4A1VA

Co-complex structure of ns3-4a protease with the optimized inhibitory peptide cp5-46a-4d5e
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
194
structure length
190
Chain Sequence
GSVVIVGRIILSPITAYSQQTRGLLGCIITSLTGRDRNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Affinity Peptide Inhibitors of the Hepatitis C Virus Ns3-4A Protease Refractory to Common Resistant Mutants.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1b
molecule tags Hydrolase/peptide
molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
total genus 51
structure length 190
sequence length 194
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4a1vA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4a1vA01
1EX3A 2BMGB 4GPGA 1GHXH 1ZOMA 2ZZUH 1ESTA 3GY8A 3SI4H 1B0EA 2WPJS 2F83A 2QAAA 2Z94A 2B0FA 1IQMA 1LKBA 4K8YA 3URCA 1VCWA 2CV3A 1GBMA 2AMPA 3EQ0H 2BY8X 2ODQA 3TH4H 3RXTA 2OQUA 1HAGE 1G2LA 2FX6A 5EW1H 2GCHG 3SUGA 1ID5H 3M35A 2FOAA 4FU8A 2TBSA 1QA7A 3MI4A 1DITH 3MU0A 3RXRA 2GTBA 6GCHF 1O2TA 1HRTH 4WWYA 2ZGJA 1CQQA 1BITA 1GVKB 1GBLA 2XBVA 4KELA 4FUCA 1INCA 3UWJH 1O2VA 1K1IA 5BRRE 1RIWC 4X6MA 3LGTA 3AVZA 4X6NA 1HXFH 1RRKA 1UVPA 1OWJA 1TNJA 5FX6A 3SHAH 1L0ZA 4KTUA 3PMAB 1C5TA 1NFUA 1TA2A 1FLEE 3SJOA 3C1KA 2VWMA 3FP8E 2XNIA 1AWFH 4X1PU 1KY9A 1UTKA 2RDLA 1HCGA 5DPAA 4B74A 2ZTYA 2ESTE 1AWHB 1SI5H 1LDTT 1HAZB 2NU0E 2YNBA 1V2LT 1WSSH 2BM2A 2ZFRH 1T32A 1GMDF 2BTCE 2W5EA 2UUJB 3BTME 4AGKA 1J16A 3L3TA 1O5DH 1C1WH 1DLKB 4OS4A 6CHAB 3LOXA 2GV7A 2ASUB 2YOLA 1GDNA 3F9HA 4YTAA 3MNBA 2G52A 4IS5A 4YO9A 2JH6D 4IBLH 4TY6A 1SPJA 1ELFA 1OKXA 1WYKA 2ZHFH 1NY22 1O2YA 2SGFE 2Y5HA 4ISLA 2ZC9H 1TBZH 2H2ZA 1CGIE 4JK6A 5T3HA 1A3BH 2F9UA 1GJDB 1WV7H 3A7YA 3T62A 1AQ7A 3UR9A 1DOJA 1SBWA 3VB3A 4ABAA 1EPTC 1ETTH 1FY4A 1TMTH 1SHYA 1DM4B 1VGCC 1AHTH 2ODYB 5E2OA 1EB2A 3EGKH 4BANB 3ZVCA 2CJIA 4JMYA 3ZZ3A 3RMMH 2GVFA 4U2WA 2Z9GA 5FPSA 3DT0H 2BDYA 1CT0E 1XX9A 1A3EH 2FTMA 1DXPA 1GJ8B 2OD3B 2G51A 4UFEH 3T29A 5C1XA 1B5GH 1P01A 5A0AE 1LVYA 3UNSA 2WUBA 1HJAC 4UONA 1ABIH 3E8LA 9LPRA 1OP0A 1HYLA 4BTTB 1SGPE 3SOSA 1GI1A 1O2MA 1GI7B 3VGCB 1KXEA 3VGCC 5CE1A 2WUCA 4K1SA 2WPMS 3E0NB 1QJ6B 3O8BA 1O2NA 1OWEA 4X6PA 2BXUH 2FOBA 3ZVEA 4X8TH 1CHGA 5FBEA 2W3IA 1LVBA 2ZU1A 2G55A 1C1NA 1OPHB 4AYVB 2STBE 2GCTC 1GG6C 2GMTB 2XC5A 5DO4H 1NS3A 4U30A 3DD2H 5DG6A 3TJNA 1XXFA 3E1XB 4CRAA 4ESTE 1PPGE 2QXIA 3FANA 1PQ5A 2D1JA 3F9FA 4JCNA 4ABFA 2OINA 1PQ8A 5FCKA 3RMLH 2GT7A 3GYMA 3LC3A 3TK9A 3SGBE 2PUQH 4X8VH 1IQGA 3TNTA 3ZVBA 5C2ZA 3SQEE 1JWTA 4J1YA 3RMNH 4OS1A 3E90B 1AY6H 3MHWU 3P17H 5AFYH 4XSKU 2P95A 7GCHG 2VVUA 3LGYA 1SL3A 1EUFA 1A5GH 3P8FA 4MNWA 1ZGIA 1ZJDA 3FVFB 2OQ5A 1OS8A 2FYQA 1ESBA 3ZZ9A 1KSNA 1FPCH 4MNXA 1YF4A 2QYIA 2SGEE 3MU1A 4D7GA 1GGDC 2ZU4A 1W10U 5EQQA 3TJVA 4WVPE 3QLPH 2Z9JA 5A0BA 3RUOA 4B2AA 3RXDA 1GHAF 3LH3A 2BD2A 1W12U 2J2UA 2O8MA 1NFWA 3SV9A 3A7VA 3UY9A 2DE9A 4ZXYH 1C4Y2 1EPTB 1QA0A 4CHAB 2AGGX 4NG9H 3QDZB 2HPQH 3VB5A 1YPHC 4MQAA 1O2UA 3RXHA 1FAXA 1LPGB 2Q6FA 1NU9A 3BTQE 5C20A 1FIWA 1ZRKA 1O3DA 3M5MA 2VINA 1GMDG 5ESBA 1FY8E 2VWOA 1FZZA 2B8OH 2ZA5A 1IQNA 3KHVA 2A5KA 2ZU5A 5AFZH 2ZNKH 4H42U 4I33A 5L30H 2IOTA 1G36A 4I31A 3HPTB 2THFB 1V2OT 1DWBH 1P9UA 3N7OA 1AVGH 1O30A 2GV6A 1BUIA 2BDCA 3EDXB 2VGCC 1C2DA 4ZROA 4AFZA 1YPJH 2Z7FE 2XTTB 3SUEA 1GDUA 1UHBB 3SGAE 1AUTC 1GBCA 1EJMA 1QL7A 2OC1A 2QF0A 4H6TA 1SGRE 4AYYB 2Y80A 3IITA 3STJA 3AW1A 3OTJE 5DGJA 3SGQE 1O36A 2HWLB 1MU6B 1F0RA 4FVBA 3U8TH 1GI4A 1O3OA 3V3MA 1LMWB 1E35B 1ZJKA 4OM9A 1SVPA 1THPB 3KNXA 5GCHG 1TPOA 1BTUA 4A92A 1AB9B 1JRSA 3BG4C 4JZEH 1GHBG 1PFXC 3EE0B 1DXWA 3ZZ6A 3V7TA 3QWCH 1TWXB 3A7ZA 3TH3H 3ZZBA 4ABJA 1MTVA 1DY9A 1BMAA 2BHGA 4MNVA 4X1NU 1ELTA 3NKKA 2ZTXA 4Y0ZE 4JZDH 1KIGH 4NZQA 1C2JA 1T8OA 4UE7H 3D65E 2RA0A 1S5SA 2G4UA 3UOUA 1C1RA 1W7GH 3MNCA 1K1JA 2W7SA 1CO7E 3RDZA 1GMCF 1IQLA 1V2MT 4X1QU 3ATMA 3F6UH 3JZ2B 4MDSA 2ZECA 3LGUA 1T31A 7KMEH 1BRAA 2WPLS 4DJZB 3RLWH 1MTWA 1FPHH 4YOIA 5F8ZA 2DUCA 3ATLA 5JBAS 2ZCLP 4X0WU 3GY2A 3GCTG 3PO1B 2A4OA 5I46H 2A5AA 1SLWB 1BRUP 1W11U 2HRVA 4A1TA 4O9VA 4B2BA 5IYTA 1IQHA 3A8DA 4K2YA 1RGQA 4MPWA 3TGJE 4NWLA 3QZQA 1GJCB 1P09A 5HGGA 1LTOA 1O5BB 1SLVB 1NM6A 1EJAA 2A7JA 2FMJA 3RU4D 1ZHMA 1NRRH 1T8MA 1ZSKA 1W8BH 3LU9B 5LPEA 2FOGA 1Z6EA 2QV1A 2BDGA 3F68H 1BBRE 1UK2A 1LPKB 4A1VA 1AN1E 1YP9A 3HATH 3ZYDA 3PTBA 3RXPA 2R3UA 1T8LA 3BTDE 3K9XB 3RXKA 1C9PA 5FCRA 1NT1A 1CA0C 3SU1A 1MD7A 1UK4A 4I32A 4JYTA 3RC5A 3A8AA 1DE7H 2J9NA 1BCUH 2SNWA 2TIOA 4B2CA 3SU3A 1LHGH 3SO3A 3ZZCA 3ZZ8A 1TQ0B 1XUGA 1ELAA 3O8RA 4BXSA 2UWLA 3A8CA 1L1JA 4JZFH 3ATWA 1ZTJA 1VCQA 2C8ZB 4XOJA 1MTSA 1BTPA 2F3CE 3NK8A 3QUMP 3SJ8A 5ETXA 5DK1A 1S82A 2WPHS 3ZZ7A 1GG6B 1HAYB 2GMTC 3H7OA 3SNDA 4E06H 1HAHH 1YKTA 3LGWA 4DG4A 3LJOA 1EAWA 1RS0A 1FY1A 3M7QA 1GMHG 4TPIZ 2W26A 4Z0KA 2H9EH 3SU2A 1YPMH 1P3CA 4CH2B 8LPRA 1HAOH 4D9QA 1SLXB 1BMMH 4KKDA 3TK6A 1D3DB 2BY9X 4K5ZA 1ZTKA 1DUEA 2AMDA 2Y7ZA 1EJNA 1DUAA 1GJ9B 1WCZA 3UNQA 2F9PA 1H8IH 1W0YH 2WV4A 1HJAB 1TNLA 1WAYB 4XBCA 1HAPH 2PSXA 1O3FA 2A31A 5CMXH 1A5HA 1VITF 2BDBA 1THSH 3SNCA 1GHBF 4ZKOU 2CF9H 4B75A 1QRWA 2IJD1 1CE5A 1S6HA 