4A1VA

Co-complex structure of ns3-4a protease with the optimized inhibitory peptide cp5-46a-4d5e
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
194
structure length
190
Chain Sequence
GSVVIVGRIILSPITAYSQQTRGLLGCIITSLTGRDRNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Affinity Peptide Inhibitors of the Hepatitis C Virus Ns3-4A Protease Refractory to Common Resistant Mutants.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1b
molecule tags Hydrolase/peptide
molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
total genus 51
structure length 190
sequence length 194
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4a1vA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4a1vA01
1AKSA 4FU7A 3SV2H 2XC4A 3BG4B 3T26A 1OWIA 2FOEA 5B6OA 1FY1A 1GDNA 1C5RA 3NWUA 1Z6EA 5EW1H 1ETTH 3ITIA 3UUZA 1D3PB 2XNIA 2ALVA 4UONA 1NRSH 4DGJA 4RKJB 1O35A 7KMEH 4ESTE 1QJ7B 1PJPA 2H6MA 3RXFA 2JH5D 1C5OH 2GCTC 4Y10E 3U1JB 3KQBA 3LC3A 3ZZ8A 4AORA 1GBTA 4MPWA 1HPGA 3EA8A 1ZRKA 3F9HA 1SMFE 3BSQA 1F0RA 1O2VA 1KXAA 1AVWA 5C1XA 3RXHA 5EPYA 5C67A 1XUFA 1ARCA 1TPAE 3UR9A 1DLEA 1SGTA 1YKTA 2HALA 1GBDA 1W0YH 4FU8A 1NESE 1G3EA 3MMGA 1JRSA 3E91A 4NCYA 2Q6GA 3PMJA 3VGCB 2P94A 3TPIZ 4Y71A 3UOPA 4Y8YA 1P04A 1C2LA 1FN8A 1DLKB 4DG4A 1QFKH 4IBLH 1HAGE 1RIWC 5JB8S 3H5CB 4YT6H 1W11U 3ZYDA 2NU1E 4NIVA 4GCHG 1JIRA 3EAJA 3M7QA 2FOAA 3D23A 1BZXE 1GJ8B 1VJAU 1ELDE 4DOQA 2FYQA 2UUYA 3OU0A 3PV2A 2HNTE 4TY6A 2UUKB 1DVAH 2A5IA 1V2LT 2ZQ2A 3D65E 1TFXA 3PLBA 1EZSC 3ZZDA 3BEIB 1B0FA 2R0KA 2UUFB 4X1SU 1EKBB 4X1RU 3VEQB 3S9BA 4K3JA 3KHVA 5A8XA 4ABEA 1BTZA 1UCYH 1P9UA 2Q6FA 3MWIU 5EG4A 1SGFA 1AZ8A 1YPKH 4THNH 1NZQH 1WYKA 3ZV8A 1LQDB 1C5NH 1DY9A 3UIRA 4TY7A 3PYHA 4WMEA 3MH5A 4ASHA 2ZFRH 1V2PT 1Q3XA 1V3XA 4LZ4B 1C1UH 1AVXA 2XWBI 5E0JA 2WUCA 4I8KA 3K2UA 1QY6A 2P95A 4A7IB 1XXDA 2WPJS 2XBVA 1HJAC 4X8UH 2GD4B 2CXVA 3H7OA 1TNGA 1MD8A 3A89A 1HXEH 1MCTA 1O5CB 2OQUA 3Q00A 3LGWA 1O3KA 2EI6A 3H09A 1QTFA 2SGDE 5ESTE 1TGBA 1C1VH 2A45B 4B76A 1GI4A 1WSSH 1CA0C 1GGDB 1Z6JH 3NUMA 2VGCC 7GCHF 2ASUB 3QLPH 2QF3A 3HPTB 1SB1H 1NS3A 2Y6TA 1P2QA 4E7NA 1GHVH 1VCPA 2AS9A 3SU1A 2CV3A 4INKA 2WV4A 1ZPZA 1IQJA 3F6UH 2QAAA 2STAE 2STBE 4R8TB 1EAXA 3TJUA 5HYOA 2OXSA 1ETSH 2W7UA 1A5IA 1MTNC 1GHXH 3ATIA 4ABHA 2BD5A 2V3OH 1WTHD 1AWHB 4RSPA 1NRPH 3SORA 2VGCB 5FBIA 1IQFA 2J94A 3MNCA 3URDA 4CH8B 2AIPA 4JCNA 1SFQB 1TQ7B 2IN2A 1UMAH 2BDYA 3VB4A 1O37A 6LPRA 2PKAA 5DP4A 2Z9JA 1O0DH 4B73A 1E38B 2WPKS 2BDGA 4U30A 1TMTH 4XSKU 5FPSA 1EX3A 2WHXA 3QGJA 1PFXC 1V6DA 2XBXA 1MH0A 1OX1A 3F68H 1P11E 1CQQA 3SU5A 1H9HE 3FZDA 4B6FA 1N1LA 2BY8X 2Z9LA 1O32A 1H9IE 1DSTA 5ETXA 1GVZA 3VXFH 3N7OA 3TK5A 4D8NA 3SU0A 4CBOA 1Y5UT 1AE5A 1WAYB 2K1QA 3EE0B 4KTUA 2Z9KA 4DW2U 2BMGB 1AMHA 5A0BA 1AWFH 2TBSA 4FUHA 4WVPE 1C5LH 4FUCA 4AGJA 1SGCA 3GOVB 3RXEA 2BOHB 1XUHA 1CHGA 1SLUB 4BANB 2F83A 1CHOF 1QL8A 1EZQA 3FP7E 4IW4E 1TMBH 1OYTH 2ZGBH 3VB3A 1GBKA 2A4QA 2GT8A 4I8GA 1YBWA 4OS6A 2FX4A 2NWNA 3ODDA 2Y81A 2OINA 4CR9A 1PQAA 1YYY1 2ANMH 5F03A 1DANH 1D3QB 1GMDG 2F9UA 4YZUA 1DWDH 4CRBA 4NFEA 6GCHG 1C2KA 2DE8A 4DJZB 4Y76A 1GI3A 4MTBA 2LNCA 3V13A 4LK4A 4AFSA 4AG2A 3ZZAA 1O2UA 5FCRA 3GCTG 3OYPA 1S84A 1C1RA 2SNWA 3RXTA 1SGEE 2P3FH 1AE8H 1ELCA 2V0BA 5F8XA 2RDLA 1XKBC 3A86A 1TPOA 4GLYA 1EP6A 3H7TA 1O2QA 3RLYH 1SBWA 1SC8U 2DUCA 1TPPA 2D2DA 4MNYA 3F1SB 3F9FA 4WMDA 3KN2A 1W14U 2G51A 3O8CA 3RXSA 4LXBH 4FXGH 4WH6A 1GBCA 1MKWH 2VH0A 4B2BA 4CRGA 3GY6A 5TJXA 2OTVA 1GBLA 3U98H 3SO3A 2I6SA 1BRUP 3R3GB 4INLA 5C20A 1HJ8A 2VIQA 3MH7A 2ZGJA 1E34B 2XTTB 1Y59T 9ESTA 4AGKA 2FYRA 1LVMA 5A8ZA 4CHAC 1GVKB 2C4FH 2VH6A 5DP5A 2G8TA 2GX4A 3EA7A 1G36A 1BA8B 1NT1A 1W12U 1HAVB 3BTDE 2VJ1A 2LPRA 1P3CA 1TX6A 4ABGA 3SZNA 4AN7A 2SGEE 2ZFSA 3V12A 1QBNA 2F9PA 2BY9X 2B5TB 2RA3A 3CENA 1EZUC 4CBNA 1KTSB 3V0XA 1C5ZB 4BXSA 1SPJA 1EPTA 2FI3E 1YP9A 2BXTH 2A7JA 1RTFB 2Y7ZA 1UHBA 5A2MH 1O2NA 4TWWA 1O2HA 3RXDA 4GAWA 2XC0A 3T27A 3VFEA 1CO7E 4O97A 1AUJA 1ZZZA 3P95A 3QK1A 3JZ1B 1DOJA 2TPIZ 1GI5A 2FIRH 8LPRA 1NM6A 2Z6BD 4AYYB 3MOCA 5I46H 1SL3A 2TGDA 1DUEA 1P05A 2F9BH 2R3UA 2FOBA 4JYUH 3CS7A 3LGIA 1DFPA 3A83A 1V2UT 1MBMA 1O5FH 4H6TA 3SGBE 4X0WU 1ZRBA 1GJBB 2ZTYA 1C9TA 3AASA 1OPHB 2H1UA 4X2XA 2OC8A 2VWNA 1Y3VA 1GJAB 2A0QB 2VVCA 1AB9C 2VVVA 1K22H 1D4PB 5A8YA 1TLDA 3K6ZA 2FTLE 1TOCB 1THRH 5C5OA 2QC2A 1DWBH 1C5QA 2WYJA 1RIWB 3RXVA 1T31A 4O3UA 1P09A 3LT3A 1SQAA 3MFJA 1ZSJA 1V2OT 2WV5A 1RRKA 2THFB 1C1PA 1OXGA 2B0FA 1O2SA 5EODA 3LC5A 3LGYA 4JZ1A 4QT8C 3BEFB 2ZU2A 1YPEH 1KDQB 3SJOA 1HNEE 4ISNA 1EPTC 2ZTXA 3OY5U 1V2TT 1GJ4H 5F8ZA 1FDPA 2P3TB 4XBDA 5E2PA 5EW2H 1O5GH 1NFYA 3ESTA 3RM0H 3P70B 1BJUA 2A1DB 1WUNH 2QA9E 1C2IA 1UO6A 4J1YA 3LGVA 2BOKA 1LKBA 2FXRA 1D9IA 4FVBA 1P2IA 3DD2H 1XM1A 1GHWH 4Z6AH 2A7HA 3LIWA 1C5PA 5AVDA 1HLTH 3BTGE 1ZTKA 4H6SB 1NPMA 3UWJH 1O30A 2GZ9A 3SI3H 3PV5A 2FESH 1O3GA 3MO6A 3GICB 1YLDA 1S83A 1RTLA 3AAUA 1VGCC 1D3DB 1NRNH 1F5LA 1ZHPA 4IGDA 1TNIA 2V6NA 2TRMA 5E0HA 1NU7B 1LVOA 1AB9B 1OOKB 1LVYA 4D9QA 2GDDA 3A7VA 3AK5A 2P16A 5CHAB 4E05H 2GCTB 5ABWA 1CU1A 4K60A 3SJ8A 4NA8A 1OSSA 3A85A 1G3CA 2PGBB 1GBEA 1P2KA 1O5AB 