4A1XA

Co-complex structure of ns3-4a protease with the inhibitory peptide cp5-46-a (synchrotron data)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
195
structure length
191
Chain Sequence
GSVVIVGRIILSPITAYSQQTRGLLGCIITSLTGRDRNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Affinity Peptide Inhibitors of the Hepatitis C Virus Ns3-4A Protease Refractory to Common Resistant Mutants.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1b
molecule tags Hydrolase/peptide
molecule keywords NONSTRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
total genus 52
structure length 191
sequence length 195
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4a1xA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4a1xA01
1O30A 1P9UA 4ZKRU 1PYTC 1P2IA 1TNKA 1P8VC 4AOQA 2VIPA 1ZSLA 2QXHA 4IC6A 2ODPA 1HFDA 2BY9X 2O8LA 1CVWH 2BY6X 1AMHA 4GAWA 4A1XA 4FUGA 1BTUA 1XXFA 1GBMA 1O2KA 1CBWC 2ZA5A 3A89A 1TGBA 1GPZA 1QJ1B 2H1UA 3M5OA 3RUOA 2FS8A 1BJUA 1C5OH 2PSYA 4AN7A 2A5KA 1EUFA 4I8HA 4K1TA 3BTFE 1RJXB 4K2YA 1ELDE 2J4IA 2V0BA 1O3KA 1P9SA 1AE8H 1YGCH 3BTQE 3EA7A 1C2JA 1TNIA 4Z0KA 2ZG0H 5E2PA 2SFAA 3ATMA 1K9OE 1KYNA 3GY2A 4MNXA 2XRCA 2LPRA 1G37A 1Y3VA 2Q6GA 2WPHS 1MCVA 1QBVH 1EJNA 3R3GB 2FTLE 1F0UA 1MKXH 3ZVCA 1JOUB 1TNJA 2AGIX 4CR5A 2HNTC 3AK5A 1EATA 1GHYH 5EGMA 2ZHDA 3IG6B 5K0HA 2CHAB 2Z3EA 4JYVH 1AGJA 1KLJH 2VJ1A 4PROA 1W13U 2CN0H 3MU8A 3SGBE 1W14U 2XBXA 1TPOA 1TWXB 1A7SA 4K69A 4Y8YA 1Q3XA 2BVRH 5FPYA 2ZDLA 1OSSA 1THPB 1J14A 2CXVA 1V2TT 1TLDA 3OYPA 1GHZA 1GI3A 3HK3B 4Y0ZE 2SGEE 1SGTA 1ID5H 1V2JT 1UO6A 1DY8A 1H9IE 2OLGA 2VIWA 1PFXC 1O2VA 2VGCB 2ZWLH 1O3IA 4ZXXH 3N7OA 1MBQA 1Q31A 3SW2B 1UCYK 4B76A 1UTNA 1YPHE 3UOPA 4YZUA 4AG1A 1GHWH 5T1VA 1MTVA 1K1IA 1GBAA 3QUMP 2O8UA 4FUHA 4UFGH 1FN6A 1L4ZA 1YPLH 2PKAB 1ACBE 2FZZA 1AWHB 2ODYB 2RA3A 3BIVH 2XXLA 1FN8A 4U2WA 1C5SA 3D23A 2BQ6B 2FOBA 2NU3E 3P6ZB 4Y0YE 2EI7A 4KGAA 4MTBA 4ASHA 3ZYDA 2P95A 1TBQH 1MMJN 1E35B 2GDEH 4H42U 1AD8H 1AZ8A 3TJVA 2BDGA 1Y8TA 3P8GA 2BDBA 4NFFA 4E06H 1C2DA 2VWLA 5DP4A 1P0SH 2ALPA 5JBBS 1LO6A 1FNIA 4OS6A 4O97A 3KL6A 2FDAA 1ANBA 1G30B 2ZGXH 5FPSA 2AERH 3MNXA 2ZFQH 3M7UA 2BZ6H 3CS7A 4NA9H 3TPIZ 2XW9A 3PO1B 2BD7A 3TIUA 1EAWA 3TJOA 1D4PB 2XCFA 2FS9A 1HNEE 1NPMA 4B6EA 2YOLA 4JK6A 1PYTD 3PMAB 1KSNA 3RMOH 4GLYA 3S7KB 2QGRA 3A87A 1P01A 5FCKA 4BXWA 1GCDA 8GCHG 3A7ZA 1HAHH 3I77A 3LGTA 3SHAH 1SI5H 3PO1C 3PV4A 3AASA 4MNWA 4FVDA 3GYLB 2JKHA 1SHHB 2GMTB 4X0WU 2CJIA 1P06A 4UFDH 1UK2A 1IAUA 2QV1A 1KXBA 1JIRA 1HAIH 1KLTA 2UUFB 4LOYH 3ZZCA 3SGAE 1MKWH 1LHCH 2F3CE 1GBLA 3VB6A 5TCAA 2ZGJA 2VVVA 4A92A 2F4LA 1EAUA 1PPZA 5BPEA 4ZHLU 2FMJA 5DP5A 4AYYB 3T27A 1MQ5A 4K8BA 2FWWA 2TGAA 1BHXB 1TGCA 4X6MA 4ZHAA 1P02A 1ESAA 5DKMA 1SFQB 2GMTC 3MU1A 1SGRE 1Z8GA 2IPHA 3HATH 3OY6U 1LMWB 2ZIQH 3MWIU 3SU0A 3T28A 1GI8B 1MBMA 6LPRA 1PQ7A 1NU7B 1C5TA 3LC5A 