2WPIS 4XBDA 2Z6BD 2VIPA 3BEUA 1GBAA 4INHA 1TFXA 4GVUA 3EA7A 1CHOG 1BBRK 4E7NA 1A46H 1EP5A 1VGCB 6LPRA 3RXCA 9ESTA 3S9CA 2SNVA 1EZSC 2R3YA 1P05A 2QGRA 2BVXH 2XCFA 2XC0A 3UQVA 2VJ1A 4ZKNU 3PTNA 3BEIB 2GKVE 1AGJA 2FESH 3RXIA 1QBNA 1OOKB 1GBIA 2Y82A 4WXIA 3SV2H 2VB0A 2ALVA 1FN8A 2F9NA 4M9FA 2B5TB 3DA9B 4YLUA 2P94A 2ZGXH 1YPKH 4GHQA 4CBNA 1UVTH 4Y8XA 1BOQA 2ZFFH 4BAHB 2ILNA 1QNJA 4RN6A 4U32A 1GI6A 1HPGA 2UWOA 1V2NT 3L33A 1C4U2 1L1GA 2P3UB 1S6FA 2BD7A 5EPYA 1Z7KA 1V2PT 2V3OH 2ZGBH 1TNKA 2KAIA 1K9OE 4Y71A 4OS7A 1UJ1A 3F9GA 3RXOA 3KEEA 1G3EA 1GI9B 2AGEX 2OP9A 1TRMA 2D26C 5C1UA 1FV9A 1H8DH 1SB1H 3BG8A 1V2ST 1FNIA 1TYNA 3VXEH 1LHEH 1W3CA 5H4IB 4DGJA 3STIA 3UTUH 1VZQH 3A81A 3PV5A 4X6OA 1HAVB 1O39A 3LJJA 2QY0B 1CA8B 2FLBH 2H6MA 2P93A 1G9IE 4A1XA 1O2HA 4J2YB 3SUDA 1ZYOA 2A45B 3VXFH 1FIZA 3ZYEA 4AGJA 4CRDA 2FXRA 2NU1E 3PWBA 3M7TA 1Z8IB 2G81E 1PQAA 2AIQA 2SGDE 1ORFA 1Z8GA 2FDAA 1GCTB 3M37A 3RC6A 7GCHF 5GNDA 1BBRH 3SHCH 3H7TA 4IW4E 1AMHA 5IDKA 4ABEA 1PPFE 4K8BA 2ALPA 4TY7A 2FOMB 1O31A 5JBBS 1BTZA 4O3UA 1NZQH 5C3NA 1TABE 3BTGE 5AF9H 1AVWA 1C4V2 5EODA 4GAWA 3QN7A 1ANCA 3NWUA 4DY7B 1W7XH 4O03A 3RXSA 3OY5U 4Y6DA 2BLWA 3P8OA 4NA9H 4BAOB 1C5OH 1CT4E 1IHSH 3RXVA 1XM1A 1DSTA 2LPRA 2G5NA 4IMZA 4SGAE 5DP4A 3AK5A 3MNSA 2ZCKP 2ZTZA 5DP5A 2C8WB 1BZXE 1XUFA 4HFPB 3R3GB 1WUNH 2BX4A 4PROA 4BTUB 1QB9A 4GSOA 1HV7A 2ZDNA 3PMJA 1MQ5A 2OK5A 1WQSA 3D49H 1AU8A 5E2PA 1DT2A 1O32A 1PPHE 2W3KA 1UTPA 4XE4A 4IC5A 2C3SA 1CGJE 1GVZA 1TGTA 4CRGA 1O3LA 5TCCA 1GI0A 1HUTH 8GCHG 1GHZA 3M7UA 3TJOA 1UCYH 3MMGA 1A1RA 2M5TA 3OYPA 1LPZB 1BMLA 1RXPA 1TOCB 5TCAA 1NC6A 3PLBA 1Y5AT 1D3PB 1LCYA 4ISNA 3PV2A 3TGIE 3SJIA 3V13A 4AORA 2QXGA 1DSUA 1WOFA 2ZHEH 3CS7A 1V3XA 2VNTA 1GHAG 2QF3A 1J14A 2B7DH 4WMEA 4Y11E 1C1QA 2SFAA 2BOHB 2ZIQH 1GI3A 1K28D 2C90B 2TGDA 2JETC 1P12E 1D9IA 3Q3YA 2BLQA 1ETRH 3BTHE 3ELAH 4NA7A 4GCHF 4HGCA 2P16A 3GCHC 1ACBE 2A7CA 3OU0A 1D6RA 2F9BH 1DVAH 1BJVA 3A80A 1DWCH 3GY7A 1P2MA 4XDEA 4ZAEA 4R0IA 1GBDA 4AN7A 1AO5A 1XKAC 3OX7U 1YPGH 4K1EA 3ZZAA 1TRNA 1F0SA 2GZ8A 4ISIH 1V2RT 2R0KA 1O3EA 1YYY1 2Z9LA 4X1RU 3Q3KA 1KLJH 3QTOH 1FONA 4Y8YA 5EU8A 3I77A 1SQOA 3OSYA 5LH8A 2XXLA 1XVOA 2RG3A 3ATKA 3V0XA 1C1VH 1KXCA 1N1LA 2FI4E 4THNH 2JKHA 3NZIA 2LNCA 3NPSA 4K60A 4UD9H 1IOEA 3K65B 2Y81A 3M3TA 1HLTH 1JXPA 2ZHQH 2FLRH 1GL0E 2OC7A 1PPZA 4JZIA 1O3AA 4TWYA 3KIDU 2ZGCA 5FPYA 1C2HA 2HLCA 3T5FH 2FEQH 4B76A 1JMOH 1P02A 5EW2H 1AB9C 2EI7A 2SGPE 1N6XA 1P0SH 3GCOA 3GOVB 3UREA 4FUHA 3TIUA 1C1UH 2TPIZ 1FQ3A 3M61U 1GI8B 1P10A 4SGBE 2BVRH 1O2IA 4FUEA 4XBBA 1MBMA 1C5NH 4WH8A 2A4QA 1PPCE 2FX4A 1UTJA 3LC5A 5HM2A 3A7TA 1QCPA 2O8TA 2WV5A 1IAUA 2Y6TA 4QT8C 1EAXA 1HAXB 1IQEA 1D3TB 4HTCH 2WYGA 2WYJA 5GJ4B 3AAUA 2FZZA 4AOQA 3SU4A 1V2JT 2FS9A 1YPEH 3U69H 4DURA 1C5UA 3A86A 1PYTC 4KTCA 1YLDA 3PMBB 3P70B 1EPTA 2NU2E 1O2XA 1TNGA 1IQJA 1KXAA 1Q31A 2QN5T 1UVOA 1EZXC 1SC8U 5A8ZA 4YOGA 1SGYE 3GCTF 3A87A 1WXRA 4NSVA 4B6EA 3U8RH 4AB9A 1BTHH 2XYAA 1O3IA 5F8XA 3KCGH 2OUAA 1MKWK 1FXYA 2FI3E 3MO9A 4A7IB 4LZ1H 1Y59T 4NFFA 1H9LB 3F9EA 1VJ9U 2PV9B 1MBQA 3U9AH 2AYWA 1QBOA 1YBWA 1OP8A 4FUBA 4AZ2B 2GD4B 1C5LH 2VIQA 4F49A 3PMHB 4ZUHA 1GGDB 3NCLA 4I8LA 3SW2B 2JH5D 3RP2A 3UIRA 3ZZDA 4AB8A 3P8GA 5LPRA 2CHAB 3FZDA 1W13U 1TX6A 1T4VH 1WTGH 3UPEA 2VIWA 3Q77A 2W7UA 2XW9A 1O2GH 1P11E 2P3TB 4MPXA 4ASHA 4DW2U 3FZZA 1ZHRA 2ZDVH 1O38A 3M5OA 4BAMB 4ABBA 2XBYA 2VIOA 2ZHDA 1O2QA 3A88A 2UWPA 4AFSA 1NRNH 2BY5X 3GYLB 1SFIA 2PFEA 4DOQA 2STAE 2PKAA 2P8OC 3UOPA 2C4FH 2PSYA 3S7HB 1CVWH 1BHXF 3M3VA 4INKA 3UFAA 1DX5M 1F2SE 4AG1A 2IN2A 1ZPCA 4Q7XA 1UTNA 3RXUA 1AZZA 3ODDA 2BD4A 1CBWB 1C1TA 3RC4A 3TH2H 2F9VA 1XVMA 5GXPA 1UTMA 3MH5A 1TBQH 3EA8A 1GJ5H 2AIPA 3KQDA 4KGAA 3DFJA 3SU6A 1AVXA 3HK6B 3D23A 3MO3A 2SGQE 1GJBB 3BSQA 1O0DH 2Y5GA 1OXGA 4X2YA 2GZ9A 3MOCA 1GMHF 3BTEE 5G4BA 1S85A 2BY6X 4XFQA 1SG8B 4OGXA 1GMCG 5T1VA 2QIQA 1TOMH 5F03A 2FYRA 2BB4A 4IMQA 1DFPA 2CMYA 3MTYA 3E91A 4CRCA 5J4SA 1G37A 3GY6A 2OBQA 4HI3A 1O2ZA 2ODPA 1MKWH 1LHFH 5DKMA 1O5FH 1ARBA 1ZSJA 4AFQA 4CR9A 5B6OA 1Q3XA 2XC4A 1YPLH 5F8TA 2Q1JA 3ZVDA 1O3MA 3IWMA 4MNYA 2FI5E 4WY3A 3SJ9A 1SSXA 1VITH 1Z6JH 1B0FA 1EOLA 2R0LA 2F91A 5ESTE 2XBWA 2XCNA 2FPZA 4FUJA 2UUFB 1J8AA 4FUDA 4Q80A 3EAJA 1O3KA 1ELCA 2JETB 1GHYH 2PGBB 1YLCA 2Y7XA 1KXDA 1AFQC 3O8DA 1EASA 2ZDMA 4AX9H 1O3NA 1MZAA 1YCPH 1O5CB 3TNSA 1BRCE 4INLA 5EOKA 1MTNB 3QGNB 4LOYH 3T27A 3B9FH 3CENA 4BOHA 1K21H 1SGEE 2ZDKA 3UUZA 2FOCA 4NIVA 1V6DA 1YGCH 2ZI2H 5T6GA 3ATIA 1P2OA 2PTNA 1J15A 1RTLA 2PKSC 3LGVA 1IQIA 1G3CA 3EYDA 3UR6A 1TIOA 1UTQA 2AFQB 3T26A 3PO1C 1HXEH 2G5VA 3QGJA 1TMUH 1RTKA 1FDPA 1Z71A 1HGTH 1HDTH 3QO6A 4ABHA 4CH8B 1UTLM 1KXBA 4RI0A 1DICA 1O2WA 1H9HE 2ZWLH 3BN9A 3BF6H 3O8CA 1QQ4A 5HYOA 2PLXA 1TPSA 1NRQH 2ZFSA 1NPMA 2ZFTA 4D76A 1OWIA 3S9BA 1SHHB 1K1MA 5C1YA 3MU4A 3MYWA 5DP8A 1WTHD 1GJ4H 2BDAA 4WMFA 2BXTH 1D3QB 5DP7A 4B6FA 1QQUA 1ABJH 1AZ8A 4I8JA 3PROA 1KLTA 2ANMH 1VITG 3QX5H 4OS2A 4NIXA 2HVXA 5I25A 4GHTA 1NN6A 3IG6B 3PB1E 2FP7B 2ZO3H 5C5NA 1C5RA 3P92A 4U01A 1A7SA 1S83A 1O2LA 1P9SA 1G3DA 2PW8H 3HKIB 2A0QB 3BG4B 3SNAA 3LIWA 3HKJB 3VPKA 1BIOA 1TPPA 5K0HA 1ESAA 1MTUA 4YLQH 