCAA 4I6GA 3RU0A 4Q96A 4GCOA 1WY6A 3G2WA 2XGMA 3EJNA 5BV0A 1OUVA 4NRHB 1X5BA 2KCVA 3EHNA 4HORA 3IEGA 3ULQA 4KZ0A 3PZDA 1Z3XA 3FUEA 5T3RA 4B8CB 3FUKA 4HS2A 3ZW3A 4A1GA 4DK5A 3FULA 4LRZA 3JYSA 3CV0A 2LAIA 2HR2A 4XX5A 3G2VA 4ILHB 3CIAA 3FTSA 3CLJA 4J8DA 2I2OA 3FUHA 2KATA 2WXLA 2WXOA 3PVLA 2QFCA 1NA3A 1IYGA 2VSYA 3FY4A 3JQ1A 2XPIA 3FUMA 2WVIA 2CG2A 3T8MA 4L1BA 3D9IA 2NXPA 3MV2B 2LNIA 3ESKA 2WXPA 4FU3A 1HH8A 4MKTA 5BV1A 4V3IA 1FCHA 5FQ6A 3L13A 2GW1A 4U0ZA 3CHSA 4FHJA 5J08A 2X6IA 3RO3A 4I1AA 1EPUA 2IQCA 3RIBA 5G04J 3S7BA 1DVPA 3HVEA 4JHJA 3IHVA 2Q7FA 2KC7A 4GCNA 3RRNB 1IHGA 1TJCA 2R59A 3JCKC 3PNTB 3R7RA 3ZIMA 4LEUA 3AS4A 4GA0A 3HDXA 4WWPA 1PAQA 5G04C 2IOSA 3FUJA 3LKUA 2KZTA 4ACKA 3RJVA 3MKRA 2J9QA 2FEZA 3KD7A 3CKCA 4I1OB 2VSXE 5AJDA 1H2UA 2GRLA 5FJYA 3FUNA 1N54A 1W3BA 2KZTB 1HX8A 4XI0A 2VYIA 3VLDA 3SD5A 4FADA 4BFRA 5AIJA 4G1TA 4KT6B 5LOZA 2C0MA 3I5PA 5LFAA 4GPKA 3B7RL 3GW4A 3MKQA 4FJYA 1ZBPA 5LX8A 2WXJA 3CR3A 3ONKA 4H7YA 4GB9A 3PEVB 2KCLA 2J49A 4J8SA 4MS6A 3CVUA 1A17A 3FEXA 2CFUA 3MKQB 2FO7A 3ZEFA 1WM5A 3G2SA 4XKCA 5EX3A 3WXXA 2ILRA 4UQYA 2PL2A 3D9OA 2L6JA 2X38A 1P5QA 2Y4TA 4KVMA 5KJKA 2WMOA 3CK8A 4XI9A 2FULA 3RRUA 4E6HA 1HF8A 4JC8A 3RK6A 4ANUA 4JVSA 2WXIA 2VTBA 3VTYA 2YINA 3CK7A 4BX9A 4PDXA 3PE3A 1WAO1 3CVXA 1PC2A 1PY1A 2CHXA 2VTBB 3LY9A 3TAXA 3IHYA 4I43A 3LVQE 4RG9A 4AEZC 5DIZA 3P2BA 3CSFA 4JPSA 2XEVA 4JEHA 4LCTA 3S7DA 1E90A 4FLHA 4WNFA 4UI9J 3RKVA 2WQHA 2V8SE 4URKA 4U0UA 3QJZA 5G05J 3FP3A 4KZCA 5T8IA 1H2TC 5C1DA 2WXKA 1NP7A 3SHFA 2A5UA 4UI9C 4CDMA 4L2YA 1JPLA 3Q5MA 3NQPA 5G05C 3CHQA 3PDNA 2AXVA 4A1SA 5EDSA 4MRUA 2CG3A 3ONLA 4EBAA 3MEKA 2XHEA 1HZ4A 4I17A 4UQZA 3CVLA 4GZ6A 3APCA 2AW6A 2MHKA 1SQMA 3B7UX 2WB2A 3UT7A 1Z6TA 5ANRA 4EZLA 2PQRA 3HHMA 4G24A 4CCAA 3UPVA 2VGYA 5KCMA 4MLPA 1EYHA 3PH0C 4OYSA 5EX0A 4B8AA 4I2ZA 4PH4B 5JJ7A 5KJMA 1NZNA 1XGWA 2CFZA 3MX3A 4GA1A 2V5FA 4GYYA 2X6KA 3OAWA 1ELRA 3D3MA 1UG3A 4IULA 4LERA 1B89A 1KLXA 1LF8A 4IN3B 3CVYA 5D0OD 4ME2A 4OVUA 4DLQA 3B13A 1UN9A 3FDHA 1IQUA 5ANLA 5FTPA 4E85A 2OVBA 2ZU6B 2AVPA 3MZLB 4HLEA 2WXMA 1INZA 4J0UA 3MJWA 5AENA 4G2VA 4ANWA 4CGVA 3FU3A 3RO2A 2L0TB 4GA2A 4DLOA 3CGHA 3QWVA 4AY6A 4YVQC 2WMNA 2XPYA 1YA0A 2HO1A 3ESLA 2J07A 4PUCA 4ANVA 4AOFA 5EKQD 5CCLA 1VDYA 3O48A 3KAEA 4BTAA 3U3WA 2C0LA 3LY8A 4UWFA 5JJ6A 3TG5A 3ZN3A 4NQ0A 3AU4A 5BT1A 3CHRA 3Q49B 4Q69A 4U04A 4GYOA 2E2EA 3FTXA 3FU0A 1E7VA 4I6EA 4FJZA 3CHMA 2WQ6A 4JEUA 4DJAA 3L08A 3BEEA 2Y4UA 3LYAA 3IV0A 4ATGA 4N3CA 4N2SA 4RSYA 5BPPA 4BX8A 1E8WA 2JEKA 3ZYKA 2X6HA 3L17A 3QC1A 3OXFA 4N3AA 2PQNA 3LY7A 4HOUA 4G11A 5A7DB 5KJNA 2I6HA 4I9CA 3QARA 3QWWA 1EF1C 3EIJA 1U3DA 3K9IA 3FTZA 4I2WA 2FBNA 4HOSA 3RRMB 3URZA 3D9KA 3HVEB 3FHEA 3UT4A 3B7SA 3FUDA 3SF4A 3OTNA 3AS5A 4WNEA 3ENEA 5DBKA 2X6JA 2J4DA 3QNKA 4LUNU 3ZGQA 3GZ1A 3LEWA 4DI3A 2XPZA 3FTVA 4APOA 1KT0A 4L23A 4WWOA 2MOWA 3DPDA 1UJJA 3ML8A 1HU3A 3CQCB 2HM8A 4NACA 4ABNA 2AXUA 3R7QA 3CVVA 1H2VC 2KCKA 2J08A 3N71A 3SGHA 4FHKA 2VSNA 4XIFA 4IYPA 3ZVVA 1L5JA 1S0PA 3PUJA 4J8EA 4P29A 5FQ7A 2PM6A 3JQ0A 2XQ0A 3CVPA 3VLEA 2UWJG 3LXUX 3VTXA 3FU5A 4DI4A 2I9CA 4GYWA 1OWNA 1SZAA 2PM7A 4I6JA 2IJGX 2IONA 3IKOB 2WXGA 3QB2A 1JUQA 3TG4A 1GW6A 2V4LA 3KS2A 3OXGA 4A3VA 5G2NA 1JWFA 4CT0A 2DIWA 2JLBA 4AXHA 3S7JA 4RG6A 4FP7A 1HE8A 2LSVA 3I4RB 4N2QA 4F3VA 3CSTA 4EQFA 4EZJA 4L7TA 4I9EA 3MA5A 4QFVA 3CK9A 4U07A 2UY1A 3AS8A 5J90A 3PNLB 5FQ8A 3SBSA 4AP2A 2HYZA 4GZDA 4U63A 3L22A 2UY1B 3LS8A 3FU6A 2AWIA 3LPZA 3ZFWA 2J09A 3ZYQA 3CHOA 3QK0A 5BW8C 1HFAA 1HXIA 1E8XA 4IRUA 3E4BA 4CEMA 5C2YA 5JJTA 3L16A 3PUKA 3APFA 4J8FA 4O6FA 2IU1A 3FUFA 5CHEE 4M3OA 1ZU2A 4NURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A1G A;  4AEZ C;  2LAH A;  2WVI A;  3SI5 A; 