1O3HA 1Z71A 1L4DA 1Q31A 1Y3XA 4HTCH 3FP8E 1AGJA 3B23B 1O39A 4NA9H 1K1PA 1SFIA 3UR6A 4CH2B 5L2YH 1PPBH 2ZGCA 3PLKA 1IQKA 2WUBA 3EQ0H 4DY7B 5AF9H 1ETRH 4JYVH 3ZZ9A 4HGCA 2ZPSA 3SJIA 1C1QA 2EEKA 2H9HA 4ABBA 1SLXB 4Q2KA 1GBIA 1O38A 1TBZH 3MU5A 3M3VA 2ODYB 1GWAA 2ANYA 4CR5A 1V2JT 1ESBA 4GSOA 4FUBA 5E0GA 1HDTH 2ANKH 4BTUB 1TGCA 4FU9A 3RXUA 1PPEE 1A0HB 1BUIA 2BZAA 2CHAC 1B5GH 3KEEA 4XBBA 1TBQH 1EASA 5J4SA 1Z8JB 2NU4E 3RXLA 3TJVA 4U2WA 2CF9H 1EQ9A 1DWEH 2Y80A 1E36B 3QGNB 2HPQH 2A4GA 2JH6D 2CJIA 3QTOH 4GVUA 4Y7BA 1C1SA 2BXUH 4K69A 1GBAA 1O3OA 1MZAA 1CVWH 1FXYA 2W3IA 2BD2A 2PTNA 1V2KT 4WJG2 4Y0YE 1SGYE 2F9OA 1C4U2 4HZHA 1C2DA 3KQEA 1GBBA 3TNTA 2GV6A 3BN9A 3GY3A 3SV9A 1FIWA 1SR5C 1NFWA 2ZFQH 3BEUA 3F9GA 3UREA 2J2UA 1THSH 4A1XA 4H4FA 4D76A 1FPHH 3C27B 1EOJA 2Q1JA 1ELTA 5L2ZH 2P8OB 1PYTD 3MU1A 1P02A 1V2QT 2BLQA 1S81A 2FM2A 3SUFA 1JBUH 4A6LA 5FX5A 2GKVE 5JPMH 1LO6A 2ZDVH 1HBTH 2VIDA 4A1VA 1TQ0B 3SNCA 2Y5GA 1MU6B 1V2WT 1F7ZA 5L30H 1YPLH 1OWEA 1QR3E 3S7KB 1XMNB 3SU3A 2VWLA 2P8OC 5EQRA 5L6NH 3KL6A 1TONA 5GJ4B 5FX6A 2ZPQA 2FMJA 5DK1A 1MKXH 1MKWK 1TB6H 3STJA 2BD7A 3W95A 4Z0KA 1H9LB 1C2MA 1ORFA 1F92A 1GJ7B 1TX7A 5T6DA 1T8MA 3KCGH 4XFQA 3ZZ3A 3CS0A 3DFLA 3SYJA 2OP9A 2TGPZ 2ZIQH 1GCDA 1V2MT 2FX6A 1P03A 1MU8B 1W2KH 5HGGA 1TNHA 1M9UA 1QURH 3RXGA 3TJOA 4YOIA 2WV9A 3RU4T 3MYWA 2VBCA 2AGEX 2BYAX 5FPYA 4FUFA 3A88A 2AFQB 1N8OB 1GMDF 3SU4A 1KXFA 5C1YA 1P12E 3HK3B 3GYMA 4OGYA 5A09A 1XUGA 2VNTA 5DP6A 4YOGA 1ELBA 4O03A 5J4QA 1NY22 1X7AC 3K9XB 3BTTE 1ZTLA 3VGCC 5TCAA 3GDUA 1O3FA 1MAYA 3TNSA 3RUOA 1TNJA 7ESTE 3ATMA 1SGPE 1T32A 1TWXB 1WQSA 1ZSKA 1C4Y2 1ZGVA 1WV7H 1TE0A 1BDAA 3RU4E 2EA3A 4NG9H 1SHYA 1HGTH 1L0ZA 4YM9A 1YF4A 4M7GA 1P06A 2A32A 5JBCS 5T1VA 1ZSLA 1NFUA 1C5WB 5T6FA 1QRWA 1SG8B 2GDEH 1HAIH 1A1RA 3NPSA 3BTWE 6ESTA 4B6EA 1OWDA 1QGFA 4JYTA 3QDZB 1H8DH 5B6LA 3TGKE 3DA9B 4XBCA 1AFQB 1Z8IB 5AFYH 3DUXH 2O9QA 3BTME 1LPZB 2WPMS 3O8BA 2FOGA 1P2MA 3TJNA 1JWTA 1HAHH 2BDBA 5EXMA 1P8VC 2YOLA 4R0IA 4NIWA 3GYLB 1HAOH 1J9CH 1FV9A 1HRTH 2PKSC 3ZVBA 1JXPA 1O3IA 1ID5H 4YO9A 1C4V2 4RKOB 3A7ZA 5EOKA 1P9SA 5HXFA 6GCHF 8GCHG 1TA6A 1Y3UA 3U1IB 1D6RA 2FLRH 1BIOA 1O5BB 1ESAA 2IJD1 3ATKA 3KGPA 5BRRE 7GCHG 3M7UA 1YCPH 1GMCG 1KLJH 2JETC 3UNQA 1K1NA 2Q6DA 1QA7A 2ZGXH 5FXLA 2R3YA 5DJ7A 2HRVA 1PYTC 2AEIH 2UWLA 3BTEE 1LHCH 2P3UB 3PLPA 3OY6U 1A0JA 3TIUA 4HFPB 1QA0A 5I25A 2GV7A 2DE9A 2OBOA 5EQQA 1TA2A 1VITH 4BTIB 2VIOA 2Z9IA 3OTPA 4ISLA 1LDTT 1MKXK 5DPAA 1OS8A 3PMBB 4K1SA 4MNVA 2XCNA 3BTKE 3RXMA 1O2LA 1TRNA 1DDJA 2Z3EA 1ZGIA 4MG3A 1BRBE 1A3BH 2EI8A 4A5TS 4WXIA 1K2I1 2UWPA 3W94A 4BAMB 3PWBA 4MNWA 2HGTH 1SLVB 3TH2H 4CHAB 5LPRA 2ZEBA 2SNVA 2XBWA 3M61U 1BHXB 4NWKA 3M5LA 1GL0E 4UFDH 2H5CA 4MPVA 3IWMA 3GDSA 1J16A 3M3SA 3PB1E 4H42U 4OM9A 4D7GA 3MNSA 4FVDA 4I8JA 2M5TA 3RMLH 2BDCA 1GI6A 1AY6H 5GXPA 4K2YA 5GCHF 2ZDMA 2ZP0H 2W7SA 4B74A 2FOFA 2QV1A 1T7CA 2VIVA 1VCWA 1BTPA 2GCHF 1C1NA 2R2WU 1SVPA 3MO3A 4RN6A 3SUDA 1P3EA 1F0UA 1SGRE 4ZKOU 2ZU1A 2ZZUH 2RCEA 1SGFG 1K1LA 3JZ2B 2V3HH 3TGJE 4YLUA 5JB9S 2PUXB 1HAXB 1O5EH 1T8NA 1PPCE 4AOQA 3FANA 1TBRH 1P01A 1KXCA 1RXPA 3GY4A 1KXDA 4Q7XA 1E0FD 1ABJH 1P0SH 1A5GH 1HB0B 2ZA5A 1OP0A 1FAXA 1TMUH 4YLQH 1SOTA 3R0FA 1O36A 4BAQB 3ODFA 1A4WH 4ISHH 5DG6A 3ZZCA 4KTCA 1K1MA 4UEHH 1KDQA 1FQ3A 1B7XB 1HAYB 4O9VA 4ABIA 1O31A 3Q3KA 5JYIA 3MU4A 5DP9A 1BTXA 3RXAA 2SGFE 2ZU4A 2OK5A 3SUEA 1F0TA 2PKAB 3QO6A 1UTLM 2CN0H 1LVBA 3PMAB 5FAHA 2GTBA 4K1TA 1OKXA 1CSOE 1RFNA 2ULLA 3RXRA 4AFZA 1BTWA 5EPNA 1Z1IA 2XRCA 5LH8A 1UVTH 1AI8H 3RXPA 1NN6A 1GI1A 3DFJA 1GVLA 4M9FA 3SU6A 1EXFA 1CA0B 1GGDC 2SGPE 3GCTF 3U8TH 2UUJB 1BMLA 2TGAA 4YTAA 5C2ZA 3K65B 1KTTB 3S7HB 3TGIE 1VCQA 4Y6DA 3SOSA 3UPEA 1QIXB 4NIXA 3SGAE 2FLBH 1IQHA 1ELVA 5HM2A 1CBWC 2BX4A 2BX3A 3HK6B 2G4UA 2QXHA 1J14A 2AIQA 1Z8GA 4ISIH 5F6MA 1J17T 1BHXF 3HGNA 3P8OA 2VB0A 2BDIA 1C1WH 2A2QH 1V2VT 2A5KA 1CT2E 3SJ9A 3I77A 3KQCA 1DY8A 2PFEA 2ZFFH 3LJJA 1SQTA 1QJ6B 3PROA 1SHHB 2C90B 3KQDA 1RJXB 4X8VH 3SV8A 1UHBB 2HPPH 2BD9A 1GHBF 5FBEA 2QN5T 3MO9A 4CRCA 2H9EH 2Z94A 1G32B 3HATH 4YESB 1BITA 2P59A 4I8LA 5EQSA 2GVFA 3D49H 1PQ8A 3LOXA 1UK3A 1UVUH 3EGKH 2FZZA 5GDSH 1O3JA 3MNBA 3RMMH 3E8LA 5DGJA 1MTNB 3TLOA 3PTBA 3E90B 3T2NA 1WXRA 1JRTA 1K28D 4NFFA 1O3LA 4WF8A 5EGMA 1T8OA 4X1NU 2ZDNA 3Q3XA 4I31A 1PPGE 5FCKA 3DT0H 3ENSB 2IJOB 2A4RA 4INHA 1ANDA 4IN1A 3F9EA 4CRAA 1MBQA 3MNXA 1ZHRA 4GPGA 2FOCA 1NU9A 1O3DA 1L4ZA 4UFGH 1FI8A 2XBYA 5CHAC 1O2MA 4B2AA 3ZZ6A 3UOUA 1GMHF 3BG4C 5LGOA 1GG6C 5TCCA 4ABJA 3GY2A 3IG6B 4B71A 3HGPA 1FN6A 1W3CA 1Y8TA 1D3TB 4AB9A 5GPIB 3SNAA 1EOLA 4X1QU 6CHAB 1QBVH 4OGXA 3NK8A 5DP7A 1DITH 2GCHG 2G00A 3M3TA 4GHTA 3B9FH 1DS2E 2ZI2H 3MHWU 4AG1A 4UE7H 1F5RA 1GCTC 3SNBA 4OS1A 1RGQA 4FUDA 3C1KA 2ZU3A 1ANBA 1MQ6A 4UD9H 5IDKA 3A84A 3BV9B 1BRCE 3PMHB 3AVZA 3O8RA 4F49A 3TU7H 1K21H 2R9PA 1G30B 1IQMA 1K1OA 2XWAA 3BTHE 4WXVA 2AMDA 1IHSH 2ZHEH 1QRXA 2WPIS 3A8DA 1BMMH 1GCTB 2R2MB 3S9AA 2FOMB 2BVSH 3RXBA 3TK6A 3UFAA 2OC1A 4X6OA 1QB1A 1GJCB 1KY9A 1MTWA 5JDUB 2GP9B 4MQAA 1LTOA 3ZVCA 1ELAA 3UQVA 1P10A 1L1JA 3NXPA 4K5ZA 1OWJA 2NU2E 5SGAE 1O2ZA 2BD4A 4BOHA 3RDZA 1MTUA 2ZDLA 5C5NA 3KF2A 