8KME2 3KQEA 1O3BA 1JIRA 1GWAA 3GICB 2ZQ1A 1J17T 1LVOA 4CBOA 4H6SB 2VBCA 3UQOA 1AE8H 3A8BA 3SZNA 4Y79A 3TVJB 2UUKB 1C1OA 1N6YA 4FU7A 3GISB 2O8WA 1PJPA 4O97A 5B6LA 1K2I1 1NRSH 3KGPA 1HIAA 1UVSH 2XWBI 1A0HB 2FOFA 1F5KU 4E05H 1SGCA 1HFDA 2DE8A 2R2WU 1CGHA 3AAVA 1HAIH 2PHBA 3SORA 8GCHF 1BB0B 1Z8JB 1EAIA 4RSPA 3SI3H 3VB6A 5FAHA 3RXFA 3DFLA 8ESTE 4B71A 3RXQA 1THRH 2IPHA 1QIXB 5ABWA 2FOHA 1S81A 4ZHAA 5JDUB 4YT7H 1QFKH 1SGQE 2ZPQA 4YZUA 1UMAH 1H1BA 3T25A 3Q3XA 4DIHH 1O2RA 2H1UA 2EEKA 2PKSB 3TITA 1ETSH 1KTTB 4TWWA 5JB8S 1PQ7A 1OWHA 3BTWE 1G3BA 4D7FA 1GBJA 1ZLRA 2TGTA 2A2QH 1EXFA 2BYAX 1L1NA 2GZ7A 2Q6DA 3U1JB 3PLKA 1C1MA 5EXMA 5TJXA 4ZH8A 4MLFB 2V35A 2QXJA 2WINI 3VEQB 1N8OC 1F5RA 1OWKA 2O9QA 5L2ZH 3BTTE 1BQYA 1AKSA 5JPMH 2QC2A 1VCPA 1DWDH 3E16B 1C5QA 1Y8TA 2BDHA 3L6PA 4CREA 3BEFB 4ZKRU 1E36B 5LGOA 2Z9IA 1QB6A 3MH4A 2V3HH 3QTVH 1FY3A 2CN0H 1OX1A 5L6NH 3K6YA 4I8GA 1AKSB 3MO6A 4B73A 1A4WH 7LPRA 1IQKA 3EA9A 4DCDA 2ZHWH 5HMAA 3TK5A 2AEIH 3W94A 1XUHA 1AFEH 3RXJA 4DT7B 1QR3E 2OC0A 1GBTA 2ANYA 5C5OA 2ZFPH 1QGFA 4ABDA 1FN6A 1BTXA 1C5WB 3VB4A 7ESTE 1ANBA 4KTSA 4D9RA 3A83A 2PTCE 2O8UA 5CHAC 1MMJN 4IGDA 1NO9H 1AD8H 1WU1A 2P8OB 3UWIA 3SYJA 1P04A 2GDEH 1UO6A 2FWWA 5GIBA 5GWZA 1C5SA 1SQAA 3ZVAA 3P95A 1EOJA 1K1PA 3UNRA 2ZPRA 4MPUA 3GY4A 1K1OA 4CR5A 3VFEA 1QL9A 3LH1A 1SMFE 1BTWA 5LPFA 1HIAB 2I6QA 1L2EA 1ZPBA 2HNTE 2Z9KA 4X1SU 1GBBA 1XUKA 2FO9A 2PUXB 3AASA 3LT3A 1OWDA 1ZTLA 5JBTA 1BHXB 3U8OH 3RXBA 4BNRA 1DPOA 1N8OB 4FU9A 3PM3A 2NU4E 5FHTA 1P2IA 2ZG0H 4AG2A 2OCVB 3GCNA 1H4WA 1S0QA 3A84A 1TMBH 3TJUA 5EG4A 1SGTA 5E0JA 1VR1H 2Y5FA 1F0TA 1BMNH 1TRYA 1Z8RA 2AGIX 2VWNA 2BY7X 3M5NA 1A0LA 3HK3B 3RMOH 5A8XA 2ZDAH 5GDSH 4NIYA 6CHAC 1FY5A 5EQSA 1MCTA 2BQ6B 1B7XB 4OS5A 1O3JA 1FMGA 1SGDE 1FAKH 1GVLA 1TNIA 1Y5UT 3GDUA 5AVDA 2BVSH 1D6WA 2CF8H 1ZMJA 4TYDA 2PR3A 1MAYA 3NUMA 3ZV9A 4NIWA 5JYIA 5PTPA 2J92A 3RXAA 1C2IA 1Z1IA 1RFNA 1AUJA 1TGSZ 2A32A 2VH6A 3SNBA 4UEHH 4CRBA 1V2QT 3MU5A 5J4QA 5EQRA 2Z3EA 2IJOB 1GHWH 3ZZ4A 1C5XB 3ENSB 3D62A 1TA6A 4AFUA 2XRCA 3DUXH 2V0BA 2A4RA 1E0FD 4NWKA 5T6FA 2BD8A 2ZP0H 2F4LA 2KAIB 3TU7H 5A0CA 1S84A 5E0GA 1ZR0A 1SOZA 3I29A 1O3HA 1QJ7B 1GDQA 1Y3YA 1YCPK 3BTFE 1GHVH 4D8NA 1FJSA 2A5IA 1KLIH 1HB0B 3KN2A 1QRXA 2Q6GA 1HNEE 1EKBB 4UDWH 2RA3A 4ZXXH 1GI5A 2FODA 2G8TA 3A85A 1MH0A 2Z3DA 3S9AA 4OS6A 2ZF0H 1C5VA 1GPZA 1ANDA 3B8JA 5FBIA 3T2NA 3ESTA 5A2MH 1SGIB 3HGNA 3W95A 5CHAB 3FAOA 1TX7A 5C67A 5DJ7A 4ABGA 1TE0A 1ELGA 3T28A 1OYTH 2ZU3A 1WBGB 1NFYA 1MKXK 2AH4X 2FM2A 6GCHG 5JBCS 1LQEA 1MAXA 1O5AB 4K1TA 3ZZ5A 2OXSA 2WHXA 4M7GA 2VVCA 5A8YA 3GY3A 2VIVA 2CXVA 1Y5BT 1O2JA 4DVAU 1YM0A 4I8HA 5EXLA 2Z3CA 1QB1A 1RTFB 1P8VC 1Y3UA 4Y7AA 1DANH 4A6LA 3Q00A 4ZMAH 3LPRA 1MKXH 4Q2KA 4CRFA 1CA0B 1FI8A 3H5CB 4OGYA 1X7AC 2R2MB 1XUJA 2PWXA 3FP7E 3TPIZ 2BOKA 4CHAC 1EB1H 1T4UH 4FXGH 1LKAA 2ZDLA 4WMDA 4I7YH 4LZ4B 5DP3A 1JBUH 1V2KT 2D8WA 4MPVA 3V12A 5FPTA 1MTNC 2ULLA 1GBEA 2R9PA 1PYTD 1GBFA 1C5YB 2FTLE 4ABIA 3RXMA 4NGAH 1T7CA 2VH0A 1QURH 3BIUH 2BQ7B 2FOEA 3GCHB 1KDQA 1C5PA 2O8LA 1JOUB 3RM2H 1SLUB 3DHKH 1T8NA 3CS0A 1QL8A 1QY6A 3TGKE 1V2VT 1ZHPA 4H4FA 3K6ZA 1ELDE 2YNAA 2OC8A 2V6NA 3VB7A 4NA8A 4IC6A 1W0ZU 4MVNA 4X8UH 4JK5A 5F6MA 1PPEE 3LDXH 1C1SA 4GUXA 2PKAB 2BD9A 4WF8A 1O5GH 1C2MA 1HJ9A 2SGAA 2ANWA 4ZHLU 1C9TA 2TRMA 1RJXB 3SZEA 3A7WA 4YESB 1O3PB 2J94A 4DIIH 1A5IA 3B23B 1LHDH 1TGCA 4NFEA 3ITIA 3SBKA 2WZQA 2QCYA 3RU4E 2A2XH 2QXHA 3LKWA 1NU7B 2VU8E 3QK1A 2A7HA 4HZHA 5A09A 2NWNA 5HXFA 1K22H 1JRTA 1GBHA 2ZGHA 2I6SA 1SGFG 1C2KA 4JZ1A 4NSYA 1XXDA 2GX4A 2ZU2A 2P3FH 4ISOA 1F7ZA 1YPHE 1TGBA 2C8YB 1VJAU 1QHRB 1TAWA 1BT7A 2OLGA 3WY8A 2GCHF 1BDAA 3KL6A 1L4ZA 1YCPM 1TNHA 1GBKA 1ARCA 3MH6A 5BPEA 1NFXA 1LHCH 1CSOE 1ZGVA 3Q76A 3A89A 1AE5A 1CBWC 1ZMNA 3PV4A 1MU8B 1SGFA 1FUJA 2H5DA 4A5TS 4Z6AH 1GJAB 3LGIA 1UCYK 2A4GA 2EC9H 3ZV8A 4BTIB 1F0UA 4BAQB 1C5ZB 1EQ9A 2PGQB 2GP9B 1QTFA 3SQHE 1P57B 4UFGH 1O5EH 1SFQB 1G32B 3GDVA 1HJ8A 1GCTC 5E0HA 4GCHG 3GDSA 1O2SA 2ZQ2A 4JYVH 3SV6A 2BD3A 3F1SB 3GY5A 4BAKB 1A2CH 4VGCC 2VGCB 2B9LA 1EATA 1BJUA 3PWCA 1XKBC 2NU3E 1ZMLA 2GT8A 4F4OC 5HM9A 3P6ZB 3SN8A 1CHOF 3PLPA 3FFGA 3QZRA 2ANKH 3P8NA 1TONA 1C2LA 2BD5A 1CU1A 4FUIA 4Y8ZA 1P2KA 1IQFA 1DLEA 1U6QA 4YM9A 4X2VA 1C1PA 1WQVH 3SUFA 3SNEA 3M36A 1ZRBA 5FXLA 1O3CA 1ZZZA 3E6PH 1D4PB 2HALA 1C5MD 2H9TH 3M5LA 4MTBA 3SU0A 4BXWA 1ELVA 4Q7YA 2BZ6H 2J34A 1RIWB 4Y76A 5E8EH 1MZDA 2AMQA 2RCEA 1O3GA 1NTPA 1ZPZA 4E7RG 4I8KA 1KYNA 5FX5A 3ZVGA 3S7KB 1A61H 1Z1JA 1NRPH 3ZVFA 1LVMA 1Y3VA 3JZ1B 3FP6E 4WXVA 3MWIU 2BQWB 1AFQB 1BA8B 1P03A 3SV7A 4Y0YE 1CT2E 1SOTA 1E38B 1M9UA 4ZHMU 1MD8A 1QBVH 4VGCB 1KXFA 4GLYA 1C2GA 1F5LA 3ODFA 2OTVA 1P3EA 3SV8A 1TGNA 1HBTH 2G00A 3BTKE 1C2EA 4ZKSU 1L4DA 4RKOB 3RXGA 4Q7ZA 2BLOA 4FUGA 4X2WA 2UUYA 1Y3WA 3TLOA 2EI6A 5GCHF 4Y7BA 4LK4A 2OBOA 3KF2A 4UFFH 1H9IE 5EPNA 1MQ6A 1OYQA 2QA9E 3HGPA 3RLYH 2BX3A 2GCTB 3NXPA 1F92A 1EZQA 1TX8A 5L2YH 2EI8A 4X8SH 1OSSA 4TPYA 3S69A 4KP0A 1W14U 2WPKS 3S0NA 1G30B 1ELEE 1O33A 1RD3B 3MH7A 3CP7A 1KDQB 3E3TA 1G2MA 3AW0A 4YT6H 1DS2E 1O2PA 1GJ7B 2HNTC 1E37B 2BLVA 2J38A 4JYUH 1SQTA 1W2KH 5T6DA 1AI8H 3SJKA 2F9OA 2P59A 1QJ1B 2C8XB 