#chains in the Genus database with same CATH topology
 1E7U A;  3FH5 A;  2EQX A;  3Q7F A;  4DUI A;  3SBT B;  3PEU B;  2V0P A;  4FUL A;  4D10 C;  4TV3 A;  3LDZ A;  4XZ4 A;  3HXE A;  5JHA A;  2BUG A;  3TWS A;  2OVF A;  2IF4 A;  3UM0 A;  4ATZ D;  4UWG A;  3MGB A;  5T4Y A;  2E0I A;  4XE0 A;  3GZ2 A;  4ANX A;  2ZXW E;  3D9M A;  2RG8 A;  5CEA A;  5A6C A;  3QOU A;  2XRY A;  3JUE A;  4JZY A;  3D9N A;  3C3Q A;  3DSS A;  4JD2 G;  2P9L G;  3PRZ A;  3TL5 A;  2P58 C;  1E96 B;  5AQ7 A;  1QYM A;  3HIZ A;  5FQ4 A;  1SZ9 A;  3FFL A;  5LP0 A;  3HG0 D;  1KT1 A;  1OT8 A;  3QDN A;  5ITZ F;  1HS6 A;  2R17 C;  3EHM A;  1QQE A;  3L82 A;  5FZS A;  3C98 A;  2DZO A;  5ENN A;  2VGE A;  2VGX A;  3CKB A;  2WXH A;  3ASH A;  1WG0 A;  4CYM D;  1U3C A;  4PS8 A;  2XRZ A;  4A3T A;  4EBA G;  1Y8M A;  1H6O A;  1LD8 A;  4K5B A;  4UWL A;  3SI5 A;  4U0S A;  1H19 A;  5BNW A;  3DEP A;  5EID A;  4KVO A;  3TXM A;  1QBQ A;  1MQS A;  3UMV A;  1V54 E;  2H6H A;  1FVF A;  1OWP A;  4A63 B;  3BUA A;  3FTY A;  4HRN A;  2A5E A;  3HYM B;  2YNQ A;  4HXI A;  5CMW A;  1OXJ A;  4NIK A;  4GMR A;  2I1J A;  4CT4 A;  2NYJ A;  1E8Z A;  5FT9 A;  2P9N G;  4WNG A;  2WXR A;  4ZFH A;  4JA7 A;  4Y6W A;  2J4B A;  5LCW J;  3U64 A;  4BSX A;  5LCW C;  3QWP A;  2EIM E;  3L6A A;  2L0I A;  2IOL A;  1N4P A;  2WXF A;  4RLY A;  1BI8 B;  3W9G A;  1SA4 A;  4GCO A;  1Q2Z A;  4HQD A;  1OUV A;  4NRH B;  2KCV A;  3EHN A;  4HOR A;  3ULQ A;  4KZ0 A;  2KXP C;  1Z3X A;  3FUE A;  5T3R A;  3FUK A;  4HS2 A;  3ZW3 A;  4A1G A;  4LRZ A;  2LAI A;  2HR2 A;  4XX5 A;  4J8D A;  1S70 B;  1TNB A;  3FY4 A;  5AQ9 A;  2CG2 A;  3MV2 B;  5BV1 A;  4FU3 A;  1FCH A;  4K5A B;  3L13 A;  2GW1 A;  3BU8 A;  5J08 A;  2AJA A;  3RO3 A;  1EPU A;  3RIB A;  3S7B A;  1DVP A;  3HVE A;  4JHJ A;  4GCN A;  3RRN B;  1PAQ A;  3FUJ A;  2J9Q A;  2FEZ A;  3EHR A;  3CKC A;  2XZT G;  5AJD A;  1N54 A;  1W3B A;  4XI0 A;  4BSZ B;  2VYI A;  4BFR A;  4KT6 B;  4DX1 A;  3B7R L;  5LX8 A;  2J49 A;  4TXR A;  3CVU A;  1A17 A;  2FO7 A;  3UM1 A;  3G2S A;  4XKC A;  5EX3 A;  3TWU A;  2PL2 A;  2XS1 A;  1MJ0 A;  5BXO A;  2Y4T A;  4KVM A;  2P9U G;  3AG1 E;  3VTY A;  3CK7 A;  4PDX A;  4B93 B;  2CHX A;  2JAB A;  1D8E A;  5AAO A;  2GRO B;  4RG9 A;  4AEZ C;  4JEH A;  4WNF A;  2V8S E;  4URK A;  4U0U A;  3QJZ A;  1H2T C;  4CDM A;  1JPL A;  4A1S A;  2DYR E;  2CG3 A;  3ONL A;  4I17 A;  3E37 A;  1SQM A;  5D2M C;  2ZIR A;  5JJ7 A;  2CFZ A;  4GA1 A;  4BEP A;  3OAW A;  5B1A E;  5D0O D;  3B13 A;  2B0O E;  2OVB A;  2WXM A;  3T8K A;  1INZ A;  4ANW A;  4CGV A;  4DLO A;  1O1T A;  3ESL A;  2J07 A;  1TNY A;  3Q7A A;  3KAE A;  3TG5 A;  2E2E A;  3HXB A;  3FU0 A;  1TNU A;  2Y4U A;  4ATG A;  4RSY A;  5BPP A;  4BX8 A;  1E8W A;  3QC1 A;  4N3A A;  5A7D B;  5KJN A;  