4XFQA 3MO3A 3UNQA 1LHFH 3ZZ9A 3LOXA 1KXAA 4D76A 3LJJA 1GBIA 3T25A 4JYUH 1CO7E 2BDAA 1W10U 3KQEA 3RC4A 4UDWH 1YLCA 1Z1IA 2ZHWH 3GY8A 5ETXA 3V12A 8ESTE 4A5TS 1C5ZB 4Y8ZA 3FFGA 1HAOH 1THSH 1IQHA 1O3JA 2JH6D 1VR1H 2HLCA 5L30H 2A4OA 3URDA 2XBWA 1B5GH 3EDXB 4J1YA 3E0NB 4B73A 1V2PT 1A0JA 4E05H 1O34A 2D8WA 2R9PA 5CMXH 3E16B 4X1SU 1UVTH 2ZCKP 5TJXA 1O2MA 3LGVA 4Y10E 1ZGIA 2R3YA 4DIHH 1W0ZU 3ZZDA 1C1PA 3BEFB 1P2JA 1SPJA 1YKTA 3SI4H 3LT3A 1Q2WA 2DE8A 1VJ9U 4YOGA 3NPSA 1D3QB 2J94A 2G4TA 5EXNA 2A31A 3ZZBA 2OXSA 3RXHA 1SVPA 4GSOA 1LPGB 4J2YB 2WV4A 1LVMA 4HGCA 3MFJA 3M7QA 3P70B 1QL7A 8KME2 4B74A 1UMAH 2FX4A 2Q1JA 5G4BA 1GDUA 1BUIA 1TALA 4OM9A 1B0EA 2R0KA 1GG6B 2BB4A 3PV2A 5GIBA 1C5YB 1O2ZA 3SNEA 3SI3H 1VGCB 2ZECA 3E3TA 2QA9E 1NC6A 3H7OA 2VB0A 3A80A 1QURH 3SUEA 3VB4A 3RXVA 5F03A 4ABEA 3BG4B 3PM3A 1GJCB 2XC4A 3MO6A 5GWZA 1ZTJA 1OWDA 1UTOA 4D9QA 1OOKB 1FZZA 1T32A 4DGJA 1HV7A 2OINA 1H4WA 1KDQB 1AKSA 1AKSB 1HAZB 2ZDNA 2GT8A 4Q80A 3BSQA 1BJVA 2FOCA 3SUGA 1C2FA 3BG4C 1NN6A 1O3FA 1GBHA 1T7CA 5DP7A 2AFQB 1O2RA 3F9EA 2XBYA 1FY8E 3RXFA 3HPTB 2PKSC 1TB6H 1WSSH 4IN2A 1TGNA 1MKWK 2TIOA 3P95A 1QGFA 1NRSH 1GVZA 3JZ2B 2R0LA 4XSKU 3KCGH 5LH8A 3GCTG 2QF3A 2O8WA 3PROA 2GKVE 4R0IA 1MD8A 3KN2A 1HJ9A 3RXTA 5DP6A 1TIOA 5A8XA 2ZQ1A 1FLEE 1SLVB 1F0RA 2F9OA 2XYAA 1QNJA 1TOMH 4OGYA 1W7GH 3AVZA 2A2XH 4I33A 1C1SA 4B2AA 1FY1A 4DIIH 4BAMB 1G3BA 1GI7B 1V2KT 2G8TA 4Y76A 4OS5A 5A2MH 2ZTYA 2FX6A 4BXSA 3QWCH 1JRSA 2A4GA 5LGOA 3SJOA 1PJPA 2GCTB 1T8NA 3EYDA 3MU0A 1LKAA 3DUXH 4B71A 2ZDAH 1ANCA 3B9FH 3TGIE 1K1MA 2HPQH 1EASA 3DFLA 3M3VA 2BOHB 5FX6A 1FI8A 1L1JA 2XC5A 4ZUHA 1O3LA 1FAKH 1KIGH 3UREA 3QK1A 1HJ8A 1T8MA 1QIXB 4WWYA 3A8AA 1TQ0B 4ISNA 1W7XH 3SNBA 1CHOF 1HIAA 1GBTA 2M5TA 2WINI 2Z9JA 1BBRE 2ZF0H 2G00A 1CSOE 3ATIA 2CV3A 1HYLA 2K1QA 4XBCA 5L2ZH 1YM0A 1PPGE 3E90B 1O5AB 2G51A 4NIYA 4DCDA 3E6PH 1T31A 4MNYA 4MQAA 3T62A 1ESBA 2B7DH 3UR9A 2ANMH 1RGQA 3UIRA 1V3XA 1EPTA 3AW0A 3RP2A 4F4OC 1GHAF 1GHBG 3LH1A 2OQUA 1O3AA 1V2VT 3GOVB 2BD2A 7KMEH 1CHOG 2GCHG 1C5XB 2P3FH 1FIWA 3MH6A 1NRQH 1OWEA 2SNVA 3A7XA 3ZZAA 1EZSC 1BA8B 1N8OB 1BT7A 2ZGBH 2F9NA 4D7GA 4Q2KA 3MMGA 3M61U 1TNGA 4X8VH 1A3BH 1GI2A 4K5ZA 4R8TB 5JDUB 4ZKSU 1CGJE 1S0QA 1P05A 4CBNA 1L4DA 3B8JA 2XC0A 1KXEA 1MTSA 5LPFA 2W7UA 3ELAH 1AUJA 4FUBA 1HXFH 1Z1JA 1AWFH 2FESH 1YCPK 3NZIA 1GJ9B 1O33A 2OD3B 4AFSA 2PV9B 5DG6A 4I31A 2F9UA 1SB1H 2NU0E 4XOJA 3RXAA 4IN1A 4DW2U 2ZKSA 4NIXA 1DITH 2LNCA 4MPXA 4JZIA 1IQIA 5AF9H 3LGWA 3ZZ4A 1K28D 1PPEE 1EPTB 5EXMA 1Z71A 1S82A 4ZXYH 2ZQ2A 1BRBE 3ODDA 2ZDMA 4KP0A 4Z6AH 1SGQE 1MZDA 2I6QA 3PYHA 3UPEA 2F83A 1F5KU 1GMCG 4D8NA 1H8DH 3O8BA 2G55A 2AS9A 1HUTH 2QXGA 5TCCA 4MNVA 1OWKA 2KAIB 3MO9A 2FI4E 1AHTH 1O2GH 3OTJE 4HZHA 3WY8A 1NM6A 4FU7A 1IQGA 2ZI2H 1SOTA 4XE4A 4AB8A 3SORA 2PGBB 3RXCA 3ZVDA 1E34B 4ABHA 2IOTA 2GV6A 4NA7A 5JB8S 2Y7XA 4FXGH 1AB9B 4FUFA 1O3MA 4NSYA 1WQSA 