4A1VA

Co-complex structure of ns3-4a protease with the optimized inhibitory peptide cp5-46a-4d5e
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
194
structure length
190
Chain Sequence
b'GSVVIVGRIILSPITAYSQQTRGLLGCIITSLTGRDRNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
publication title High Affinity Peptide Inhibitors of the Hepatitis C Virus Ns3-4A Protease Refractory to Common Resistant Mutants.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1b
molecule tags Hydrolase/peptide
total genus 51
structure length 190
sequence length 194
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4a1vA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4a1vA01
1SHHB 1QBNA 2HALA 1DUAA 1JXPA 3RMLH 1KSNA 1GBJA 2PKAB 1JBUH 2BLOA 3N7OA 4GCHG 1HV7A 1QL7A 3TGKE 1M9UA 3A83A 5J4QA 2A7HA 5C1YA 1PJPA 5C20A 3UR9A 1K1JA 3AVZA 2WINI 1ELAA 3C1KA 1EZXC 4YT7H 3TK5A 4D7GA 3RXVA 3PB1E 1PPHE 1BMNH 2ZIQH 1DFPA 1TGNA 1C1PA 1FY8E 2BY7X 2HGTH 2ZDKA 1OP8A 3K2UA 4IC5A 3UPEA 1W14U 4ZKSU 1AVXA 4I31A 2ZU3A 4GCHF 3U1JB 3VGCB 2Z9GA 1Y3YA 2Y80A 2HVXA 1ABJH 1MZAA 2Y6TA 3RM0H 2JKHA 4XSKU 1BB0B 3K6YA 3CP7A 1O5FH 1SLXB 1GBKA 1EZQA 4UD9H 1SMFE 1O2NA 4X0WU 4NA7A 4D9QA 1V2ST 2BTCE 2OC7A 1JIMA 2VGCC 5C1XA 1XX9A 3FP6E 3SUDA 2EI8A 1SLUB 2BD4A 1O2YA 1BTZA 5SGAE 3NXPA 2ZFRH 2XBVA 4B2CA 3OY6U 2G52A 4X6OA 3PROA 2CF9H 4GPGA 3RXKA 3VB7A 5C3NA 2QV1A 5E0GA 2WYGA 2Z3CA 3V3MA 4DW2U 4FVBA 1ELBA 3O8RA 1GG6B 2Z9IA 3U9AH 5EOKA 3RXBA 5C5NA 3SV9A 4CRDA 1GDUA 3ZZAA 2PUXB 3RLWH 3ZVDA 1MH0A 4AFZA 5T1VA 1EJMA 2VU8E 5L2ZH 4B73A 2A7CA 5ESTE 1DVAH 4J1YA 1Z8RA 2FDAA 1UCYK 3MH6A 1HNEE 5FCRA 2BDGA 1F5LA 2QC2A 1WTGH 4FU9A 1G3CA 2F91A 5GIBA 4BAMB 2CJIA 3RXDA 1C1UH 2H5DA 5JBBS 1AMHA 5G4BA 3PMAB 1BRBE 2BQ7B 4IN1A 4JZFH 3ZZ4A 3AW0A 4Q80A 1GGDC 2QXJA 1OKXA 2QXIA 2HNTF 3GDSA 1O3AA 3P92A 2IJOB 3PLKA 3RMNH 1Z8IB 1CT0E 1GBLA 4H6TA 4X1SU 4U01A 4DY7B 1QHRB 2UUFB 1OXGA 1MD7A 3TIUA 1D3DB 1EATA 2ZCKP 2VWNA 2A5IA 3SBKA 2CV3A 1BUIA 3UQOA 5IYTA 4Z0KA 3A81A 1HAYB 2G81E 3MNBA 4ZMAH 1V2TT 1Y5BT 3MH5A 4TYDA 3RMOH 1DE7H 2PKAA 1HGTH 3NKKA 1EZSC 2BOHB 2TGPZ 1HAHH 3MU1A 2H9TH 1CA0B 1GVKB 1NFYA 1G37A 2J9NA 1F0SA 1UVTH 3ZVEA 1WCZA 2HNTE 2ZDVH 2AS9A 2Y7XA 1ZOMA 1UMAH 4NFEA 4RSPA 3E16B 1ZPCA 2CHAC 3T28A 2ZQ1A 1GMCG 2WPKS 4B6FA 4ABDA 1C2HA 2BDAA 1UCYE 4FUFA 1S0RA 4NGAH 2P95A 2FOEA 1GL1A 1TB6H 1GI9B 1AZZA 3QTVH 2GDDA 3ZZ7A 3T5FH 1PYTC 1DSTA 1C2EA 1V2PT 4IMZA 1GBAA 4IMQA 1SGTA 1EX3A 1GMCF 2A5KA 1T32A 5E2OA 2FOAA 4YTAA 1O2RA 1S85A 4U32A 1N8OC 1P0SH 4ABHA 3TK6A 2DE9A 2IOTA 4E7NA 4YO9A 4CRBA 9ESTA 4RI0A 4CBNA 1EJAA 3BTQE 9LPRA 2XRCA 5CHAB 2G4UA 1Y3UA 1BHXF 2PW8H 4OGYA 1EJNA 3EAJA 3NUMA 3A8DA 1Q3XA 1O3HA 4AGJA 1GBHA 1V2RT 3BTEE 3AASA 3P8NA 1CSOE 1UCYH 2WHXA 3ZVAA 1SGFA 1ZGIA 1NC6A 3E1XB 1LVYA 3GCTG 2HPQH 4X6MA 7ESTE 1PPCE 2FLRH 5EQQA 3URDA 1TX7A 2ZU5A 4NIVA 1AFEH 5FPSA 2R0KA 3RXRA 2IJD1 4LK4A 4WVPE 1MKWK 1JRSA 5EU8A 1LKAA 1O3EA 3V7TA 1PQ7A 3H7OA 2JH5D 1P06A 1Z8JB 2PHBA 2ZGBH 1GI5A 1ACBE 2P93A 1P2NA 1IQNA 2JH6D 5CE1A 1C2MA 1KDQA 2BLQA 3GISB 1CBWC 4X1QU 1EPTB 1CQQA 3GCTF 1F5KU 1NROH 1HBTH 1WAYB 3HKJB 1P8VC 3FP7E 3QTOH 4E06H 1UJ1A 1ZMJA 2VNTA 2TGAA 3W95A 1NS3A 1GCTC 3QZQA 2A45B 2WPLS 3PLBA 1NRRH 2C8ZB 4CBOA 2BLVA 1MBMA 5E0JA 5F6MA 4DIHH 2R3UA 1GI7B 1MD8A 2CXVA 3LKWA 1LTOA 2TIOA 1CVWH 2VGCB 5ABWA 1LDTT 1TABE 1LPGB 1GI2A 2TGTA 2BXTH 2P3UB 2PR3A 3ZZBA 1GBTA 3M5OA 3RXIA 2A2QH 3RXUA 1QIXB 2PGQB 1V2WT 1O3JA 1CT4E 1AWHB 2OC1A 1QRWA 4K69A 5T6FA 4NA9H 3TJVA 3A8BA 1S6HA 2ZQ2A 4D76A 4AZ2B 4XDEA 1W7XH 2ZTZA 5C5OA 2O8LA 3LGIA 1B5GH 1HXFH 1W8BH 1GPZA 1CHGA 5K0HA 4ZH8A 1TQ0B 1AGJA 4D9RA 1J14A 4ZXXH 1YCPH 3BTGE 4FU7A 1GJBB 1DUEA 4BNRA 3G01A 3MH4A 1IQFA 1ORFA 1QQUA 3SQHE 5A8XA 3AK5A 2HWLB 3EA7A 4X1RU 1DANH 1TIOA 4DOQA 4CRAA 2V35A 3RXFA 1ZRBA 1O5BB 1A3EH 3LGVA 5HMAA 3EYDA 4AFSA 1EOLA 1EP6A 1H8DH 3L6PA 3F68H 1GWAA 3FFGA 2WPJS 4NFFA 3ZZ6A 2ZC9H 3A7ZA 4ASHA 1GHBG 2O8TA 1MTWA 1O30A 3LH3A 2FOHA 1RJXB 2BD5A 2DUCA 1U6QA 1BTUA 3F9FA 1SQOA 1UHBB 3MFJA 3A7VA 1MU6B 1PFXC 1ZGVA 3SJOA 2W26A 3HGNA 4LZ1H 2G5NA 4GVUA 5HM9A 3CS0A 3TGIE 1GMHG 3KGPA 3VB5A 3V13A 4DVAU 4ISOA 1BIOA 1MZDA 4INKA 5F03A 2Y81A 4O9VA 4E7RG 1O2WA 3RXMA 3C27B 2OQUA 3PO1C 3S7HB 4E05H 2ZHWH 1IQGA 2GV7A 2H2ZA 1GHBF 2Q6GA 1EPTA 1YPMH 2OUAA 2ZEBA 4CRCA 2F9OA 1LQEA 2A4QA 2FIRH 3M5LA 4X2YA 1MTSA 1JMOH 2XBWA 5DO4H 1XKBC 1ANEA 3AAUA 1DY8A 1L2EA 2FPZA 1GMHF 3RU4D 1N6XA 1K1MA 4JZEH 3LT3A 1BOQA 1LMWB 4FXGH 3JZ1B 3A7YA 1BMLA 1N8OB 1TYNA 1BMMH 4HTCH 2JH0D 4OS6A 4JYTA 2ZU2A 2VVUA 1P10A 1FPCH 1HIAB 1O2IA 1YPJH 1VGCB 2K1QA 4MPXA 2AGIX 1XMNB 2SGFE 2XW9A 3SGQE 1Y5AT 4Q7XA 1C1NA 4UEHH 5PTPA 4I8JA 2GD4B 4YOIA 1Q2WA 2XNIA 1O2LA 4IBLH 1W0ZU 1PQAA 3PTBA 1THPB 4FUHA 1NM6A 3GYLB 3UREA 1W3CA 2BY8X 1QTFA 2ZDLA 3MO9A 4R0IA 4X1NU 1UTPA 2ZECA 1Y5UT 2NU0E 1P2MA 1L1GA 2QF3A 4QT8C 4A6LA 4BOHA 1NRPH 3LH1A 2ZZUH 1QQ4A 2BD8A 3OTPA 3I29A 3SU3A 2OCVB 3BF6H 1GJ7B 1TOCB 4ZHAA 1BTPA 1UTQA 1NU7B 1J16A 4CRFA 1ZZZA 4CRGA 2O8WA 2FS9A 1WTHD 1P2KA 2ALVA 2BVRH 3R0FA 2GZ9A 5T6DA 1PQ5A 1C1SA 4UONA 1K28D 2FXRA 1SGRE 4DG4A 1LHFH 2BD3A 3GDVA 2GCHG 4KKDA 1CBWB 