1EF1 C;  3FTZ A;  2FBN A;  4HOS A;  3HVE B;  5CBN A;  3SF4 A;  5HKP A;  3OTN A;  3UTM A;  3F6Q A;  3LEW A;  4DI3 A;  3FTV A;  1KT0 A;  2MOW A;  3CQC B;  1NI1 A;  1JCS A;  5AQA A;  4XIF A;  5FQ7 A;  2PM6 A;  3JQ0 A;  2XQ0 A;  3VTX A;  2I9C A;  3IKO B;  4EHM A;  3QB2 A;  5ENR D;  3TG4 A;  1GW6 A;  3OXG A;  4A3V A;  4FP7 A;  1HE8 A;  4N2Q A;  1K3Z D;  1WDY A;  3MA5 A;  3CK9 A;  4GPM A;  4LSZ E;  4X8Q A;  5J90 A;  4LNU D;  3SBS A;  3DSW A;  3L22 A;  2UY1 B;  3FU6 A;  4K5C A;  3LPZ A;  2MYO A;  3L16 A;  4M3O A;  1ZU2 A;  1N52 A;  3NOG D;  5FIN A;  3SFZ A;  4N3B A;  1OWM A;  2XCC A;  4HOT A;  3ZYL A;  3MV3 B;  3KSQ A;  2X3M A;  3SZ7 A;  5EIL A;  3ZXS A;  2KM4 A;  4BY6 A;  1N95 A;  1ELK A;  3FTW A;  1UW4 B;  2IO3 C;  3G2U A;  4YDY A;  3C3R A;  3SNX A;  3UKR G;  4FC8 A;  3QAQ A;  4AJW A;  2BKG A;  1QZ2 A;  3KEZ A;  4YDO A;  3JUI A;  1JCQ A;  5FZQ A;  4YVO A;  4GTM A;  3E33 A;  5KJL A;  4GMJ A;  2Y1L E;  1IXV A;  3UT8 A;  3Q4A B;  2M63 A;  2C2L A;  3DWL G;  3EDT B;  3PZ4 A;  3TJP A;  3D9L A;  4G8L A;  2J8S D;  4TRQ A;  3ASF A;  3Q79 A;  4JHR A;  3NF1 A;  2VJ8 A;  4C48 B;  3GYZ A;  3I3N A;  4AY5 A;  1N4S A;  5AAR A;  1HO8 A;  2WM9 A;  4DX2 A;  3FWV A;  1NA0 A;  5ENQ D;  4YDE A;  2WXQ A;  3UI2 A;  4RVB A;  5BUZ A;  3MYV A;  2QZA A;  4HBD A;  4ACL A;  1UJK A;  1SA5 A;  3BG0 B;  3FTU A;  2OND A;  3UUX A;  1OCZ E;  4UWH A;  5AJL A;  3MCX A;  3CQG B;  4HVB A;  3BG1 B;  4HI9 A;  1DNP A;  5HS0 A;  2CHW A;  3C5R A;  5KWD A;  4B89 A;  1D8D A;  4O60 A;  3S7F A;  3DEO A;  1H6P A;  4CDR A;  4KYO B;  4AM9 A;  2RD0 A;  3DPY A;  5BXU A;  3UXG A;  2R03 A;  4GZ5 A;  4G25 A;  3CVQ A;  1K1B A;  1JWG A;  3PZ1 A;  1E8Y A;  1TJF A;  2A4Z A;  1N0Q A;  3T5V A;  3SO8 A;  3V31 A;  1N11 A;  2BF0 X;  4N5Q A;  3ASD A;  3ZPJ A;  3ULE G;  2XGM A;  5BV0 A;  1N9A A;  1X5B A;  3DRA A;  2QYJ A;  5FIO A;  3HRA A;  3FUL A;  3CV0 A;  3G2V A;  3CLJ A;  2I2O A;  2KAT A;  2WXL A;  3PVL A;  1IYG A;  2VSY A;  4L1B A;  3D9I A;  4MBG A;  3ESK A;  4MKT A;  1HH8 A;  5KBA A;  2IEJ A;  2DYS E;  4U0Z A;  3CHS A;  5CEC B;  2Q7F A;  1TJC A;  2R59 A;  1BU9 A;  2IOS A;  3LKU A;  2IY0 C;  3KD7 A;  2VSX E;  2GRL A;  5FJY A;  2KZT B;  3SD5 A;  2EIL E;  3ZU7 B;  3I5P A;  4H7Y A;  3PEV B;  2KCL A;  4J8S A;  3FEX A;  3MKQ B;  1WM5 A;  1ZB1 A;  2P9P G;  2X38 A;  5ENO D;  5KJK A;  3CK8 A;  2FUL A;  4E6H A;  4JC8 A;  4JVS A;  2WXI A;  2YIN A;  3PE3 A;  1WAO 1;  1PY1 A;  2VTB B;  3LY9 A;  3TAX A;  2GRR B;  1FT2 A;  4OAV B;  3P2B A;  1E90 A;  4UI9 J;  3FP3 A;  4KZC A;  5C1D A;  1KZP A;  3SHF A;  4UI9 C;  3CHQ A;  2AXV A;  3HXF A;  4EBA A;  3MEK A;  1HZ4 A;  3CVL A;  3APC A;  2MHK A;  3UT7 A;  5ANR A;  4EZL A;  2PQR A;  4G24 A;  4CCA A;  2VGY A;  1EYH A;  5KJM A;  4B8A A;  1NZN A;  3MX3 A;  1OCO E;  3TWR A;  4BER A;  1ELR A;  1TN7 A;  1UG3 A;  4GTT A;  4IUL A;  4LER A;  1KLX A;  4OVU A;  3BQO A;  4E85 A;  3MZL B;  4J0U A;  4G2V A;  3FU3 A;  3RO2 A;  2L0T B;  4GA2 A;  3RSE G;  3DST A;  3QWV A;  4YVQ C;  3ZXP A;  1YA0 A;  2HO1 A;  4PUC A;  5EKQ D;  5CCL A;  4GTP A;  3U3W A;  3O48 A;  2C0L A;  5JJ6 A;  4HI8 A;  4Q69 A;  2EIN E;  4QQI A;  3FTX A;  3IV0 A;  4N3C A;  4N2S A;  5EIB E;  2JEK A;  3ZYK