1WU1A 1O34A 3GY8A 3L3TA 1HJ9A 1YM0A 3PWCA 3LPRA 1ELGA 2AERH 4E06H 4I33A 4VGCC 1G2LA 3VB6A 1TGSZ 5GNDA 1GJ9B 1C2EA 2PV9B 1YPHC 1GBHA 1TNKA 1KYNA 1O33A 2G81E 3QZQA 1O3NA 2B9LA 2SFAA 1W13U 1QCPA 4KP0A 3ZZBA 2BLOA 1P2OA 2H5DA 4E7RG 3SU2A 1JOUB 2AGIX 4IN2A 1NO9H 1O2GH 1H4WA 1A0LA 5JBTA 3A87A 1AHTH 2D8WA 2O8WA 1C2FA 1P2NA 3M36A 1GI7B 4OS2A 4WH8A 4WWYA 4OS5A 3SNEA 1NTPA 1IHTH 1FPCH 4K8YA 4Y79A 4D7FA 3T28A 5DO4H 4BAOB 1TRMA 3UTUH 5JBBS 5FPTA 3SN8A 3RM2H 1W7GH 2CGAA 1XUIA 2G5NA 1VZQH 1C5TA 5EU8A 1QJ1B 1LHFH 3E0PB 4ZHMU 2XC5A 5CE1A 2FOHA 4WY3A 1U6QA 1ZR0A 2FS9A 3UNSA 2AGGX 4Q7YA 3PO1B 1C5VA 3SZEA 1DWCH 3ZVGA 2ESTE 3LGUA 4UDWH 1G3DA 2J4IA 1O5DH 4TWYA 1SSXA 1DXWA 1O2XA 3RC5A 3PV4A 1WQVH 3A8AA 1O3CA 1G37A 1O2WA 5T3HA 2PW8H 8ESTE 4IMQA 1QB6A 1YCPM 3TVJB 2QYIA 3MTYA 1TOMH 5E8EH 1YPHE 4ZROA 2OLGA 1BQYA 4GUXA 3GCNA 3BG8A 2H2ZA 4F4OC 1MUEB 3ATLA 1QBOA 2CMYA 3RC6A 3UNRA 1EB2A 2BB4A 2W26A 3B8JA 1BB0B 1CGJE 2BVRH 2OCVB 4NIYA 2ZPRA 4ABFA 2OUAA 1ZMLA 3QTVH 3BTQE 1EAUA 1GDUA 1SQOA 1BCUH 1DM4B 1A7SA 8KME2 1G3BA 5FHTA 1LHEH 4OS7A 3T62A 1QQUA 4MPUA 4DURA 1LHGH 1FONA 2BHGA 2BD3A 4JK6A 4NSYA 2J38A 3FAOA 4DCDA 1N6YA 4ZUHA 2ZC9H 2AMPA 4X8SH 1A5HA 3OSYA 5DP8A 4AZ2B 1KLTA 1YC0A 2FODA 3ZVEA 2BQ6B 2KAIB 3A7TA 3RP2A 1PPZA 2KAIA 4NGAH 3SHCH 3RXKA 4IC5A 4OS4A 2FTMA 1FY8E 2JETB 1FY3A 5HM9A 2R0LA 1BBRH 3LU9B 1GJDB 1IAUA 2ZCHP 2YNAA 1L1NA 1O2YA 1F5KU 2PGQB 1AQ7A 1SI5H 1HXFH 3UY9A 3E3TA 1O3AA 4FUEA 1WTGH 3A80A 1UCYE 1UTNA 3DHKH 4NWLA 3CP7A 4B1TA 5GIBA 1HUTH 2PWXA 3QX5H 1ANCA 1DT2A 2Z3DA 3I29A 2VWOA 1XUJA 1EATA 1CA8B 3GDVA 3Q76A 2HOBA 1UTJA 4ABDA 2HWLB 4MDSA 2QXJA 3ATWA 3SV6A 5AFZH 3RXJA 2GZ7A 4J2YB 1GBJA 1RD3B 4AB8A 2GMTB 1MMJN 1D6WA 3RXOA 5LPFA 2ALPA 1GMCF 2ILNA 2ZFPH 2VIWA 5F8TA 4A92A 4A1TA 4Q80A 1KXBA 4HI3A 3TH4H 2A31A 1N8OC 1Y3YA 3OTJE 5GWZA 1AZZA 5GCHG 2J92A 3GY5A 1NRQH 1W8BH 4CRFA 3LJOA 1GMHG 1UK4A 1CGIE 1ZPBA 2BY5X 2Y5HA 4DT7B 3LONA 3AW1A 3T5FH 3MU0A 4AFUA 3SV7A 1AD8H 1GG6B 1ELEE 1XUKA 1K9OE 1Y5AT 1SGQE 4K8BA 1VJ9U 1W0ZU 2Y7XA 3A8BA 1AFEH 1UVPA 2ODQA 1TGNA 3AW0A 1YCPK 4KELA 1S0RA 2A7CA 1TAWA 1AIXH 3V7TA 4ISOA 3SI4H 2ZECA 3GISB 1DUAA 4MPXA 1CT0E 1ZMJA 4JMYA 3BIUH 4KTSA 1E37B 2AH4X 2B8OH 1GHZA 5BPEA 1LCYA 1G9IE 3ZZ7A 4BTTB 4NZQA 1EUFA 1VITG 1P57B 2AYWA 4LZ1H 1EJNA 2ZHQH 3O8DA 1YLCA 9LPRA 1GI0A 4ZH8A 1JIMA 4MVNA 2PSXA 1C1MA 2ZHDA 2WZQA 1F0SA 1VITF 1IQIA 3V3MA 1LHDH 3PO1C 2FPZA 1EJAA 4I32A 1OP2A 1V2RT 2VINA 2FP7B 1ANEA 1FJSA 3L6PA 4X1PU 1IOEA 1TYNA 3A8CA 2ZNKH 4FUJA 4K1EA 1UTMA 2FS8A 1GHBG 3I78A 1S6FA 2ZHWH 2BVXH 1DX5M 3E0NB 3M35A 3MH4A 1O3BA 1ZPCA 2GT7A 2CF8H 1Y5BT 2J34A 3VB5A 3P8NA 1HAPH 1F2SE 2TIOA 3RLWH 4YT7H 4ZXXH 1QL7A 1LKAA 4GCHF 3ZZ5A 1BMAA 4IMZA 1CT4E 2A5AA 1ARBA 3T25A 3ZVAA 1QNJA 1T8LA 4ABAA 4B75A 4BAKB 4IC6A 1XKAC 1VR1H 3GY7A 4X6MA 1UTQA 2ZU5A 2UWOA 3A81A 2FWWA 3UQOA 1Z8RA 2OBQA 3ELAH 4KGAA 4BAHB 4I7YH 1QB9A 1V2ST 4ZAEA 3AAVA 1IQLA 1TPSA 1ZYOA 3LDXH 1E35B 2C8ZB 2FEQH 1ESTA 1FY5A 2NU3E 2TGTA 5G4BA 5A0AE 3RU4D 3STIA 1C5SA 2W5EA 2RA0A 1GJ6A 4KKDA 2HLCA 1KSNA 3ZV9A 1SGNE 1EAWA 4IS5A 2PSYA 4ZXYH 1YGCH 3M5OA 4Y8ZA 4ZMAH 1EAIA 5DP3A 1V2NT 2F91A 3SW2B 2ZCKP 2HNTF 1GI2A 1QRZA 3ZYEA 1ZOMA 4Y11E 1O2PA 4FUGA 5EXNA 3BTFE 1ZHMA 4DVAU 3FVFB 3MI4A 1K1IA 1W7XH 3MH6A 2XCFA 1O2JA 5K7RA 1GBFA 4RI0A 3E16B 2XW9A 4BXWA 2ZWLH 3Q3YA 2G5VA 1WOFA 1NRRH 3LH3A 3QUMP 2BLWA 2O8UA 1GI8B 5E2OA 1TX8A 2J95A 2CHAB 1EPTB 1YPGH 2BY7X 2ZKSA 4UFEH 2O8MA 1ZJKA 3NCLA 2PR3A 4DIIH 2OQ5A 3SQEE 2OC0A 2PLXA 4DIHH 1DPOA 2P93A 4JZEH 2F9NA 4O3TA 1OWKA 1A61H 2BQ7B 2WPLS 3FZZA 1FZZA 1TRYA 4X6NA 3HKIB 5IYTA 4JZFH 1MAXA 1H8IH 1LQEA 3QN7A 3VPKA 2H9TH 2XXLA 3E6PH 2PUQH 3RXIA 2JH0D 4MNXA 1O3PB 2QY0B 2BD8A 3LH1A 3GCOA 1BTYA 1HIAA 3L33A 2VVUA 2FDAA 1EB1H 4X6PA 1C1OA 3A7YA 3GCHB 1C5UA 2G4TA 1PQ5A 3ZZ4A 1QL9A 1S0QA 2C8YB 5C1UA 4CREA 2BQWB 3U9AH 4SGBE 4Y0ZE 4X2VA 4AX9H 1OP8A 1MCVA 4MLFB 2A2XH 3RMOH 2F4LA 4TYDA 1O2RA 2ANWA 1B0EA 1S82A 3URCA 4LOYH 1K1JA 1HAZB 1TABE 1GI9B 4XE4A 5PTPA 2VIPA 1G2MA 1C1TA 2BM2A 2Z7FE 1PQ7A 1UK2A 1ZLRA 1THPB 8GCHF 3EYDA 2Y82A 1FY4A 1LMWB 2AMQA 1CBWB 1ZMNA 1GDQA 2WPHS 1S5SA 1Q2WA 1FNIA 2ZHFH 1INCA 3FFGA 2PTCE 1UTKA 2O8LA 4SGAE 1HYLA 3Q77A 2Y5FA 1RS0A 1O2KA 2V35A 3TH3H 4BNRA 4FUIA 1NROH 4Q7ZA 3P92A 5DKMA 1UTPA 1FUJA 2C8XB 1BBRK 1KIGH 2C3SA 2FI4E 4ZKNU 3ZVDA 2QIQA 3SHAH 3K6YA 1MD7A 1DSUA 1LPGB 1TALA 3PM3A 1XX9A 1FLEE 4NZLA 1WCZA 3S0NA 2F3CE 3A7XA 3P8GA 3VXEH 2HNTC 2VWMA 4WMFA 1NC6A 1Z1JA 5H4IB 2ZQ1A 1AO5A 1GBMA 3MU8A 3P17H 4GHQA 1UVSH 4I8HA 3RMNH 5A0CA 1HV7A 1YPMH 3D62A 1J15A 3TK9A 3NZIA 1IQEA 3PTNA 4U01A 4PROA 4XDEA 3P8FA 3M5MA 1O2TA 1CE5A 1S6HA 4AYVB 3HKJB 1FMGA 2SGAA 4YOJA 2ZDAH 1JMOH 4TPIZ 4VGCB 1C2HA 4JK5A 1UJ1A 5T6GA 7LPRA 2BDAA 1N6XA 2ZG0H 3SNDA 1EZXC 3VB7A 1J8AA 2VU8E 2OC7A 1NFXA 1VGCB 3RXQA 1DE7H 1MQ5A 1CHOG 1C9PA 3A7WA 2EC9H 1O2OA 2D1JA 2GMTC 2QGRA 2ZCLP 1MTVA 2ZF0H 4CRDA 1BJVA 1O3MA 1AVGH 1GPZA 2IPHA 1BTUA 4JZDH 2ZGHA 2BLVA 1XVMA 1P2JA 2FI5E 1A2CH 2ZO3H 1T4VH 2SGQE 3KIDU 1AUTC 1C5XB 1QHRB 1GJ5H 4ZKRU 1W10U 1SGIB 1AKSB 2EI7A 1ELFA 1XXFA 2BY6X 2ZTZA 2BDHA 2RG3A 1BOQA 2QCYA 3ZVFA 1MZDA 2ODPA 3T29A 2GGVB 2NU0E 