4I7YH 2QYIA 2W5EA 2VVCA 5E8EH 1ZTLA 8KME2 4BAQB 3ITIA 2G00A 3EA8A 3HK3B 3Q3KA 2DE8A 2HPPH 3E91A 4X8SH 5C1UA 1G32B 3ZZ8A 1UHBA 5DG6A 3KEEA 1O3BA 2B5TB 1A3BH 4NIXA 4X2VA 2FYQA 3TNSA 3MMGA 1O3DA 3P6ZB 1OS8A 4HFPB 1RTFB 4X8VH 4B2BA 2ZDMA 2GMTC 3QZRA 1QGFA 2PKSC 1ZSKA 1KLIH 2ANKH 4A5TS 2GCHF 2BDBA 3T27A 2GT8A 3T26A 4OS7A 3SU0A 1CU1A 2OK5A 3HGPA 3PV5A 5JB8S 5C67A 3SORA 2RDLA 1ZPBA 2FODA 1FPHH 2NU1E 1T8LA 1Z6EA 1GMDG 4JZ1A 2F4LA 1C2FA 1C9PA 2XTTB 2KAIB 4XFQA 5LH8A 1FXYA 4SGAE 2WV5A 1MCTA 1XXFA 5T3HA 3S9CA 1HYLA 2FLBH 4Y71A 3VB6A 4BAOB 2A32A 4I8LA 4NG9H 5EQRA 4FUDA 4PROA 1D6WA 2ZWLH 2QXGA 2P16A 3F9EA 1HIAA 1O2JA 1O5GH 1C2KA 2Z9KA 3ZZ3A 4FUJA 1TGBA 1ID5H 2SGDE 3RXOA 3D23A 3UNSA 2BDCA 1OWEA 1C5PA 4MPWA 1GMDF 1P9SA 2BY5X 3RM2H 5JPMH 1ZTJA 1FLEE 3RXAA 1RIWC 2O8MA 3LU9B 4UDWH 1GJ6A 3RC6A 1UVPA 2G51A 3PMJA 1HB0B 1E36B 1AFQC 1YCPM 2A31A 3H09A 1MTNC 1GHVH 1YPKH 2XBYA 3CS7A 1V2JT 2R2WU 2SGEE 3LGYA 2BX4A 4JMYA 4ABGA 1WBGB 1NFWA 3WY8A 4DIIH 1TPAE 5DKMA 3M61U 4A92A 4GAWA 4K1SA 1GCDA 1TE0A 2D8WA 2QXHA 2STAE 1AKSB 8GCHG 2ZGHA 4TPYA 1SG8B 3T2NA 4Y6DA 3SUFA 4M9FA 1K1LA 1MKXH 1ELTA 3M37A 1QL8A 1THSH 3NWUA 1MQ6A 1SHYA 2P8OB 4A1TA 1AO5A 3SJIA 1C2DA 5AVDA 1ZMLA 1OWHA 4Y11E 4J2YB 1DWDH 1EUFA 2PSYA 1D3TB 4NWKA 1SBWA 2WPHS 1C1RA 1BHXB 2AGGX 1PPEE 2FOCA 1DWBH 3SI3H 2AMQA 5B6OA 2GCTB 3TK9A 1ZSLA 2QIQA 5LPFA 1P05A 1W10U 4LZ4B 5HXFA 5EXNA 3SGAE 3PYHA 2GVFA 2ZPQA 3SU2A 1YLDA 1BBRK 1GL0E 2Q6FA 1BRAA 1MTUA 1TONA 2QAAA 3GY4A 2FWWA 8GCHF 3FAOA 2H9HA 2BXUH 3ODFA 1WXRA 1Y3XA 1O3GA 5FPYA 2UUYA 5FBEA 1W0YH 2C90B 1DWCH 1S84A 4RKJB 2PLXA 3P8FA 1QJ7B 2OBQA 1FY3A 1ZR0A 4I33A 3VXFH 1NESE 1P03A 4AG1A 4MLFB 2BDYA 4A1VA 3FZDA 3SGBE 5K7RA 1HJAC 1TAWA 2RA0A 4TWYA 1A46H 1KXAA 1O2UA 2SFAA 6CHAB 1BJUA 2FOFA 3F9HA 2GZ8A 3ATMA 1QBOA 2ZA5A 2EC9H 1ELDE 1MBQA 2BY9X 3OYPA 2ZU1A 1F2SE 1O3FA 2SGQE 3RC4A 1OSSA 2BM2A 1SGQE 2KAIA 1OOKB 4K5ZA 1E0FD 5A0AE 1C1QA 3BTHE 5JBCS 2BDIA 1C5OH 1QRZA 3SZEA 3SUGA 2ZHDA 1NRSH 4X2XA 4LXBH 5JDUB 2A4OA 1K22H 1O2VA 1SSXA 1BBRE 3A86A 4U30A 3GCHB 1MUEB 1GJAB 4AX9H 3A7TA 2FX6A 4M7GA 3QWCH 4Y0ZE 1C5TA 1L4ZA 2V6NA 4KTUA 1EXFA 1NFUA 1VCWA 4AORA 4I8KA 2P3FH 1J9CH 2GGVB 1CGIE 3RXPA 4I32A 1BTXA 2PFEA 3SU1A 3U8RH 1TNJA 1HJ9A 4I8HA 2AMPA 1TA6A 4WH8A 1DXPA 1FUJA 1YPEH 1QR3E 3MO3A 1C4Y2 1KY9A 2ZKSA 1HAVB 1V2MT 4YESB 3U69H 5GNDA 1O2GH 4B2AA 3SUEA 3A89A 3PV2A 1G3BA 1RRKA 2J94A 1F0UA 1A5GH 4YOGA 4CREA 5I46H 1AKSA 3F1SB 1C9TA 5DP3A 1JIRA 2F9NA 2XC5A 4O3TA 1WUNH 5DP9A 4AFQA 1C5MD 3BIVH 2SNWA 3ZYDA 3P17H 1TRYA 1E35B 2ZP0H 5C2ZA 4JYVH 5I25A 1C5SA 4X8TH 3BSQA 3M3VA 4KTCA 3PM3A 2PKSB 5F8TA 4K60A 1K1PA 4KTSA 4MNWA 1BBRH 1XUKA 1V2QT 2OQ5A 5GJ4B 5JB9S 4ABAA 4YM9A 2BY6X 1GBCA 2XC0A 3FANA 1IQHA 1EB1H 2BZAA 1PPGE 2ZFPH 4XOJA 2WZQA 1JOUB 3H5CB 1C2JA 4B1TA 2PWXA 1C4U2 4SGBE 1WOFA 3ZV8A 4ZXYH 1C1VH 3CENA 1ETSH 1KYNA 4GHQA 2WV4A 1K21H 2ZHEH 2OC8A 1QY6A 3ZZDA 1P3CA 3ENSB 3OU0A 3PMHB 3FZZA 4OM9A 1AQ7A 2VWMA 3TJOA 2FZZA 2NU3E 1XVOA 3MTYA 1FZZA 1SPJA 3L3TA 1AB9C 2AGEX 2SGAA 3BTFE 1C1OA 3LGUA 8LPRA 1GHXH 1RS0A 2AIPA 2BQ6B 1H9IE 3K9XB 1T8MA 2WV9A 2R3YA 2VINA 2ZPSA 4D7FA 4IC6A 1TRMA 3ZZCA 5FX6A 3D62A 3BG8A 1O5AB 3T29A 2BX3A 1AIXH 1YBWA 3GY3A 1C5ZB 4INHA 1G3EA 2G8TA 1FNIA 3ZVBA 1MTNB 2VJ1A 1L0ZA 2B8OH 1GBBA 4IS5A 2ULLA 1ANDA 2ZU4A 2BD7A 1GBFA 5HM2A 4VGCC 2XBXA 1C5RA 3QGNB 3OTJE 2FESH 1OX1A 4RN6A 1HDTH 3STJA 2G5VA 5GXPA 1ZRKA 2B7DH 1V2LT 1GI4A 1HAIH 1PQ8A 2WYJA 3MWIU 1ESTA 1WU1A 2EA3A 1ELCA 1ESAA 1HRTH 1O2ZA 2Q1JA 3KQCA 3RXSA 2Z94A 1DWEH 2P59A 2GV6A 1P3EA 5HYOA 5DP6A 4FUIA 3KQDA 1V6DA 4MPUA 3SJ8A 1EKBB 2ODQA 1Y8TA 2F9BH 4A7IB 1DS2E 3STIA 3GICB 5DK1A 4O03A 3HK6B 1C5QA 1KXCA 1ZLRA 3OSYA 2BVSH 1VCQA 3ZZ5A 2ZHFH 4NIYA 1HAVA 1FQ3A 1N6YA 1S6FA 2Z7FE 3VPKA 3ZVGA 2Y5FA 7LPRA 1YPHC 1HAGE 1C2LA 4WY3A 4GSOA 2BDHA 3GCNA 3PLPA 1FV9A 4ISHH 3NPSA 2ZDAH 4CR5A 3I77A 4GHTA 5FXLA 1FY5A 1GGDB 3ZVCA 4AG2A 3QO6A 1BT7A 1P57B 1XXDA 1FIWA 1KIGH 1HLTH 4RKOB 2PV9B 1A4WH 1K1IA 2J38A 3UR6A 4Q2KA 2FS8A 1DLEA 2A2XH 1FIZA 1KXBA 1GI8B 2Z3DA 2V3HH 1DICA 2ALPA 2ILNA 3A85A 3L33A 2B0FA 1XVMA 1WYKA 2QF0A 1GDQA 1QCPA 1ZYOA 4Y76A 1MKWH 1V2KT 1AHTH 4KELA 3VGCC 3ZYEA 1O38A 1AE5A 4I8GA 2WPMS 1D6RA 4X6PA 1ZHPA 1P2JA 1MAXA 1E37B 2CHAB 2ZTXA 3M3TA 1EZUC 3T25A 1BMAA 3F9GA 3TLOA 2ZFSA 2Y7ZA 1EAIA 3BEIB 1CHOG 4JZDH 2ANWA 1O2KA 3KIDU 1CGHA 1UTNA 1P09A 3VB4A 4X8UH 1MQ5A 2F83A 5E0HA 3LC3A 2ZPRA 1DX5M 4XE4A 1Z8GA 1T4VH 1O2OA 1BRUP 3M7QA 2PTNA 1PPZA 3TITA 2ODPA 2H6MA 1XUHA 1XUJA 4ZKNU 1GG6C 1L4DA 2J92A 4K8YA 5FBIA 2C3SA 2GP9B 4K2YA 3GY7A 4Y7BA 2CGAA 2A4GA 1TMTH 1NTPA 3B9FH 5ESBA 2J95A 3A7WA 5B6LA 1O0DH 2VIWA 5EPNA 4CH2B 1XKAC 5FHTA 1D9IA 1CHOF 3UFAA 1PPBH 4Y10E 5LPRA 2FTLE 4H6SB 1AE8H 3EA9A 5FX5A 1TQ7B 3SV6A 1GHWH 1GHAG 3SU4A 1UK2A 3E3TA 4Y79A 2VIDA 3E0NB 4ISLA 3MI4A 4HZHA 2Z9LA 2JETC 1UO6A 2I6QA 4ESTE 4ABBA 4DGJA 2TBSA 2VIOA 1UTMA 4DT7B 4X2WA 3EGKH 1ELVA 2C93B 1C5XB 3LJJA 3MU5A 3K65B 4K1EA 1UVOA 1ANCA 4Y7AA 3E0PB 1FONA 2O9QA 3P8GA 2FX4A 2ZHQH 5GDSH 1L1JA 3LGWA 5LGOA 1GBDA 2NWNA 2W7SA 4WMFA 4AFUA 1O3OA 2V3OH 6GCHG 1DXWA 3BTKE 1ABIH 3BEUA 2ZFFH 5DGJA 2QCYA 1NY22 1IQJA 2FYRA 