A;  2X6H A;  1V55 E;  3ABL E;  2LXM A;  3QWW A;  3EIJ A;  3UT4 A;  3FHE A;  3B7S A;  3FUD A;  3ENE A;  2GRQ B;  5DBK A;  2X6J A;  3QNK A;  4LUN U;  3ZGQ A;  2XPZ A;  1D9S A;  1O1S A;  1HU3 A;  2V5Q C;  3CVV A;  4IYP A;  3ZVV A;  3PUJ A;  4U95 D;  1K1A A;  2PNN A;  2UWJ G;  4DI4 A;  2PM7 A;  4I6J A;  1KPS B;  2WXG A;  2XEE A;  2JLB A;  2ETA A;  4AXH A;  1FT1 A;  3I4R B;  3Q9N C;  5IY5 E;  3DSU A;  3ZNG A;  2UY1 A;  3V30 A;  2HYZ A;  3LS8 A;  1NL4 A;  2J09 A;  3CHO A;  2OEW A;  1AP7 A;  4CEM A;  4O6F A;  3FUF A;  5CED B;  5HI7 A;  3UX4 A;  3TWX A;  3HXC A;  2ETB A;  1AWC B;  4GZ3 A;  2EIK E;  2FI7 A;  5AYW D;  4EEC A;  2VSO E;  3IBE A;  2NSZ A;  1OWL A;  4DX5 D;  3PRE A;  4ILI A;  4HFG A;  3LVR E;  3V2O A;  5CMY A;  3AJI A;  1HG5 A;  3ABK E;  4LNB A;  2QY7 A;  3U9W A;  3TWW A;  4J6I A;  4KBQ A;  4HRM B;  4KMO A;  2XEN A;  2P9K G;  4UUC A;  3ZHE B;  2WQ7 A;  3O4Z A;  4YND A;  2MRI A;  3NZU A;  2IFU A;  4UWK A;  3S2A A;  4B94 A;  5AN8 A;  1LTX A;  2XGO A;  5JHB A;  4C0E A;  3Q15 A;  4AIF A;  3EIQ C;  5CRU A;  1BPO A;  2YHC A;  3CEQ A;  2LXL A;  1Y6I A;  2OOE A;  4F1P A;  1IQR A;  3TXN A;  2XZD G;  5HQ8 A;  3WG7 E;  5E75 A;  3DBS A;  2AXZ A;  1XNF A;  2X6F A;  4U8H A;  1ELW A;  3ZUV B;  1Z5S C;  1DC2 A;  4W9R A;  4B0Z A;  3UIO C;  3AU5 A;  3Q75 A;  3E30 A;  4EZK A;  3T5X A;  2ZIS A;  2R2L A;  4BT8 A;  2BTD A;  4CGW A;  5ARG A;  2YHE A;  4F1S A;  2GRN B;  3NZS A;  4FLB A;  5EYP F;  3FEY A;  1BI7 B;  1DCQ A;  3ZYM A;  4GAA A;  3FH7 A;  3W9F A;  3OXL A;  4JA9 A;  4F6R D;  2Y3A A;  1A5E A;  4I1M A;  4R7L A;  3D9P A;  2FF4 A;  3FUI A;  3V2X A;  1OWO A;  3UQ3 A;  4J8Y A;  4FA6 A;  4N5C A;  4U96 D;  4GZC A;  5AQB A;  4WWN A;  2LAH A;  5D0Q D;  3RAU A;  3PE4 A;  4JW1 A;  1UN8 A;  2NC9 A;  3D9H A;  3L54 A;  4JHK A;  3R9M A;  3QKY A;  4OVV A;  2XGS A;  3CHP A;  4M7C A;  3FH8 A;  3ML9 A;  5G55 A;  4JB8 P;  3RU0 A;  1WY6 A;  3EJN A;  5CBO A;  3IEG A;  1MX6 A;  3PZD A;  4B8C B;  5ENS D;  4DK5 A;  3JYS A;  3DSX A;  3CIA A;  3FTS A;  4ILH B;  4YDW A;  3FUH A;  2WXO A;  3L9T A;  1NA3 A;  2RFM A;  1SW6 A;  3JQ1 A;  2H6I A;  2XPI A;  3ABM E;  1RW2 A;  3T8M A;  2LUH A;  2DWZ A;  1RZ4 A;  4FHJ A;  4I1A A;  1N4R A;  5G04 J;  3IHV A;  3AG3 E;  3R7R A;  2ETC A;  3PNT B;  4LEU A;  3HDX A;  5G04 C;  2R02 A;  2KZT A;  4ACK A;  3RJV A;  3MKR A;  4FAD A;  5AIJ A;  2BED A;  3SQV A;  4GPK A;  3J5P A;  3MKQ A;  1ZBP A;  3V79 K;  3CR3 A;  4MS6 A;  3TWT A;  1S64 A;  2CFU A;  3WXX A;  4UQY A;  3D9O A;  1BLX B;  2F8Y A;  3B95 A;  2WMO A;  4XI9 A;  3RRU A;  1HF8 A;  4LNG A;  1O5M A;  2VTB A;  3CVX A;  3NB2 A;  3IHY A;  5DIZ A;  3CSF A;  2XEV A;  3S7D A;  4FLH A;  3RKV A;  2WQH A;  5G05 J;  5T8I A;  1NP7 A;  2A5U A;  4L2Y A;  5G05 C;  5EDS A;  4UQZ A;  2WB2 A;  2L6B A;  4HRL A;  4MLP A;  3PH0 C;  5EX0 A;  2ZGD A;  3EU5 A;  1XGW A;  3ZKJ A;  4GYY A;  2X6K A;  3D3M A;  1TR4 A;  5ENT D;  1B89 A;  3CVY A;  3ASO E;  1UN9 A;  3SFY A;  2AVP A;  4HLE A;  1KZO A;  2RKK A;  4ANV A;  4AOF A;  1MX4 A;  4BTA A;  3E32 A;  4U04 A;  4GYO A;  2IO2 C;  1E7V A;  1TN8 A;  4FJZ A;  4JEU A;  4DJA A;  2FO1 E;  1BD8 A;  3UIP C;  4GTQ A;  3L17 A;  2PQN A;  4DX6 D;  4TUM A;  4I2W A;  