1HLTH 1CA0B 3A88A 1BCUH 1N1LA 1DUEA 4INKA 2WUBA 3F9FA 5DO4H 1A4WH 2NU1E 1D3TB 3T2NA 2H6MA 3SV9A 2Y5FA 5C67A 3UUZA 4XDEA 3RXEA 3GCHC 5AFZH 1AFQB 2D1JA 5GNDA 1TPSA 4VGCC 1QJ7B 1TPPA 4GHTA 4YO9A 2IN2A 1SBWA 3V3MA 5FPTA 4LK4A 3NUMA 1RXPA 3BEIB 5A09A 1RRKA 1ZGVA 1S83A 2AIPA 4IGDA 3E91A 1DWCH 4X2WA 3SO3A 1AFQC 3TGKE 3B23B 1V2OT 3S69A 1THRH 1Y5UT 2OBOA 3OSYA 2VVUA 1BTPA 4UD9H 3RU4D 1W0YH 2AGGX 3M3SA 4BAKB 1EQ9A 2TGPZ 4MG3A 3VFEA 4ABJA 1VJAU 1FY3A 1XUFA 3F6UH 2FLRH 9ESTA 3SU2A 3SU4A 1SG8B 5AHGH 1BRCE 2PW8H 1L1NA 3UR6A 1O35A 1GJBB 4Y7BA 1UK3A 5GJ4B 4DJZB 2Y6TA 1QTFA 1TMUH 5HYOA 1PPFE 1JXPA 1P2MA 4KKDA 5F6MA 3FZDA 1A5HA 2SGPE 1VITF 5C5OA 1MD7A 1P10A 2G81E 1C1VH 3QGJA 2VWMA 1HRTH 1O2PA 4D7FA 3O8DA 3FANA 3RXSA 3BTME 3TU7H 4AZ2B 2XCNA 3O8CA 1L0ZA 1MAYA 1JBUH 2WYGA 1QL9A 5F8ZA 2NU4E 1AVXA 2YNBA 5B6OA 1QBNA 5FBEA 3OTPA 2PR3A 1ZHRA 2R2WU 1HAPH 3UNSA 2VVCA 2JH0D 5T6FA 1LVBA 3T5FH 3SV2H 1SFIA 1O3DA 3V7TA 2WPMS 1J15A 5BRRE 1F5LA 2VWOA 4YLUA 3SUDA 2V35A 4QT8C 2SGFE 2FOAA 1QQUA 4ESTE 1KDQA 1ELBA 4WF8A 3ZVGA 1PQ8A 1W11U 1VGCC 4K1SA 2VH0A 3M37A 3TK6A 3PMHB 4JMYA 1S5SA 3RXMA 1V6DA 1ANDA 3DD2H 1GBJA 4X6OA 3BV9B 1GI4A 1UCYE 2ZZUH 1GHBF 1AN1E 3E1XB 4K8YA 5JBTA 3P8OA 1EJMA 2W5EA 1MCTA 2AIQA 2WUCA 1NU9A 3HKJB 4IC5A 3S9BA 2BHGA 2FEQH 1KXCA 1SC8U 1O36A 4YT7H 1QJ6B 2UUYA 2BTCE 1GI0A 1GBDA 4HTCH 3SUFA 1OWIA 1C1QA 4FUJA 1ELTA 5F8TA 4YT6H 4WH8A 5L2YH 1BRUP 1S0RA 3KHVA 3SZNA 5EOKA 1HJAB 5EG4A 1GJAB 5CE1A 2BLQA 1O38A 2GZ9A 1PPBH 2Y7ZA 2H2ZA 1J9CH 2OC8A 4WY3A 4OGXA 1C2GA 3BTGE 1DSTA 1EAXA 1WQVH 5A0CA 3PLPA 1DDJA 1TGTA 3HGNA 2J38A 2PLXA 3S7HB 4DT7B 1D9IA 2VBCA 5FX5A 1VZQH 6GCHG 1PPHE 1K1OA 2BXUH 4I8KA 3SBKA 3LH3A 4FVBA 2ANYA 2QN5T 3DA9B 1LPZB 3FP6E 1GWAA 2IJOB 1ETTH 2C8ZB 3PMJA 2HOBA 1EX3A 3BIUH 3L6PA 1HPGA 2Z3DA 2R2MB 5JBAS 4BAQB 2BY5X 2ESTE 2A4RA 4WXIA 1C1RA 2GD4B 1MU6B 4AGJA 3MNCA 1D6RA 1IQMA 1GJ8B 9LPRA 2BLWA 2I6SA 1JWTA 1BQYA 2ANWA 5EW2H 1DS2E 4X1QU 2VH6A 2STBE 1UVOA 2Z7FE 5GDSH 1TBRH 1GL1A 1D3DB 1MTNC 1HB0B 4HFPB 1RD3B 1V2QT 4UE7H 5ESBA 2ZDKA 2EA3A 1RTLA 2ZFTA 3QZRA 3RXKA 3KQBA 6GCHF 3S9CA 1O3CA 2ZU2A 3BTTE 2PGQB 2XWBI 2SGAA 4OS7A 3RXRA 1D6WA 1SQOA 3MTYA 1FMGA 1DM4B 1EKBB 2BLOA 1SMFE 1P57B 3OY5U 1XKAC 4RI0A 2CF8H 2VIQA 1RFNA 3GCTF 2GZ7A 1Y59T 2ALVA 2AEIH 2PKSB 3RC5A 1C5PA 3QZQA 2ZFPH 2BDHA 3SJ8A 1A0HB 1FDPA 4MPWA 3A86A 1A2CH 1WOFA 3SV7A 4Y71A 1DXPA 1QCPA 1XUGA 1O5FH 1TMBH 5JBCS 2A0QB 4MPUA 1A0LA 3RMMH 1GMHF 2W3IA 1SHYA 2TRMA 1P12E 4NCYA 1Y3UA 2BY7X 3G01A 1GMCF 2GVFA 4WMEA 2UWOA 3ENSB 1LTOA 3ODFA 3UFAA 3K9XB 5ABWA 1BBRH 2QYIA 1C1WH 1C1TA 3HK6B 2GCTC 3F68H 5B6LA 1T4UH 4D9RA 1DANH 1ELFA 2ASUB 1GI9B 1ARCA 2Y5HA 4A1VA 5J4SA 3HKIB 1FIZA 4X2XA 2P3TB 2H9HA 1EZXC 1CA0C 1LPKB 2A7JA 2NU2E 2FIRH 3TH3H 2HRVA 4X1PU 1FJSA 3SU6A 2OBQA 1A1RA 2QAAA 1Z6EA 3RMNH 3Q3YA 1W8BH 2TPIZ 1O2OA 1OXGA 4ZHMU 5T3HA 2BDYA 1GI5A 3BN9A 1YBWA 