1GHAF 2UWPA 1SLVB 3A8CA 3U8OH 1HAPH 1K1OA 1TALA 1CA0C 2F3CE 1GJ8B 3LDXH 3BTTE 1SQTA 2BQWB 3VXEH 3Q76A 4CHAC 1QFKH 1TWXB 3IG6B 2TPIZ 2IN2A 1B0EA 4ZUHA 4UE7H 4ZAEA 1O3NA 3ATIA 4H42U 1AB9B 1QB1A 3QLPH 3DT0H 1CA8B 2A4RA 1N1LA 4ABEA 2QGRA 2TGDA 4WWYA 1TX8A 4ZHMU 5EW1H 3RUOA 1UVUH 3VB3A 4DCDA 4ISIH 6GCHF 1ZJDA 5AF9H 1KLTA 1UVSH 1GBEA 3UWIA 3KNXA 2AYWA 1DSUA 2D1JA 1O2QA 1GCTB 3BN9A 1P2IA 1SGYE 3KL6A 7GCHG 2CMYA 4BANB 2NU4E 1LVMA 5HGGA 2ZFTA 2H9EH 2I6SA 4TPIZ 3QN7A 5EODA 1P04A 4YZUA 3FP8E 2XCFA 3SNDA 5BPEA 3LIWA 4UFFH 2VIVA 3BTME 5F8XA 1QJ1B 2GT7A 1W13U 3RU4E 3QUMP 3BTWE 2ZCHP 1IQLA 2ANMH 2LPRA 1QB9A 5CHAC 3A87A 1BRCE 2D26C 1O3LA 2BD2A 1SLWB 1AVWA 4X6NA 3V12A 1SGCA 1HXEH 4DURA 2CN0H 7GCHF 1OP2A 4MDSA 3RXTA 1LHEH 1A1RA 2YNAA 2Y82A 3SU5A 3ZVFA 1F5RA 2HLCA 5EG4A 3OY5U 2F9VA 2UUKB 1EAXA 1O32A 4WXVA 1O36A 2P3TB 1GJCB 5A0CA 4Y8XA 1QBVH 1MAYA 1F0TA 1TMBH 1Z71A 2VWLA 3U8TH 1QJ6B 1ELGA 2SNVA 5FPTA 4WJG2 1O5DH 3TJUA 3V0XA 4AYVB 3MU4A 5JYIA 5DJ7A 2G55A 1AVGH 1KXDA 5A2MH 2FOBA 1Z7KA 1LQDB 2J2UA 5L6NH 3TH4H 1DOJA 2XCNA 3E8LA 3KN2A 2ZG0H 3RXHA 1VCPA 1HUTH 4AN7A 1UTKA 1YLCA 4ZKOU 3O8CA 3KQBA 4IW4E 4JZIA 1VITH 1OP0A 1TOMH 2VB0A 2ZDNA 2BD9A 4H4FA 5TJXA 1Y3VA 1EPTC 1JWTA 2Z3EA 5JBAS 4B71A 1P02A 4ISNA 3RXLA 4YT6H 5EXMA 1W11U 1C4V2 1GHYH 1WSSH 1INCA 5DP7A 4B76A 4THNH 1ARCA 1QB6A 4BXSA 1J15A 1IQIA 4NCYA 4Q7ZA 2LNCA 1S82A 1A0LA 1ARBA 3P95A 3A80A 3SI4H 1L1NA 3SN8A 1SGEE 1B7XB 1O34A 1ZTKA 3A7XA 1G3DA 1QNJA 1V3XA 1H8IH 1GJDB 4WXIA 1YPLH 1EAWA 4UFGH 3PO1B 1DT2A 3ATKA 2FOGA 2PSXA 1V2UT 3SZNA 4B75A 4IGDA 2THFB 4JK6A 1NU9A 2FI4E 1THRH 3QX5H 4UFDH 3KF2A 2UWOA 1GBIA 2OD3B 5DP4A 1EB2A 3BIUH 1TGTA 2ZGJA 2RCEA 1C2GA 3E6PH 4FUBA 3TJNA 1GVZA 1TBRH 4KGAA 1C5WB 3EDXB 5J4SA 2OP9A 2ZO3H 2AFQB 1DPOA 2EI6A 4MQAA 1EQ9A 3IITA 2FTMA 3T62A 3W94A 1LCYA 3UOPA 3GYMA 2OXSA 1QL9A 3ATWA 5GWZA 3SV8A 1YYY1 5L2YH 2J34A 1NT1A 1HAOH 3LOXA 1W7GH 4OGXA 3S9BA 2M5TA 2JETB 2RA3A 2F9UA 3MH7A 1ETRH 2BOKA 1S81A 2ODYB 3BG4C 1HFDA 1H4WA 1XUFA 1Q31A 5DP5A 4U2WA 3DHKH 3HPTB 2ZI2H 3DFJA 3SHCH 4F4OC 1BQYA 1KDQB 4NZLA 2OBOA 1LHGH 1OWIA 3RC5A 4ZKRU 5AFYH 1SVPA 4JYUH 3UQVA 1VJ9U 1KTSB 1K1NA 5EGMA 1LO6A 2FM2A 3LJOA 3RDZA 2FP7B 4XBBA 1FN6A 2SGPE 1O2SA 4CHAB 1EOJA 2J4IA 1YPHE 1O3CA 4CR9A 3S9AA 2Z9JA 2FI3E 1ZSJA 3SU6A 1YF4A 4BTTB 3RLYH 1NPMA 1TNKA 3RXJA 4BAKB 2C8WB 1D3PB 3RXEA 1HAXB 1O3MA 3NCLA 3MNCA 4AB9A 1T7CA 1RD3B 4ZHLU 6LPRA 1BTYA 1F92A 3M3SA 1V2VT 5JBTA 3DD2H 1OPHB 1A61H 4NWLA 3ATLA 3FVFB 2XWBI 3GY6A 4Y8YA 1OWJA 1UTJA 2GTBA 3PTNA 3RXGA 3MNSA 1UK4A 2GX4A 1SGFG 1B0FA 2A7JA 4OS5A 4AGKA 2QY0B 3TH2H 1O31A 1TA2A 3UTUH 5A8YA 4BAHB 1SR5C 1SGNE 1CO7E 1O2TA 1T4UH 3A8AA 2GMTB 1TFXA 1GI1A 3RMMH 1DITH 1TGSZ 1O2HA 2VVVA 8ESTE 2Q6DA 2Y5HA 3SV7A 2XC4A 1WV7H 2G4TA 3RP2A 1LKBA 4FUCA 1SFQB 1Z6JH 1VGCC 1MCVA 4B74A 3AAVA 1O37A 1O2XA 1C1TA 3LPRA 4OS4A 2W3IA 1FY4A 2ZFQH 1LPZB 1TNHA 3ZZ9A 1YCPK 3HATH 3R3GB 3SJKA 1P11E 1NN6A 1IQEA 1LHCH 1YPGH 1UTOA 1AN1E 1WQVH 2OC0A 1BTHH 3O8BA 4F49A 4WMEA 1IAUA 2ASUB 1V2NT 3M36A 1ESBA 3UUZA 1AI8H 2VWOA 1E34B 5AFZH 2ZGCA 1KTTB 1O5EH 1KXEA 4HGCA 1EP5A 1HCGA 3MOCA 4ABIA 2FO9A 3D65E 4JCNA 1H1BA 1H9HE 5TCCA 1C5LH 3Q77A 3TU7H 3H7TA 1A2CH 4O3UA 1FN8A 1BTWA 1UK3A 3K6ZA 2GDEH 3KQEA 3LGTA 2YNBA 3SW2B 2C8XB 3SHAH 2XXLA 2CF8H 2FOMB 4AB8A 2VIQA 1C5NH 1IHSH 4BTUB 1W2KH 1RIWB 3A88A 2EEKA 1GBMA 4NSVA 4DJZB 4XBDA 4YLUA 3EQ0H 1AFQB 1FDPA 1GJ4H 4MNXA 4NZQA 3U1IB 1VR1H 4K8BA 1CGJE 1ETTH 4Y8ZA 4BTIB 1TBZH 2FMJA 2PUQH 3D49H 1LVBA 2OINA 1AY6H 1NZQH 1JRTA 2WPIS 1O3KA 2HOBA 4R8TB 1BITA 1O2MA 3PWBA 2ANYA 1OYQA 1QRXA 1TPPA 2WUCA 3UNRA 4AOQA 5BRRE 1NFXA 2RG3A 2C8YB 4INLA 1TBQH 2UUJB 1IQKA 4JK5A 1PPFE 2W3KA 4O97A 3UOUA 1J8AA 3ELAH 1RTKA 1YC0A 4MNVA 3VFEA 3TPIZ 2A1DB 1O3PB 1F0RA 3Q3XA 3IWMA 5A8ZA 2GZ7A 3ODDA 1SI5H 3M35A 2HNTC 3AW1A 2VH6A 4B6EA 1FY1A 3MU0A 1J17T 3PWCA 1GDNA 4UFEH 5TCAA 1X7AC 1O39A 1RXPA 1SB1H 1UTLM 2QA9E 5EPYA 3GDUA 1AUTC 1GI3A 1T31A 2R0LA 2UWLA 3MNXA 1IQMA 1ZHMA 4MTBA 1ZJKA 1C1MA 5CMXH 1TNGA 3LONA 1BCUH 5DP8A 4ABJA 3EE0B 1SC8U 4XBCA 1TPSA 1HJAB 3P70B 3URCA 1P2QA 5H4IB 1SQAA 3MU8A 1TPOA 3UY9A 1BJVA 3BEFB 1A7SA 1DLKB 4HI3A 2R9PA 1BDAA 1HAZB 1IOEA 2PGBB 2WUBA 3M5NA 4TY6A 1XUGA 1TMUH 2HRVA 2BHGA 2FEQH 5E2PA 2P94A 3E90B 3BG4B 4Z6AH 1AZ8A 4NIWA 1BA8B 1W12U 1G30B 1Z1JA 2BYAX 3SNBA 1A5HA 1V2OT 2A0QB 1MU8B 4OS2A 3GCOA 1FAKH 1GI0A 3DUXH 2OTVA 1CT2E 4TWWA 2ZCLP 1F7ZA 3Q00A 3SJ9A 4BXWA 4TY7A 3GOVB 4FUGA 1TGCA 4ZROA 2H5CA 2NU2E 3S69A 2ZNKH 2ESTE 3SNCA 4A1XA 3M7TA 5FCKA 1KLJH 3UNQA 4GUXA 2ZTYA 3UIRA 1T8NA 1EASA 1C5VA 1TX6A 3MHWU 2ZGXH 1YP9A 2H1UA 1VJAU 2P8OC 3SV2H 3BTDE 1GJ9B 3B8JA 1AU8A 3O8DA 1DM4B 4MVNA 1D4PB 2B9LA 1YGCH 1TRNA 1OYTH 3GY8A 4LOYH 1GI6A 3MO6A 1SOZA 1P9UA 1K9OE 3RXQA 1O3IA 4MG3A 2BLWA 2GCTC 3NZIA 1S0QA 3P8OA 1SGPE 2AIQA 1HJ8A 1MTVA 3A82A 3RXCA 3LC5A 1ELEE 2STBE 2AH4X 2BMGB 2EI7A 1E38B 5AHGH 5EW2H 1G36A 1O35A 1OWKA 3NK8A 5EQSA 3SNAA 5L30H 4NA8A 1GHZA 3S0NA 5IDKA 4K1TA 3BV9B 4OS1A 1BZXE 2PTCE 1QA0A 1D3QB 3I78A 3Q3YA 1LPKB 1A0JA 1OWDA 5GCHG 2A5AA 1IHTH 4X1PU 1K2I1 3ZV9A 1ZPZA 2QN5T 5LPEA 3U98H 1A0HB 3ESTA 1NRNH 1SFIA 3KCGH 2BB4A 