3URZ A;  3D9K A;  4GTV A;  5CER B;  3AS5 A;  4WNE A;  2OCC E;  1O1R A;  3GZ1 A;  4J7W A;  4APO A;  4WWO A;  1UJJ A;  3ML8 A;  1H2V C;  3EHQ A;  2J08 A;  3SGH A;  3DXM G;  4FHK A;  4Z68 A;  2VSN A;  1L5J A;  1S0P A;  3JXI A;  3Q78 A;  1MX2 A;  3HXD A;  4TXQ A;  3TWQ A;  1OWN A;  1SZA A;  1JUQ A;  2V4L A;  3KEA A;  2DIW A;  3S7J A;  4F3V A;  4L7T A;  1NFI E;  4I9E A;  4QFV A;  5D66 A;  4U07 A;  3PNL B;  5FQ8 A;  2HE0 A;  2V4H C;  4GZD A;  1MZC A;  2AWI A;  3ZFW A;  5JA4 D;  3QK0 A;  5BW8 C;  1HFA A;  5C2Y A;  2BKK B;  3PUK A;  4J8F A;  2IU1 A;  4LG6 A;  4NUR A;  2OV8 A;  3TGO A;  2XEH A;  5CCM A;  1U2V G;  2YQ8 A;  3G2T A;  2R5S A;  4G23 A;  4UQX A;  1TEZ A;  4CDN A;  3D9J A;  3AAA C;  5FZR A;  5KNG A;  2LSU A;  3CVW A;  3ASG A;  2OEV A;  2L9B A;  1IHB A;  2Y69 E;  3NAW A;  4U8V D;  4C0M A;  1H6K A;  3ZHE A;  5FWQ A;  4GU5 A;  1N94 A;  3GZS A;  4BES A;  5CRV A;  3LJN A;  1H0A A;  1HG2 A;  5HRY A;  4TUU A;  4KXK B;  2F0Y A;  4OAU C;  3U4T A;  3VLF A;  1JCR A;  2I1K A;  4Q94 A;  1S63 A;  4L2L A;  2VQ2 A;  4C9B B;  4Y6C A;  2WPV A;  5H7P A;  3EUV A;  3PZ3 A;  4CRW A;  1MYO A;  4F53 A;  4AVX A;  5ARF A;  4F7A A;  1EDU A;  1G3N B;  4EPZ A;  1QNF A;  2RFA A;  4XEI G;  5E76 A;  4GTS A;  4JXT A;  3I4G A;  2VGX B;  3SY2 A;  4G26 A;  2CHZ A;  2DCP A;  4BTB A;  2R05 A;  3B7T A;  5EYL A;  2EIJ E;  2PZI A;  4K03 A;  3R9A B;  3DXK G;  3UM2 A;  4ILG A;  4BWR A;  3AG2 E;  3APD A;  1Z3Y A;  4WAF A;  4BT9 A;  4WND A;  2WXN A;  2GGF A;  2LO6 A;  4APF A;  1FVH A;  4DPR A;  4UI9 K;  4HOQ A;  1TNZ A;  3Q47 B;  4K0R A;  5A23 A;  3U66 A;  4L9P A;  5M72 A;  3UM3 A;  4A55 A;  4PS3 A;  3TWV A;  3ZRH A;  1YMP A;  2QC9 A;  4H7X A;  2XCB A;  3P1U A;  2P9S G;  3PS6 A;  1N4Q A;  4GML A;  2ZGG A;  4JL0 A;  3CVN A;  4N39 A;  1IKN D;  3LJ3 A;  4XKB A;  1MHQ A;  3SFX A;  4AV7 A;  2DBA A;  5B1B E;  4O1P A;  1K8K G;  4PS7 A;  2GRM A;  3C72 A;  3LCA A;  4I6G A;  4Q96 A;  3G2W A;  3AG4 E;  3Q9U C;  3J5Q B;  3ASN E;  1TNO A;  2QFC A;  3IXE A;  3C3O A;  4RQI A;  3FUM A;  2WVI A;  2NXP A;  1UOH A;  2LNI A;  2WXP A;  1OCC E;  4V3I A;  5FQ6 A;  2X6I A;  3DSV A;  2XS8 A;  2IQC A;  2KC7 A;  3ZIM A;  1IHG A;  2DVW A;  3JCK C;  1SVX A;  1LD7 A;  5B3S E;  1N0R A;  3AS4 A;  4GA0 A;  4WWP A;  5KNH D;  4I1O B;  1H2U A;  3FUN A;  1HX8 A;  3VLD A;  4G1T A;  5LOZ A;  2C0M A;  5LFA A;  3GW4 A;  4FJY A;  2WXJ A;  3ONK A;  4GB9 A;  3ZEF A;  2P2C P;  2ILR A;  2L6J A;  3ISM C;  2H6F A;  1P5Q A;  4U7E B;  1OY3 D;  3RK6 A;  4ANU A;  3ULY A;  4BX9 A;  1PC2 A;  1FPP A;  4I43 A;  3LVQ E;  4JPS A;  4LCT A;  2WXK A;  2DZN A;  3Q5M A;  3NQP A;  3PDN A;  4MRU A;  4HNA D;  2P9I G;  2XHE A;  4GZ6 A;  1X81 A;  2AW6 A;  3B7U X;  1Z6T A;  3KSL A;  3HHM A;  2KBX A;  3UPV A;  5KCM A;  4OYS A;  4I2Z A;  4PH4 B;  2V5F A;  2Y0B G;  1LF8 A;  4IN3 B;  4ME2 A;  4DLQ A;  3FDH A;  5FTP A;  1IQU A;  5ANL A;  1YCS B;  4DX7 D;  2ZU6 B;  3MJW A;  5AEN A;  3EU9 A;  3CGH A;  4CZ2 D;  1TN6 A;  4AY6 A;  2WMN A;  2XPY A;  1VDY A;  3LY8 A;  3ZN3 A;  4UWF A;  3UIN C;  4NQ0 A;  3AU4 A;  5BT1 A;  3CHR A;  4G8K A;  3Q49 B;  1YYH A;  4I6E A;  3CHM A;  2WQ6 A;  3L08 A;  3BEE A;  3LYA A;  2H6G A;  3B7B A;  4O1O A;  2F8X