2H5CA 1Y3XA 1UK3A 3M3SA 4FUFA 1XMNB 1NROH 1P2JA 1O2OA 1SGNE 4X2XA 4B1TA 4MG3A 5EXNA 1DDJA 1P2QA 2XBXA 1UTOA 1KTSB 3SU5A 1LO6A 2TGAA 1K1NA 3RXLA 2BDIA 3A7XA 3RXEA 2BZAA 2XWAA 3H09A 4K3JA 3MNXA 1TQ7B 3KQBA 1OP2A 1TBRH 2H9HA 3BIVH 3LONA 1ZSLA 2FS8A 1O34A 3KQCA 3MU8A 4IN2A 1EZUC 2AERH 2FIRH 1Q2WA 2J4IA 2J95A 2AS9A 3A82A 2GGVB 3OTPA 2HGTH 1DY8A 1BTYA 2CHAC 2ZPSA 1S0RA 1SR5C 1O37A 5SGAE 2VVVA 1TALA 1UCYE 1V2TT 1V2WT 5DP9A 1C2FA 1NESE 1V2UT 1GI2A 3MFJA 4WH6A 1GCDA 1O35A 2HNTF 1P06A 4R8TB 3OY6U 1TPAE 1LQDB 1MUEB 5GPIB 1XUIA 1A0JA 3BV9B 1YC0A 4YOJA 1E34B 4Y10E 3G01A 1TB6H 2ZFQH 3PYHA 2ZKSA 1ELBA 1J9CH 5K7RA 1MCVA 2VWLA 2GDDA 3C27B 3R0FA 2ZCHP 4FVDA 1GL1A 1K1LA 3U98H 6ESTA 1EP6A 3U1IB 1DWEH 2G4TA 1JIMA 4NZLA 1EAUA 2A1DB 2K1QA 3URDA 4LXBH 4O3TA 4WJG2 2TGPZ 5DP6A 1HAVA 3I78A 2D2DA 1AIXH 1O2KA 2C93B 1PPBH 2VIDA 4UFDH 1QRZA 2EA3A 1ANEA 4K69A 4NCYA 1BRBE 1P2NA 5JB9S 3RM0H 5EGMA 1UHBA 3K2UA 2WV9A 2HOBA 2CGAA 4ISHH 5AHGH 2HPPH 3RU4T 2JH0D 2ZEBA 3E0PB 1IHTH 1TLDA 4IN1A 1GJ6A 1UVUH 4RKJB
chains in the Genus database with same CATH superfamily
1EX3A 2BMGB 4GPGA 1GHXH 1ZOMA 2ZZUH 1ESTA 3GY8A 3SI4H 3VG8A 1B0EA 2WPJS 2F83A 2QAAA 5HKKD 2Z94A 2B0FA 1IQMA 1LKBA 4K8YA 3URCA 1VCWA 2CV3A 1GBMA 2AMPA 3EQ0H 2BY8X 5C0UA 2ODQA 3TH4H 3RXTA 2OQUA 1HAGE 1G2LA 2FX6A 5EW1H 2GCHG 3SUGA 1ID5H 3M35A 2FOAA 4FU8A 2TBSA 1QA7A 3MI4A 1DITH 3MU0A 3RXRA 2GTBA 6GCHF 1O2TA 1HRTH 4WWYA 2ZGJA 1CQQA 1BITA 2KCAA 1GVKB 1GBLA 2XBVA 4KELA 4FUCA 1INCA 3UWJH 1O2VA 1K1IA 5BRRE 1RIWC 4X6MA 3LGTA 3AVZA 4X6NA 1HXFH 1RRKA 1UVPA 1OWJA 1TNJA 5FX6A 3SHAH 1L0ZA 4KTUA 3PMAB 1C5TA 1NFUA 1TA2A 1FLEE 3SJOA 3C1KA 2VWMA 3FP8E 2XNIA 1AWFH 4X1PU 1KY9A 1UTKA 2KCPA 2RDLA 1HCGA 5DPAA 3CNRA 4B74A 2ZTYA 2ESTE 1AWHB 1SI5H 1LDTT 1HAZB 2NU0E 2YNBA 1V2LT 1WSSH 2BM2A 2ZFRH 1T32A 1GMDF 2BTCE 2W5EA 2UUJB 3BTME 4AGKA 1J16A 3L3TA 1O5DH 1C1WH 1DLKB 4OS4A 6CHAB 3LOXA 3KQ5A 2JJ1D 2GV7A 2XOKD 2ASUB 2YOLA 1GDNA 3F9HA 4YTAA 3MNBA 2G52A 4IS5A 4YO9A 2JH6D 4IBLH 4TY6A 1SPJA 1ELFA 1OKXA 1WYKA 2ZHFH 1NY22 1OHHD 1O2YA 2SGFE 2Y5HA 4ISLA 2ZC9H 1TBZH 2H2ZA 1CGIE 4JK6A 5T3HA 1A3BH 2F9UA 1GJDB 1WV7H 3A7YA 3T62A 1AQ7A 3UR9A 1DOJA 1SBWA 3VB3A 4ABAA 1EPTC 2XNDD 1ETTH 1FY4A 1TMTH 1SHYA 1DM4B 1VGCC 1AHTH 2ODYB 5E2OA 1EB2A 3EGKH 4BANB 3ZVCA 1YWUA 2CJIA 4JMYA 3ZZ3A 3RMMH 2GVFA 4U2WA 2Z9GA 5FPSA 3DT0H 2BDYA 1CT0E 1XX9A 1A3EH 2FTMA 1DXPA 1GJ8B 2OD3B 2G51A 4UFEH 3T29A 5C1XA 1B5GH 4DT4A 1P01A 5A0AE 1LVYA 3UNSA 2WUBA 1HJAC 5CDFE 4UONA 1ABIH 3E8LA 9LPRA 1OP0A 1HYLA 4BTTB 1SGPE 3SOSA 1GI1A 1O2MA 1GI7B 3VGCB 1KXEA 3VGCC 5CE1A 2WUCA 4K1SA 2WPMS 3E0NB 1QJ6B 3O8BA 1O2NA 1OWEA 4X6PA 2BXUH 2FOBA 3ZVEA 4X8TH 1CHGA 5FBEA 2W3IA 1LVBA 2ZU1A 2G55A 1C1NA 1OPHB 4AYVB 2STBE 2GCTC 1GG6C 2GMTB 2XC5A 5DO4H 1NS3A 4U30A 3DD2H 5DG6A 3TJNA 1XXFA 3E1XB 4CRAA 3WWFA 4ESTE 1PPGE 2QXIA 3FANA 1PQ5A 1KMHB 2D1JA 3F9FA 4JCNA 4ABFA 2OINA 1PQ8A 5FCKA 3RMLH 2GT7A 3DSGA 3GYMA 3LC3A 3TK9A 3SGBE 2PUQH 4X8VH 1IQGA 3TNTA 3ZVBA 5C2ZA 3SQEE 1JWTA 4J1YA 3RMNH 4OS1A 3E90B 1AY6H 3MHWU 3P17H 5AFYH 4XSKU 2P95A 7GCHG 2VVUA 3LGYA 1SL3A 1EFRD 1EUFA 1A5GH 3P8FA 4MNWA 1ZGIA 1ZJDA 3FVFB 2OQ5A 1OS8A 5F53A 2FYQA 1ESBA 3ZZ9A 1KSNA 1FPCH 4MNXA 1YF4A 2QYIA 2SGEE 3MU1A 4D7GA 1GGDC 2ZU4A 1E1QD 1YY3A 1W10U 5EQQA 3TJVA 4WVPE 3QLPH 2Z9JA 5A0BA 3RUOA 4B2AA 3RXDA 1GHAF 3LH3A 2BD2A 1W12U 2J2UA 2O8MA 1NFWA 3F0PA 3SV9A 3A7VA 3UY9A 2DE9A 4ZXYH 1C4Y2 1EPTB 1QA0A 4CHAB 2AGGX 4NG9H 4AC9A 2L74A 3QDZB 2HPQH 3VB5A 1YPHC 4MQAA 1O2UA 3RXHA 1FAXA 1LPGB 2Q6FA 1NU9A 3BTQE 5C20A 1FIWA 1ZRKA 1O3DA 3M5MA 2VINA 1GMDG 5ESBA 1FY8E 2VWOA 1FZZA 2B8OH 2ZA5A 1IQNA 3KHVA 2A5KA 2ZU5A 5AFZH 2ZNKH 4H42U 4I33A 5L30H 1NBME 2IOTA 1G36A 4I31A 3HPTB 2THFB 1V2OT 1DWBH 1P9UA 3N7OA 1AVGH 1O30A 2GV6A 1BUIA 2BDCA 3EDXB 2VGCC 1C2DA 4ZROA 4AFZA 1YPJH 2Z7FE 2XTTB 3SUEA 1GDUA 1UHBB 3SGAE 3ZIAD 1AUTC 1GBCA 1EJMA 1QL7A 2OC1A 2QF0A 4H6TA 1SGRE 4AYYB 2Y80A 3IITA 3STJA 3AW1A 3OTJE 5DGJA 3SGQE 1O36A 2HWLB 1MU6B 1F0RA 4FVBA 3U8TH 1GI4A 1O3OA 3V3MA 1LMWB 1E35B 1ZJKA 4OM9A 1SVPA 1THPB 3KNXA 5GCHG 3EE7A 3F2FA 1TPOA 1BTUA 4A92A 1AB9B 1JRSA 3BG4C 5EIYA 4JZEH 1GHBG 1PFXC 3EE0B 1DXWA 3ZZ6A 3V7TA 3QWCH 4Z1MD 1TWXB 3A7ZA 3TH3H 3ZZBA 4ABJA 1MTVA 1DY9A 1BMAA 2GJGA 2BHGA 4MNVA 4X1NU 1ELTA 3NKKA 2ZTXA 2JIZD 4Y0ZE 4JZDH 1KIGH 4NZQA 1C2JA 1T8OA 4UE7H 3D65E 2RA0A 1S5SA 2G4UA 3UOUA 1C1RA 1W7GH 3MNCA 1K1JA 1BMFD 2W7SA 5IK2D 1CO7E 3RDZA 1GMCF 1IQLA 1YLNA 1V2MT 4X1QU 3ATMA 3F6UH 3JZ2B 4MDSA 2ZECA 3LGUA 2J98A 1T31A 7KMEH 1BRAA 2WPLS 4DJZB 3RLWH 1MTWA 1FPHH 4YOIA 5F8ZA 2DUCA 3ATLA 5JBAS 2ZCLP 4X0WU 3GY2A 3GCTG 3PO1B 2A4OA 5I46H 2A5AA 1SLWB 1BRUP 1W11U 2HRVA 4A1TA 4O9VA 4B2BA 5IYTA 1IQHA 2PP6A 3A8DA 1RGQA 4K2YA 4MPWA 3TGJE 4NWLA 3QZQA 1GJCB 1P09A 5HGGA 1LTOA 1O5BB 1SLVB 1NM6A 1EJAA 2A7JA 2FMJA 3RU4D 1ZHMA 1NRRH 1T8MA 1ZSKA 1W8BH 3LU9B 5LPEA 2FOGA 1Z6EA 2QV1A 2BDGA 3F68H 1BBRE 1S6LA 1UK2A 3OFND 1LPKB 4A1VA 1AN1E 1YP9A 3HATH 3ZYDA 3PTBA 3RXPA 2R3UA 5C17A 1T8LA 3BTDE 3K9XB 3RXKA 1C9PA 5FCRA 1NT1A 1CA0C 3SU1A 1MD7A 1UK4A 4I32A 4JYTA 3DSPA 3OAAD 3A8AA 1DE7H 2J9NA 3RC5A 1BCUH 2SNWA 2TIOA 4B2CA 3SU3A 1LHGH 