1GJ5H 3S7KB 3QGJA 3SOSA 2OLGA 2YOLA 3QK1A 3RU4T 3SYJA 1QURH 6CHAC 3SNEA 4Q7YA 2VH0A 4MPVA 2AEIH 3OX7U 3MYWA 2ZF0H 4KP0A 1ZHRA 1SOTA 1VITG 3DFLA 1DDJA 1CE5A 1EAUA 4YLQH 3KHVA 1Z1IA 5GCHF 1HPGA 1T8OA 1P2OA 1XUIA 3JZ2B 2XYAA 1P01A 4WF8A 1VZQH 4FVDA 1PYTD 2Y5GA 2R2MB 1FAXA 3PMBB 1FI8A 3SQEE 2XWAA 2AMDA 2C4FH 1SGIB 1TLDA 2VIPA 1AUJA 3GCHC 3SO3A 3TGJE 2D2DA 2W7UA 3A84A 1QA7A 5EXLA 1G2LA 1S83A 3B23B 2F9PA 1MMJN 4CH8B 3UWJH 1Y3WA 4FUEA 1MKXK 1DY9A 4YOJA 1VITF 4WH6A 3GY2A 3TNTA 3TH3H 1SGDE 3PV4A 1C2IA 1YM0A 1RTLA 3VEQB 3GY5A 4ABFA 4D8NA 5FAHA 1GVLA 1TNIA 1FJSA 2BZ6H 5DPAA 1LVOA 4VGCB 2GKVE 5A09A 4WMDA 1Y59T 1H9LB 1C5YB 2VBCA 2IPHA 3HKIB 1WQSA 1SL3A 1ANBA 2AERH 2TRMA 4FU8A 7KMEH 1FMGA 3M5MA 4AYYB 1NO9H 3DA9B 1AWFH 2O8UA 4GLYA 4K3JA 5A0BA 1G2MA 1NRQH 4Y0YE 3F6UH 5F8ZA 5ETXA 1C5UA 1O5CB 3TVJB 2FI5E 2V0BA 1AD8H 1C1WH 2BVXH 3QDZB 1ELFA 4NSYA 1RFNA 1G9IE 1O33A 5T6GA 5GPIB 6ESTA 3M7UA 4MNYA 1LHDH 1RGQA 2Z6BD 4IN2A 1A5IA 1O2PA 1KXFA 1S5SA 1XM1A 1YKTA 1TNLA 1ZMNA 1P12E
chains in the Genus database with same CATH superfamily
1SHHB 1QBNA 2KM0A 2W6JD 2HALA 1DUAA 1JXPA 3RMLH 1KSNA 1GBJA 2PKAB 1JBUH 2BLOA 3N7OA 4GCHG 1HV7A 1QL7A 3TGKE 1M9UA 3A83A 5J4QA 2A7HA 5C1YA 1PJPA 5C20A 3UR9A 1K1JA 3AVZA 2WINI 1ELAA 3C1KA 1EZXC 4YT7H 3TK5A 4D7GA 3RXVA 3PB1E 1PPHE 1BMNH 2ZIQH 1DFPA 1TGNA 1C1PA 1FY8E 2BY7X 2HGTH 2ZDKA 1OP8A 3K2UA 4IC5A 3UPEA 1W14U 4ZKSU 1AVXA 4I31A 2ZU3A 4GCHF 3U1JB 3VGCB 2Z9GA 1Y3YA 2Y80A 2HVXA 1ABJH 1MZAA 2Y6TA 3RM0H 2JKHA 4XSKU 1BB0B 2K0QA 3K6YA 3CP7A 1O5FH 1SLXB 1GBKA 1EZQA 4UD9H 1SMFE 1O2NA 4X0WU 4NA7A 4D9QA 1V2ST 2BTCE 2OC7A 1JIMA 2VGCC 5C1XA 1XX9A 3FP6E 3SUDA 2EI8A 1SLUB 2BD4A 1O2YA 1BTZA 5SGAE 3NXPA 2ZFRH 2XBVA 4B2CA 3OY6U 2G52A 4X6OA 3PROA 2CF9H 4GPGA 3RXKA 3VB7A 5C3NA 2QV1A 5E0GA 2WYGA 2Z3CA 3V3MA 4DW2U 4FVBA 1ELBA 3O8RA 1GG6B 2Z9IA 3U9AH 5EOKA 3RXBA 5C5NA 3SV9A 4CRDA 1GDUA 3NRLA 2PUXB 3ZZAA 3RLWH 3ZVDA 2HLDD 1MH0A 4AFZA 5T1VA 1EJMA 2VU8E 5L2ZH 4B73A 2A7CA 5ESTE 1DVAH 4J1YA 1Z8RA 2FDAA 1UCYK 3MH6A 1HNEE 5FCRA 2BDGA 1F5LA 2QC2A 1WTGH 4FU9A 1G3CA 2F91A 5GIBA 4BAMB 2CJIA 3PRBA 5C94A 3RXDA 1C1UH 1W0KD 2H5DA 5JBBS 1AMHA 5G4BA 3PMAB 1BRBE 2BQ7B 4IN1A 4JZFH 3ZZ4A 3AW0A 4Q80A 1GGDC 2QXJA 1OKXA 2QXIA 2HNTF 3GDSA 1O3AA 3P92A 2IJOB 3PLKA 3RMNH 1Z8IB 1CT0E 1GBLA 4H6TA 4X1SU 4U01A 4DY7B 1QHRB 2UUFB 1OXGA 1MD7A 4RT0A 3TIUA 1D3DB 1EATA 2ZCKP 2VWNA 2A5IA 3SBKA 2CV3A 1BUIA 3UQOA 5IYTA 4Z0KA 3A81A 1HAYB 2G81E 3MNBA 4ZMAH 3KYFA 1V2TT 1Y5BT 3MH5A 4TYDA 3RMOH 1DE7H 2PKAA 1HGTH 3NKKA 3UB0A 1EZSC 2BOHB 2TGPZ 1HAHH 3MU1A 2H9TH 1CA0B 1GVKB 1NFYA 1G37A 2J9NA 1F0SA 1UVTH 3ZVEA 1WCZA 2HNTE 2ZDVH 2AS9A 2Y7XA 1ZOMA 1UMAH 4NFEA 4RSPA 3E16B 1ZPCA 2CHAC 3T28A 2ZQ1A 1GMCG 2WPKS 4B6FA 4ABDA 1C2HA 2BDAA 1UCYE 4FUFA 1S0RA 4NGAH 2P95A 2FOEA 1GL1A 1TB6H 1GI9B 1AZZA 3QTVH 2GDDA 3ZZ7A 3T5FH 1PYTC 1DSTA 1C2EA 1V2PT 2YMSD 4IMZA 5IK2D 1GBAA 4IMQA 1SGTA 1EX3A 1GMCF 2A5KA 1T32A 5E2OA 2FOAA 4YTAA 1O2RA 1S85A 4U32A 1N8OC 1P0SH 4ABHA 3TK6A 2DE9A 2IOTA 4E7NA 4YO9A 4CRBA 9ESTA 3UAIC 4RI0A 4CBNA 1EJAA 3BTQE 9LPRA 2XRCA 5CHAB 2G4UA 1Y3UA 1BHXF 2PW8H 4OGYA 1EJNA 3EAJA 3NUMA 3A8DA 1FX0B 1O3HA 1Q3XA 4AGJA 1GBHA 1V2RT 3BTEE 3AASA 3P8NA 2EQNA 1CSOE 1UCYH 2WHXA 3ZVAA 1SGFA 1ZGIA 1NC6A 2QF5A 3E1XB 1LVYA 3GCTG 2HPQH 4X6MA 7ESTE 1PPCE 2FLRH 5EQQA 3URDA 1TX7A 2ZU5A 4NIVA 1AFEH 5FPSA 2R0KA 3RXRA 2IJD1 4LK4A 4WVPE 4AC9A 1MKWK 1JRSA 4F48B 5EU8A 1LKAA 1O3EA 3V7TA 1PQ7A 3H7OA 2JH5D 1P06A 1Z8JB 2PHBA 2ZGBH 1GI5A 1ACBE 2P93A 1P2NA 1IQNA 2JH6D 2K8IA 2W6ID 5CE1A 1C2MA 1KDQA 2BLQA 3GISB 1CBWC 4X1QU 1EPTB 1CQQA 3GCTF 1F5KU 1NROH 1HBTH 1WAYB 3HKJB 1P8VC 3FP7E 3QTOH 4E06H 1UJ1A 1ZMJA 2VNTA 2TGAA 3W95A 1NS3A 1GCTC 3QZQA 2A45B 2WPLS 3PLBA 1NRRH 2C8ZB 4CBOA 2BLVA 1MBMA 5E0JA 5F6MA 4DIHH 2R3UA 1GI7B 1MD8A 2CXVA 3LKWA 1LTOA 4TSFD 2TIOA 1CVWH 2VGCB 5ABWA 1LDTT 1TABE 4RT1A 1LPGB 1GI2A 2TGTA 2BXTH 2P3UB 2PR3A 3ZZBA 1GBTA 3M5OA 3RXIA 2A2QH 3RXUA 1QIXB 2PGQB 1V2WT 1O3JA 1CT4E 1AWHB 2OC1A 1QRWA 4K69A 5T6FA 4NA9H 3TJVA 2EY4C 1S6HA 2ZQ2A 3A8BA 4D76A 4AZ2B 4XDEA 1W7XH 2ZTZA 5C5OA 2O8LA 3LGIA 1B5GH 1HXFH 1W8BH 1GPZA 1CHGA 5K0HA 4ZH8A 1TQ0B 1AGJA 4D9RA 1J14A 4ZXXH 1YCPH 3BTGE 4FU7A 1GJBB 1DUEA 4BNRA 3G01A 3MH4A 1IQFA 1ORFA 1QQUA 3SQHE 5A8XA 3AK5A 2HWLB 3EA7A 4X1RU 1DANH 1TIOA 4DOQA 4CRAA 2V35A 3RXFA 1ZRBA 1O5BB 2RDEA 1A3EH 3LGVA 5HMAA 3EYDA 4AFSA 1EOLA 1EP6A 1H8DH 3L6PA 3F68H 1GWAA 3FFGA 2WPJS 4NFFA 3ZZ6A 2ZC9H 3A7ZA 4ASHA 1GHBG 2O8TA 1MTWA 1O30A 3LH3A 2FOHA 1RJXB 2BD5A 2DUCA 1U6QA 1BTUA 3F9FA 1SQOA 1UHBB 3MFJA 3A7VA 1MU6B 1PFXC 1ZGVA 3SJOA 2W26A 3HGNA 4LZ1H 2G5NA 4GVUA 5HM9A 3CS0A 3TGIE 1GMHG 3KGPA 3VB5A 3V13A 4DVAU 4ISOA 1BIOA 1MZDA 4INKA 5F03A 2Y81A 4O9VA 4E7RG 1O2WA 3RXMA 3C27B 2OQUA 3PO1C 3S7HB 4E05H 2ZHWH 1IQGA 2GV7A 2H2ZA 1GHBF 2Q6GA 1EPTA 1YPMH 2OUAA 2ZEBA 4CRCA 2F9OA 1LQEA 2A4QA 2FIRH 3M5LA 4X2YA 1MTSA 1JMOH 2KZ4A 2XBWA 5DO4H 1XKBC 1ANEA 3AAUA 3ZIAD 1DY8A 1L2EA 3FOAA 2FPZA 1GMHF 3RU4D 1N6XA 1K1MA 4JZEH 3LT3A 1BOQA 1LMWB 4FXGH 3JZ1B 3A7YA 1BMLA 1N8OB 1TYNA 1BMMH 4HTCH 2JH0D 4OS6A 4JYTA 2ZU2A 5KECA 2VVUA 1P10A 1FPCH 1HIAB 1O2IA 1YPJH 