K;  4U8Y D;  3NOC D;  3OXF A;  1TYQ G;  3LY7 A;  4HOU A;  4G11 A;  2I6H A;  5EN5 D;  4I9C A;  3QAR A;  4ZHB A;  1U3D A;  3K9I A;  4GTO A;  3RRM B;  2QYU A;  2B6C A;  2F37 A;  2J4D A;  3Q73 A;  4L23 A;  3DPD A;  2HM8 A;  4NAC A;  4ABN A;  2AXU A;  3R7Q A;  3T9K A;  2KCK A;  3N71 A;  3NBN B;  4J8E A;  4P29 A;  1OCR E;  3X2Q E;  4BET A;  3CVP A;  3VLE A;  1DCE A;  3LXU X;  3FU5 A;  4GYW A;  2IJG X;  2ION A;  3UKU G;  4HLL A;  4CT0 A;  3KS2 A;  5ENP D;  5G2N A;  1JWF A;  5JMN D;  4RG6 A;  2LSV A;  3E34 A;  3CST A;  4EQF A;  4EZJ A;  4HB5 A;  4DRX E;  3AS8 A;  2GRP B;  4AP2 A;  4TXP A;  4U63 A;  3ZYQ A;  1HXI A;  1E8X A;  4IRU A;  3E4B A;  5JJT A;  3APF A;  3JXJ A;  5CHE E;  4WUY A;  3PZ2 A;  4GTR A; 
#chains in the Genus database with same CATH homology
 5HI7 A;  1N52 A;  2OV8 A;  3TGO A;  5CCM A;  1E7U A;  3UX4 A;  3FH5 A;  2EQX A;  2YQ8 A;  3G2T A;  2R5S A;  4G23 A;  4UQX A;  1TEZ A;  3SBT B;  4CDN A;  3D9J A;  3PEU B;  4GZ3 A;  2V0P A;  4FUL A;  4D10 C;  2FI7 A;  3SFZ A;  4TV3 A;  3LDZ A;  4XZ4 A;  4N3B A;  5AYW D;  4EEC A;  5FZR A;  2LSU A;  2VSO E;  3IBE A;  3CVW A;  3ASG A;  2NSZ A;  5JHA A;  2BUG A;  2L9B A;  1OWL A;  1OWM A;  3PRE A;  2XCC A;  4HOT A;  2OVF A;  3ZYL A;  4ILI A;  4HFG A;  2IF4 A;  3MV3 B;  3LVR E;  5CMY A;  2X3M A;  4UWG A;  3SZ7 A;  1HG5 A;  3ZXS A;  2KM4 A;  2QY7 A;  3MGB A;  5T4Y A;  2E0I A;  4C0M A;  1H6K A;  3U9W A;  4BY6 A;  4XE0 A;  4J6I A;  3ZHE A;  3GZ2 A;  1ELK A;  3FTW A;  1UW4 B;  3G2U A;  4KBQ A;  4ANX A;  3D9M A;  4KMO A;  5FWQ A;  2RG8 A;  3ZHE B;  4GU5 A;  2WQ7 A;  3GZS A;  3O4Z A;  4YND A;  2MRI A;  3NZU A;  2IFU A;  3SNX A;  4UWK A;  3S2A A;  4FC8 A;  4B94 A;  3QAQ A;  4AJW A;  5A6C A;  3KEZ A;  1QZ2 A;  2XGO A;  3QOU A;  2XRY A;  3JUI A;  5JHB A;  4JZY A;  5FZQ A;  1H0A A;  4WUY A;  4YVO A;  4C0E A;  1HG2 A;  3D9N A;  3Q15 A;  4TUU A;  4AIF A;  3EIQ C;  4KXK B;  3PRZ A;  5KJL A;  3U4T A;  3TL5 A;  1BPO A;  2YHC A;  2P58 C;  3VLF A;  4GMJ A;  3CEQ A;  2I1K A;  1E96 B;  4Q94 A;  3UT8 A;  3Q4A B;  1Y6I A;  2M63 A;  3HIZ A;  4L2L A;  2OOE A;  2VQ2 A;  2C2L A;  5FQ4 A;  1IQR A;  4C9B B;  4Y6C A;  3TXN A;  2WPV A;  1SZ9 A;  5HQ8 A;  3EDT B;  3FFL A;  3TJP A;  4CRW A;  3D9L A;  5LP0 A;  1KT1 A;  5E75 A;  3DBS A;  2AXZ A;  1XNF A;  2X6F A;  3QDN A;  4U8H A;  4F53 A;  4TRQ A;  1HS6 A;  1ELW A;  3ASF A;  2R17 C;  4JHR A;  3EHM A;  3NF1 A;  4AVX A;  5ARF A;  1QQE A;  5FZS A;  4W9R A;  4B0Z A;  4F7A A;  1EDU A;  2VJ8 A;  3C98 A;  4EPZ A;  3AU5 A;  1QNF A;  5ENN A;  3GYZ A;  4EZK A;  3T5X A;  3I3N A;  4AY5 A;  5E76 A;  2VGX A;  4JXT A;  4BT8 A;  1HO8 A;  3CKB A;  2BTD A;  4CGW A;  2WXH A;  2WM9 A;  3I4G A;  5ARG A;  2VGX B;  2YHE A;  3ASH A;  3FWV A;  1NA0 A;  1U3C A;  2CHZ A;  2DCP A;  4G26 A;  4F1S A;  4BTB A;  2WXQ A;  4PS8 A;  3NZS A;  4FLB A;  2XRZ A;  3B7T A;  3FEY A;  4A3T A;  4EBA G;  1Y8M A;  2PZI A;  4RVB A;  5BUZ A;  3MYV A;  4K03 A;  3R9A B;  4ACL A;  1UJK A;  4UWL A;  3SI5 A;  4U0S A;  3BG0 B;  1H19 A;  5BNW A;  3ZYM A;  3FTU A;  4ILG A;  4BWR A;  4KVO A;  3TXM A;  2OND A;  4GAA A;  3FH7 A;  3UUX A;  1MQS A;  3OXL A;  4JA9 A;  4UWH A;  3APD A;  3UMV A;  1Z3Y A;  4WAF A;  4BT9 A;  