1ABIH 1PPFE 1DICA 1S85A 3LGTA 1HAVA 1H1BA 1TIOA 1L1GA 4X8TH 1KXEA 1WBGB 2BZ6H 1RTKA 4XOJA 1GHAG 1CGHA 1TNLA 3U69H 4B2CA 1AN1E 3S9CA 2QXGA 1IQNA 3LKWA 1EJMA 3SUGA 2FO9A 1OYQA 4ZHLU 1C2GA 1OWHA 3EDXB 3M7TA 4AFQA 1YPJH 4JZIA 4ZHAA 1PPHE 2GZ8A 1C5MD 1SOZA 3E1XB 1XVOA 3UWIA 4U32A 3S69A 3WY8A 3NKKA 2B7DH 5C3NA 4Y7AA 1BBRE 5LPEA 1Y3WA 1BT7A 2YNBA 1MTSA 1HCGA 2F9VA 1O2IA 3OX7U 2BTCE 2WINI 1T4UH 3GCHC 2ZDKA 2O8TA 2PHBA 3QZRA 3QWCH 4D9RA 3A82A 1HJAB 3BIVH 2JKHA 3FP6E 3SBKA 3SQHE 1IQGA 4NA7A 1EP5A 1UVOA 5AHGH 3SGQE 1UCYK 5K0HA 5HMAA 1ZTJA 1C5YB 1FAKH 2PKSB 4ZKSU 2HVXA 1DXPA 3EA9A 3U8OH 1Z7KA 5CMXH 2C8WB 2J9NA 3SJKA 1SLWB 2I6QA 1L2EA 4TPYA 1BTHH 1GHAF 1LPKB 4NSVA 1BRAA 2D26C 3M37A 4X2YA 1TGTA 2QF0A 1AFQC 1O3EA 3P6ZB 1A3EH 4Y8XA 1AU8A 3TITA 4UFFH 3KNXA 3U8RH 2IOTA 1HFDA 1C2JA 3M5NA 3RC4A 4X2WA 1ACBE 2OD3B 1GHYH 3RXCA 5ESBA 2W3KA 2C93B 3IITA 1BMNH 1UTOA 1QQ4A 2QXIA 1HIAB 3G01A 2G52A 2ZFTA 2Z9GA 2Z3CA 5JBAS 1A46H 1FIZA 2A4OA 6CHAC 2XYAA 3BF6H 1KLIH 1SGDE 1ZJDA 2WYGA 1GL1A 2G55A 5EXLA
chains in the Genus database with same CATH superfamily
1AKSA 2QF4A 4FU7A 3SV2H 2XC4A 3BG4B 3T26A 1OWIA 2FOEA 2M2AA 5B6OA 1FY1A 1GDNA 1BMFD 1C5RA 3NWUA 1Z6EA 5EW1H 1ETTH 3ITIA 3UUZA 1D3PB 2XNIA 2ALVA 4UONA 1NRSH 4DGJA 4RKJB 1O35A 7KMEH 4ESTE 1QJ7B 1PJPA 2H6MA 3RXFA 2JH5D 1C5OH 2GCTC 4Y10E 3U1JB 3KQBA 3LC3A 3ZZ8A 4AORA 1GBTA 4MPWA 1HPGA 3EA8A 1ZRKA 3F9HA 1SMFE 3BSQA 1F0RA 1O2VA 1KXAA 1AVWA 4F55A 3RXHA 5EPYA 5C1XA 5C67A 1XUFA 1ARCA 1TPAE 3UR9A 1DLEA 1SGTA 1YKTA 2HALA 1GBDA 1W0YH 4FU8A 1NESE 1G3EA 3MMGA 1JRSA 3E91A 4NCYA 2Q6GA 3PMJA 3VGCB 2L74A 2P94A 3TPIZ 4Y71A 3UOPA 4Y8YA 3PRBA 1P04A 1C2LA 1FN8A 1DLKB 4DG4A 5C94A 1QFKH 4IBLH 1HAGE 1RIWC 5JB8S 3H5CB 4YT6H 1W11U 3ZYDA 2NU1E 4NIVA 4GCHG 1JIRA 3EAJA 3M7QA 2FOAA 3D23A 1BZXE 1GJ8B 1VJAU 1ELDE 4DOQA 3DCLA 2FYQA 2UUYA 3OU0A 3PV2A 2HNTE 4TY6A 2UUKB 1DVAH 2A5IA 1V2LT 2ZQ2A 3D65E 1TFXA 3PLBA 1EZSC 3ZZDA 3BEIB 1B0FA 2R0KA 2UUFB 4X1SU 1EKBB 4X1RU 3VEQB 3S9BA 4K3JA 3KHVA 4ACBA 5A8XA 4ABEA 1BTZA 1UCYH 1P9UA 2JJ2D 2Q6FA 3MWIU 2JDID 5EG4A 1SGFA 5KGOA 1AZ8A 1YPKH 4THNH 1NZQH 1WYKA 3ZV8A 1LQDB 1C5NH 1DY9A 3UIRA 3ZIAD 4TY7A 2HVYB 3PYHA 4WMEA 3MH5A 5F53A 4ASHA 2ZFRH 1V2PT 1Q3XA 1V3XA 4LZ4B 1C1UH 1AVXA 2XWBI 5E0JA 2WUCA 4I8KA 3K2UA 1QY6A 2P95A 4A7IB 1XXDA 2WPJS 2XBVA 1HJAC 4X8UH 2GD4B 2CXVA 3H7OA 1TNGA 1MD8A 3A89A 1HXEH 1MCTA 4Z1MD 1O5CB 2OQUA 3Q00A 3LGWA 1O3KA 2EI6A 3H09A 1QTFA 2SGDE 5ESTE 4HG6A 4FOUC 1TGBA 1C1VH 2A45B 4B76A 1GI4A 1WSSH 1CA0C 1GGDB 1Z6JH 3NUMA 2VGCC 7GCHF 2ASUB 3QLPH 2QF3A 3HPTB 1SB1H 1NS3A 2Y6TA 1P2QA 4E7NA 1GHVH 1VCPA 2AS9A 3SU1A 2CV3A 4INKA 2WV4A 1ZPZA 1IQJA 3F6UH 2QAAA 2JIZD 2STAE 2STBE 4Q63A 4R8TB 1EAXA 4P00A 3TJUA 5HYOA 2OXSA 1ETSH 2W7UA 1A5IA 1MTNC 1GHXH 3ATIA 4ABHA 2BD5A 2V3OH 1WTHD 1AWHB 4RSPA 1NRPH 3SORA 2VGCB 5FBIA 1IQFA 2J94A 3KYGA 3MNCA 3URDA 4CH8B 2AIPA 4JCNA 1SFQB 1TQ7B 2IN2A 1UMAH 2BDYA 3VB4A 1O37A 6LPRA 2PKAA 5DP4A 2Z9JA 1O0DH 4B73A 1E38B 2WPKS 2BDGA 4U30A 1TMTH 4XSKU 5FPSA 4AC9A 1EX3A 2WHXA 3QGJA 1PFXC 1H8HD 2QE7D 1V6DA 2XBXA 1MH0A 1OX1A 3F68H 1P11E 2XNDD 1CQQA 3SU5A 1H9HE 3FZDA 4B6FA 1N1LA 2BY8X 2Z9LA 1O32A 1H9IE 1DSTA 5ETXA 1GVZA 3VXFH 3N7OA 3TK5A 4D8NA 3SU0A 4CBOA 1Y5UT 1AE5A 1WAYB 2K1QA 3EE0B 4KTUA 2Z9KA 4DW2U 2BMGB 1AMHA 5A0BA 1AWFH 3F0PA 2TBSA 4FUHA 4WVPE 1C5LH 4FUCA 4AGJA 1SGCA 3GOVB 3RXEA 2BOHB 1XUHA 1CHGA 1SLUB 4BANB 2F83A 1CHOF 1QL8A 1EZQA 3FP7E 4IW4E 1TMBH 1OYTH 2ZGBH 3VB3A 1GBKA 2A4QA 2GT8A 4I8GA 1YBWA 4OS6A 2FX4A 2NWNA 3ODDA 2Y81A 2OINA 4CR9A 1PQAA 1YYY1 2ANMH 5F03A 1DANH 1D3QB 1GMDG 2F9UA 4YZUA 1DWDH 4CRBA 4NFEA 6GCHG 1C2KA 1SKYE 2DE8A 4DJZB 4Y76A 1GI3A 3F0OA 4MTBA 2LNCA 3V13A 4LK4A 4AFSA 4AG2A 3ZZAA 1O2UA 5FCRA 3GCTG 3OYPA 1S84A 2K8IA 1C1RA 2SNWA 1VKYA 1SGEE 2P3FH 1AE8H 3RXTA 1ELCA 2V0BA 5F8XA 2RDLA 1XKBC 3A86A 2J97A 1TPOA 4GLYA 1EP6A 3H7TA 1O2QA 3RLYH 2W6ID 1SBWA 1SC8U 2DUCA 1UW7A 1TPPA 2D2DA 4MNYA 3F1SB 3F9FA 4WMDA 3KN2A 1W14U 2G51A 3O8CA 3RXSA 4LXBH 4FXGH 4WH6A 1GBCA 1MKWH 2VH0A 4B2BA 4CRGA 3GY6A 5TJXA 2OTVA 1OHHD 1GBLA 3U98H 3SO3A 2I6SA 1BRUP 3R3GB 4INLA 5C20A 1HJ8A 2J98A 2VIQA 3MH7A 2ZGJA 1E34B 2XTTB 1Y59T 9ESTA 4AGKA 2FYRA 1LVMA 5A8ZA 4CHAC 1GVKB 2C4FH 4ZCNA 2VH6A 5DP5A 2G8TA 2GX4A 3EA7A 1G36A 1BA8B 1NT1A 1W12U 1HAVB 3BTDE 2VJ1A 2LPRA 1P3CA 1TX6A 4ABGA 3SZNA 4AN7A 2SGEE 2ZFSA 3VG8A 3V12A 1QBNA 2F9PA 2BY9X 2KCYA 2B5TB 2RA3A 3CENA 1EZUC 4CBNA 1KTSB 3V0XA 1C5ZB 4BXSA 1SPJA 1EPTA 2FI3E 1YP9A 2BXTH 2A7JA 1RTFB 2Y7ZA 1UHBA 5A2MH 1O2NA 4TWWA 1O2HA 3RXDA 4GAWA 2XC0A 3PRDA 3T27A 3OE7D 3VFEA 1CO7E 4O97A 1AUJA 1ZZZA 3P95A 3QK1A 3JZ1B 4P02A 1DOJA 2KZ4A 2TPIZ 5KECA 1GI5A 2FIRH 8LPRA 1NM6A 2Z6BD 4AYYB 3MOCA 5I46H 1SL3A 2TGDA 1DUEA 1P05A 2F9BH 2R3UA 2FOBA 4JYUH 3CS7A 3LGIA 1DFPA 3A83A 1V2UT 1MBMA 1O5FH 4H6TA 3SGBE 4X0WU 1ZRBA 1GJBB 2ZTYA 1C9TA 3AASA 5C0UA 1OPHB 2H1UA 4X2XA 2OC8A 2VWNA 1Y3VA 1GJAB 2A0QB 2VVCA 1AB9C 2VVVA 1K22H 1D4PB 5A8YA 1TLDA 3K6ZA 2FTLE 1TOCB 1THRH 5C5OA 2QC2A 1DWBH 1C5QA 1NBME 1RIWB 2WYJA 2YMSD 3RXVA 1T31A 4O3UA 1P09A 3LT3A 1SQAA 3MFJA 1ZSJA 1V2OT 2WV5A 1RRKA 2THFB 1C1PA 1OXGA 2B0FA 1O2SA 5EODA 