1VGCB 2K1QA 4MPXA 2AGIX 1XMNB 2SGFE 2XW9A 3SGQE 1Y5AT 4Q7XA 1C1NA 4UEHH 5PTPA 4I8JA 2GD4B 4YOIA 4ACBA 1Q2WA 2XNIA 1O2LA 2YMSC 4IBLH 1W0ZU 1PQAA 3PTBA 1THPB 4FUHA 1NM6A 3GYLB 3UREA 1W3CA 2BY8X 1QTFA 2ZDLA 5EJZA 3MO9A 4R0IA 4X1NU 3N7EA 1UTPA 2ZECA 1Y5UT 2NU0E 1P2MA 1L1GA 2QF3A 4QT8C 4A6LA 1YY3A 4BOHA 1NRPH 3LH1A 2ZZUH 1QQ4A 2BD8A 3OTPA 3I29A 3SU3A 2OCVB 3BF6H 1GJ7B 1TOCB 4ZHAA 1BTPA 1UTQA 1NU7B 1J16A 3OEED 4CRFA 1ZZZA 4CRGA 2O8WA 2FS9A 1WTHD 1P2KA 2ALVA 2BVRH 3R0FA 1COWD 2GZ9A 5T6DA 1PQ5A 1C1SA 4UONA 1K28D 1S6LA 2FXRA 1SGRE 4DG4A 1LHFH 2BD3A 3GDVA 2GCHG 4KKDA 1CBWB 4I7YH 2QYIA 3OFND 2W5EA 2VVCA 5E8EH 1ZTLA 8KME2 4BAQB 3DSOA 3ITIA 2G00A 3EA8A 3HK3B 3Q3KA 2DE8A 2HPPH 3E91A 4X8SH 5C1UA 1G32B 1EFRD 3F3BA 3ZZ8A 1UHBA 5DG6A 3KEEA 1O3BA 2B5TB 1A3BH 4NIXA 2KCOA 4X2VA 2FYQA 3TNSA 3FKSD 3MMGA 1O3DA 3P6ZB 1KMHB 1OS8A 4HFPB 1RTFB 4X8VH 4B2BA 2ZDMA 2GMTC 3QZRA 3F0PA 1QGFA 2PKSC 1ZSKA 1KLIH 2ANKH 4A5TS 2GCHF 2BDBA 3T27A 2GT8A 3T26A 4OS7A 3SU0A 1CU1A 2OK5A 3HGPA 3PV5A 5JB8S 5C67A 3SORA 2RDLA 1ZPBA 2FODA 1FPHH 2NU1E 1T8LA 1Z6EA 1GMDG 2F4LA 4JZ1A 1C2FA 2L74A 1C9PA 2XTTB 2KAIB 4XFQA 5F53A 5LH8A 1FXYA 4SGAE 2WV5A 1MCTA 1XXFA 1YWUA 5T3HA 4DT4A 3S9CA 1HYLA 2FLBH 4Y71A 3VB6A 4BAOB 2A32A 4I8LA 4NG9H 5EQRA 4FUDA 4PROA 1D6WA 2ZWLH 5C0TA 2QXGA 2P16A 3F9EA 1HIAA 1O2JA 1O5GH 1C2KA 2Z9KA 1K0HA 3ZZ3A 4FUJA 1TGBA 1ID5H 2SGDE 3RXOA 3D23A 3UNSA 2BDCA 1OWEA 2RFKC 1C5PA 4MPWA 1GMDF 1P9SA 2BY5X 3RM2H 5JPMH 2V7QD 1ZTJA 1FLEE 3RXAA 1RIWC 2O8MA 3LU9B 4UDWH 1GJ6A 3RC6A 1UVPA 2G51A 3PMJA 1HB0B 1E36B 1AFQC 1YCPM 2A31A 3H09A 1MTNC 1GHVH 1YPKH 2XBYA 3CS7A 1V2JT 2R2WU 2SGEE 3LGYA 2BX4A 4JMYA 4ABGA 1WBGB 1NFWA 3WY8A 4DIIH 1TPAE 5DKMA 3M61U 4A92A 4GAWA 4K1SA 1GCDA 3OEHD 1TE0A 2D8WA 2QXHA 2STAE 1AKSB 3F2GA 8GCHG 2JDID 2ZGHA 1SG8B 4TPYA 4Y6DA 3T2NA 3SUFA 4M9FA 1K1LA 1MKXH 1ELTA 3M37A 1QL8A 1THSH 3NWUA 1MQ6A 1SHYA 2P8OB 4A1TA 1AO5A 3EE7A 1C2DA 5AVDA 3SJIA 1ZMLA 1OWHA 4Y11E 3PRDA 4J2YB 1DWDH 1EUFA 2PSYA 1D3TB 4NWKA 1SBWA 2WPHS 1C1RA 1BHXB 2AGGX 1PPEE 2FOCA 1DWBH 3SI3H 2AMQA 5B6OA 2GCTB 3TK9A 1ZSLA 2QIQA 5LPFA 1P05A 1W10U 4LZ4B 5HXFA 5EXNA 3SGAE 3PYHA 2GVFA 2ZPQA 3SU2A 1YLDA 1BBRK 1GL0E 2Q6FA 1BRAA 1MTUA 1TONA 2QAAA 3GY4A 2FWWA 8GCHF 3FAOA 2H9HA 2BXUH 3ODFA 1WXRA 1Y3XA 1O3GA 5FPYA 2UUYA 5FBEA 1W0YH 2C90B 1DWCH 2LP6A 1S84A 4RKJB 2PLXA 3P8FA 1QJ7B 2OBQA 1FY3A 1ZR0A 4I33A 3VXFH 1NESE 1P03A 4AG1A 4MLFB 2BDYA 4A1VA 3FZDA 3SGBE 5DSFA 5K7RA 1HJAC 1TAWA 2RA0A 4TWYA 1A46H 1KXAA 1O2UA 4ASUD 2SFAA 6CHAB 1BJUA 2FOFA 3F9HA 2GZ8A 3ATMA 1QBOA 2ZA5A 2EC9H 1ELDE 1MBQA 2BY9X 3OYPA 2ZU1A 1F2SE 1O3FA 2SGQE 3RC4A 2YMSB 1OSSA 2BM2A 1SGQE 2KAIA 1OOKB 4K5ZA 1E0FD 5A0AE 1C1QA 3BTHE 5JBCS 2BDIA 1C5OH 1QRZA 3SZEA 3SUGA 2ZHDA 4XD7D 1NRSH 4X2XA 4LXBH 5JDUB 2A4OA 1K22H 1O2VA 1SSXA 1BBRE 3A86A 4U30A 3GCHB 1MUEB 1GJAB 4AX9H 3A7TA 2FX6A 4M7GA 3QWCH 4Y0ZE 1C5TA 1L4ZA 2V6NA 2KCPA 2XOKD 4KTUA 2HVYB 1EXFA 1NFUA 1VCWA 1YLNA 4AORA 4I8KA 2P3FH 1J9CH 2GGVB 1CGIE 3RXPA 4I32A 1BTXA 2PFEA 3SU1A 3U8RH 1TNJA 1HJ9A 4I8HA 2AMPA 1TA6A 4WH8A 1DXPA 1FUJA 1YPEH 1QR3E 3MO3A 1C4Y2 1KY9A 2ZKSA 1HAVB 1V2MT 4YESB 3U69H 5GNDA 1O2GH 4B2AA 3PV2A 3A89A 3SUEA 1G3BA 1RRKA 2J94A 1F0UA 1A5GH 4YOGA 4CREA 5I46H 1AKSA 3F1SB 1C9TA 5DP3A 1JIRA 2F9NA 2XC5A 5HIZA 4O3TA 1WUNH 5DP9A 4AFQA 1C5MD 3BIVH 2SNWA 3ZYDA 3P17H 2KX4A 1TRYA 1E35B 2ZP0H 5C2ZA 4JYVH 5I25A 1C5SA 4X8TH 3BSQA 3M3VA 4KTCA 3PM3A 2PKSB 5F8TA 4K60A 1K1PA 4KTSA 4MNWA 1BBRH 1XUKA 1V2QT 2OQ5A 5GJ4B 5JB9S 4ABAA 4YM9A 2BY6X 1GBCA 2XC0A 3FANA 1IQHA 1EB1H 2BZAA 1PPGE 2ZFPH 4XOJA 2WZQA 1JOUB 3H5CB 1C2JA 4B1TA 2PWXA 2JJ2D 1C4U2 4SGBE 1WOFA 3ZV8A 4ZXYH 1C1VH 3CENA 1ETSH 1KYNA 4GHQA 2WV4A 1K21H 2ZHEH 2OC8A 1QY6A 2AHME 3ZZDA 1P3CA 2CK3D 3ENSB 3OU0A 3U28C 3PMHB 3FZZA 4OM9A 1AQ7A 2VWMA 3TJOA 2FZZA 4HG6A 2NU3E 1XVOA 3MTYA 1FZZA 1SPJA 3L3TA 1AB9C 2AGEX 2SGAA 3BTFE 1C1OA 3LGUA 8LPRA 1GHXH 1RS0A 2AIPA 2BQ6B 1H9IE 3K9XB 1T8MA 3WWFA 5HKKD 2WV9A 2R3YA 2VINA 2ZPSA 4D7FA 4IC6A 1TRMA 4P00A 3ZZCA 5FX6A 3D62A 3BG8A 1O5AB 3T29A 2BX3A 1AIXH 1YBWA 3GY3A 1C5ZB 4INHA 1G3EA 2G8TA 1FNIA 3ZVBA 1MTNB 2VJ1A 1L0ZA 2B8OH 1GBBA 4IS5A 2ULLA 1ANDA 2ZU4A 2BD7A 1GBFA 5HM2A 4VGCC 2XBXA 1C5RA 3QGNB 3OTJE 2FESH 1OX1A 4RN6A 3DSPA 1HDTH 3STJA 5KGOA 2G5VA 5GXPA 1ZRKA 1VKYA 2B7DH 1V2LT 1GI4A 1HAIH 1PQ8A 2WYJA 3MWIU 1ESTA 1MABB 1WU1A 2EA3A 1ELCA 1ESAA 1HRTH 1O2ZA 2Q1JA 3KQCA 3RXSA 2Z94A 1DWEH 2P59A 2GV6A 1SKYE 1P3EA 5HYOA 5DP6A 5EJLA 4FUIA 3KQDA 1V6DA 4MPUA 3SJ8A 1EKBB 2ODQA 1Y8TA 2F9BH 4A7IB 1DS2E 4FOUC 3STIA 3GICB 5DK1A 4O03A 3HK6B 1C5QA 1KXCA 1ZLRA 3OSYA 1NBMD 2BVSH 1VCQA 3ZZ5A 2ZHFH 4NIYA 1HAVA 1FQ3A 1N6YA 1S6FA 2Z7FE 3VPKA 3ZVGA 2Y5FA 7LPRA 1YPHC 1HAGE 1C2LA 4WY3A 3WWBA 4GSOA 2BDHA 3GCNA 3PLPA 1FV9A 4ISHH 3NPSA 2ZDAH 4CR5A 4I86A 3I77A 3OE7D 4GHTA 5FXLA 1FY5A 1GGDB 3ZVCA 4AG2A 3QO6A 1BT7A 1P57B 1XXDA 1FIWA 1KIGH 1HLTH 4RKOB 2PV9B 1A4WH 1K1IA 2J38A 3UR6A 4Q2KA 2FS8A 1DLEA 2A2XH 1FIZA 1KXBA 4YXWD 1GI8B 2Z3DA 2V3HH 1DICA 2ALPA 2ILNA 3A85A 3L33A 2B0FA 1XVMA 1WYKA 2QF0A 1GDQA 1QCPA 1ZYOA 4Y76A 1MKWH 1V2KT 1AHTH 4KELA 3VGCC 3ZYEA 1O38A 1AE5A 4I8GA 2WPMS 1D6RA 4X6PA 