4WND A;  5AJL A;  3MCX A;  2WXN A;  1FVF A;  1OWP A;  3CQG B;  4HVB A;  2Y3A A;  3BG1 B;  1DNP A;  4I1M A;  2GGF A;  2LO6 A;  2CHW A;  3FTY A;  4APF A;  1FVH A;  4R7L A;  4B89 A;  4DPR A;  3S7F A;  3D9P A;  4UI9 K;  2FF4 A;  3FUI A;  4HOQ A;  3HYM B;  3Q47 B;  4K0R A;  1OWO A;  4CDR A;  5A23 A;  3U66 A;  2YNQ A;  3UQ3 A;  4HXI A;  4KYO B;  5CMW A;  5M72 A;  4AM9 A;  4FA6 A;  2RD0 A;  4A55 A;  2I1J A;  4N5C A;  4PS3 A;  4CT4 A;  1E8Z A;  3ZRH A;  5FT9 A;  4GZC A;  4WWN A;  2LAH A;  5D0Q D;  3PE4 A;  4H7X A;  2XCB A;  3P1U A;  4WNG A;  2WXR A;  4JA7 A;  3PS6 A;  4GML A;  2J4B A;  4GZ5 A;  1UN8 A;  4JW1 A;  4JL0 A;  4Y6W A;  5LCW J;  2NC9 A;  4G25 A;  3CVN A;  3U64 A;  3CVQ A;  3L54 A;  4BSX A;  4N39 A;  1JWG A;  4JHK A;  5LCW C;  3QWP A;  1E8Y A;  1TJF A;  2A4Z A;  3LJ3 A;  3QKY A;  4XKB A;  1MHQ A;  3T5V A;  4OVV A;  3L6A A;  4AV7 A;  2XGS A;  2DBA A;  3CHP A;  2L0I A;  3FH8 A;  2IOL A;  2WXF A;  3ML9 A;  4PS7 A;  2BF0 X;  2GRM A;  5G55 A;  3ASD A;  3ZPJ A;  3LCA A;  4I6G A;  3RU0 A;  4Q96 A;  4GCO A;  1WY6 A;  3G2W A;  2XGM A;  3EJN A;  5BV0 A;  1OUV A;  4NRH B;  1X5B A;  2KCV A;  3EHN A;  4HOR A;  3IEG A;  3ULQ A;  4KZ0 A;  3PZD A;  1Z3X A;  3FUE A;  5T3R A;  4B8C B;  3FUK A;  4HS2 A;  3ZW3 A;  4A1G A;  4DK5 A;  3FUL A;  4LRZ A;  3JYS A;  3CV0 A;  2LAI A;  2HR2 A;  4XX5 A;  3G2V A;  4ILH B;  3CIA A;  3FTS A;  3CLJ A;  4J8D A;  2I2O A;  3FUH A;  2KAT A;  2WXL A;  2WXO A;  3PVL A;  2QFC A;  1NA3 A;  1IYG A;  2VSY A;  3FY4 A;  3JQ1 A;  2XPI A;  3FUM A;  2WVI A;  2CG2 A;  3T8M A;  4L1B A;  3D9I A;  2NXP A;  3MV2 B;  2LNI A;  3ESK A;  2WXP A;  4FU3 A;  1HH8 A;  4MKT A;  5BV1 A;  4V3I A;  1FCH A;  5FQ6 A;  3L13 A;  2GW1 A;  4U0Z A;  3CHS A;  4FHJ A;  5J08 A;  2X6I A;  3RO3 A;  4I1A A;  1EPU A;  2IQC A;  3RIB A;  5G04 J;  3S7B A;  1DVP A;  3HVE A;  4JHJ A;  3IHV A;  2Q7F A;  2KC7 A;  4GCN A;  3RRN B;  1IHG A;  1TJC A;  2R59 A;  3JCK C;  3PNT B;  3R7R A;  3ZIM A;  4LEU A;  3AS4 A;  4GA0 A;  3HDX A;  4WWP A;  1PAQ A;  5G04 C;  2IOS A;  3FUJ A;  3LKU A;  2KZT A;  4ACK A;  3RJV A;  3MKR A;  2J9Q A;  2FEZ A;  3KD7 A;  3CKC A;  4I1O B;  2VSX E;  5AJD A;  1H2U A;  2GRL A;  5FJY A;  3FUN A;  1N54 A;  1W3B A;  2KZT B;  1HX8 A;  4XI0 A;  2VYI A;  3VLD A;  3SD5 A;  4FAD A;  4BFR A;  5AIJ A;  4G1T A;  4KT6 B;  5LOZ A;  2C0M A;  3I5P A;  5LFA A;  4GPK A;  3B7R L;  3GW4 A;  3MKQ A;  4FJY A;  1ZBP A;  5LX8 A;  2WXJ A;  3CR3 A;  3ONK A;  4H7Y A;  4GB9 A;  3PEV B;  2KCL A;  2J49 A;  4J8S A;  4MS6 A;  3CVU A;  1A17 A;  3FEX A;  2CFU A;  3MKQ B;  2FO7 A;  3ZEF A;  1WM5 A;  3G2S A;  4XKC A;  5EX3 A;  3WXX A;  2ILR A;  4UQY A;  2PL2 A;  3D9O A;  2L6J A;  2X38 A;  1P5Q A;  2Y4T A;  4KVM A;  5KJK A;  2WMO A;  3CK8 A;  4XI9 A;  2FUL A;  3RRU A;  4E6H A;  1HF8 A;  4JC8 A;  3RK6 A;  4ANU A;  4JVS A;  2WXI A;  2VTB A;  3VTY A;  2YIN A;  3CK7 A;  4BX9 A;  4PDX A;  3PE3 A;  1WAO 1;  3CVX A;  1PC2 A;  1PY1 A;  2CHX A;  2VTB B;  3LY9 A;  3TAX A;  3IHY A;  4I43 A;  3LVQ E;  4RG9 A;  4AEZ C;  5DIZ A;  3P2B A;  3CSF A;  4JPS A;  2XEV A;  4JEH A;  4LCT A;  3S7D A;  1E90 A;  4FLH A;  4WNF A;  4UI9 J;  3RKV A;  2WQH A;  2V8S E;  4URK A;  4U0U A;  3QJZ A;  5G05 J;  