4KELA 2F9PA 3NCLA 3TGJE 4NIWA 2KAIA 2YNAA 4M7GA 2THFB 3BTHE 1WCZA 1UVUH 5DP8A 1F5RA 4O3TA 4MPVA 6ESTA 1E0FD 2ZNKH 5EU8A 1E36B 3PTNA 3RXIA 3BTDE 4DG4A 4Q7XA 1GJ6A 1LCYA 3TJUA 2FYRA 1NRNH 1Y3YA 1H8IH 1GJ4H 1YCPM 3RXPA 3U69H 3UQVA 2OC7A 2BYAX 1UTPA 4Y79A 2FOGA 1UTKA 1K1NA 1WYKA 4H6TA 3SU5A 2ZU4A 2RDLA 4U01A 3DHKH 3CP7A 1UHBA 1BTZA 2STAE 2FOMB 2G5VA 4O03A 3VGCB 1ELCA 2ZPRA 3Q76A 3UWIA 2BD9A 2BD4A 1S6FA 3SV6A 4B75A 1XXDA 3F1SB 4RKOB 1V2MT 1E38B 1FY4A 4ISIH 5LPRA 5GCHG 1YC0A 1C2KA 1ETSH 2AYWA 4X6NA 3RLYH 3I78A 1CT2E 3QGNB 3MI4A 3ITIA 1K21H 3QX5H 2Y5GA 4BOHA 1G2MA 1GVKB 1IQLA 2Z3CA 1XM1A 4GCHF 4AGKA 2Z94A 4FUEA 1ETRH 1NFXA 1P04A 3S9AA 1XMNB 1C5WB 3AAUA 1EOLA 4GPGA 1KTSB 3OX7U 3A85A 4TY7A 2P8OC 1UTMA 4K1EA 1P2KA 1ZJKA 1CQQA 1ZMJA 3D49H 3RU4E 1TMTH 3P8FA 1O5BB 1J16A 1P03A 3PMBB 3MYWA 1Z8RA 1RS0A 3GDSA 2A1DB 1YF4A 5JYIA 4GUXA 8GCHF 3MU4A 3O8RA 3SN8A 3MNBA 5K7RA 2AH4X 1SGDE 1UVSH 4WMDA 2G4UA 4YOIA 1BMLA 2J2UA 2J92A 1S81A 5T6GA 1WUNH 1BTYA 1ZRBA 5A8ZA 2FLBH 1C1OA 4BTUB 2ZTZA 3RM0H 3L33A 3M35A 2Q6FA 4I8LA 2BLVA 3VXFH 1ZR0A 4CRGA 1O2HA 4Y7AA 4A1TA 2A5IA 3ZV9A 1O5CB 1EAIA 1C4Y2 2O9QA 3EQ0H 1O2WA 3ZVBA 1C1NA 4F49A 1X7AC 1A46H 2ZFFH 1GBFA 4IMQA 3K6ZA 4CRAA 2WPIS 2ZHQH 1TGSZ 2CGAA 3U1JB 4NZQA 1CBWB 4TPIZ 4YLQH 3TNTA 2W26A 3S0NA 4AG2A 2PTNA 1HDTH 1O5EH 4BAOB 1DICA 2H5DA 2XTTB 5EQQA 1GBEA 5E0HA 1C9TA 4E7RG 3GCHB 3SJKA 1TNHA 2AGEX 5FXLA 2HALA 2A7HA 1K22H 1MU8B 2A5AA 1EP5A 4XBBA 5DJ7A 4YM9A 5EQSA 4ZKNU 1SGIB 4OS1A 2OCVB 2GT7A 1FPHH 1BITA 1F0TA 1ZZZA 1QB1A 3VGCC 3LONA 1Z7KA 2CMYA 1GHXH 3LDXH 1MH0A 1MTUA 4JZFH 1WBGB 2OUAA 1ZRKA 3ZVEA 7ESTE 3ZZ5A 4CRDA 1C5MD 4X8TH 1O2NA 1WV7H 1KXFA 2GZ8A 1C5UA 2F91A 4DY7B 2PHBA 1OPHB 2AMQA 1TE0A 2QF0A 4ISHH 1MQ6A 1JMOH 2ZU5A 3TLOA 2V3HH 3MOCA 2SNWA 4ISLA 4Q7YA 1ABJH 1O5GH 3RXQA 2GCHF 2D2DA 3EAJA 1GG6C 3KQDA 3IWMA 3LGUA 1SGYE 5AFYH 1P3EA 1Z8JB 4CHAC 3URCA 1O3EA 3D62A 1TQ7B 4Y11E 4RN6A 2ZU1A 2VIDA 2H9EH 4FU9A 2EEKA 1JRTA 3W95A 5C3NA 1G32B 1NTPA 5DP9A 1Z6JH 1O3NA 1ZHPA 1LHGH 1G3EA 1C9PA 5IDKA 2FPZA 1UTJA 4AFUA 5A8YA 5E0JA 3TVJB 3R0FA 1DLKB 1SGCA 1SGNE 2FI3E 3A7WA 1TAWA 4NA8A 1P09A 1RTKA 1F7ZA 2RA0A 1DFPA 1DVAH 3F9GA 4DURA 1T8LA 3NWUA 2A2QH 3D65E 1ZTKA 2ZCLP 2C8XB 3LIWA 4OS2A 4U32A 1SR5C 3Q3KA 1SGPE 1V2NT 2EI8A 1A5IA 1A5GH 2XBVA 4WH6A 4CBOA 3A7TA 4JZ1A 4BTIB 1CT0E 1DPOA 1XVMA 2Z9GA 5C2ZA 1PPCE 4ZKOU 1IQEA 1F92A 1YCPH 1YLDA 2P59A 1HJAC 3ZZ8A 3F9HA 1V2RT 5GCHF 3ZZ6A 1O2LA 4JZDH 1QRXA 1TONA 1GDQA 3QN7A 1ZLRA 5IYTA 2J34A 4TWYA 4MLFB 4A7IB 3DFJA 1LKBA 1EZQA 1H9HE 1O3HA 1ZPBA 1C2LA 1HAGE 5HM2A 2WV9A 4IW4E 2J95A 1ABIH 2ODQA 3FP8E 2BDCA 3STIA 2QIQA 4WVPE 2GDDA 1IHSH 1HXEH 5DPAA 1XUIA 1V2WT 2JH5D 2PUQH 3TJNA 1EB1H 3HGPA 3ZVFA 2Z9IA 4LZ1H 4X2VA 1N6YA 5EXLA 2WV5A 1VCPA 1ZPCA 4MDSA 1Y5AT 1QR3E 1TBZH 1C4V2 1MUEB 5L6NH 2ZDVH 3H09A 1QQ4A 3PWBA 2PKAA 2PUXB 1GJDB 1QY6A 3IITA 3MHWU 1XUHA 