3SO3A 3ZZCA 3ZZ8A 1TQ0B 1XUGA 1ELAA 3O8RA 4BXSA 2UWLA 3A8CA 1L1JA 4JZFH 3ATWA 1ZTJA 1VCQA 2C8ZB 4XOJA 1MTSA 1BTPA 2F3CE 3NK8A 3QUMP 3SJ8A 5ETXA 5DK1A 1S82A 2WPHS 3ZZ7A 1GG6B 1HAYB 2GMTC 3H7OA 3SNDA 4E06H 1HAHH 1YKTA 3LGWA 4DG4A 3LJOA 1EAWA 1RS0A 4Q4LA 1FY1A 3M7QA 1GMHG 4TPIZ 2W26A 4Z0KA 2H9EH 3SU2A 1YPMH 1P3CA 4CH2B 8LPRA 1HAOH 4D9QA 1SLXB 1BMMH 4KKDA 3TK6A 1D3DB 2BY9X 4K5ZA 1ZTKA 1DUEA 2AMDA 2Y7ZA 1EJNA 1DUAA 1GJ9B 1WCZA 3UNQA 2RDEA 2F9PA 1H8IH 1W0YH 2WV4A 1HJAB 1TNLA 1WAYB 4XBCA 1HAPH 3NRLA 2PSXA 1O3FA 2A31A 5CMXH 1A5HA 1VITF 2BDBA 1THSH 3SNCA 1GHBF 4ZKOU 2CF9H 2IJD1 1QRWA 4B75A 1CE5A 1S6HA 2WPIS 4XBDA 2Z6BD 2VIPA 3BEUA 1GBAA 4INHA 1TFXA 4GVUA 3EA7A 1CHOG 1BBRK 4E7NA 1A46H 1EP5A 1VGCB 6LPRA 3RXCA 9ESTA 3S9CA 2SNVA 1EZSC 2R3YA 1P05A 2QGRA 2BVXH 2XCFA 2XC0A 3UQVA 2VJ1A 4ZKNU 3PTNA 3BEIB 2GKVE 1AGJA 2FESH 3RXIA 1QBNA 1OOKB 5EJLA 1GBIA 2Y82A 4WXIA 3SV2H 2VB0A 2ALVA 1FN8A 2F9NA 4M9FA 2B5TB 3DA9B 4YLUA 2P94A 2ZGXH 1YPKH 4GHQA 4CBNA 1UVTH 4Y8XA 1BOQA 2ZFFH 4BAHB 2ILNA 1QNJA 4RN6A 4U32A 1GI6A 1HPGA 2UWOA 1V2NT 3L33A 1C4U2 1L1GA 2P3UB 1S6FA 4HG6A 2BD7A 5EPYA 1Z7KA 1V2PT 2V3OH 2ZGBH 1TNKA 2KAIA 1K9OE 4Y71A 4OS7A 1UJ1A 3F9GA 3RXOA 3KEEA 1G3EA 1GI9B 2AGEX 2OP9A 1TRMA 2D26C 5C1UA 1FV9A 1H8DH 1SB1H 3BG8A 1V2ST 1FNIA 1TYNA 3VXEH 1LHEH 1W3CA 5H4IB 4DGJA 3STIA 3UTUH 1VZQH 3A81A 3PV5A 4X6OA 1HAVB 1O39A 3LJJA 2QY0B 1CA8B 2FLBH 2H6MA 2P93A 1G9IE 4A1XA 1O2HA 4J2YB 3N99A 3SUDA 5DN6D 1ZYOA 2A45B 3VXFH 1FIZA 3ZYEA 4AGJA 3FN8A 4CRDA 2FXRA 2NU1E 3PWBA 3M7TA 1Z8IB 2G81E 1PQAA 5EJ1A 2AIQA 2SGDE 1ORFA 1Z8GA 2FDAA 5FL7D 1GCTB 3M37A 3RC6A 7GCHF 5GNDA 1BBRH 3SHCH 3H7TA 4IW4E 1AMHA 5IDKA 4ABEA 1PPFE 4K8BA 2ALPA 4TY7A 2FOMB 1O31A 5JBBS 1BTZA 3KYFA 1NZQH 4O3UA 5C3NA 3U28C 1TABE 3BTGE 5AF9H 1AVWA 1C4V2 5EODA 4GAWA 3QN7A 1ANCA 3NWUA 1K0HA 4DY7B 1W7XH 4O03A 3RXSA 3OY5U 4Y6DA 2BLWA 3P8OA 4NA9H 4BAOB 1C5OH 1CT4E 1IHSH 3RXVA 1XM1A 1DSTA 2LPRA 2G5NA 4IMZA 4SGAE 5DP4A 3AK5A 3MNSA 2ZCKP 2KCYA 2ZTZA 5DP5A 2C8WB 1BZXE 1XUFA 4HFPB 3R3GB 1WUNH 2BX4A 4PROA 4BTUB 2M2AA 1QB9A 4GSOA 1HV7A 2ZDNA 3PMJA 1MQ5A 2OK5A 1WQSA 3D49H 1AU8A 5KEDA 5E2PA 1DT2A 1O32A 1PPHE 2W3KA 1UTPA 4XE4A 4IC5A 2C3SA 1CGJE 1GVZA 1TGTA 4CRGA 1O3LA 2W6JD 5TCCA 1GI0A 1HUTH 8GCHG 1GHZA 3M7UA 3TJOA 1UCYH 3MMGA 1A1RA 2M5TA 3OYPA 3F2GA 1LPZB 1BMLA 1RXPA 1TOCB 5TCAA 1NC6A 3PLBA 1Y5AT 1D3PB 1LCYA 4ISNA 3PV2A 3TGIE 3SJIA 3V13A 4AORA 2QXGA 1DSUA 1WOFA 2ZHEH 3CS7A 3MQKC 1V3XA 2VNTA 1GHAG 2QF3A 2QE7D 1J14A 1H8HD 2B7DH 2JJ2D 4WMEA 4Y11E 1C1QA 2SFAA 2BOHB 2ZIQH 1GI3A 1K28D 2C90B 2TGDA 2JETC 1P12E 1D9IA 3Q3YA 3GS9A 2BLQA 1ETRH 3BTHE 3ELAH 4NA7A 4GCHF 4HGCA 2P16A 3GCHC 1ACBE 2A7CA 3OU0A 1D6RA 2F9BH 1DVAH 1BJVA 3A80A 1DWCH 3GY7A 1P2MA 4XDEA 4ZAEA 4R0IA 1GBDA 4AN7A 1AO5A 1XKAC 3F0OA 3OX7U 1YPGH 4K1EA 3ZZAA 1TRNA 1F0SA 2GZ8A 4ISIH 1V2RT 2R0KA 1COWD 1O3EA 1YYY1 2Z9LA 4X1RU 3Q3KA 1KLJH 3QTOH 3WW7A 1FONA 4Y8YA 5EU8A 3I77A 1SQOA 3OSYA 5LH8A 2XXLA 1XVOA 2RG3A 3ATKA 3V0XA 1C1VH 1KXCA 1N1LA 2FI4E 2YMSC 4THNH 2JKHA 3NZIA 2LNCA 3NPSA 4K60A 4UD9H 1IOEA 3K65B 2Y81A 3M3TA 1HLTH 1JXPA 2ZHQH 2FLRH 1GL0E 2OC7A 1PPZA 4JZIA 4XD7D 1O3AA 4TWYA 3KIDU 2ZGCA 5FPYA 1C2HA 2HLCA 3T5FH 5KECA 2FEQH 5KGOA 4B76A 1JMOH 4FOUC 1P02A 5EW2H 1AB9C 2EI7A 2SGPE 1N6XA 1P0SH 3GCOA 3GOVB 4ACAA 3UREA 4FUHA 3TIUA 1C1UH 2TPIZ 1FQ3A 3M61U 1GI8B 1P10A 4SGBE 2BVRH 2LP6A 1O2IA 4FUEA 4XBBA 1MBMA 1C5NH 4WH8A 2A4QA 1WDIA 2HVYB 1PPCE 2FX4A 1UTJA 3LC5A 2W6ID 3A7TA 1QCPA 2O8TA 5HM2A 2WV5A 1IAUA 2Y6TA 4QT8C 1EAXA 1HAXB 1IQEA 1D3TB 4HTCH 2WYGA 2WYJA 5GJ4B 3AAUA 2FZZA 4AOQA 3SU4A 1V2JT 2FS9A 1YPEH 3U69H 4DURA 1C5UA 3A86A 1PYTC 4KTCA 1YLDA 3PMBB 3P70B 1EPTA 2NU2E 1O2XA 1TNGA 1IQJA 1KXAA 1Q31A 2QN5T 1UVOA 1EZXC 1SC8U 5A8ZA 4YOGA 1SGYE 3GCTF 3A87A 1WXRA 4NSVA 4B6EA 5CHBA 3U8RH 4AB9A 1BTHH 2XYAA 1O3IA 5F8XA 3KCGH 2OUAA 1MKWK 1FXYA 2FI3E 3MO9A 4A7IB 4LZ1H 1Y59T 4NFFA 1H9LB 3F9EA 1VJ9U 2PV9B 1MBQA 3U9AH 3OEED 2AYWA 1QBOA 1YBWA 1OP8A 4FUBA 4AZ2B 2GD4B 1C5LH 2VIQA 4F49A 3PMHB 4ZUHA 1GGDB 3NCLA 4I8LA 2KM0A 3SW2B 2JH5D 3RP2A 3UIRA 3ZZDA 4AB8A 2CK3D 3P8GA 5LPRA 2CHAB 3FZDA 1W13U 1TX6A 1T4VH 1WTGH 3UPEA 2VIWA 3Q77A 2W7UA 1O2GH 2XW9A 1P11E 2P3TB 4MPXA 4ASHA 4DW2U 3FZZA 1ZHRA 2ZDVH 1O38A 3M5OA 4BAMB 4ABBA 2XBYA 2VIOA 2ZHDA 1O2QA 3A88A 2UWPA 4AFSA 1NRNH 2BY5X 3GYLB 1SFIA 2PFEA 4DOQA 2STAE 2PKAA 2P8OC 3UOPA 2C4FH 2PSYA 3S7HB 1CVWH 1BHXF 3M3VA 4INKA 3UFAA 1DX5M 1F2SE 4AG1A 2IN2A 1ZPCA 4Q7XA 1UTNA 3RXUA 1AZZA 3ODDA 2BD4A 1CBWB 1C1TA 3RC4A 4TSFD 3TH2H 2F9VA 1XVMA 5GXPA 1UTMA 2KFWA 3MH5A 1TBQH 3EA8A 1GJ5H 1UW7A 2AIPA 3KQDA 4KGAA 3DFJA 3SU6A 1AVXA 3HK6B 3D23A 3MO3A 2SGQE 1GJBB 3BSQA 1O0DH 2Y5GA 1OXGA 4X2YA 2GZ9A 3MOCA 1GMHF 3BTEE 5G4BA 1S85A 2BY6X 4XFQA 1SG8B 4OGXA 1GMCG 5T1VA 2QIQA 4ZCNA 1TOMH 5F03A 2FYRA 2BB4A 4IMQA 1DFPA 2CMYA 3MTYA 3E91A 4CRCA 3OEHD 1G37A 5J4SA 3GY6A 2OBQA 4HI3A 1O2ZA 2ODPA 1MKWH 1LHFH 5DKMA 1O5FH 2KR7A 1ARBA 1ZSJA 4AFQA 4CR9A 5B6OA 1Q3XA 4TT3D 2XC4A 1YPLH 5F8TA 2Q1JA 3ZVDA 1O3MA 3IWMA 4MNYA 2FI5E 4WY3A 3SJ9A 1SSXA 1VITH 1Z6JH 1B0FA 1EOLA 2R0LA 3N7EA 2F91A 5ESTE 2XBWA 2XCNA 2FPZA 4FUJA 2UUFB 1J8AA 4FUDA 