3LC5A 3LGYA 4JZ1A 4QT8C 3BEFB 2ZU2A 1YPEH 1KDQB 3SJOA 1HNEE 4TSFD 4ISNA 1EPTC 2ZTXA 3OY5U 1V2TT 1GJ4H 5F8ZA 1FDPA 2P3TB 4XBDA 5E2PA 5EW2H 1O5GH 1NFYA 3ESTA 3RM0H 5C17A 3P70B 1BJUA 2A1DB 4F48B 1WUNH 2QA9E 1C2IA 1UO6A 4J1YA 3LGVA 2BOKA 1YWUA 1LKBA 2FXRA 1D9IA 4FVBA 1P2IA 3CNRA 3DD2H 1XM1A 1GHWH 4Z6AH 2A7HA 3LIWA 1C5PA 5AVDA 1HLTH 3BTGE 1ZTKA 4H6SB 1NPMA 3UWJH 1O30A 2GZ9A 3SI3H 3PV5A 2FESH 1O3GA 3MO6A 3GICB 1YLDA 1S83A 3KYFA 1RTLA 3AAUA 1VGCC 1D3DB 1NRNH 1F5LA 1ZHPA 4IGDA 1TNIA 2V6NA 2TRMA 5E0HA 1NU7B 1LVOA 1AB9B 1OOKB 1LVYA 4D9QA 1COWD 2GDDA 3A7VA 3AK5A 2P16A 5CHAB 4E05H 2GCTB 5ABWA 1CU1A 4K60A 3SJ8A 2KCAA 4NA8A 1OSSA 3A85A 1G3CA 2PGBB 1GBEA 1P2KA 1O5AB 3NRLA 1O3HA 1Z71A 1L4DA 1Q31A 1Y3XA 4HTCH 3FP8E 1AGJA 3B23B 1O39A 4NA9H 1K1PA 1SFIA 3UR6A 4CH2B 5L2YH 1PPBH 2ZGCA 3PLKA 1IQKA 2WUBA 3EQ0H 4DY7B 5AF9H 1ETRH 4JYVH 3ZZ9A 4HGCA 2ZPSA 3SJIA 1C1QA 2EEKA 2H9HA 4ABBA 1SLXB 4Q2KA 1GBIA 1O38A 1TBZH 3MU5A 3M3VA 2ODYB 1GWAA 2ANYA 4CR5A 1V2JT 1ESBA 4GSOA 4FUBA 5E0GA 1HDTH 2ANKH 4BTUB 1TGCA 4FU9A 3RXUA 1PPEE 1A0HB 1BUIA 2BZAA 2CHAC 1B5GH 3KEEA 4XBBA 1TBQH 1EASA 5J4SA 1Z8JB 2NU4E 3RXLA 3TJVA 4U2WA 2CF9H 1EQ9A 1DWEH 2Y80A 1E36B 3QGNB 2HPQH 2A4GA 2JH6D 2CJIA 3QTOH 4GVUA 4Y7BA 1C1SA 2BXUH 4K69A 1GBAA 1O3OA 1MZAA 2AHME 1CVWH 1FXYA 2W3IA 2BD2A 2PTNA 1V2KT 4WJG2 4Y0YE 1SGYE 2F9OA 1C4U2 4HZHA 1C2DA 3KQEA 1GBBA 3TNTA 2CK3D 2GV6A 3BN9A 3GY3A 3SV9A 1FIWA 1SR5C 1NFWA 2ZFQH 3BEUA 3F9GA 3UREA 2J2UA 1THSH 4A1XA 4H4FA 4D76A 1FPHH 3C27B 1EOJA 2Q1JA 1W0KD 1ELTA 5L2ZH 2P8OB 1PYTD 3MU1A 1P02A 1V2QT 2BLQA 1S81A 2FM2A 3SUFA 1JBUH 4A6LA 5FX5A 2GKVE 5JPMH 1LO6A 2ZDVH 1HBTH 2VIDA 4A1VA 1TQ0B 3SNCA 2Y5GA 1MU6B 1V2WT 1F7ZA 5L30H 1YPLH 1OWEA 1QR3E 1E1QD 1XMNB 3S7KB 3SU3A 2VWLA 2P8OC 5EQRA 5L6NH 3KL6A 1TONA 5GJ4B 5FX6A 2ZPQA 2FMJA 5DK1A 1MKXH 1MKWK 1TB6H 3STJA 2BD7A 3W95A 4Z0KA 1H9LB 1C2MA 1ORFA 1F92A 3F2GA 1GJ7B 1TX7A 5T6DA 1T8MA 3KCGH 5EJ1A 4XFQA 3ZZ3A 3CS0A 3DFLA 3SYJA 2OP9A 2TGPZ 2ZIQH 1GCDA 1V2MT 2FX6A 1P03A 5HKKD 1MU8B 1W2KH 5HGGA 1TNHA 1M9UA 1QURH 3FN8A 3RXGA 3TJOA 4YOIA 2WV9A 3RU4T 3MYWA 2VBCA 2AGEX 2BYAX 5FPYA 2WPDD 4FUFA 3A88A 2AFQB 1N8OB 1GMDF 3SU4A 1KXFA 5C1YA 1P12E 3HK3B 3GYMA 4OGYA 3UB0A 5A09A 1XUGA 2VNTA 5DP6A 4YOGA 1ELBA 4O03A 5J4QA 1NY22 1X7AC 3K9XB 3BTTE 1ZTLA 3VGCC 5TCAA 3GDUA 1O3FA 1MAYA 3TNSA 1FX0B 1TNJA 3RUOA 7ESTE 3ATMA 1SGPE 1T32A 1TWXB 1WQSA 1ZSKA 1C4Y2 1ZGVA 1WV7H 1TE0A 1BDAA 5CDFE 3RU4E 2EA3A 4NG9H 1SHYA 1HGTH 1L0ZA 4YM9A 1YF4A 4M7GA 1P06A 2A32A 5EIYA 5JBCS 5T1VA 1ZSLA 1NFUA 1C5WB 5T6FA 1QRWA 1SG8B 2GDEH 1HAIH 1A1RA 3NPSA 3BTWE 4B6EA 6ESTA 1OWDA 1QGFA 4JYTA 3QDZB 1H8DH 5B6LA 3TGKE 3DA9B 4XBCA 1AFQB 5IK2D 1Z8IB 5AFYH 3DUXH 2O9QA 3BTME 1LPZB 2WPMS 3O8BA 2FOGA 1P2MA 2LELA 3TJNA 1JWTA 1HAHH 2BDBA 2V3MA 5EXMA 1P8VC 2YOLA 4R0IA 4NIWA 3GYLB 4RT0A 1HAOH 1J9CH 1FV9A 1HRTH 2PKSC 3ZVBA 1JXPA 1O3IA 1ID5H 4YO9A 1C4V2 4RKOB 5HIYA 3A7ZA 5EOKA 1P9SA 5HXFA 6GCHF 8GCHG 1TA6A 1Y3UA 3U1IB 1D6RA 2FLRH 1BIOA 1O5BB 1ESAA 2IJD1 3ATKA 3KGPA 5BRRE 7GCHG 3M7UA 1YCPH 1GMCG 1KLJH 2JETC 3UNQA 1K1NA 2Q6DA 1QA7A 2ZGXH 5FXLA 2R3YA 5DJ7A 2HRVA 1PYTC 2AEIH 2UWLA 3BTEE 1LHCH 1E79D 2P3UB 3PLPA 3OY6U 1S6LA 1A0JA 3TIUA 4HFPB 1QA0A 5I25A 2GV7A 2DE9A 2OBOA 5EQQA 1TA2A 1VITH 4BTIB 2VIOA 2Z9IA 3OTPA 4ISLA 1LDTT 1MKXK 5DPAA 1OS8A 3PMBB 4K1SA 4MNVA 2XCNA 3BTKE 3RXMA 1O2LA 1TRNA 1DDJA 2Z3EA 1ZGIA 4MG3A 1BRBE 1A3BH 2EI8A 4A5TS 4WXIA 2LP6A 1K2I1 2UWPA 3W94A 4BAMB 3PWBA 4MNWA 2HGTH 1SLVB 3TH2H 4CHAB 5LPRA 2ZEBA 2SNVA 2XBWA 3M61U 1BHXB 4NWKA 3M5LA 1GL0E 4UFDH 4XD7D 2H5CA 4MPVA 3IWMA 3GDSA 1J16A 3M3SA 3PB1E 4H42U 4OM9A 4D7GA 4YXWD 3MNSA 4FVDA 4I8JA 2M5TA 3RMLH 2BDCA 1GI6A 1AY6H 5GXPA 4K2YA 5GCHF 2ZDMA 2ZP0H 2W7SA 4B74A 2FOFA 2QV1A 1T7CA 2VIVA 1VCWA 1BTPA 2GCHF 1C1NA 2R2WU 1SVPA 3MO3A 4RN6A 3SUDA 1P3EA 1F0UA 1SGRE 4ZKOU 2ZU1A 2ZZUH 2RCEA 1SGFG 1K1LA 3JZ2B 2V3HH 3TGJE 4YLUA 5JB9S 2PUXB 1HAXB 1O5EH 3N99A 1T8NA 1PPCE 4AOQA 3FANA 1TBRH 1P01A 1KXCA 1RXPA 3GY4A 1KXDA 4Q7XA 1E0FD 1ABJH 1P0SH 1A5GH 1HB0B 2ZA5A 1OP0A 1FAXA 1TMUH 4YLQH 1SOTA 3R0FA 5CHBA 1O36A 4BAQB 3ODFA 1A4WH 4ISHH 5DG6A 3ZZCA 4KTCA 1K1MA 4UEHH 1KDQA 1FQ3A 1B7XB 1HAYB 4O9VA 4ABIA 1O31A 3F2FA 3Q3KA 5JYIA 3MU4A 5DP9A 1BTXA 3RXAA 2SGFE 2ZU4A 2OK5A 3SUEA 1F0TA 2PKAB 3QO6A 1UTLM 2CN0H 1LVBA 3PMAB 5FAHA 2GTBA 4K1TA 1OKXA 1CSOE 1RFNA 2ULLA 3RXRA 4AFZA 1BTWA 5EPNA 1Z1IA 2XRCA 5LH8A 1UVTH 1AI8H 3RXPA 1NN6A 1GI1A 3DFJA 1GVLA 4M9FA 3SU6A 1EXFA 1CA0B 1GGDC 2SGPE 3GCTF 3U8TH 2UUJB 1BMLA 2TGAA 4YTAA 5C2ZA 3K65B 1KTTB 3S7HB 3TGIE 1VCQA 4Y6DA 3SOSA 3UPEA 1QIXB 4NIXA 3SGAE 2FLBH 1IQHA 1ELVA 5HM2A 1CBWC 2BX4A 2BX3A 3HK6B 2G4UA 4DT4A 2QXHA 1J14A 2AIQA 1Z8GA 4ISIH 5F6MA 1J17T 1BHXF 3HGNA 3P8OA 2VB0A 2BDIA 1C1WH 2A2QH 1V2VT 2A5KA 1CT2E 3SJ9A 2L6OA 3I77A 3KQCA 1DY8A 2PFEA 2ZFFH 3LJJA 1SQTA 1QJ6B 3PROA 1SHHB 2C90B 3KQDA 1RJXB 4X8VH 3SV8A 1UHBB 2HPPH 2BD9A 1GHBF 5FBEA 2QN5T 3MO9A 4CRCA 2H9EH 2Z94A 1G32B 3HATH 4YESB 1BITA 2P59A 4I8LA 3GS9A 5EQSA 2GVFA 3D49H 1PQ8A 3LOXA 1UK3A 1UVUH 3EGKH 2FZZA 5GDSH 1O3JA 3MNBA 3RMMH 3E8LA 5DGJA 1MTNB 3TLOA 3PTBA 3E90B 3T2NA 1WXRA 1JRTA 1K28D 4NFFA 1O3LA 