3A7YA 1HBTH 4ZROA 3RXOA 1CGIE 1W3CA 2FOHA 1HGTH 4IBLH 5PTPA 2ZHEH 5GXPA 4ABAA 3NKKA 3GYMA 1GGDC 2WHXA 1SGFG 5GPIB 1P2NA 3U8OH 7GCHF 3SGQE 1NESE 5EQRA 3RMLH 2BQWB 1PQ5A 5I25A 4BAHB 3QTVH 1ARBA 2VWNA 3U1IB 2BMGB 2C90B 1NO9H 1LVYA 6CHAC 5JPMH 2ZPQA 5CHAB 1OP8A 1U6QA 1WXRA 1NZQH 1O2UA 1ZMLA 2RG3A 3PB1E 4B2CA 4X1NU 3FP7E 4CH8B 2DE9A 1FPCH 2BQ7B 1AUTC 1K1PA 2CF9H 3U9AH 1YPMH 1GI6A 3KEEA 2A32A 1GMHG 1GCTB 1BMNH 2ZU3A 4JYTA 4H6SB 3VPKA 2AMPA 1ELAA 7GCHG 1UJ1A 2P8OB 3M5NA 4JK5A 1QHRB 1C1UH 3VXEH 1NFWA 3DT0H 1IQJA 2BVXH 3ZV8A 2WPKS 1O2IA 1MTNB 1C2MA 4BNRA 1FONA 1TA2A 1C1MA 4K60A 4AORA 3A7VA 3RXBA 5H4IB 3VEQB 1ZPZA 1F0SA 2HWLB 1AZZA 4GHQA 2ZP0H 1C2IA 2OP9A 2OC0A 4ABDA 4BTTB 3RC6A 1KLIH 1O3BA 3TITA 3A8BA 5C1XA 3Q00A 3LGIA 3KIDU 1YP9A 2TGTA 2BDIA 1A61H 1BTXA 3RXDA 2F9BH 3GICB 1FAXA 2EI6A 1AI8H 4Y6DA 3NK8A 3SU1A 1PQAA 1KXDA 4M9FA 1AVGH 4RKJB 1OYTH 1UVPA 5LPEA 4WJG2 3GY3A 4I32A 2FM2A 5DK1A 3M5LA 1ESTA 1GDNA 2EC9H 2FO9A 2FP7B 3KGPA 2ZGHA 4X2YA 3SHCH 1CU1A 3AAVA 4AFZA 1SGFA 5AVDA 4KTUA 4SGBE 1DWEH 2A45B 4HI3A 5T6DA 3GCNA 3VB3A 3NXPA 1AB9C 1FUJA 1VCWA 1BMMH 1GHVH 1J8AA 4INLA 4KTCA 4JZEH 4ABGA 1YPEH 1EPTC 5SGAE 2XNIA 5HMAA 1IQFA 1TOCB 1OYQA 1HAYB 1FY5A 3GDUA 2Q6DA 1BBRK 1BMAA 4MVNA 2BX3A 3A82A 1J17T 1OKXA 1C4U2 4O3UA 1DXWA 3E8LA 4NWLA 1IQNA 1N6XA 1LQDB 1EJAA 1GHAG 1AO5A 1O2TA 1QB6A 1VCQA 4Q7ZA 1JIMA 1AFEH 1YPKH 5E2OA 4ABFA 2ZHFH 1MZAA 1O37A 1OWJA 2ZEBA 3QTOH 4CRBA 1UTQA 1EOJA 2WPLS 2R3UA 3MH5A 2GV7A 3PLKA 1TRMA 1A3EH 3RU4T 3RXLA 3M5MA 1UCYH 2QY0B 1QL8A 1INCA 2WZQA 3ZZ7A 3ZZ3A 3V0XA 3A8CA 1DWDH 5EW1H 2GTBA 2BXTH 1NT1A 1T4VH 3M7TA 5C5NA 2FTMA 2P3UB 5HM9A 3SQEE 2WYJA 5E8EH 1GBCA 4GVUA 1TA6A 1O39A 2FODA 4CH2B 2HGTH 1SSXA 4I7YH 5EPYA 2ZTXA 1GL0E 1GGDB 4RSPA 3K2UA 4X8SH 3Q3XA 2QXIA 2OTVA 1ZSKA 3FVFB 4BANB 3SNAA 1DWBH 8LPRA 1TX6A 1EP6A 1EXFA 2FOEA 3K6YA 1VITG 1WAYB 1ZHMA 1OP0A 4LXBH 3UTUH 4UONA 2Z9KA 3A8DA 1KY9A 2C4FH 1MAXA 5CHAC 2A4QA 2ZFRH 4AB9A 1C5VA 4AFQA 1OP2A 1LDTT 2G5NA 3GCOA 5A0AE 4B2BA 1HIAB 2PSXA 1XUJA 3A81A 1SQTA 2BD5A 2VINA 2PFEA 5JB9S 1GJ7B 1NRPH 2ULLA 5C1YA 1LVOA 1NFUA 5DP3A 4ABIA 1L1GA 1FQ3A 4ZMAH 2O8MA 1CE5A 1SL3A 1BDAA 2XWAA 1CHGA 1H9LB 2H5CA 3SV8A 4CRCA 1XKBC 2TBSA 3UWJH 5EODA 2W3KA 4XBDA 4CR9A 5HXFA 1P3CA 2C8WB 2P94A 4NFEA 4TPYA 3GY7A 1O3OA 4NWKA 1WTHD 1C2HA 1OWHA 1UK4A 4TY6A 5FHTA 4UEHH 1YYY1 1GMDG 1ZYOA 3T26A 4KTSA 3TH2H 3GY5A 2VIVA 3Q77A 1D3PB 1K2I1 2F9VA 3RXGA 1O31A 3BEUA 4YOJA 3RLWH 5C1UA 1ZOMA 2VIOA 1SLXB 4WMFA 1BRAA 3V13A 1BIOA 1L2EA 2Z9LA 3PWCA 1QB9A 3C27B 1MKXK 3ZYEA 3AW1A 2UWLA 3A84A 2OQ5A 1Y3WA 2IJD1 2JETB 2FYQA 1V2ST 2HNTF 3SNCA 1AY6H 3KF2A 3MU5A 2VGCC 1DUAA 2Z6BD 1V2LT 2B0FA 1FXYA 1TX8A 2TGDA 1O5DH 1BHXF 1H1BA 3SJIA 3P8NA 3STJA 2QXJA 2ZGCA 1DLEA 1Z8IB 4WXVA 1ELEE 1M9UA 3LKWA 1LQEA 3K65B 3UY9A 1GJ5H 2ILNA 4AX9H 1G3CA 3MNSA 4DOQA 2JETC 4ZAEA 4CHAB 1C5LH 1GCTC 3SJ9A 1DX5M 