4Q80A 3EAJA 1O3KA 1ELCA 2JETB 1GHYH 2PGBB 1YLCA 2Y7XA 1KXDA 1AFQC 3O8DA 1EASA 2ZDMA 4AX9H 1O3NA 1MZAA 1YCPH 1O5CB 3TNSA 1BRCE 4INLA 5EOKA 1MTNB 3QGNB 4LOYH 3T27A 4RT0A 3B9FH 3CENA 4BOHA 1K21H 1SGEE 2ZDKA 3UUZA 2FOCA 4NIVA 1V6DA 1YGCH 2ZI2H 5T6GA 1SQRA 3ATIA 1P2OA 2PTNA 1J15A 1RTLA 2PKSC 3LGVA 1IQIA 1G3CA 3EYDA 3UR6A 1TIOA 1UTQA 2AFQB 3T26A 3PO1C 1HXEH 2G5VA 3QGJA 3PRBA 1TMUH 1RTKA 1FDPA 1Z71A 1HGTH 1HDTH 3QO6A 4ABHA 4CH8B 1UTLM 1KXBA 4RI0A 1DICA 1O2WA 1H9HE 2ZWLH 3BN9A 3BF6H 3O8CA 1QQ4A 5HYOA 2PLXA 1TPSA 1NRQH 2ZFSA 1NPMA 2ZFTA 4D76A 1OWIA 3S9BA 1SHHB 1K1MA 5C1YA 3MU4A 3MYWA 5DP8A 1WTHD 1GJ4H 2BDAA 4WMFA 2BXTH 1D3QB 5DP7A 4B6FA 1QQUA 1ABJH 1AZ8A 4I8JA 3PROA 1KLTA 2ANMH 1VITG 3QX5H 4OS2A 4NIXA 2HVXA 3F3BA 5I25A 4GHTA 1NN6A 3IG6B 3PB1E 3FO8D 2FP7B 2ZO3H 5C5NA 1C5RA 3P92A 4U01A 1A7SA 1S83A 1O2LA 1P9SA 1G3DA 2PW8H 3HKIB 2A0QB 3BG4B 3SNAA 4F55A 3LIWA 3HKJB 3VPKA 1BIOA 1TPPA 5K0HA 1ESAA 1MTUA 4YLQH 8KME2 3KQEA 1O3BA 1JIRA 1GWAA 3GICB 2ZQ1A 1J17T 1LVOA 4CBOA 4H6SB 2VBCA 3UQOA 1AE8H 3A8BA 3SZNA 4Y79A 4Q63A 3TVJB 1E1RD 2UUKB 2J98B 4FETA 1C1OA 1N6YA 4FU7A 3GISB 2O8WA 1PJPA 3DCLA 4O97A 5B6LA 1K2I1 1NRSH 3KGPA 1HIAA 1UVSH 2XWBI 1A0HB 2FOFA 1F5KU 4E05H 1SGCA 1HFDA 2DE8A 2R2WU 1CGHA 3AAVA 1HAIH 2PHBA 3SORA 8GCHF 1BB0B 1Z8JB 1EAIA 4RSPA 3WWBA 3SI3H 3VB6A 5FAHA 3RXFA 3DFLA 5EJZA 8ESTE 4B71A 3RXQA 1THRH 2IPHA 1QIXB 5ABWA 2FOHA 1S81A 4ZHAA 5JDUB 4YT7H 1QFKH 1SGQE 2ZPQA 4YZUA 1UMAH 1H1BA 3T25A 3Q3XA 4DIHH 1O2RA 2H1UA 4YXWD 2EEKA 2PKSB 3TITA 1ETSH 1KTTB 4TWWA 5JB8S 1PQ7A 1OWHA 3BTWE 1G3BA 4D7FA 1GBJA 2YMSD 1ZLRA 2TGTA 2A2QH 1EXFA 2BYAX 1L1NA 2GZ7A 2Q6DA 4I86A 3FKSD 3U1JB 3PLKA 1C1MA 5EXMA 5TJXA 4ZH8A 4MLFB 2V35A 2QXJA 2WINI 3VEQB 1N8OC 1F5RA 2WSSD 1E79D 1OWKA 2O9QA 5L2ZH 3BTTE 1BQYA 1AKSA 5JPMH 2QC2A 1VCPA 1DWDH 3E16B 1C5QA 1Y8TA 2BDHA 3L6PA 4CREA 3BEFB 4ZKRU 1E36B 5LGOA 2Z9IA 1QB6A 3MH4A 2V3HH 3QTVH 1FY3A 2CN0H 1OX1A 5L6NH 3K6YA 4I8GA 1AKSB 3MO6A 4B73A 1A4WH 7LPRA 1IQKA 3EA9A 4DCDA 2ZHWH 5HMAA 3TK5A 2AEIH 3W94A 1XUHA 1AFEH 3RXJA 4DT7B 1QR3E 2OC0A 1GBTA 2ANYA 5C5OA 2ZFPH 1QGFA 4ABDA 1QZ8A 1FN6A 1BTXA 1C5WB 3VB4A 7ESTE 1ANBA 4KTSA 4D9RA 3A83A 2PTCE 1VKYA 2O8UA 5CHAC 1MMJN 4IGDA 1NO9H 1AD8H 1WU1A 2P8OB 3UWIA 3SYJA 1P04A 2GDEH 1UO6A 2FWWA 5GIBA 5GWZA 1C5SA 1SQAA 3ZVAA 3P95A 3DSOA 1EOJA 1K1PA 3UNRA 2ZPRA 4MPUA 3GY4A 1K1OA 4CR5A 3VFEA 1QL9A 3LH1A 1SMFE 1BTWA 1W0JD 5LPFA 1HIAB 2I6QA 1L2EA 1ZPBA 2HNTE 2RFKC 2Z9KA 4X1SU 1GBBA 1XUKA 2FO9A 2PUXB 2HLDD 3AASA 3LT3A 1OWDA 1ZTLA 5JBTA 1BHXB 3U8OH 3RXBA 4BNRA 1DPOA 1N8OB 4FU9A 3PM3A 2NU4E 5FHTA 1P2IA 2ZG0H 4AG2A 2OCVB 3GCNA 1H4WA 1S0QA 3A84A 2F43B 1SKYE 1TMBH 3TJUA 5EG4A 1SGTA 5E0JA 1VR1H 2Y5FA 1F0TA 1BMNH 1TRYA 1Z8RA 2AGIX 2VWNA 2AHME 2BY7X 4RT1A 3M5NA 1A0LA 3HK3B 3RMOH 5A8XA 2ZDAH 5GDSH 4NIYA 6CHAC 1FY5A 5EQSA 1MCTA 2BQ6B 1B7XB 4OS5A 1O3JA 1FMGA 1SGDE 1FAKH 1GVLA 1TNIA 1Y5UT 4P02A 3GDUA 5AVDA 5C0TA 2BVSH 1D6WA 2CF8H 1ZMJA 4TYDA 2PR3A 1MAYA 3NUMA 3ZV9A 4NIWA 5JYIA 5PTPA 2J92A 3RXAA 1C2IA 1Z1IA 1RFNA 1AUJA 1TGSZ 3PRDA 2A32A 2VH6A 3SNBA 4UEHH 4CRBA 1V2QT 3MU5A 5J4QA 5EQRA 2Z3EA 2IJOB 1GHWH 3ZZ4A 1C5XB 3ENSB 3D62A 1TA6A 4AFUA 2XRCA 3DUXH 2WPDD 2V0BA 2A4RA 1E0FD 4XRNA 4NWKA 5T6FA 2BD8A 2ZP0H 2F4LA 2KAIB 3TU7H 5A0CA 1S84A 5E0GA 1ZR0A 1SOZA 3I29A 1O3HA 1QJ7B 1GDQA 1Y3YA 1YCPK 3BTFE 1GHVH 4D8NA 1FJSA 2A5IA 1KLIH 1HB0B 3KN2A 1QRXA 2Q6GA 1HNEE 1EKBB 4UDWH 2RA3A 4ZXXH 1GI5A 2FODA 2G8TA 3A85A 1MH0A 2Z3DA 3S9AA 4OS6A 2ZF0H 1C5VA 1GPZA 1ANDA 3B8JA 5FBIA 3T2NA 3ESTA 5A2MH 1SGIB 3HGNA 3W95A 5CHAB 3FAOA 1TX7A 5C67A 5DJ7A 4ABGA 1TE0A 1ELGA 3T28A 1H8ED 1OYTH 2ZU3A 1WBGB 1NFYA 1MKXK 2AH4X 2FM2A 6GCHG 5JBCS 1LQEA 1MAXA 1O5AB 4K1TA 3ZZ5A 2OXSA 2K8IA 2WHXA 4M7GA 2VVCA 5A8YA 3GY3A 2VIVA 2CXVA 2J5UA 1Y5BT 1O2JA 4DVAU 1YM0A 4I8HA 5EXLA 2Z3CA 1QB1A 1RTFB 2YMSB 1P8VC 1Y3UA 4Y7AA 1DANH 4A6LA 3Q00A 4ZMAH 3LPRA 1MKXH 4Q2KA 4CRFA 1CA0B 1FI8A 3H5CB 4OGYA 1X7AC 2R2MB 1XUJA 2PWXA 3FP7E 3TPIZ 2BOKA 4CHAC 1EB1H 1T4UH 4FXGH 1LKAA 2ZDLA 4WMDA 4I7YH 4LZ4B 5DP3A 1JBUH 1V2KT 2D8WA 4MPVA 3V12A 5FPTA 1MTNC 2ULLA 1GBEA 2R9PA 1PYTD 1GBFA 1C5YB 2FTLE 4ABIA 3RXMA 4NGAH 1T7CA 2VH0A 1QURH 3BIUH 2BQ7B 2FOEA 3GCHB 1KDQA 1C5PA 2O8LA 1JOUB 3RM2H 2K0QA 1SLUB 3DHKH 1T8NA 3CS0A 1QL8A 1QY6A 3UAIC 3TGKE 1V2VT 1ZHPA 4H4FA 3K6ZA 1ELDE 2YNAA 2OC8A 2V6NA 3VB7A 4NA8A 4IC6A 1W0ZU 4MVNA 4X8UH 4JK5A 5F6MA 1PPEE 3LDXH 1C1SA 4GUXA 2PKAB 2BD9A 4WF8A 1O5GH 1C2MA 1HJ9A 2SGAA 2ANWA 4ZHLU 1C9TA 2QF4A 1RJXB 2TRMA 3SZEA 3A7WA 4YESB 1O3PB 2J94A 4DIIH 1A5IA 3B23B 1LHDH 1TGCA 4NFEA 3ITIA 3SBKA 5C94A 2WZQA 2QCYA 3RU4E 2A2XH 2QXHA 3LKWA 1NU7B 2VU8E 3QK1A 2A7HA 4HZHA 5A09A 2NWNA 5HXFA 1K22H 1JRTA 1GBHA 2ZGHA 2I6SA 1SGFG 1C2KA 4JZ1A 4NSYA 1XXDA 2GX4A 2ZU2A 2P3FH 4ISOA 1F7ZA 1YPHE 1TGBA 2C8YB 1VJAU 1QHRB 1TAWA 1BT7A 2OLGA 3WY8A 2GCHF 1BDAA 3KL6A 1L4ZA 1YCPM 1TNHA 1GBKA 1ARCA 3MH6A 5BPEA 1NFXA 3KYGA 1LHCH 1CSOE 1ZGVA 3Q76A 3A89A 1AE5A 1CBWC 1ZMNA 3PV4A 1MU8B 1SGFA 1W0KD 1FUJA 2H5DA 4A5TS 4Z6AH 1GJAB 3LGIA 1UCYK 2A4GA 2EC9H 3ZV8A 4BTIB 1F0UA 4BAQB 1C5ZB 1EQ9A 2PGQB 2GP9B 1QTFA 3SQHE 1P57B 4UFGH 1O5EH 1SFQB 1G32B 