1ZHPA 1P2JA 1MAXA 1E37B 2CHAB 2ZTXA 3M3TA 1EZUC 3T25A 1BMAA 3F9GA 3TLOA 2ZFSA 2Y7ZA 1EAIA 3BEIB 1CHOG 4JZDH 2ANWA 1O2KA 3KIDU 1CGHA 1UTNA 1P09A 3VB4A 4X8UH 1MQ5A 2F83A 5E0HA 3LC3A 2ZPRA 1DX5M 4XE4A 1Z8GA 2KCAA 1T4VH 2QF4A 1O2OA 1BRUP 3M7QA 2PTNA 1PPZA 3TITA 2ODPA 2H6MA 1XUHA 1XUJA 4ZKNU 1GG6C 1L4DA 2J92A 4K8YA 5FBIA 2C3SA 2GP9B 4K2YA 3GY7A 4Y7BA 2CGAA 2A4GA 1TMTH 1NTPA 3B9FH 5ESBA 2J95A 2JJ1D 3A7WA 5B6LA 1O0DH 2VIWA 5EPNA 4CH2B 1XKAC 5FHTA 1D9IA 1CHOF 3UFAA 1PPBH 4Y10E 5LPRA 2FTLE 4H6SB 1AE8H 3EA9A 5FX5A 1TQ7B 3SV6A 1GHWH 1GHAG 3SU4A 1UK2A 3E3TA 4Y79A 2VIDA 3E0NB 4ISLA 3MI4A 4HZHA 2Z9LA 2JETC 1UO6A 2I6QA 4ESTE 4ABBA 4DGJA 2TBSA 2VIOA 1UTMA 4DT7B 4X2WA 3EGKH 1ELVA 2C93B 1C5XB 3LJJA 3MU5A 3K65B 4K1EA 1UVOA 1ANCA 2XNDD 4Y7AA 3E0PB 1FONA 2O9QA 3P8GA 2FX4A 2ZHQH 5GDSH 1L1JA 3LGWA 5LGOA 1GBDA 2NWNA 2W7SA 4WMFA 4AFUA 1O3OA 2V3OH 6GCHG 1DXWA 3BTKE 1ABIH 3BEUA 2ZFFH 5DGJA 2QCYA 1NY22 1IQJA 2FYRA 2L6OA 1GHAF 2UWPA 1SLVB 3A8CA 3U8OH 3N99A 1HAPH 1K1OA 1TALA 1CA0C 2F3CE 1GJ8B 3LDXH 3BTTE 1SQTA 2BQWB 3VXEH 3Q76A 4CHAC 1QFKH 1TWXB 3IG6B 2TPIZ 2IN2A 1B0EA 4ZUHA 4UE7H 4ZAEA 1O3NA 3ATIA 4H42U 1AB9B 1QB1A 3QLPH 3DT0H 1CA8B 2A4RA 1N1LA 4ABEA 2QGRA 2TGDA 4WWYA 1TX8A 4ZHMU 5EW1H 3RUOA 5KEDA 4ZCNA 1UVUH 3KQ5A 3VG8A 3VB3A 4DCDA 4ISIH 6GCHF 1ZJDA 5AF9H 1KLTA 1UVSH 1GBEA 3UWIA 3KNXA 2AYWA 1DSUA 2D1JA 2V3MA 1O2QA 1GCTB 3BN9A 2J97A 1P2IA 1SGYE 3KL6A 2IPQX 7GCHG 2CMYA 4BANB 2NU4E 1LVMA 5HGGA 2ZFTA 2H9EH 2I6SA 4TPIZ 3QN7A 2J5UA 5EODA 1P04A 4YZUA 3FP8E 2XCFA 3SNDA 5BPEA 3LIWA 4UFFH 2VIVA 3BTME 5F8XA 1QJ1B 2GT7A 1W13U 3RU4E 3QUMP 3BTWE 2ZCHP 1IQLA 2ANMH 2LPRA 1QB9A 5CHAC 3A87A 1BRCE 2D26C 1O3LA 2BD2A 1SLWB 1AVWA 4X6NA 3V12A 1SGCA 1HXEH 4DURA 3F2HA 2CN0H 7GCHF 1OP2A 4MDSA 3RXTA 1LHEH 1A1RA 2YNAA 2Y82A 3SU5A 3ZVFA 1F5RA 2HLCA 5EG4A 3OY5U 3GS9A 2F9VA 2UUKB 1EAXA 1O32A 4WXVA 1O36A 2P3TB 2QE7D 1GJCB 5A0CA 4Y8XA 1QBVH 1MAYA 1F0TA 1TMBH 1Z71A 2VWLA 3U8TH 1QJ6B 1ELGA 1SQRA 2SNVA 5FPTA 4WJG2 1O5DH 3TJUA 3V0XA 4AYVB 3MU4A 5JYIA 5DJ7A 2G55A 1AVGH 1KXDA 5A2MH 2FOBA 1Z7KA 1LQDB 2J2UA 4FETA 5L6NH 3TH4H 1DOJA 2XCNA 3E8LA 3KN2A 2ZG0H 3RXHA 1VCPA 1HUTH 4AN7A 1UTKA 1YLCA 4ZKOU 3O8CA 3KQBA 4IW4E 4JZIA 1VITH 1OP0A 1TOMH 2VB0A 2ZDNA 2BD9A 4H4FA 5TJXA 1Y3VA 1EPTC 1JWTA 2Z3EA 5JBAS 4B71A 3F2FA 1P02A 4ISNA 3RXLA 4YT6H 3DSGA 3OAAD 5EXMA 1W11U 1C4V2 1GHYH 1WSSH 1INCA 5DP7A 4B76A 4THNH 1ARCA 1QB6A 4BXSA 1J15A 1IQIA 4NCYA 4Q7ZA 2LNCA 1S82A 1A0LA 1ARBA 3P95A 3A80A 3SI4H 1E1QD 1L1NA 3SN8A 1SGEE 1B7XB 1O34A 1ZTKA 3A7XA 1G3DA 1QNJA 1V3XA 1H8IH 1GJDB 4WXIA 1YPLH 2WSSD 1EAWA 4Q4LA 4UFGH 3PO1B 1DT2A 3ATKA 2FOGA 2PSXA 1V2UT 3SZNA 4B75A 4IGDA 2THFB 4JK6A 1NU9A 2FI4E 5EJ1A 1THRH 3QX5H 4UFDH 3KF2A 2UWOA 1GBIA 2OD3B 5DP4A 1EB2A 3BIUH 1TGTA 2ZGJA 2RCEA 1C2GA 3E6PH 4FUBA 3TJNA 1GVZA 1TBRH 4KGAA 1C5WB 3EDXB 5J4SA 2OP9A 2ZO3H 2AFQB 1DPOA 2EI6A 4MQAA 1EQ9A 3IITA 2FTMA 3T62A 5CDFE 3W94A 1LCYA 3UOPA 3GYMA 2OXSA 1QL9A 3ATWA 5GWZA 3F0OA 3SV8A 1YYY1 5L2YH 3WW7A 2J34A 1NT1A 1HAOH 3LOXA 1W7GH 4OGXA 3S9BA 2M5TA 2JETB 2RA3A 2F9UA 3MH7A 1H8ED 1ETRH 2BOKA 1S81A 2ODYB 3BG4C 1HFDA 4P02A 1H4WA 1XUFA 1Q31A 5DP5A 4U2WA 3DHKH 3HPTB 2ZI2H 3DFJA 3SHCH 4F4OC 1BQYA 2M2AA 1KDQB 4NZLA 2OBOA 1LHGH 1OWIA 3RC5A 4ZKRU 5AFYH 1SVPA 1W0JD 4JYUH 3UQVA 1VJ9U 1KTSB 1K1NA 5EGMA 1LO6A 2FM2A 3LJOA 3RDZA 2FP7B 4XBBA 1FN6A 2SGPE 4Q63A 1O2SA 4CHAB 1E1RD 1EOJA 2J4IA 1YPHE 1O3CA 4CR9A 3S9AA 2Z9JA 2FI3E 2LELA 1ZSJA 3SU6A 1YF4A 4BTTB 3RLYH 1NPMA 1TNKA 3RXJA 4BAKB 2C8WB 1D3PB 3RXEA 1HAXB 1O3MA 3NCLA 3MNCA 4AB9A 1T7CA 1RD3B 4ZHLU 6LPRA 1BTYA 1F92A 3M3SA 1V2VT 5JBTA 3DD2H 1OPHB 1A61H 4NWLA 3ATLA 3FVFB 2XWBI 3GY6A 4Y8YA 1OWJA 1UTJA 2GTBA 3PTNA 3RXGA 3MNSA 1UK4A 2GX4A 2J98B 1SGFG 1B0FA 2A7JA 4OS5A 4AGKA 2QY0B 3TH2H 1O31A 1TA2A 3UTUH 5A8YA 4BAHB 1SR5C 1SGNE 1CO7E 1O2TA 1T4UH 3A8AA 2GMTB 1TFXA 1GI1A 3RMMH 1DITH 1TGSZ 1O2HA 2VVVA 8ESTE 2Q6DA 2Y5HA 3SV7A 2XC4A 1WV7H 2G4TA 3RP2A 1LKBA 4FUCA 1SFQB 1Z6JH 1VGCC 1MCVA 4B74A 3AAVA 1O37A 1O2XA 1C1TA 3LPRA 4OS4A 2KCYA 2W3IA 1FY4A 2ZFQH 1LPZB 1TNHA 3ZZ9A 1YCPK 3HATH 3R3GB 3SJKA 1P11E 1NN6A 1IQEA 1LHCH 1YPGH 1UTOA 1AN1E 1WQVH 2OC0A 1BTHH 3O8BA 4F49A 4WMEA 1IAUA 2ASUB 2KFWA 1V2NT 3M36A 1ESBA 3UUZA 1AI8H 2PP6A 1OHHD 2VWOA 3N7DA 1E34B 5AFZH 3KYGA 2ZGCA 1KTTB 1O5EH 1KXEA 4HGCA 1EP5A 1HCGA 3MOCA 4ABIA 5DN6D 2FO9A 3D65E 4JCNA 1H1BA 1H9HE 5TCCA 1C5LH 3Q77A 3TU7H 3H7TA 1A2CH 4O3UA 1FN8A 1BTWA 1UK3A 3K6ZA 2GDEH 3KQEA 3LGTA 5C0UA 2YNBA 3SW2B 2C8XB 3SHAH 2XXLA 2CF8H 2FOMB 4AB8A 2VIQA 1C5NH 1IHSH 4BTUB 1W2KH 1RIWB 3A88A 5CHBA 2EEKA 1GBMA 4NSVA 4Z1MD 4DJZB 4XBDA 4YLUA 3EQ0H 1AFQB 1FDPA 1GJ4H 4MNXA 4NZQA 5HIYA 3U1IB 1VR1H 4K8BA 1CGJE 1ETTH 4Y8ZA 2WPDD 4BTIB 1TBZH 2FMJA 2PUQH 3D49H 1LVBA 2OINA 1AY6H 1NZQH 1JRTA 2WPIS 1O3KA 2HOBA 4R8TB 1BITA 1O2MA 3PWBA 2ANYA 1OYQA 1QRXA 1TPPA 2WUCA 4F55A 3UNRA 4AOQA 5BRRE 1NFXA 2RG3A 2C8YB 4INLA 1TBQH 2UUJB 1IQKA 4JK5A 1PPFE 2W3KA 4O97A 3UOUA 1J8AA 1WDIA 3ELAH 1RTKA 1YC0A 4MNVA 3VFEA 3TPIZ 3FO8D 2A1DB 1O3PB 1F0RA 3Q3XA 3IWMA 5A8ZA 2GZ7A 3ODDA 1SI5H 3M35A 2HNTC 3AW1A 2VH6A 4B6EA 1FY1A 3MU0A 1J17T 3PWCA 1GDNA 4UFEH 