4WF8A 3DSGA 5EGMA 1T8OA 4X1NU 2ZDNA 3Q3XA 4I31A 3WW7A 1PPGE 5FCKA 3DT0H 3ENSB 2IJOB 2A4RA 4INHA 1ANDA 4IN1A 3F9EA 4CRAA 1MBQA 3MNXA 1ZHRA 4GPGA 3N7EA 2FOCA 1NU9A 1O3DA 1L4ZA 4UFGH 1FI8A 2XBYA 3W1EA 5CHAC 1O2MA 4B2AA 3ZZ6A 1KMHB 3UOUA 1GMHF 3BG4C 5LGOA 1GG6C 5TCCA 3EE7A 4ABJA 3GY2A 3IG6B 3UAIC 4B71A 3HGPA 1FN6A 1W3CA 1Y8TA 1D3TB 4AB9A 5GPIB 2F43B 3SNAA 5DN6D 1EOLA 4FETA 4X1QU 6CHAB 1QBVH 4OGXA 3NK8A 5DP7A 1DITH 2EY4C 2GCHG 2G00A 3M3TA 4GHTA 3B9FH 1DS2E 2ZI2H 3MHWU 4AG1A 4UE7H 1F5RA 1GCTC 3SNBA 4OS1A 2RFKC 1RGQA 2KCOA 3C1KA 4FUDA 2ZU3A 1ANBA 1MQ6A 4UD9H 1NBMD 5IDKA 3A84A 4RT1A 3BV9B 1BRCE 3PMHB 3AVZA 3O8RA 4F49A 3TU7H 1K21H 2R9PA 1G30B 1IQMA 1K1OA 2XWAA 3BTHE 4WXVA 2AMDA 1IHSH 2ZHEH 1QRXA 2WPIS 3A8DA 1BMMH 1GCTB 2R2MB 3S9AA 2FOMB 4XRNA 2BVSH 3RXBA 3TK6A 3UFAA 2OC1A 4X6OA 3OAAD 1YY3A 1QB1A 1GJCB 1KY9A 2KFWA 1MTWA 5JDUB 2GP9B 4MQAA 1LTOA 3ZVCA 1ELAA 3UQVA 1P10A 1L1JA 3NXPA 4K5ZA 1OWJA 2NU2E 5SGAE 1O2ZA 2BD4A 4BOHA 3RDZA 1MTUA 2ZDLA 5C5NA 3KF2A 1WU1A 1O34A 3GY8A 3FOAA 3L3TA 5EJLA 1HJ9A 1YM0A 3PWCA 3FKSD 3LPRA 1ELGA 2AERH 4E06H 4I33A 4VGCC 1G2LA 3VB6A 1TGSZ 5GNDA 1GJ9B 1C2EA 2PV9B 1YPHC 1GBHA 1TNKA 2YMSC 1KYNA 1O33A 2G81E 3QZQA 1O3NA 2B9LA 2SFAA 1W13U 1QCPA 4KP0A 3ZZBA 2BLOA 1P2OA 2QF5A 2H5DA 4E7RG 3SU2A 1JOUB 2AGIX 4IN2A 1NO9H 1O2GH 1H4WA 1A0LA 5JBTA 3A87A 1AHTH 2D8WA 2O8WA 1C2FA 1P2NA 3M36A 1GI7B 4OS2A 4WH8A 4WWYA 4OS5A 3SNEA 1NTPA 1IHTH 1FPCH 4K8YA 4Y79A 4D7FA 3T28A 5DO4H 4BAOB 1TRMA 3UTUH 5JBBS 5FPTA 3SN8A 3RM2H 1W7GH 3N7DA 2CGAA 1XUIA 2KX4A 2G5NA 1VZQH 1C5TA 5EU8A 1QJ1B 1LHFH 3E0PB 4ZHMU 2XC5A 5CE1A 2FOHA 4WY3A 1U6QA 1ZR0A 2FS9A 3UNSA 2AGGX 3F3BA 4Q7YA 3PO1B 1C5VA 3SZEA 1DWCH 3ZVGA 3U28C 2ESTE 3LGUA 4UDWH 1G3DA 2J4IA 1O5DH 4TWYA 1SSXA 1DXWA 1O2XA 3RC5A 3PV4A 1WQVH 2IPQX 3A8AA 1O3CA 1G37A 1O2WA 5T3HA 2PW8H 8ESTE 4IMQA 1QB6A 1YCPM 3TVJB 2QYIA 3MTYA 1TOMH 5E8EH 3WWBA 1YPHE 4ZROA 2OLGA 1BQYA 4GUXA 3GCNA 3BG8A 2H2ZA 5EJZA 4F4OC 1MUEB 3ATLA 1QBOA 2CMYA 3RC6A 3UNRA 1EB2A 2BB4A 2W26A 3B8JA 3DSPA 1BB0B 1CGJE 2BVRH 2OCVB 4NIYA 2ZPRA 4ABFA 2OUAA 1ZMLA 3QTVH 3BTQE 1EAUA 1GDUA 1SQOA 1BCUH 1DM4B 1A7SA 8KME2 1G3BA 5FHTA 1LHEH 1QZ8A 4OS7A 3T62A 1QQUA 4MPUA 4DURA 2KCPA 1LHGH 4I86A 1FONA 2BHGA 2BD3A 4JK6A 4NSYA 2J38A 3FAOA 4DCDA 1N6YA 4ZUHA 2ZC9H 2AMPA 4X8SH 1K0HA 1A5HA 3OSYA 5DP8A 4AZ2B 1KLTA 1YC0A 2FODA 3ZVEA 2BQ6B 2KAIB 3A7TA 3RP2A 1PPZA 2KAIA 3OFND 4NGAH 3SHCH 3RXKA 4IC5A 4OS4A 2FTMA 1FY8E 2JETB 1FY3A 5HM9A 2R0LA 1BBRH 3LU9B 1E1RD 1GJDB 1IAUA 2ZCHP 2YNAA 1L1NA 1O2YA 1F5KU 2PGQB 1AQ7A 1SI5H 1HXFH 3UY9A 5KEDA 5HIZA 3E3TA 1O3AA 4FUEA 1WTGH 3A80A 3KQ5A 1UCYE 1UTNA 3DHKH 4NWLA 3CP7A 4B1TA 1EFRD 5GIBA 1HUTH 2PWXA 3QX5H 1ANCA 1DT2A 2Z3DA 3I29A 2VWOA 1XUJA 1EATA 1CA8B 3GDVA 3Q76A 2HOBA 1UTJA 4ABDA 2HWLB 4MDSA 2QXJA 3ATWA 3SV6A 5AFZH 3RXJA 2GZ7A 4J2YB 1GBJA 1RD3B 4AB8A 2GMTB 1MMJN 1D6WA 3RXOA 5LPFA 3WWFA 2ALPA 1GMCF 2ILNA 2ZFPH 2VIWA 5F8TA 4A92A 4A1TA 4Q80A 1KXBA 4HI3A 3TH4H 2A31A 1N8OC 1Y3YA 3OTJE 5GWZA 1AZZA 5GCHG 2J92A 3GY5A 1WDIA 1NRQH 1W8BH 4CRFA 3LJOA 1GMHG 1UK4A 1CGIE 1ZPBA 2BY5X 2Y5HA 4DT7B 3LONA 2EQNA 3AW1A 3T5FH 3MU0A 4AFUA 3SV7A 1AD8H 1GG6B 1ELEE 1XUKA 1K9OE 1Y5AT 1SGQE 4K8BA 1VJ9U 1W0ZU 2Y7XA 3A8BA 1AFEH 1UVPA 2ODQA 1TGNA 3AW0A 1YCPK 4KELA 1S0RA 2A7CA 1TAWA 1AIXH 3V7TA 4ISOA 3SI4H 2ZECA 3GISB 1DUAA 4MPXA 1CT0E 1ZMJA 4JMYA 3BIUH 4KTSA 1E37B 2AH4X 2B8OH 1GHZA 5BPEA 1LCYA 1G9IE 3ZZ7A 4BTTB 4NZQA 1EUFA 1VITG 1P57B 2AYWA 4LZ1H 1EJNA 2ZHQH 2V7QD 1YLCA 3O8DA 9LPRA 1GI0A 4ZH8A 1JIMA 4MVNA 2PSXA 1C1MA 2ZHDA 2WZQA 3MQKC 1F0SA 2WSSD 1VITF 1IQIA 3V3MA 1LHDH 3PO1C 2FPZA 1EJAA 4I32A 1OP2A 1V2RT 2VINA 2FP7B 1ANEA 4ASUD 1FJSA 3L6PA 4X1PU 1IOEA 1TYNA 3A8CA 2ZNKH 4FUJA 4K1EA 1UTMA 2FS8A 1GHBG 3I78A 1S6FA 2ZHWH 2BVXH 1DX5M 3E0NB 3M35A 3MH4A 1O3BA 1ZPCA 2GT7A 2CF8H 1Y5BT 2J34A 3VB5A 3P8NA 1HAPH 1F2SE 2TIOA 3RLWH 4YT7H 4ZXXH 1QL7A 1LKAA 4GCHF 3ZZ5A 1BMAA 4IMZA 1CT4E 2A5AA 1ARBA 3T25A 3ZVAA 1QNJA 1T8LA 4ABAA 4B75A 4BAKB 4IC6A 1XKAC 1VR1H 3GY7A 4X6MA 1UTQA 2ZU5A 2UWOA 3A81A 2FWWA 3UQOA 1Z8RA 4ACAA 2OBQA 3OEHD 1YLNA 3ELAH 4KGAA 4BAHB 4I7YH 1QB9A 1V2ST 4ZAEA 3AAVA 1IQLA 1TPSA 1ZYOA 3LDXH 1E35B 3F2HA 2C8ZB 2FEQH 1ESTA 1FY5A 2NU3E 2HLDD 2TGTA 5G4BA 5A0AE 3RU4D 3STIA 1C5SA 2W5EA 2RA0A 1GJ6A 4KKDA 2HLCA 1KSNA 3ZV9A 1SGNE 1EAWA 4IS5A 2PSYA 4ZXYH 1YGCH 3M5OA 4Y8ZA 4ZMAH 2GJGA 1EAIA 5DP3A 1V2NT 2F91A 3SW2B 2ZCKP 2HNTF 1GI2A 1QRZA 3ZYEA 1ZOMA 4Y11E 1O2PA 4FUGA 5EXNA 3BTFE 1ZHMA 4DVAU 3FVFB 3MI4A 1K1IA 1W7XH 3MH6A 2XCFA 1O2JA 5K7RA 1GBFA 4RI0A 3E16B 2XW9A 4BXWA 2ZWLH 3Q3YA 2G5VA 1WOFA 1NRRH 3LH3A 2JJ1D 3QUMP 2BLWA 2O8UA 1GI8B 5E2OA 1TX8A 2J95A 2CHAB 1EPTB 1YPGH 2BY7X 2ZKSA 4UFEH 2O8MA 1ZJKA 3NCLA 2PR3A 4DIIH 2OQ5A 3SQEE 2OC0A 2PLXA 4DIHH 1DPOA 2P93A 4JZEH 2F9NA 4O3TA 1OWKA 1A61H 2BQ7B 2WPLS 3FZZA 1FZZA 1TRYA 4X6NA 3HKIB 5IYTA 1MABB 4JZFH 1MAXA 1H8IH 1LQEA 3QN7A 3VPKA 2H9TH 2XXLA 3E6PH 2PUQH 3RXIA 2JH0D 4MNXA 1O3PB 2QY0B 2BD8A 3LH1A 3GCOA 1BTYA 1HIAA 3L33A 2VVUA 2FDAA 1EB1H 4X6PA 1C1OA 3A7YA 3GCHB 1C5UA 2G4TA 2KR7A 1PQ5A 3ZZ4A 1QL9A 1S0QA 2C8YB 5C1UA 4CREA 2BQWB 3U9AH 4SGBE 4Y0ZE 4X2VA 2XOKD 