1SLWB 1XUKA 3P92A 3U98H 5HGGA 3U8RH 3FAOA 1O2QA 3TH4H 2SGDE 2QC2A 4SGAE 2C3SA 4YESB 2DUCA 1O32A 5A0BA 1QBOA 1B7XB 2OK5A 3M36A 4ISOA 1HCGA 2A7CA 1N8OC 1TABE 1TRNA 1K1JA 3ZVAA 3SNDA 1MTWA 1SGEE 2BD8A 2CHAC 2HPPH 3SU3A 2B5TB 1CGHA 3H7TA 2ANKH 1CT4E 1Y3XA 2GGVB 2WPJS 3CS0A 1WU1A 1WTGH 3SOSA 3UNRA 1P2OA 5F8XA 3LU9B 1QRZA 1GBBA 4NG9H 1ZSJA 1TFXA 1RIWC 2BVSH 2GP9B 3RXUA 4FU8A 1G36A 2PTCE 1OS8A 3UOUA 7LPRA 2SGQE 4UFFH 1S84A 1ZJDA 2VNTA 2QCYA 1UHBB 3GDVA 2FOFA 3M3TA 3P17H 1O2YA 4NGAH 3ATKA 3C1KA 3GY4A 4H4FA 1IOEA 2UWPA 4ABBA 1VITH 1NY22 1S6HA 4FUIA 2BOKA 4B6FA 5FCRA 3EGKH 4E7NA 3PTBA 3QLPH 2VU8E 3EE0B 3U8TH 3GY6A 4I8GA 1FV9A 3KQCA 3RXJA 1DE7H 1SLUB 4LZ4B 4NSVA 3BTEE 2B8OH 3ATWA 2ZO3H 1KTTB 2J9NA 3ESTA 4OS4A 3TK5A 3UQOA 2ZFSA 5C20A 1ELVA 1BZXE 4TYDA 4FUDA 1HAXB 3L3TA 1O2XA 4B1TA 2H9TH 3SYJA 2RCEA 1XX9A 3VB7A 1C5RA 1TRYA 1AVWA 2V3OH 1ELGA 1EZUC 4X6PA 4AYVB 3CENA 1AE5A 4U30A 1ANEA 1DOJA 1C2EA 1QFKH 1O3PB 2P93A 3BTWE 2D26C 5I46H 3RM2H 1RTFB 5ESTE 1QRWA 5J4QA 3LC3A 3EA9A 2BX4A 1UTLM 1S85A 1O3GA 3EA8A 3PLBA 1P11E 4ZH8A 1O0DH 5FAHA 3MH7A 2G52A 3VB5A 2AMDA 1ZTLA 2UUKB 1BB0B 3JZ1B 4X1RU 1F2SE 1G3DA 4VGCB 1EB2A 1LHDH 1O2JA 1QA0A 3KNXA 4UFEH 3BF6H 1T8OA 3OU0A 1NRRH 3E0PB 1DY9A 3LJOA 1B0FA 2C8YB 3A83A 4Y8XA 4CREA 2HVXA 1E37B 1ORFA 3PV5A 1Y5BT 2PWXA 2Y81A 4O9VA 4X8UH 1G2LA 3SQHE 2FI5E 2Y82A 1K1LA 1TPAE 1TX7A 3H5CB 1NS3A 6CHAB 1NROH 2BD3A 1GBKA 2P16A 1BTHH 2C93B 3GISB 3QDZB 4IMZA 1SOZA 4IS5A 1QA7A 1BTWA 5DGJA 1CA8B 2Y80A 2ZPSA 3QO6A 3ATLA 4THNH 2FXRA 1O2SA 2BY8X 3BTKE 1DSUA 3TNSA 2OC1A 1RIWB 1GMDF 1AQ7A 5FBIA 1HAVB 3T29A 1G9IE 4K3JA 4YTAA 1HAVA 1BOQA 4A6LA 1IHTH 1XVOA 4GCHG 1AIXH 1GI1A 3SZEA 3TK9A 1GVLA 4NIVA 1V2UT 2BZAA 1C5NH 4JCNA 4I8JA 2HNTE 1LHEH 3W94A 1OX1A 1ZMNA 1NFYA 2W7SA 3RDZA 1YPGH 1C5QA 2UUJB 3LPRA 3LGYA 1W2KH 4CRFA 3MH4A 2ZC9H 4FUCA 3I29A 2V6NA 2NWNA 1W12U 1TYNA 1YPJH 2B9LA 2GX4A 2O8TA 1IQKA 1DT2A 2ZCHP 3FZZA 5E0GA 1TNLA 4TWWA 4NZLA 1AU8A 1YPHC 5EPNA 2BM2A 1P2QA 3BG8A 4INHA 1SQAA 4DVAU
chains in the Genus database with same CATH superfamily
1O30A 1P9UA 3OFND 4ZKRU 1PYTC 1P2IA 1TNKA 1P8VC 4AOQA 2VIPA 1ZSLA 2QXHA 4IC6A 2ODPA 1HFDA 2BY9X 2O8LA 1CVWH 1KMHB 2BY6X 1AMHA 4GAWA 4A1XA 4FUGA 1BTUA 1XXFA 1GBMA 1O2KA 1CBWC 2J5UA 2ZA5A 3A89A 1TGBA 4XD7D 1GPZA 1QJ1B 2H1UA 3M5OA 3RUOA 2FS8A 1BJUA 1C5OH 2PSYA 4AN7A 2A5KA 1EUFA 4I8HA 4K1TA 3BTFE 1RJXB 4K2YA 1ELDE 2J4IA 2V0BA 1O3KA 1P9SA 1AE8H 1YGCH 3BTQE 3EA7A 1C2JA 1TNIA 4Z0KA 2ZG0H 5E2PA 2SFAA 3ATMA 1K9OE 1KYNA 3GY2A 4MNXA 2XRCA 2LPRA 1G37A 1Y3VA 2Q6GA 2WPHS 1MCVA 2KCPA 1QBVH 1EJNA 3R3GB 2FTLE 1F0UA 1MKXH 3ZVCA 1JOUB 2V7QD 1TNJA 2AGIX 4P02A 4CR5A 2HNTC 3AK5A 1EATA 1GHYH 5EGMA 2ZHDA 3IG6B 5K0HA 2CHAB 2Z3EA 4JYVH 1AGJA 1KLJH 2VJ1A 4PROA 1W13U 2CN0H 3MU8A 3SGBE 1W14U 2XBXA 1TPOA 1TWXB 1A7SA 4K69A 4Y8YA 1Q3XA 2BVRH 5FPYA 2ZDLA 1OSSA 1THPB 1J14A 2CXVA 1V2TT 