5TCAA 1X7AC 1O39A 1RXPA 1SB1H 1UTLM 2QA9E 5EPYA 3GDUA 1AUTC 1GI3A 1T31A 2R0LA 2UWLA 3MNXA 1IQMA 1ZHMA 4MTBA 1ZJKA 1C1MA 5CMXH 2KR7A 1TNGA 2J98A 3LONA 1BCUH 5DP8A 4ABJA 3EE0B 1SC8U 4XBCA 1TPSA 1HJAB 3P70B 3URCA 1P2QA 5H4IB 1SQAA 3MU8A 1H8HD 1TPOA 3UY9A 1BJVA 3BEFB 1A7SA 1DLKB 4HI3A 2R9PA 1BDAA 4XRNA 1HAZB 1IOEA 2PGBB 2WUBA 3M5NA 4TY6A 1XUGA 1TMUH 2HRVA 3CNRA 1QZ8A 2BHGA 2FEQH 5E2PA 2P94A 3E90B 3BG4B 4Z6AH 1AZ8A 4NIWA 1BA8B 1W12U 1G30B 1Z1JA 2BYAX 3SNBA 1A5HA 1V2OT 2A0QB 1MU8B 4OS2A 3GCOA 1FAKH 1GI0A 3DUXH 2OTVA 1CT2E 4TWWA 2ZCLP 1F7ZA 3Q00A 3SJ9A 4BXWA 4TY7A 3GOVB 4FUGA 1TGCA 2JIZD 2H5CA 4ZROA 2NU2E 3S69A 2ZNKH 2GJGA 2ESTE 3SNCA 4A1XA 3M7TA 5FCKA 1KLJH 3UNQA 4GUXA 2ZTYA 3UIRA 1T8NA 1EASA 1C5VA 1TX6A 3MHWU 2ZGXH 1YP9A 2H1UA 1VJAU 2P8OC 3SV2H 3DCLA 3BTDE 1GJ9B 1BMFD 3B8JA 1AU8A 3O8DA 1DM4B 4MVNA 1D4PB 2B9LA 1YGCH 1TRNA 1OYTH 3GY8A 4LOYH 1GI6A 3MO6A 1SOZA 1P9UA 1K9OE 3RXQA 1O3IA 4MG3A 2BLWA 2GCTC 3NZIA 1S0QA 3P8OA 1SGPE 2AIQA 1HJ8A 1MTVA 3A82A 3RXCA 3LC5A 1ELEE 2STBE 2AH4X 2BMGB 2EI7A 1E38B 5EIYA 5AHGH 5EW2H 1G36A 1O35A 1OWKA 3NK8A 5EQSA 3SNAA 5L30H 4NA8A 1GHZA 3S0NA 5IDKA 1NBME 4K1TA 3BV9B 4OS1A 1BZXE 2PTCE 1QA0A 1D3QB 3I78A 3Q3YA 1LPKB 1A0JA 1OWDA 5GCHG 2A5AA 1IHTH 4X1PU 1K2I1 3ZV9A 1ZPZA 2QN5T 5LPEA 3U98H 1A0HB 3ESTA 1NRNH 1SFIA 5FL7D 2F43B 3KCGH 2BB4A 1GJ5H 3S7KB 3QGJA 3SOSA 2OLGA 2YOLA 5C17A 3QK1A 3RU4T 3SYJA 1QURH 6CHAC 4TT3D 3SNEA 4Q7YA 2VH0A 4MPVA 2AEIH 3OX7U 3MYWA 2ZF0H 4KP0A 1ZHRA 1SOTA 1VITG 3DFLA 1DDJA 1CE5A 1EAUA 4YLQH 3KHVA 1Z1IA 5GCHF 1HPGA 1T8OA 1P2OA 1UW7A 1XUIA 3JZ2B 2XYAA 1P01A 4WF8A 1VZQH 4FVDA 1PYTD 2Y5GA 3MQKC 2R2MB 1FAXA 1E79D 3PMBB 1FI8A 3SQEE 2XWAA 2AMDA 2C4FH 1SGIB 1TLDA 2VIPA 1AUJA 3GCHC 3SO3A 3TGJE 2D2DA 2W7UA 3A84A 1QA7A 5EXLA 1G2LA 1S83A 3B23B 2F9PA 1MMJN 4CH8B 3UWJH 1Y3WA 4FUEA 1MKXK 1DY9A 4YOJA 1VITF 4WH6A 3GY2A 3TNTA 3TH3H 1SGDE 3PV4A 1C2IA 1YM0A 1RTLA 3VEQB 3GY5A 4ABFA 4D8NA 5FAHA 1GVLA 1TNIA 1FJSA 2BZ6H 5DPAA 1LVOA 4VGCB 4ACAA 2GKVE 5A09A 4WMDA 1Y59T 1H9LB 1C5YB 2VBCA 2IPHA 3HKIB 1WQSA 1SL3A 1ANBA 2AERH 2TRMA 4FU8A 7KMEH 1FMGA 3M5MA 4AYYB 1NO9H 3DA9B 1AWFH 2O8UA 4GLYA 4K3JA 5A0BA 1G2MA 1NRQH 4Y0YE 3F6UH 5F8ZA 5ETXA 1C5UA 1O5CB 3TVJB 2FI5E 3W1EA 2V0BA 1AD8H 1C1WH 2BVXH 3QDZB 1ELFA 4NSYA 1RFNA 1G9IE 1O33A 5T6GA 5GPIB 6ESTA 3M7UA 4MNYA 1LHDH 3FN8A 1RGQA 2Z6BD 4IN2A 1A5IA 1O2PA 1KXFA 1S5SA 1XM1A 1YKTA 1TNLA 1ZMNA 1P12E
chains in the Genus database with same CATH topology
1SHHB 1QBNA 2KM0A 2W6JD 2HALA 1DUAA 1JXPA 3RMLH 1KSNA 1GBJA 2PKAB 1JBUH 2BLOA 3N7OA 4GCHG 1HV7A 1QL7A 3TGKE 1M9UA 3A83A 5J4QA 2A7HA 5C1YA 1PJPA 5C20A 3UR9A 1K1JA 3AVZA 2WINI 1ELAA 3C1KA 1EZXC 4YT7H 3TK5A 4D7GA 3RXVA 3PB1E 1PPHE 1BMNH 2ZIQH 1DFPA 1TGNA 1C1PA 1FY8E 2BY7X 2HGTH 2ZDKA 1OP8A 3K2UA 4IC5A 3UPEA 1W14U 4ZKSU 1AVXA 4I31A 2ZU3A 4GCHF 3U1JB 3VGCB 2Z9GA 1Y3YA 2Y80A 2HVXA 1ABJH 1MZAA 2Y6TA 3RM0H 2JKHA 4XSKU 1BB0B 2K0QA 3K6YA 3CP7A 1O5FH 1SLXB 1GBKA 1EZQA 4UD9H 1SMFE 1O2NA 4X0WU 4NA7A 4D9QA 1V2ST 2BTCE 2OC7A 1JIMA 2VGCC 5C1XA 1XX9A 3FP6E 3SUDA 2EI8A 1SLUB 2BD4A 1O2YA 1BTZA 5SGAE 3NXPA 2ZFRH 2XBVA 4B2CA 3OY6U 2G52A 4X6OA 3PROA 2CF9H 4GPGA 3RXKA 3VB7A 5C3NA 2QV1A 5E0GA 2WYGA 2Z3CA 3V3MA 4DW2U 4FVBA 1ELBA 3O8RA 1GG6B 2Z9IA 3U9AH 5EOKA 3RXBA 5C5NA 3SV9A 4CRDA 1GDUA 3ZZAA 2PUXB 3NRLA 3RLWH 3ZVDA 2HLDD 1MH0A 4AFZA 5T1VA 1EJMA 2VU8E 5L2ZH 4B73A 2A7CA 5ESTE 1DVAH 4J1YA 1Z8RA 2FDAA 1UCYK 3MH6A 1HNEE 5FCRA 2BDGA 1F5LA 2QC2A 1WTGH 4FU9A 1G3CA 2F91A 5GIBA 4BAMB 2CJIA 3PRBA 3RXDA 1C1UH 2H5DA 5JBBS 1W0KD 1AMHA 5G4BA 3PMAB 1BRBE 2BQ7B 4IN1A 4JZFH 3ZZ4A 3AW0A 4Q80A 1GGDC 2QXJA 1OKXA 2QXIA 2HNTF 3GDSA 1O3AA 3P92A 2IJOB 3PLKA 3RMNH 1Z8IB 1CT0E 1GBLA 4H6TA 4X1SU 4U01A 4DY7B 1QHRB 2UUFB 1OXGA 1MD7A 3TIUA 1D3DB 1EATA 2ZCKP 2VWNA 2A5IA 3SBKA 2CV3A 1BUIA 3UQOA 5IYTA 4Z0KA 3A81A 1HAYB 2G81E 3MNBA 4ZMAH 1V2TT 1Y5BT 3MH5A 4TYDA 3RMOH 1DE7H 2PKAA 1HGTH 3NKKA 3UB0A 1EZSC 2BOHB 2TGPZ 1HAHH 3MU1A 2H9TH 1CA0B 1GVKB 1NFYA 1G37A 2J9NA 1F0SA 1UVTH 3ZVEA 1WCZA 2HNTE 2ZDVH 2AS9A 2Y7XA 1ZOMA 1UMAH 4NFEA 4RSPA 3E16B 1ZPCA 2CHAC 3T28A 2ZQ1A 1GMCG 2WPKS 4B6FA 4ABDA 1C2HA 2BDAA 1UCYE 4FUFA 1S0RA 4NGAH 2P95A 2FOEA 1GL1A 1TB6H 1GI9B 1AZZA 3QTVH 2GDDA 3ZZ7A 3T5FH 1PYTC 1DSTA 1C2EA 1V2PT 4IMZA 2YMSD 5IK2D 1GBAA 4IMQA 1SGTA 1EX3A 1GMCF 2A5KA 1T32A 5E2OA 2FOAA 4YTAA 1O2RA 1S85A 4U32A 1N8OC 1P0SH 4ABHA 3TK6A 2DE9A 2IOTA 4E7NA 4YO9A 4CRBA 9ESTA 4RI0A 4CBNA 1EJAA 3BTQE 9LPRA 2XRCA 5CHAB 2G4UA 1Y3UA 1BHXF 2PW8H 4OGYA 1EJNA 3EAJA 3NUMA 3A8DA 1Q3XA 1O3HA 1FX0B 4AGJA 1GBHA 1V2RT 3BTEE 3AASA 3P8NA 1CSOE 1UCYH 2WHXA 3ZVAA 1SGFA 1ZGIA 1NC6A 2QF5A 3E1XB 1LVYA 3GCTG 2HPQH 4X6MA 7ESTE 1PPCE 2FLRH 5EQQA 3URDA 1TX7A 2ZU5A 4NIVA 1AFEH 5FPSA 2R0KA 3RXRA 2IJD1 4LK4A 4WVPE 1MKWK 1JRSA 5EU8A 1LKAA 1O3EA 3V7TA 1PQ7A 3H7OA 2JH5D 1P06A 1Z8JB 2PHBA 2ZGBH 1GI5A 1ACBE 2P93A 1P2NA 1IQNA 2JH6D 2K8IA 2W6ID 5CE1A 1C2MA 1KDQA 2BLQA 3GISB 1CBWC 4X1QU 1EPTB 1CQQA 3GCTF 1F5KU 1NROH 1HBTH 1WAYB 3HKJB 1P8VC 3FP7E 3QTOH 4E06H 1UJ1A 1ZMJA 2VNTA 2TGAA 3W95A 1NS3A 1GCTC 3QZQA 2A45B 2WPLS 3PLBA 1NRRH 2C8ZB 4CBOA 2BLVA 1MBMA 5E0JA 5F6MA 