3GDVA 4P00A 1HJ8A 1GCTC 5E0HA 4GCHG 3GDSA 1O2SA 2ZQ2A 4JYVH 3SV6A 2BD3A 3F1SB 3GY5A 4BAKB 1A2CH 4VGCC 2KCOA 2VGCB 2B9LA 1EATA 1BJUA 3PWCA 1XKBC 2NU3E 1ZMLA 2GT8A 4F4OC 5HM9A 3P6ZB 2JDID 3SN8A 1CHOF 3PLPA 3FFGA 3QZRA 2ANKH 3P8NA 1TONA 3FOAA 1C2LA 2BD5A 1CU1A 4FUIA 4Y8ZA 1P2KA 1IQFA 1DLEA 1U6QA 3OE7D 4X2VA 4YM9A 1C1PA 1WQVH 3SUFA 3SNEA 3M36A 1ZRBA 5FXLA 1O3CA 1ZZZA 3E6PH 1D4PB 2EY4C 2HALA 1C5MD 2H9TH 3M5LA 4MTBA 3SU0A 4BXWA 1ELVA 4Q7YA 2BZ6H 2J34A 1RIWB 4Y76A 3N7DA 5E8EH 1MZDA 2AMQA 4F48B 2RCEA 1O3GA 1NTPA 1ZPZA 4E7RG 4I8KA 1KYNA 5FX5A 3ZVGA 3S7KB 1A61H 1Z1JA 1NRPH 3ZVFA 1LVMA 1Y3VA 3JZ1B 3FP6E 2L6OA 4WXVA 3MWIU 2BQWB 1AFQB 1BA8B 1P03A 3SV7A 4Y0YE 1CT2E 1SOTA 1E38B 1M9UA 4ZHMU 1MD8A 1QBVH 4VGCB 1KXFA 4GLYA 1C2GA 5DSFA 1F5LA 3ODFA 2OTVA 1P3EA 3SV8A 1TGNA 3W1EA 1HBTH 2G00A 3BTKE 1C2EA 4ZKSU 1L4DA 4RKOB 3RXGA 4Q7ZA 1MABB 2BLOA 4FUGA 4X2WA 2UUYA 1Y3WA 3TLOA 2EI6A 2V3MA 5GCHF 4Y7BA 4LK4A 2OBOA 3KF2A 4UFFH 1H9IE 5EPNA 1MQ6A 1OYQA 2QA9E 3HGPA 3RLYH 2BX3A 2GCTB 3NXPA 1F92A 1EZQA 1TX8A 5L2YH 2EI8A 4X8SH 3F2HA 1OSSA 4TPYA 3S69A 4KP0A 1W14U 2WPKS 3S0NA 1G30B 1ELEE 1O33A 1RD3B 3MH7A 3CP7A 1KDQB 3E3TA 1G2MA 2IPQX 3AW0A 4YT6H 1DS2E 1O2PA 1GJ7B 2HNTC 2EQNA 1E37B 2BLVA 2J38A 4JYUH 1SQTA 1W2KH 5T6DA 1AI8H 3SJKA 2F9OA 2P59A 2QF5A 1QJ1B 2C8XB 2H5CA 1Y3XA 1UK3A 3M3SA 4FUFA 1XMNB 1NROH 1P2JA 1O2OA 1SGNE 4X2XA 4B1TA 4ASUD 4MG3A 5EXNA 1DDJA 1P2QA 2XBXA 1UTOA 1KTSB 3SU5A 2KZ4A 1LO6A 2TGAA 1K1NA 3RXLA 2BDIA 3A7XA 3RXEA 2BZAA 2XWAA 3H09A 2LELA 4K3JA 3MNXA 1TQ7B 3KQBA 1OP2A 1TBRH 2H9HA 3BIVH 3LONA 1ZSLA 2FS8A 1O34A 3KQCA 3MU8A 4IN2A 1EZUC 2KX4A 2AERH 2FIRH 1Q2WA 2J4IA 2J95A 2AS9A 3A82A 2GGVB 3OTPA 2HGTH 1DY8A 1BTYA 5HIYA 2CHAC 2ZPSA 1S0RA 1SR5C 1O37A 5SGAE 5HIZA 2VVVA 1TALA 1UCYE 1V2TT 1V2WT 5DP9A 1C2FA 1NESE 1V2UT 1GI2A 3MFJA 4WH6A 1GCDA 1O35A 2HNTF 1P06A 4R8TB 3OY6U 1TPAE 1LQDB 1MUEB 5GPIB 1XUIA 1A0JA 2V7QD 3BV9B 1YC0A 4YOJA 1E34B 4Y10E 3G01A 1TB6H 2ZFQH 3PYHA 2ZKSA 1ELBA 1J9CH 5K7RA 1MCVA 2VWLA 1FX0B 2GDDA 3C27B 3R0FA 2ZCHP 4FVDA 1GL1A 1K1LA 3U98H 6ESTA 1EP6A 3U1IB 1DWEH 2G4TA 1JIMA 4NZLA 1EAUA 2A1DB 2K1QA 3URDA 4LXBH 4O3TA 1NBMD 4WJG2 2TGPZ 5DP6A 1HAVA 2J97A 3I78A 2D2DA 1AIXH 1O2KA 2C93B 1PPBH 4ACBA 2VIDA 4UFDH 1QRZA 2EA3A 1ANEA 4K69A 4NCYA 1BRBE 3UB0A 1P2NA 5JB9S 3RM0H 5EGMA 1UHBA 2WV9A 3K2UA 2HOBA 2CGAA 4ISHH 5AHGH 2HPPH 3RU4T 2JH0D 2ZEBA 3E0PB 1IHTH 1TLDA 4IN1A 1GJ6A 1UVUH 4RKJB
chains in the Genus database with same CATH topology
1EX3A 2BMGB 4GPGA 1GHXH 1ZOMA 2ZZUH 1ESTA 3GY8A 3SI4H 3VG8A 1B0EA 2WPJS 2F83A 2QAAA 5HKKD 2Z94A 2B0FA 1IQMA 1LKBA 4K8YA 3URCA 1VCWA 2CV3A 1GBMA 2AMPA 3EQ0H 2BY8X 5C0UA 2ODQA 3TH4H 3RXTA 2OQUA 1HAGE 1G2LA 2FX6A 5EW1H 2GCHG 3SUGA 1ID5H 3M35A 2FOAA 4FU8A 2TBSA 1QA7A 3MI4A 1DITH 3MU0A 3RXRA 2GTBA 6GCHF 1O2TA 1HRTH 4WWYA 2ZGJA 1CQQA 1BITA 2KCAA 1GVKB 1GBLA 2XBVA 4KELA 4FUCA 1INCA 3UWJH 1O2VA 1K1IA 5BRRE 1RIWC 4X6MA 3LGTA 3AVZA 4X6NA 1HXFH 1RRKA 1UVPA 1OWJA 1TNJA 5FX6A 3SHAH 1L0ZA 4KTUA 3PMAB 1C5TA 1NFUA 1TA2A 1FLEE 3SJOA 3C1KA 2VWMA 3FP8E 2XNIA 1AWFH 4X1PU 1KY9A 1UTKA 2RDLA 2KCPA 1HCGA 5DPAA 4B74A 2ZTYA 2ESTE 1AWHB 1SI5H 1LDTT 1HAZB 2NU0E 2YNBA 1V2LT 1WSSH 2BM2A 2ZFRH 1T32A 1GMDF 2BTCE 2W5EA 2UUJB 3BTME 4AGKA 1J16A 3L3TA 1O5DH 1C1WH 1DLKB 4OS4A 6CHAB 3LOXA 2JJ1D 2GV7A 2XOKD 2ASUB 2YOLA 1GDNA 3F9HA 4YTAA 3MNBA 2G52A 4IS5A 4YO9A 2JH6D 4IBLH 4TY6A 1SPJA 1ELFA 1OKXA 1WYKA 2ZHFH 1NY22 1OHHD 1O2YA 2SGFE 2Y5HA 4ISLA 2ZC9H 1TBZH 2H2ZA 1CGIE 4JK6A 5T3HA 1A3BH 2F9UA 1GJDB 1WV7H 3A7YA 3T62A 1AQ7A 3UR9A 1DOJA 1SBWA 3VB3A 4ABAA 1EPTC 2XNDD 1ETTH 1FY4A 1TMTH 1SHYA 1DM4B 1VGCC 1AHTH 2ODYB 5E2OA 1EB2A 3EGKH 4BANB 3ZVCA 2CJIA 4JMYA 3ZZ3A 3RMMH 2GVFA 4U2WA 2Z9GA 5FPSA 3DT0H 2BDYA 1CT0E 1XX9A 1A3EH 2FTMA 1DXPA 1GJ8B 2OD3B 2G51A 4UFEH 3T29A 5C1XA 1B5GH 4DT4A 1P01A 5A0AE 1LVYA 3UNSA 2WUBA 1HJAC 5CDFE 4UONA 1ABIH 3E8LA 9LPRA 1OP0A 1HYLA 4BTTB 1SGPE 3SOSA 1GI1A 1O2MA 1GI7B 3VGCB 1KXEA 3VGCC 5CE1A 2WUCA 4K1SA 2WPMS 3E0NB 1QJ6B 3O8BA 1O2NA 1OWEA 4X6PA 2BXUH 2FOBA 3ZVEA 4X8TH 1CHGA 5FBEA 2W3IA 1LVBA 2ZU1A 2G55A 1C1NA 1OPHB 4AYVB 2STBE 2GCTC 1GG6C 2GMTB 2XC5A 5DO4H 1NS3A 4U30A 3DD2H 5DG6A 3TJNA 1XXFA 3E1XB 4CRAA 4ESTE 3WWFA 1PPGE 2QXIA 3FANA 1PQ5A 1KMHB 2D1JA 3F9FA 4JCNA 4ABFA 2OINA 1PQ8A 5FCKA 3RMLH 2GT7A 3GYMA 3LC3A 3TK9A 3SGBE 2PUQH 4X8VH 1IQGA 3TNTA 3ZVBA 5C2ZA 3SQEE 1JWTA 4J1YA 3RMNH 4OS1A 3E90B 1AY6H 3MHWU 3P17H 5AFYH 4XSKU 2P95A 7GCHG 2VVUA 3LGYA 1SL3A 1EFRD 1EUFA 1A5GH 3P8FA 4MNWA 1ZGIA 1ZJDA 3FVFB 2OQ5A 1OS8A 5F53A 2FYQA 1ESBA 3ZZ9A 1KSNA 1FPCH 4MNXA 1YF4A 2QYIA 2SGEE 3MU1A 4D7GA 1GGDC 2ZU4A 1E1QD 1W10U 5EQQA 3TJVA 4WVPE 3QLPH 2Z9JA 5A0BA 3RUOA 4B2AA 3RXDA 1GHAF 3LH3A 2BD2A 1W12U 2J2UA 2O8MA 1NFWA 3F0PA 3SV9A 3A7VA 3UY9A 2DE9A 4ZXYH 1C4Y2 1EPTB 1QA0A 4CHAB 2AGGX 4NG9H 3QDZB 2HPQH 3VB5A 1YPHC 4MQAA 1O2UA 3RXHA 1FAXA 1LPGB 2Q6FA 1NU9A 3BTQE 5C20A 1FIWA 1ZRKA 1O3DA 3M5MA 2VINA 1GMDG 5ESBA 1FY8E 2VWOA 1FZZA 2B8OH 2ZA5A 1IQNA 3KHVA 2A5KA 2ZU5A 5AFZH 2ZNKH 4H42U 4I33A 5L30H 2IOTA 1NBME 1G36A 4I31A 3HPTB 2THFB 1V2OT 1DWBH 1P9UA 3N7OA 1AVGH 1O30A 2GV6A 1BUIA 2BDCA 3EDXB 2VGCC 