1TLDA 3OYPA 1GHZA 1GI3A 3HK3B 4Y0ZE 2SGEE 1SGTA 1ID5H 1V2JT 1UO6A 1DY8A 1H9IE 2OLGA 2VIWA 1PFXC 1O2VA 2VGCB 2ZWLH 3WWBA 1O3IA 4ZXXH 3N7OA 1MBQA 1Q31A 3SW2B 1UCYK 4B76A 1UTNA 1YPHE 3UOPA 4YZUA 4AG1A 1GHWH 5T1VA 1MTVA 1UW7A 1K1IA 1GBAA 3QUMP 2O8UA 4FUHA 4UFGH 1FN6A 1L4ZA 1YPLH 2PKAB 1ACBE 2FZZA 1AWHB 2ODYB 2RA3A 3BIVH 2XXLA 1FN8A 4U2WA 2KM0A 1C5SA 3D23A 2BQ6B 2FOBA 2NU3E 3P6ZB 4Y0YE 3WWFA 2EI7A 4KGAA 4MTBA 4ASHA 3ZYDA 2P95A 1TBQH 1MMJN 1E35B 2GDEH 4H42U 1AD8H 1AZ8A 3TJVA 3F0OA 2BDGA 1Y8TA 3P8GA 3UAIC 2BDBA 4NFFA 4E06H 1C2DA 2VWLA 5DP4A 1P0SH 2ALPA 5JBBS 1LO6A 1FNIA 4OS6A 4O97A 3KL6A 2FDAA 1ANBA 1G30B 2ZGXH 5FPSA 2AERH 3MNXA 2ZFQH 3M7UA 2BZ6H 3CS7A 2KCOA 4NA9H 3TPIZ 2XW9A 3PO1B 2BD7A 1YWUA 2HLDD 3TIUA 1EAWA 3TJOA 1D4PB 2XCFA 2FS9A 1HNEE 1NPMA 4B6EA 2YOLA 4JK6A 1PYTD 3PMAB 1KSNA 3RMOH 4GLYA 1S6LA 3S7KB 3EE7A 2QGRA 3A87A 1P01A 2XOKD 5FCKA 4BXWA 1GCDA 8GCHG 3A7ZA 1HAHH 3I77A 3LGTA 3SHAH 1SI5H 3PO1C 2QF5A 3PV4A 3AASA 4I86A 4MNWA 4FVDA 3GYLB 2JKHA 1SHHB 2V3MA 2GMTB 4X0WU 2CJIA 1P06A 4UFDH 1UK2A 1IAUA 2QV1A 1KXBA 1JIRA 1HAIH 1KLTA 2UUFB 4LOYH 3ZZCA 3SGAE 2QF4A 1MKWH 1LHCH 2F3CE 1QZ8A 1GBLA 3VB6A 5TCAA 2ZGJA 2VVVA 4A92A 2F4LA 2K8IA 1EAUA 1PPZA 4RT1A 5BPEA 4ZHLU 2FMJA 5DP5A 4AYYB 2XNDD 3T27A 1MQ5A 4K8BA 2FWWA 2TGAA 1BHXB 1EFRD 1TGCA 4X6MA 4ZHAA 1P02A 1ESAA 1YLNA 1SFQB 2J98A 5DKMA 2GMTC 3MU1A 1SGRE 1Z8GA 2IPHA 3HATH 3OY6U 1LMWB 2ZIQH 3MWIU 3SU0A 3T28A 1GI8B 1MBMA 6LPRA 1PQ7A 1NU7B 1C5TA 3LC5A 4XFQA 3MO3A 3UNQA 1LHFH 3ZZ9A 3LOXA 1KXAA 4D76A 2KX4A 3LJJA 1GBIA 3T25A 4JYUH 1CO7E 2BDAA 1W10U 3KQEA 3RC4A 4UDWH 1YLCA 1Z1IA 2ZHWH 3GY8A 5ETXA 3V12A 8ESTE 4A5TS 1C5ZB 4Y8ZA 3FFGA 1HAOH 1THSH 1IQHA 1O3JA 2JH6D 1VR1H 2HLCA 5L30H 2A4OA 3URDA 2XBWA 1B5GH 3EDXB 4J1YA 3E0NB 4B73A 1V2PT 1A0JA 4E05H 1O34A 2D8WA 2R9PA 5CMXH 3E16B 3FKSD 4X1SU 1UVTH 2ZCKP 5TJXA 4FETA 1O2MA 3LGVA 4Y10E 1ZGIA 2R3YA 4DIHH 1W0ZU 3ZZDA 1C1PA 3BEFB 1P2JA 1SPJA 1YKTA 3SI4H 3LT3A 1Q2WA 2DE8A 1VJ9U 4YOGA 3NPSA 1D3QB 2J94A 2G4TA 5EXNA 2A31A 3ZZBA 2OXSA 3RXHA 1SVPA 4GSOA 1LPGB 4J2YB 2WV4A 1LVMA 2W6JD 4HGCA 3MFJA 3M7QA 3P70B 1QL7A 8KME2 1E1RD 4B74A 1UMAH 2FX4A 2Q1JA 5G4BA 1GDUA 1BUIA 1TALA 4OM9A 1B0EA 2R0KA 2F43B 1GG6B 2BB4A 3PV2A 5GIBA 1C5YB 1O2ZA 3SNEA 3SI3H 1VGCB 2ZECA 3E3TA 2QA9E 1NC6A 3H7OA 2AHME 2VB0A 3A80A 1QURH 3SUEA 3VB4A 3RXVA 5F03A 4ABEA 3BG4B 3PM3A 1GJCB 2XC4A 3MO6A 5GWZA 1ZTJA 1OWDA 1UTOA 4D9QA 1OOKB 1FZZA 1T32A 4DGJA 1HV7A 2OINA 1H4WA 1KDQB 1AKSA 1AKSB 1HAZB 2ZDNA 2GT8A 4Q80A 3BSQA 1BJVA 2FOCA 3SUGA 1C2FA 3BG4C 1NN6A 1O3FA 1GBHA 1T7CA 5KEDA 5DP7A 2AFQB 1O2RA 3F9EA 2XBYA 1FY8E 3RXFA 3HPTB 2PKSC 1TB6H 1WSSH 4IN2A 1TGNA 1MKWK 2TIOA 3P95A 4TT3D 1QGFA 1NRSH 1GVZA 3JZ2B 2R0LA 4XSKU 3KCGH 5LH8A 3GCTG 2QF3A 2O8WA 3PROA 2GKVE 4R0IA 1MD8A 3KN2A 1HJ9A 3RXTA 5DP6A 1TIOA 3KQ5A 2ZQ1A 1FLEE 5A8XA 1SLVB 1F0RA 2F9OA 1QNJA 1TOMH 2XYAA 4OGYA 