4DIHH 2R3UA 1GI7B 1MD8A 2CXVA 3LKWA 1LTOA 4TSFD 2TIOA 1CVWH 2VGCB 5ABWA 1LDTT 1TABE 1LPGB 1GI2A 2TGTA 2BXTH 2P3UB 2PR3A 3ZZBA 1GBTA 3M5OA 3RXIA 2A2QH 3RXUA 1QIXB 2PGQB 1V2WT 1O3JA 1CT4E 1AWHB 2OC1A 1QRWA 4K69A 5T6FA 4NA9H 3TJVA 3A8BA 1S6HA 2ZQ2A 4D76A 4AZ2B 4XDEA 1W7XH 2ZTZA 5C5OA 2O8LA 3LGIA 1B5GH 1HXFH 1W8BH 1GPZA 1CHGA 5K0HA 4ZH8A 1TQ0B 1AGJA 4D9RA 1J14A 4ZXXH 1YCPH 3BTGE 4FU7A 1GJBB 1DUEA 4BNRA 3G01A 3MH4A 1IQFA 1ORFA 1QQUA 3SQHE 5A8XA 3AK5A 2HWLB 3EA7A 4X1RU 1DANH 1TIOA 4DOQA 4CRAA 2V35A 3RXFA 1ZRBA 1O5BB 1A3EH 3LGVA 5HMAA 3EYDA 4AFSA 1EOLA 1EP6A 1H8DH 3L6PA 3F68H 1GWAA 3FFGA 2WPJS 4NFFA 3ZZ6A 2ZC9H 3A7ZA 4ASHA 1GHBG 2O8TA 1MTWA 1O30A 3LH3A 2FOHA 1RJXB 2BD5A 2DUCA 1U6QA 1BTUA 3F9FA 1SQOA 1UHBB 3MFJA 3A7VA 1MU6B 1PFXC 1ZGVA 3SJOA 2W26A 3HGNA 4LZ1H 2G5NA 4GVUA 5HM9A 3CS0A 3TGIE 1GMHG 3KGPA 3VB5A 3V13A 4DVAU 4ISOA 1BIOA 1MZDA 4INKA 5F03A 2Y81A 4O9VA 4E7RG 1O2WA 3RXMA 3C27B 2OQUA 3PO1C 3S7HB 4E05H 2ZHWH 1IQGA 2GV7A 2H2ZA 1GHBF 2Q6GA 1EPTA 1YPMH 2OUAA 2ZEBA 4CRCA 2F9OA 1LQEA 2A4QA 2FIRH 3M5LA 4X2YA 1MTSA 1JMOH 2XBWA 2KZ4A 5DO4H 1XKBC 1ANEA 3AAUA 3ZIAD 1DY8A 1L2EA 3FOAA 2FPZA 1GMHF 3RU4D 1N6XA 1K1MA 4JZEH 3LT3A 1BOQA 1LMWB 4FXGH 3JZ1B 3A7YA 1BMLA 1N8OB 1TYNA 1BMMH 4HTCH 2JH0D 4OS6A 4JYTA 2ZU2A 2VVUA 1P10A 1FPCH 1HIAB 1O2IA 1YPJH 1VGCB 2K1QA 4MPXA 2AGIX 1XMNB 2SGFE 2XW9A 3SGQE 1Y5AT 4Q7XA 1C1NA 4UEHH 5PTPA 4I8JA 2GD4B 4YOIA 1Q2WA 2XNIA 1O2LA 2YMSC 4IBLH 1W0ZU 1PQAA 3PTBA 1THPB 4FUHA 1NM6A 3GYLB 3UREA 1W3CA 2BY8X 1QTFA 2ZDLA 3MO9A 4R0IA 4X1NU 3N7EA 1UTPA 2ZECA 1Y5UT 2NU0E 1P2MA 1L1GA 2QF3A 4QT8C 4A6LA 4BOHA 1NRPH 3LH1A 2ZZUH 1QQ4A 2BD8A 3OTPA 3I29A 3SU3A 2OCVB 3BF6H 1GJ7B 1TOCB 4ZHAA 1BTPA 1UTQA 1NU7B 1J16A 3OEED 4CRFA 1ZZZA 4CRGA 2O8WA 2FS9A 1WTHD 1P2KA 2ALVA 2BVRH 3R0FA 1COWD 2GZ9A 5T6DA 1PQ5A 1C1SA 4UONA 1K28D 1S6LA 2FXRA 1SGRE 4DG4A 1LHFH 2BD3A 3GDVA 2GCHG 4KKDA 1CBWB 4I7YH 2QYIA 3OFND 2W5EA 2VVCA 5E8EH 1ZTLA 8KME2 4BAQB 3DSOA 3ITIA 2G00A 3EA8A 3HK3B 3Q3KA 2DE8A 2HPPH 3E91A 4X8SH 5C1UA 1G32B 1EFRD 3F3BA 3ZZ8A 1UHBA 5DG6A 3KEEA 1O3BA 2B5TB 1A3BH 4NIXA 2KCOA 4X2VA 2FYQA 3TNSA 3MMGA 3FKSD 1O3DA 3P6ZB 1KMHB 1OS8A 4HFPB 1RTFB 4X8VH 4B2BA 2ZDMA 2GMTC 3QZRA 3F0PA 1QGFA 2PKSC 1ZSKA 1KLIH 2ANKH 4A5TS 2GCHF 2BDBA 3T27A 2GT8A 3T26A 4OS7A 3SU0A 1CU1A 2OK5A 3HGPA 3PV5A 5JB8S 5C67A 3SORA 2RDLA 1ZPBA 2FODA 1FPHH 2NU1E 1T8LA 1Z6EA 1GMDG 4JZ1A 2F4LA 1C2FA 1C9PA 2XTTB 2KAIB 4XFQA 5LH8A 5F53A 1FXYA 4SGAE 2WV5A 1MCTA 1XXFA 5T3HA 4DT4A 3S9CA 1HYLA 2FLBH 4Y71A 3VB6A 4BAOB 2A32A 4I8LA 4NG9H 5EQRA 4FUDA 4PROA 1D6WA 2ZWLH 5C0TA 2QXGA 2P16A 3F9EA 1HIAA 1O2JA 1O5GH 1C2KA 2Z9KA 3ZZ3A 4FUJA 1TGBA 1ID5H 2SGDE 3RXOA 3D23A 3UNSA 2BDCA 1OWEA 1C5PA 4MPWA 1GMDF 1P9SA 2BY5X 3RM2H 5JPMH 2V7QD 1ZTJA 1FLEE 3RXAA 1RIWC 2O8MA 3LU9B 4UDWH 1GJ6A 3RC6A 1UVPA 2G51A 3PMJA 1HB0B 1E36B 1AFQC 1YCPM 2A31A 3H09A 1MTNC 1GHVH 1YPKH 2XBYA 3CS7A 1V2JT 2R2WU 2SGEE 3LGYA 2BX4A 4JMYA 4ABGA 1WBGB 1NFWA 3WY8A 4DIIH 1TPAE 5DKMA 3M61U 4A92A 4GAWA 4K1SA 1GCDA 3OEHD 1TE0A 2D8WA 2QXHA 2STAE 1AKSB 3F2GA 8GCHG 2ZGHA 4TPYA 1SG8B 3T2NA 4Y6DA 2JDID 3SUFA 4M9FA 1K1LA 1MKXH 1ELTA 3M37A 1QL8A 1THSH 3NWUA 1MQ6A 1SHYA 2P8OB 4A1TA 1AO5A 3SJIA 1C2DA 5AVDA 1ZMLA 1OWHA 4Y11E 3PRDA 4J2YB 1DWDH 1EUFA 2PSYA 1D3TB 4NWKA 1SBWA 2WPHS 1C1RA 1BHXB 2AGGX 1PPEE 2FOCA 1DWBH 3SI3H 2AMQA 5B6OA 2GCTB 3TK9A 1ZSLA 2QIQA 5LPFA 1P05A 1W10U 4LZ4B 5HXFA 5EXNA 3SGAE 3PYHA 2GVFA 2ZPQA 3SU2A 1YLDA 1BBRK 1GL0E 2Q6FA 1BRAA 1MTUA 1TONA 2QAAA 3GY4A 2FWWA 8GCHF 3FAOA 2H9HA 2BXUH 3ODFA 1WXRA 1Y3XA 1O3GA 5FPYA 2UUYA 5FBEA 1W0YH 2C90B 1DWCH 1S84A 4RKJB 2PLXA 3P8FA 1QJ7B 2OBQA 1FY3A 1ZR0A 4I33A 3VXFH 1NESE 1P03A 4AG1A 4MLFB 2BDYA 4A1VA 3FZDA 3SGBE 5DSFA 5K7RA 1HJAC 1TAWA 2RA0A 4TWYA 1A46H 1KXAA 1O2UA 4ASUD 2SFAA 6CHAB 1BJUA 2FOFA 3F9HA 2GZ8A 3ATMA 1QBOA 2ZA5A 2EC9H 1ELDE 1MBQA 2BY9X 3OYPA 2ZU1A 1F2SE 1O3FA 2SGQE 3RC4A 2YMSB 1OSSA 2BM2A 1SGQE 2KAIA 1OOKB 4K5ZA 1E0FD 5A0AE 1C1QA 3BTHE 5JBCS 2BDIA 1C5OH 1QRZA 3SZEA 3SUGA 2ZHDA 4XD7D 1NRSH 4X2XA 4LXBH 5JDUB 2A4OA 1K22H 1O2VA 1SSXA 1BBRE 3A86A 4U30A 3GCHB 1MUEB 1GJAB 4AX9H 3A7TA 2FX6A 4M7GA 3QWCH 4Y0ZE 1C5TA 1L4ZA 2V6NA 4KTUA 2KCPA 2XOKD 1EXFA 1NFUA 1VCWA 4AORA 4I8KA 2P3FH 1J9CH 2GGVB 1CGIE 3RXPA 4I32A 1BTXA 2PFEA 3SU1A 3U8RH 1TNJA 1HJ9A 4I8HA 2AMPA 1TA6A 4WH8A 1DXPA 1FUJA 1YPEH 1QR3E 3MO3A 1C4Y2 1KY9A 2ZKSA 1HAVB 1V2MT 4YESB 3U69H 5GNDA 1O2GH 4B2AA 3SUEA 3A89A 3PV2A 1G3BA 1RRKA 2J94A 1F0UA 1A5GH 4YOGA 4CREA 5I46H 1AKSA 3F1SB 1C9TA 5DP3A 1JIRA 2F9NA 2XC5A 4O3TA 1WUNH 5DP9A 4AFQA 1C5MD 3BIVH 2SNWA 3ZYDA 3P17H 1TRYA 1E35B 2ZP0H 5C2ZA 4JYVH 5I25A 1C5SA 4X8TH 3BSQA 3M3VA 4KTCA 3PM3A 2PKSB 5F8TA 4K60A 1K1PA 4KTSA 4MNWA 1BBRH 1XUKA 1V2QT 2OQ5A 5GJ4B 5JB9S 4ABAA 4YM9A 2BY6X 1GBCA 2XC0A 3FANA 1IQHA 1EB1H 2BZAA 1PPGE 2ZFPH 4XOJA 2WZQA 1JOUB 3H5CB 1C2JA 4B1TA 2PWXA 2JJ2D 1C4U2 4SGBE 1WOFA 3ZV8A 4ZXYH 1C1VH 3CENA 1ETSH 1KYNA 4GHQA 2WV4A 1K21H 2ZHEH 2OC8A 1QY6A 3ZZDA 2AHME 1P3CA 3ENSB 2CK3D 3OU0A 3PMHB 3FZZA 4OM9A 1AQ7A 2VWMA 3TJOA 2FZZA 2NU3E 1XVOA 3MTYA 1FZZA 1SPJA 3L3TA 1AB9C 2AGEX 2SGAA 3BTFE 1C1OA 3LGUA 8LPRA 1GHXH