3FP3 A;  4KZC A;  5T8I A;  1H2T C;  5C1D A;  2WXK A;  1NP7 A;  3SHF A;  2A5U A;  4UI9 C;  4CDM A;  4L2Y A;  1JPL A;  3Q5M A;  3NQP A;  5G05 C;  3CHQ A;  3PDN A;  2AXV A;  4A1S A;  5EDS A;  4MRU A;  2CG3 A;  3ONL A;  4EBA A;  3MEK A;  2XHE A;  1HZ4 A;  4I17 A;  4UQZ A;  3CVL A;  4GZ6 A;  3APC A;  2AW6 A;  2MHK A;  1SQM A;  3B7U X;  2WB2 A;  3UT7 A;  1Z6T A;  5ANR A;  4EZL A;  2PQR A;  3HHM A;  4G24 A;  4CCA A;  3UPV A;  2VGY A;  5KCM A;  4MLP A;  1EYH A;  3PH0 C;  4OYS A;  5EX0 A;  4B8A A;  4I2Z A;  4PH4 B;  5JJ7 A;  5KJM A;  1NZN A;  1XGW A;  2CFZ A;  3MX3 A;  4GA1 A;  2V5F A;  4GYY A;  2X6K A;  3OAW A;  1ELR A;  3D3M A;  1UG3 A;  4IUL A;  4LER A;  1B89 A;  1KLX A;  1LF8 A;  4IN3 B;  3CVY A;  5D0O D;  4ME2 A;  4OVU A;  4DLQ A;  3B13 A;  1UN9 A;  3FDH A;  1IQU A;  5ANL A;  5FTP A;  4E85 A;  2OVB A;  2ZU6 B;  2AVP A;  3MZL B;  4HLE A;  2WXM A;  1INZ A;  4J0U A;  3MJW A;  5AEN A;  4G2V A;  4ANW A;  4CGV A;  3FU3 A;  3RO2 A;  2L0T B;  4GA2 A;  4DLO A;  3CGH A;  3QWV A;  4AY6 A;  4YVQ C;  2WMN A;  2XPY A;  1YA0 A;  2HO1 A;  3ESL A;  2J07 A;  4PUC A;  4ANV A;  4AOF A;  5EKQ D;  5CCL A;  1VDY A;  3O48 A;  3KAE A;  4BTA A;  3U3W A;  2C0L A;  3LY8 A;  4UWF A;  5JJ6 A;  3TG5 A;  3ZN3 A;  4NQ0 A;  3AU4 A;  5BT1 A;  3CHR A;  3Q49 B;  4Q69 A;  4U04 A;  4GYO A;  2E2E A;  3FTX A;  3FU0 A;  1E7V A;  4I6E A;  4FJZ A;  3CHM A;  2WQ6 A;  4JEU A;  4DJA A;  3L08 A;  3BEE A;  2Y4U A;  3LYA A;  3IV0 A;  4ATG A;  4N3C A;  4N2S A;  4RSY A;  5BPP A;  4BX8 A;  1E8W A;  2JEK A;  3ZYK A;  2X6H A;  3L17 A;  3QC1 A;  3OXF A;  4N3A A;  2PQN A;  3LY7 A;  4HOU A;  4G11 A;  5A7D B;  5KJN A;  2I6H A;  4I9C A;  3QAR A;  3QWW A;  1EF1 C;  3EIJ A;  1U3D A;  3K9I A;  3FTZ A;  4I2W A;  2FBN A;  4HOS A;  3RRM B;  3URZ A;  3D9K A;  3HVE B;  3FHE A;  3UT4 A;  3B7S A;  3FUD A;  3SF4 A;  3OTN A;  3AS5 A;  4WNE A;  3ENE A;  5DBK A;  2X6J A;  2J4D A;  3QNK A;  4LUN U;  3ZGQ A;  3GZ1 A;  3LEW A;  4DI3 A;  2XPZ A;  3FTV A;  4APO A;  1KT0 A;  4L23 A;  4WWO A;  2MOW A;  3DPD A;  1UJJ A;  3ML8 A;  1HU3 A;  3CQC B;  2HM8 A;  4NAC A;  4ABN A;  2AXU A;  3R7Q A;  3CVV A;  1H2V C;  2KCK A;  2J08 A;  3N71 A;  3SGH A;  4FHK A;  2VSN A;  4XIF A;  4IYP A;  3ZVV A;  1L5J A;  1S0P A;  3PUJ A;  4J8E A;  4P29 A;  5FQ7 A;  2PM6 A;  3JQ0 A;  2XQ0 A;  3CVP A;  3VLE A;  2UWJ G;  3LXU X;  3VTX A;  3FU5 A;  4DI4 A;  2I9C A;  4GYW A;  1OWN A;  1SZA A;  2PM7 A;  4I6J A;  2IJG X;  2ION A;  3IKO B;  2WXG A;  3QB2 A;  1JUQ A;  3TG4 A;  1GW6 A;  2V4L A;  3KS2 A;  3OXG A;  4A3V A;  5G2N A;  1JWF A;  4CT0 A;  2DIW A;  2JLB A;  4AXH A;  3S7J A;  4RG6 A;  4FP7 A;  1HE8 A;  2LSV A;  3I4R B;  4N2Q A;  4F3V A;  3CST A;  4EQF A;  4EZJ A;  4L7T A;  4I9E A;  3MA5 A;  4QFV A;  3CK9 A;  4U07 A;  2UY1 A;  3AS8 A;  5J90 A;  3PNL B;  5FQ8 A;  3SBS A;  4AP2 A;  2HYZ A;  4GZD A;  4U63 A;  3L22 A;  2UY1 B;  3LS8 A;  3FU6 A;  2AWI A;  3LPZ A;  3ZFW A;  2J09 A;  3ZYQ A;  3CHO A;  3QK0 A;  5BW8 C;  1HFA A;  1HXI A;  1E8X A;  4IRU A;  3E4B A;  4CEM A;  5C2Y A;  5JJT A;  3L16 A;  3PUK A;  3APF A;  4J8F A;  4O6F A;  2IU1 A;  3FUF A;  5CHE E;  4M3O A;  1ZU2 A;  4NUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...