1W0JD 4AX9H 1OP8A 1MCVA 4MLFB 2A2XH 2F4LA 3RMOH 4TYDA 1O2RA 2ANWA 1B0EA 1S82A 3URCA 4LOYH 1K1JA 1HAZB 1TABE 1GI9B 4XE4A 5PTPA 2VIPA 1G2MA 1C1TA 2BM2A 2Z7FE 1PQ7A 1UK2A 1ZLRA 1THPB 8GCHF 3EYDA 2Y82A 1FY4A 1LMWB 2AMQA 1CBWB 1ZMNA 1GDQA 2WPHS 5DSFA 1S5SA 1Q2WA 1FNIA 2ZHFH 1INCA 3FFGA 2PTCE 1UTKA 2O8LA 4SGAE 1HYLA 3Q77A 2Y5FA 1RS0A 1O2KA 2V35A 3TH3H 4BNRA 2PP6A 4FUIA 1NROH 4Q7ZA 3P92A 5DKMA 1UTPA 1FUJA 2C8XB 1BBRK 1KIGH 4TT3D 2C3SA 2FI4E 4ZKNU 3ZVDA 2QIQA 3SHAH 3K6YA 1MD7A 1DSUA 1LPGB 1TALA 3PM3A 1XX9A 1FLEE 4NZLA 1WCZA 3S0NA 2F3CE 3A7XA 3P8GA 3VXEH 2HNTC 2VWMA 4WMFA 1NC6A 1Z1JA 5H4IB 2ZQ1A 1AO5A 1GBMA 3MU8A 3P17H 4GHQA 1UVSH 4I8HA 3RMNH 5A0CA 1HV7A 1YPMH 3D62A 1J15A 3TK9A 3NZIA 1IQEA 3PTNA 4U01A 4PROA 4XDEA 2KM0A 3P8FA 3M5MA 1O2TA 1CE5A 3OEED 1S6HA 4AYVB 3HKJB 1FMGA 2SGAA 4YOJA 2ZDAH 1JMOH 4TPIZ 4VGCB 1C2HA 4JK5A 1UJ1A 4Q4LA 5T6GA 7LPRA 2BDAA 1N6XA 2ZG0H 3SNDA 1EZXC 3VB7A 1J8AA 2VU8E 2OC7A 1NFXA 1VGCB 3RXQA 1DE7H 1MQ5A 1CHOG 1C9PA 3A7WA 2EC9H 1O2OA 2D1JA 2GMTC 2QGRA 2ZCLP 1MTVA 2ZF0H 4CRDA 1BJVA 1O3MA 1AVGH 1GPZA 2IPHA 1BTUA 4JZDH 2ZGHA 2BLVA 1XVMA 1P2JA 2FI5E 1A2CH 2ZO3H 1T4VH 2SGQE 3KIDU 1AUTC 1C5XB 1QHRB 5C0TA 1GJ5H 4ZKRU 1W10U 1SGIB 1AKSB 2EI7A 1ELFA 1XXFA 2BY6X 2ZTZA 2BDHA 2RG3A 1BOQA 2QCYA 3ZVFA 1MZDA 2ODPA 3T29A 2GGVB 2NU0E 1ABIH 1PPFE 1DICA 1S85A 3LGTA 3DSOA 1HAVA 1H1BA 1TIOA 1L1GA 4X8TH 1KXEA 1WBGB 2BZ6H 1RTKA 4XOJA 1GHAG 1CGHA 1TNLA 3U69H 4B2CA 1AN1E 3S9CA 2QXGA 1IQNA 3LKWA 1EJMA 3SUGA 2FO9A 1OYQA 4ZHLU 1C2GA 1OWHA 3EDXB 3M7TA 4AFQA 1YPJH 4JZIA 4ZHAA 1PPHE 2GZ8A 1SQRA 1C5MD 1SOZA 2K0QA 3E1XB 1H8ED 1XVOA 3UWIA 4U32A 3S69A 3WY8A 3NKKA 2B7DH 5C3NA 4Y7AA 1BBRE 5LPEA 1Y3WA 1BT7A 2YNBA 1MTSA 1HCGA 2F9VA 1O2IA 3OX7U 2BTCE 2WINI 1T4UH 3GCHC 2ZDKA 2O8TA 2PHBA 3QZRA 3QWCH 4D9RA 3A82A 1HJAB 3BIVH 2JKHA 3FP6E 3SBKA 3SQHE 1IQGA 4NA7A 5FL7D 1EP5A 1UVOA 5AHGH 3SGQE 1UCYK 5K0HA 5HMAA 1ZTJA 1C5YB 1FAKH 2PKSB 4ZKSU 2HVXA 1DXPA 3EA9A 3U8OH 1Z7KA 5CMXH 2C8WB 2J9NA 3SJKA 1SLWB 2I6QA 1L2EA 4TPYA 1BTHH 1GHAF 2J5UA 2W6JD 1LPKB 4NSVA 1BRAA 2D26C 3M37A 4X2YA 1TGTA 2QF0A 1AFQC 1O3EA 3P6ZB 1A3EH 4Y8XA 1AU8A 3TITA 4UFFH 3KNXA 3U8RH 2IOTA 2YMSB 1HFDA 1C2JA 3M5NA 2RDEA 3RC4A 4X2WA 1ACBE 2OD3B 1GHYH 3RXCA 5ESBA 2W3KA 2C93B 3IITA 1BMNH 1UTOA 1QQ4A 2QXIA 1HIAB 3G01A 2G52A 2ZFTA 2Z9GA 2Z3CA 5JBAS 1A46H 1FIZA 2A4OA 6CHAC 2XYAA 3BF6H 1KLIH 1SGDE 1ZJDA 2WYGA 1GL1A 2G55A 5EXLA 3FO8D 2J98B
chains in the Genus database with same CATH topology
1AKSA 2QF4A 4FU7A 3SV2H 2XC4A 3BG4B 3T26A 1OWIA 2FOEA 5B6OA 2M2AA 1FY1A 1GDNA 1BMFD 1C5RA 3NWUA 1Z6EA 5EW1H 1ETTH 3ITIA 3UUZA 1D3PB 2XNIA 2ALVA 4UONA 1NRSH 4DGJA 4RKJB 1O35A 7KMEH 4ESTE 1QJ7B 1PJPA 2H6MA 3RXFA 2JH5D 1C5OH 2GCTC 4Y10E 3U1JB 3KQBA 3LC3A 3ZZ8A 4AORA 1GBTA 4MPWA 1HPGA 3EA8A 1ZRKA 3F9HA 1SMFE 3BSQA 1F0RA 1O2VA 1KXAA 1AVWA 5C1XA 3RXHA 5EPYA 5C67A 4F55A 1XUFA 1ARCA 1TPAE 3UR9A 1DLEA 1SGTA 1YKTA 2HALA 1GBDA 1W0YH 4FU8A 1NESE 1G3EA 3MMGA 1JRSA 3E91A 4NCYA 2Q6GA 3PMJA 3VGCB 2P94A 3TPIZ 4Y71A 3UOPA 4Y8YA 3PRBA 1P04A 1C2LA 1FN8A 1DLKB 4DG4A 1QFKH 4IBLH 1HAGE 1RIWC 5JB8S 3H5CB 4YT6H 1W11U 3ZYDA 2NU1E 4NIVA 4GCHG 1JIRA 3EAJA 3M7QA 2FOAA 3D23A 1BZXE 1GJ8B 1VJAU 1ELDE 4DOQA 3DCLA 2FYQA 2UUYA 3OU0A 3PV2A 2HNTE 4TY6A 2UUKB 1DVAH 2A5IA 1V2LT 2ZQ2A 3D65E 1TFXA 3PLBA 1EZSC 3ZZDA 3BEIB 1B0FA 2R0KA 2UUFB 4X1SU 1EKBB 4X1RU 3VEQB 3S9BA 4K3JA 3KHVA 5A8XA 4ABEA 1BTZA 1UCYH 1P9UA 2Q6FA 2JJ2D 3MWIU 2JDID 5EG4A 1SGFA 1AZ8A 1YPKH 4THNH 1NZQH 1WYKA 3ZV8A 1LQDB 1C5NH 1DY9A 3UIRA 3ZIAD 4TY7A 3PYHA 4WMEA 3MH5A 5F53A 4ASHA 2ZFRH 1V2PT 1Q3XA 1V3XA 4LZ4B 1C1UH 1AVXA 2XWBI 5E0JA 2WUCA 4I8KA 3K2UA 1QY6A 2P95A 4A7IB 1XXDA 2WPJS 2XBVA 1HJAC 4X8UH 2GD4B 2CXVA 3H7OA 1TNGA 1MD8A 3A89A 1HXEH 1MCTA 4Z1MD 1O5CB 2OQUA 3Q00A 3LGWA 1O3KA 2EI6A 3H09A 1QTFA 2SGDE 5ESTE 1TGBA 1C1VH 2A45B 4B76A 1GI4A 1WSSH 1CA0C 1GGDB 1Z6JH 3NUMA 2VGCC 7GCHF 2ASUB 3QLPH 2QF3A 3HPTB 1SB1H 1NS3A 2Y6TA 1P2QA 4E7NA 1GHVH 1VCPA 2AS9A 3SU1A 2CV3A 4INKA 2WV4A 1ZPZA 1IQJA 3F6UH 2QAAA 2STAE 2JIZD 2STBE 4Q63A 4R8TB 1EAXA 3TJUA 5HYOA 2OXSA 1ETSH 2W7UA 1A5IA 1MTNC 1GHXH 3ATIA 4ABHA 2BD5A 2V3OH 1WTHD 1AWHB 4RSPA 1NRPH 3SORA 2VGCB 5FBIA 1IQFA 2J94A 3MNCA 3URDA 4CH8B 2AIPA 4JCNA 1SFQB 1TQ7B 2IN2A 1UMAH 2BDYA 3VB4A 1O37A 6LPRA 2PKAA 5DP4A 2Z9JA 1O0DH 4B73A 1E38B 2WPKS 2BDGA 4U30A 1TMTH 4XSKU 5FPSA 1EX3A 2WHXA 3QGJA 1PFXC 1H8HD 2QE7D 1V6DA 2XBXA 1MH0A 1OX1A 3F68H 1P11E 2XNDD 1CQQA 3SU5A 1H9HE 3FZDA 4B6FA 1N1LA 2BY8X 2Z9LA 1O32A 1H9IE 1DSTA 5ETXA 1GVZA 3VXFH 3N7OA 3TK5A 4D8NA 3SU0A 4CBOA 1Y5UT 1AE5A 1WAYB 2K1QA 3EE0B 4KTUA 2Z9KA 4DW2U 2BMGB 1AMHA 5A0BA 1AWFH 3F0PA 2TBSA 4FUHA 4WVPE 1C5LH 4FUCA 4AGJA 1SGCA 3GOVB 3RXEA 2BOHB 1XUHA 1CHGA 1SLUB 4BANB 2F83A 1CHOF 1QL8A 1EZQA 3FP7E 4IW4E 1TMBH 1OYTH 2ZGBH 3VB3A 1GBKA 2A4QA 2GT8A 4I8GA 1YBWA 4OS6A 2FX4A 2NWNA 3ODDA 2Y81A 2OINA 4CR9A 1PQAA 1YYY1 2ANMH 5F03A 1DANH 1D3QB 1GMDG 2F9UA 4YZUA 1DWDH 4CRBA 4NFEA 6GCHG 1C2KA 1SKYE 2DE8A 4DJZB 4Y76A 1GI3A 3F0OA 4MTBA 2LNCA 3V13A 4LK4A 4AFSA 4AG2A 3ZZAA 1O2UA 5FCRA 3GCTG 3OYPA 1S84A 2K8IA 1C1RA 2SNWA 3RXTA 1SGEE 2P3FH 1AE8H 1ELCA 2V0BA 