1C2DA 4ZROA 4AFZA 1YPJH 2Z7FE 2XTTB 3SUEA 1GDUA 1UHBB 3SGAE 3ZIAD 1AUTC 1GBCA 1EJMA 1QL7A 2OC1A 2QF0A 4H6TA 1SGRE 4AYYB 2Y80A 3IITA 3STJA 3AW1A 3OTJE 5DGJA 3SGQE 1O36A 2HWLB 1MU6B 1F0RA 4FVBA 3U8TH 1GI4A 1O3OA 3V3MA 1LMWB 1E35B 1ZJKA 4OM9A 1SVPA 1THPB 3KNXA 5GCHG 3F2FA 1TPOA 1BTUA 4A92A 1AB9B 1JRSA 3BG4C 4JZEH 1GHBG 1PFXC 3EE0B 1DXWA 3ZZ6A 3V7TA 3QWCH 4Z1MD 1TWXB 3A7ZA 3TH3H 3ZZBA 4ABJA 1MTVA 1DY9A 1BMAA 2BHGA 4MNVA 4X1NU 1ELTA 3NKKA 2ZTXA 2JIZD 4Y0ZE 4JZDH 1KIGH 4NZQA 1C2JA 1T8OA 4UE7H 3D65E 2RA0A 1S5SA 2G4UA 3UOUA 1C1RA 1W7GH 3MNCA 1K1JA 1BMFD 2W7SA 5IK2D 1CO7E 3RDZA 1GMCF 1IQLA 1V2MT 4X1QU 3ATMA 3F6UH 3JZ2B 4MDSA 2ZECA 3LGUA 1T31A 7KMEH 1BRAA 2WPLS 4DJZB 3RLWH 1MTWA 1FPHH 4YOIA 5F8ZA 2DUCA 3ATLA 5JBAS 2ZCLP 4X0WU 3GY2A 3GCTG 3PO1B 2A4OA 5I46H 2A5AA 1SLWB 1BRUP 1W11U 2HRVA 4A1TA 4O9VA 4B2BA 5IYTA 1IQHA 3A8DA 4K2YA 1RGQA 4MPWA 3TGJE 4NWLA 3QZQA 1GJCB 1P09A 5HGGA 1LTOA 1O5BB 1SLVB 1NM6A 1EJAA 2A7JA 2FMJA 3RU4D 1ZHMA 1NRRH 1T8MA 1ZSKA 1W8BH 3LU9B 5LPEA 2FOGA 1Z6EA 2QV1A 2BDGA 3F68H 1BBRE 1UK2A 1S6LA 3OFND 1LPKB 4A1VA 1AN1E 1YP9A 3HATH 3ZYDA 3PTBA 3RXPA 2R3UA 5C17A 1T8LA 3BTDE 3K9XB 3RXKA 1C9PA 5FCRA 1NT1A 1CA0C 3SU1A 1MD7A 1UK4A 4I32A 4JYTA 3DSPA 3RC5A 3A8AA 1DE7H 2J9NA 3OAAD 1BCUH 2SNWA 2TIOA 4B2CA 3SU3A 1LHGH 3SO3A 3ZZCA 3ZZ8A 1TQ0B 1XUGA 1ELAA 3O8RA 4BXSA 2UWLA 3A8CA 1L1JA 4JZFH 3ATWA 1ZTJA 1VCQA 2C8ZB 4XOJA 1MTSA 1BTPA 2F3CE 3NK8A 3QUMP 3SJ8A 5ETXA 5DK1A 1S82A 2WPHS 3ZZ7A 1GG6B 1HAYB 2GMTC 3H7OA 3SNDA 4E06H 1HAHH 1YKTA 3LGWA 4DG4A 3LJOA 1EAWA 1RS0A 4Q4LA 1FY1A 3M7QA 1GMHG 4TPIZ 2W26A 4Z0KA 2H9EH 3SU2A 1YPMH 1P3CA 4CH2B 8LPRA 1HAOH 4D9QA 1SLXB 1BMMH 4KKDA 3TK6A 1D3DB 2BY9X 4K5ZA 1ZTKA 1DUEA 2AMDA 2Y7ZA 1EJNA 1DUAA 1GJ9B 1WCZA 3UNQA 2F9PA 1H8IH 1W0YH 2WV4A 1HJAB 1TNLA 1WAYB 4XBCA 1HAPH 3NRLA 2PSXA 1O3FA 2A31A 5CMXH 1A5HA 1VITF 2BDBA 1THSH 3SNCA 1GHBF 4ZKOU 2CF9H 4B75A 1QRWA 2IJD1 1CE5A 1S6HA 2WPIS 4XBDA 2Z6BD 2VIPA 3BEUA 1GBAA 4INHA 1TFXA 4GVUA 3EA7A 1CHOG 1BBRK 4E7NA 1A46H 1EP5A 1VGCB 6LPRA 3RXCA 9ESTA 3S9CA 2SNVA 1EZSC 2R3YA 1P05A 2QGRA 2BVXH 2XCFA 2XC0A 3UQVA 2VJ1A 4ZKNU 3PTNA 3BEIB 2GKVE 1AGJA 2FESH 3RXIA 1QBNA 1OOKB 1GBIA 2Y82A 4WXIA 3SV2H 2VB0A 2ALVA 1FN8A 2F9NA 4M9FA 2B5TB 3DA9B 4YLUA 2P94A 2ZGXH 1YPKH 4GHQA 4CBNA 1UVTH 4Y8XA 1BOQA 2ZFFH 4BAHB 2ILNA 1QNJA 4RN6A 4U32A 1GI6A 1HPGA 2UWOA 1V2NT 3L33A 1C4U2 1L1GA 2P3UB 1S6FA 2BD7A 5EPYA 1Z7KA 1V2PT 2V3OH 2ZGBH 1TNKA 2KAIA 1K9OE 4Y71A 4OS7A 1UJ1A 3F9GA 3RXOA 3KEEA 1G3EA 1GI9B 2AGEX 2OP9A 1TRMA 2D26C 5C1UA 1FV9A 1H8DH 1SB1H 3BG8A 1V2ST 1FNIA 1TYNA 3VXEH 1LHEH 1W3CA 5H4IB 4DGJA 3STIA 3UTUH 1VZQH 3A81A 3PV5A 4X6OA 1HAVB 1O39A 3LJJA 2QY0B 1CA8B 2FLBH 2H6MA 2P93A 1G9IE 4A1XA 1O2HA 4J2YB 3SUDA 3N99A 5DN6D 1ZYOA 2A45B 3VXFH 1FIZA 3ZYEA 4AGJA 4CRDA 3FN8A 2FXRA 2NU1E 3PWBA 3M7TA 1Z8IB 2G81E 1PQAA 2AIQA 2SGDE 1ORFA 1Z8GA 2FDAA 5FL7D 1GCTB 3M37A 3RC6A 7GCHF 5GNDA 1BBRH 3SHCH 3H7TA 4IW4E 1AMHA 5IDKA 4ABEA 1PPFE 4K8BA 2ALPA 4TY7A 2FOMB 1O31A 5JBBS 1BTZA 4O3UA 1NZQH 5C3NA 1TABE 3BTGE 5AF9H 1AVWA 1C4V2 5EODA 4GAWA 3QN7A 1ANCA 3NWUA 4DY7B 1W7XH 4O03A 3RXSA 3OY5U 4Y6DA 2BLWA 3P8OA 4NA9H 4BAOB 1C5OH 1CT4E 1IHSH 3RXVA 1XM1A 1DSTA 2LPRA 2G5NA 4IMZA 4SGAE 5DP4A 3AK5A 3MNSA 2ZCKP 2KCYA 2ZTZA 5DP5A 2C8WB 1BZXE 1XUFA 4HFPB 3R3GB 1WUNH 2BX4A 4PROA 4BTUB 2M2AA 1QB9A 4GSOA 1HV7A 2ZDNA 3PMJA 1MQ5A 2OK5A 1WQSA 3D49H 1AU8A 5E2PA 1DT2A 1O32A 1PPHE 2W3KA 1UTPA 4XE4A 4IC5A 2C3SA 1CGJE 1GVZA 1TGTA 4CRGA 1O3LA 2W6JD 5TCCA 1GI0A 1HUTH 8GCHG 1GHZA 3M7UA 3TJOA 1UCYH 3MMGA 1A1RA 2M5TA 3OYPA 3F2GA 1LPZB 1BMLA 1RXPA 1TOCB 5TCAA 1NC6A 3PLBA 1Y5AT 1D3PB 1LCYA 4ISNA 3PV2A 3TGIE 3SJIA 3V13A 4AORA 2QXGA 1DSUA 1WOFA 2ZHEH 3CS7A 1V3XA 2VNTA 1GHAG 2QF3A 2QE7D 1J14A 2B7DH 1H8HD 2JJ2D 4WMEA 4Y11E 1C1QA 2SFAA 2BOHB 2ZIQH 1GI3A 1K28D 2C90B 2TGDA 2JETC 1P12E 1D9IA 3Q3YA 3GS9A 2BLQA 1ETRH 3BTHE 3ELAH 4NA7A 4GCHF 4HGCA 2P16A 3GCHC 1ACBE 2A7CA 3OU0A 1D6RA 2F9BH 1DVAH 1BJVA 3A80A 1DWCH 3GY7A 1P2MA 4XDEA 4ZAEA 4R0IA 1GBDA 4AN7A 1AO5A 1XKAC 3F0OA 3OX7U 1YPGH 4K1EA 3ZZAA 1TRNA 1F0SA 2GZ8A 4ISIH 1V2RT 2R0KA 1COWD 1O3EA 1YYY1 2Z9LA 4X1RU 3Q3KA 1KLJH 3QTOH 3WW7A 1FONA 4Y8YA 5EU8A 3I77A 1SQOA 3OSYA 5LH8A 2XXLA 1XVOA 2RG3A 3ATKA 3V0XA 1C1VH 1KXCA 1N1LA 2FI4E 2YMSC 4THNH 2JKHA 3NZIA 2LNCA 3NPSA 4K60A 4UD9H 1IOEA 3K65B 2Y81A 3M3TA 1HLTH 1JXPA 2ZHQH 2FLRH 1GL0E 2OC7A 1PPZA 4JZIA 4XD7D 1O3AA 4TWYA 3KIDU 2ZGCA 5FPYA 1C2HA 2HLCA 3T5FH 2FEQH 4B76A 1JMOH 1P02A 5EW2H 1AB9C 2EI7A 2SGPE 1N6XA 1P0SH 3GCOA 3GOVB 3UREA 4FUHA 3TIUA 1C1UH 2TPIZ 1FQ3A 3M61U 1GI8B 1P10A 4SGBE 2BVRH 1O2IA 4FUEA 4XBBA 1MBMA 1C5NH 4WH8A 2A4QA 1PPCE 2FX4A 1UTJA 3LC5A 5HM2A 3A7TA 1QCPA 2O8TA 2W6ID 2WV5A 1IAUA 2Y6TA 4QT8C 1EAXA 1HAXB 1IQEA 1D3TB 4HTCH 2WYGA 2WYJA 5GJ4B 3AAUA 2FZZA 4AOQA 3SU4A 1V2JT 2FS9A 1YPEH 3U69H 4DURA 1C5UA 3A86A 1PYTC 4KTCA 1YLDA 3PMBB 3P70B 1EPTA 2NU2E 1O2XA 1TNGA 1IQJA 1KXAA 1Q31A 2QN5T 1UVOA 1EZXC 1SC8U 5A8ZA 4YOGA 1SGYE 3GCTF 3A87A 1WXRA 4NSVA 4B6EA 5CHBA 3U8RH 4AB9A 1BTHH 2XYAA 1O3IA 5F8XA 3KCGH 2OUAA 1MKWK 1FXYA 2FI3E 3MO9A 4A7IB 4LZ1H 1Y59T 4NFFA 1H9LB 3F9EA 1VJ9U 2PV9B 1MBQA