5F8XA 2RDLA 1XKBC 3A86A 1TPOA 4GLYA 1EP6A 3H7TA 1O2QA 3RLYH 2W6ID 1SBWA 1SC8U 2DUCA 1TPPA 2D2DA 4MNYA 3F1SB 3F9FA 4WMDA 3KN2A 1W14U 2G51A 3O8CA 3RXSA 4LXBH 4FXGH 4WH6A 1GBCA 1MKWH 2VH0A 4B2BA 4CRGA 3GY6A 5TJXA 2OTVA 1OHHD 1GBLA 3U98H 3SO3A 2I6SA 1BRUP 3R3GB 4INLA 5C20A 1HJ8A 2VIQA 3MH7A 2ZGJA 1E34B 2XTTB 1Y59T 9ESTA 4AGKA 2FYRA 1LVMA 5A8ZA 4CHAC 1GVKB 2C4FH 4ZCNA 2VH6A 5DP5A 2G8TA 2GX4A 3EA7A 1G36A 1BA8B 1NT1A 1W12U 1HAVB 3BTDE 2VJ1A 2LPRA 1P3CA 1TX6A 4ABGA 3SZNA 4AN7A 2SGEE 2ZFSA 3VG8A 3V12A 1QBNA 2F9PA 2BY9X 2KCYA 2B5TB 2RA3A 3CENA 1EZUC 4CBNA 1KTSB 3V0XA 1C5ZB 4BXSA 1SPJA 1EPTA 2FI3E 1YP9A 2BXTH 2A7JA 1RTFB 2Y7ZA 1UHBA 5A2MH 1O2NA 4TWWA 1O2HA 3RXDA 4GAWA 2XC0A 3PRDA 3T27A 3OE7D 3VFEA 1CO7E 4O97A 1AUJA 1ZZZA 3P95A 3QK1A 3JZ1B 1DOJA 2KZ4A 2TPIZ 1GI5A 2FIRH 8LPRA 1NM6A 2Z6BD 4AYYB 3MOCA 5I46H 1SL3A 2TGDA 1DUEA 1P05A 2F9BH 2R3UA 2FOBA 4JYUH 3CS7A 3LGIA 1DFPA 3A83A 1V2UT 1MBMA 1O5FH 4H6TA 3SGBE 4X0WU 1ZRBA 1GJBB 2ZTYA 1C9TA 3AASA 5C0UA 1OPHB 2H1UA 4X2XA 2OC8A 2VWNA 1Y3VA 1GJAB 2A0QB 2VVCA 1AB9C 2VVVA 1K22H 1D4PB 5A8YA 1TLDA 3K6ZA 2FTLE 1TOCB 1THRH 5C5OA 2QC2A 1DWBH 1C5QA 2WYJA 1RIWB 3RXVA 1NBME 2YMSD 1T31A 4O3UA 1P09A 3LT3A 1SQAA 3MFJA 1ZSJA 1V2OT 2WV5A 1RRKA 2THFB 1C1PA 1OXGA 2B0FA 1O2SA 5EODA 3LC5A 3LGYA 4JZ1A 4QT8C 3BEFB 2ZU2A 1YPEH 1KDQB 3SJOA 1HNEE 4TSFD 4ISNA 1EPTC 2ZTXA 3OY5U 1V2TT 1GJ4H 5F8ZA 1FDPA 2P3TB 4XBDA 5E2PA 5EW2H 1O5GH 1NFYA 3ESTA 3RM0H 5C17A 3P70B 1BJUA 2A1DB 1WUNH 2QA9E 1C2IA 1UO6A 4J1YA 3LGVA 2BOKA 1LKBA 2FXRA 1D9IA 4FVBA 1P2IA 3DD2H 1XM1A 1GHWH 4Z6AH 2A7HA 3LIWA 1C5PA 5AVDA 1HLTH 3BTGE 1ZTKA 4H6SB 1NPMA 3UWJH 1O30A 2GZ9A 3SI3H 3PV5A 2FESH 1O3GA 3MO6A 3GICB 1YLDA 1S83A 1RTLA 3AAUA 1VGCC 1D3DB 1NRNH 1F5LA 1ZHPA 4IGDA 1TNIA 2V6NA 2TRMA 5E0HA 1NU7B 1LVOA 1AB9B 1OOKB 1LVYA 4D9QA 1COWD 2GDDA 3A7VA 3AK5A 2P16A 5CHAB 4E05H 2GCTB 5ABWA 1CU1A 4K60A 3SJ8A 2KCAA 4NA8A 1OSSA 3A85A 1G3CA 2PGBB 1GBEA 1P2KA 1O5AB 3NRLA 1O3HA 1Z71A 1L4DA 1Q31A 1Y3XA 4HTCH 3FP8E 1AGJA 3B23B 1O39A 4NA9H 1K1PA 1SFIA 3UR6A 4CH2B 5L2YH 1PPBH 2ZGCA 3PLKA 1IQKA 2WUBA 3EQ0H 4DY7B 5AF9H 1ETRH 4JYVH 3ZZ9A 4HGCA 2ZPSA 3SJIA 1C1QA 2EEKA 2H9HA 4ABBA 1SLXB 4Q2KA 1GBIA 1O38A 1TBZH 3MU5A 3M3VA 2ODYB 1GWAA 2ANYA 4CR5A 1V2JT 1ESBA 4GSOA 4FUBA 5E0GA 1HDTH 2ANKH 4BTUB 1TGCA 4FU9A 3RXUA 1PPEE 1A0HB 1BUIA 2BZAA 2CHAC 1B5GH 3KEEA 4XBBA 1TBQH 1EASA 5J4SA 1Z8JB 2NU4E 3RXLA 3TJVA 4U2WA 2CF9H 1EQ9A 1DWEH 2Y80A 1E36B 3QGNB 2HPQH 2A4GA 2JH6D 2CJIA 3QTOH 4GVUA 4Y7BA 1C1SA 2BXUH 4K69A 1GBAA 1O3OA 1MZAA 2AHME 1CVWH 1FXYA 2W3IA 2BD2A 2PTNA 1V2KT 4WJG2 4Y0YE 1SGYE 2F9OA 1C4U2 4HZHA 1C2DA 3KQEA 1GBBA 3TNTA 2GV6A 3BN9A 2CK3D 3GY3A 3SV9A 1FIWA 1SR5C 1NFWA 2ZFQH 3BEUA 3F9GA 3UREA 2J2UA 1THSH 4A1XA 4H4FA 4D76A 1FPHH 3C27B 1EOJA 2Q1JA 1W0KD 1ELTA 5L2ZH 2P8OB 1PYTD 3MU1A 1P02A 1V2QT 2BLQA 1S81A 2FM2A 3SUFA 1JBUH 4A6LA 5FX5A 2GKVE 5JPMH 1LO6A 2ZDVH 1HBTH 2VIDA 4A1VA 1TQ0B 3SNCA 2Y5GA 1MU6B 1V2WT 1F7ZA 5L30H 1YPLH 1OWEA 1QR3E 3S7KB 1XMNB 1E1QD 3SU3A 2VWLA 2P8OC 5EQRA 5L6NH 3KL6A 1TONA 5GJ4B 5FX6A 2ZPQA 2FMJA 5DK1A 1MKXH 1MKWK 1TB6H 3STJA 2BD7A 3W95A 4Z0KA 1H9LB 1C2MA 1ORFA 1F92A 3F2GA 1GJ7B 1TX7A 5T6DA 1T8MA 3KCGH 4XFQA 3ZZ3A 3CS0A 3DFLA 3SYJA 2OP9A 2TGPZ 2ZIQH 1GCDA 1V2MT 2FX6A 1P03A 5HKKD 1MU8B 1W2KH 5HGGA 1TNHA 1M9UA 1QURH 3FN8A 3RXGA 3TJOA 4YOIA 2WV9A 3RU4T 3MYWA 2VBCA 2AGEX 2BYAX 5FPYA 4FUFA 2WPDD 3A88A 2AFQB 1N8OB 1GMDF 3SU4A 1KXFA 5C1YA 1P12E 3HK3B 3GYMA 4OGYA 3UB0A 5A09A 1XUGA 2VNTA 5DP6A 4YOGA 1ELBA 4O03A 5J4QA 1NY22 1X7AC 3K9XB 3BTTE 1ZTLA 3VGCC 5TCAA 3GDUA 1O3FA 1MAYA 3TNSA 3RUOA 1TNJA 7ESTE 1FX0B 3ATMA 1SGPE 1T32A 1TWXB 1WQSA 1ZSKA 1C4Y2 1ZGVA 1WV7H 1TE0A 1BDAA 5CDFE 3RU4E 2EA3A 4NG9H 1SHYA 1HGTH 1L0ZA 4YM9A 1YF4A 4M7GA 1P06A 2A32A 5JBCS 5T1VA 1ZSLA 1NFUA 1C5WB 5T6FA 1QRWA 1SG8B 2GDEH 1HAIH 1A1RA 3NPSA 3BTWE 6ESTA 4B6EA 1OWDA 1QGFA 4JYTA 3QDZB 1H8DH 5B6LA 3TGKE 3DA9B 4XBCA 1AFQB 5IK2D 1Z8IB 5AFYH 3DUXH 2O9QA 3BTME 1LPZB 2WPMS 3O8BA 2FOGA 1P2MA 2LELA 3TJNA 1JWTA 1HAHH 2BDBA 5EXMA 1P8VC 2YOLA 4R0IA 4NIWA 3GYLB 1HAOH 1J9CH 1FV9A 1HRTH 2PKSC 3ZVBA 1JXPA 1O3IA 1ID5H 4YO9A 1C4V2 4RKOB 3A7ZA 5EOKA 1P9SA 5HXFA 6GCHF 8GCHG 1TA6A 1Y3UA 3U1IB 1D6RA 2FLRH 1BIOA 1O5BB 1ESAA 2IJD1 3ATKA 3KGPA 5BRRE 7GCHG 3M7UA 1YCPH 1GMCG 1KLJH 2JETC 3UNQA 1K1NA 2Q6DA 1QA7A 2ZGXH 5FXLA 2R3YA 5DJ7A 2HRVA 1PYTC 2AEIH 2UWLA 3BTEE 1LHCH 1E79D 2P3UB 3PLPA 3OY6U 1S6LA 1A0JA 3TIUA 4HFPB 1QA0A 5I25A 2GV7A 2DE9A 2OBOA 5EQQA 1TA2A 1VITH 4BTIB 2VIOA 2Z9IA 3OTPA 4ISLA 1LDTT 1MKXK 5DPAA 1OS8A 3PMBB 4K1SA 4MNVA 2XCNA 3BTKE 3RXMA 1O2LA 1TRNA 1DDJA 2Z3EA 1ZGIA 4MG3A 1BRBE 1A3BH 2EI8A 4A5TS 4WXIA 1K2I1 2UWPA 3W94A 4BAMB 3PWBA 4MNWA 2HGTH 1SLVB 3TH2H 4CHAB 5LPRA 2ZEBA 2SNVA 2XBWA 3M61U 1BHXB 4NWKA 3M5LA 1GL0E 4UFDH 4XD7D 2H5CA 4MPVA 3IWMA 3GDSA 1J16A 3M3SA 3PB1E 4H42U 4OM9A 4D7GA 4YXWD 3MNSA 4FVDA 4I8JA 2M5TA 3RMLH 2BDCA 1GI6A 1AY6H 5GXPA 4K2YA 5GCHF 2ZDMA 2ZP0H 2W7SA 4B74A 2FOFA 2QV1A 1T7CA 2VIVA 1VCWA 1BTPA 2GCHF 1C1NA 2R2WU 1SVPA 3MO3A 4RN6A 3SUDA 1P3EA 1F0UA 1SGRE 4ZKOU 2ZU1A 2ZZUH 2RCEA 1SGFG 1K1LA 3JZ2B 2V3HH 3TGJE 4YLUA 5JB9S 2PUXB 1HAXB