1W7GH 3AVZA 2A2XH 4I33A 1C1SA 4B2AA 1FY1A 4DIIH 4BAMB 1G3BA 1GI7B 1V2KT 2G8TA 4Y76A 4OS5A 5A2MH 2ZTYA 2FX6A 4BXSA 3QWCH 3DSGA 1JRSA 2A4GA 5LGOA 1VKYA 3SJOA 1PJPA 2GCTB 1T8NA 3EYDA 3MU0A 1LKAA 3DUXH 4B71A 2ZDAH 1ANCA 3B9FH 3TGIE 4HG6A 1K1MA 2HPQH 1EASA 3DFLA 5HKKD 3M3VA 2BOHB 5FX6A 1FI8A 1L1JA 2XC5A 4ZUHA 1O3LA 1FAKH 1KIGH 3UREA 3QK1A 1HJ8A 1T8MA 1QIXB 4WWYA 3A8AA 1TQ0B 2WPDD 4ISNA 1W7XH 3SNBA 1CHOF 1HIAA 1GBTA 2M5TA 2WINI 2Z9JA 1BBRE 2ZF0H 2G00A 1CSOE 3ATIA 2CV3A 1HYLA 2K1QA 4XBCA 5L2ZH 1YM0A 1PPGE 3E90B 1O5AB 2G51A 4NIYA 4DCDA 3E6PH 1T31A 4MNYA 4MQAA 3T62A 1ESBA 2B7DH 3UR9A 2ANMH 1RGQA 3UIRA 1V3XA 1EPTA 3AW0A 3RP2A 4F4OC 1GHAF 1GHBG 3LH1A 2OQUA 1O3AA 1V2VT 3GOVB 2JJ1D 2BD2A 7KMEH 1CHOG 2GCHG 1C5XB 2P3FH 1FIWA 3MH6A 1NRQH 1OWEA 2SNVA 3A7XA 3ZZAA 1EZSC 1BA8B 1N8OB 1BT7A 2ZGBH 2F9NA 4D7GA 4Q2KA 3MMGA 3M61U 1TNGA 4X8VH 1A3BH 1GI2A 4K5ZA 4R8TB 5JDUB 4ZKSU 1CGJE 1S0QA 1P05A 4CBNA 1L4DA 3B8JA 2K0QA 3NRLA 2XC0A 1KXEA 1MTSA 5LPFA 2W7UA 3ELAH 1AUJA 4FUBA 1HXFH 1Z1JA 1AWFH 2FESH 1YCPK 3NZIA 1GJ9B 1O33A 2OD3B 4AFSA 2PV9B 5DG6A 4I31A 2F9UA 1SB1H 2NU0E 4XOJA 3RXAA 4IN1A 4DW2U 2ZKSA 4NIXA 1DITH 2LNCA 4MPXA 4JZIA 1IQIA 5AF9H 3LGWA 3ZZ4A 1K28D 1PPEE 3WW7A 1EPTB 5EXMA 1Z71A 1S82A 4ZXYH 2ZQ2A 1BRBE 3ODDA 2ZDMA 4KP0A 4Z6AH 1SGQE 1MZDA 2I6QA 3PYHA 3UPEA 5C0UA 5FL7D 2F83A 1F5KU 1GMCG 4D8NA 1H8DH 3O8BA 2G55A 2AS9A 1HUTH 2QXGA 5TCCA 4MNVA 1OWKA 2KAIB 3MO9A 2FI4E 1AHTH 1O2GH 3OTJE 4HZHA 3WY8A 1NM6A 4FU7A 4Q63A 1IQGA 2ZI2H 1SOTA 4XE4A 4AB8A 3SORA 2PGBB 2JJ2D 3RXCA 3ZVDA 1E34B 4ABHA 2IOTA 2GV6A 4NA7A 3FN8A 5JB8S 2Y7XA 4FXGH 1AB9B 4FUFA 1O3MA 4NSYA 1WQSA 1HLTH 1CA0B 3A88A 1BCUH 1N1LA 1DUEA 4INKA 2WUBA 3F9FA 5DO4H 1A4WH 2NU1E 1D3TB 3T2NA 2H6MA 3SV9A 2Y5FA 5C67A 1OHHD 3UUZA 4XDEA 3RXEA 3GCHC 5AFZH 1AFQB 2D1JA 4RT0A 5GNDA 1TPSA 4VGCC 1QJ7B 1TPPA 4GHTA 4YO9A 2IN2A 1SBWA 3V3MA 5FPTA 4LK4A 3NUMA 1RXPA 3BEIB 5A09A 1RRKA 1ZGVA 1S83A 2AIPA 4IGDA 3E91A 1DWCH 4X2WA 3SO3A 1AFQC 5KECA 3TGKE 3B23B 1V2OT 3S69A 1THRH 4F55A 1Y5UT 2OBOA 3OSYA 2VVUA 2W6ID 1BTPA 4UD9H 3RU4D 1W0YH 2AGGX 3M3SA 4BAKB 1EQ9A 2WSSD 2TGPZ 4MG3A 3VFEA 4ABJA 1VJAU 1FY3A 1XUFA 3F6UH 2FLRH 9ESTA 3SU2A 3SU4A 1SG8B 5AHGH 1BRCE 2PW8H 1L1NA 3UR6A 1O35A 1GJBB 4Y7BA 1UK3A 5GJ4B 4DJZB 1SQRA 2Y6TA 1QTFA 1TMUH 5HYOA 1PPFE 1JXPA 3KYFA 1P2MA 4KKDA 2KCYA 5F6MA 3FZDA 1A5HA 2SGPE 1VITF 5C5OA 1MD7A 1P10A 2G81E 1C1VH 3QGJA 2VWMA 1HRTH 1O2PA 4D7FA 3O8DA 3FANA 3RXSA 3BTME 3TU7H 4AZ2B 2XCNA 3F2HA 3O8CA 1L0ZA 1MAYA 1JBUH 2WYGA 1QL9A 5F8ZA 2NU4E 1AVXA 2YNBA 3OTPA 1QBNA 5FBEA 5B6OA 2HVYB 2EQNA 2PR3A 1ZHRA 2R2WU 4ZCNA 1HAPH 3UNSA 2VVCA 2JH0D 3N7DA 5T6FA 1LVBA 3T5FH 3SV2H 1SFIA 1O3DA 3V7TA 2WPMS 1J15A 5BRRE 1F5LA 2VWOA 3CNRA 4YLUA 2V35A 4QT8C 3SUDA 2SGFE 2FOAA 1QQUA 4ESTE 1KDQA 1ELBA 4WF8A 3ZVGA 1PQ8A 1W11U 1VGCC 4K1SA 2VH0A 3M37A 3TK6A 3PMHB 4JMYA 1S5SA 3RXMA 1V6DA 1ANDA 3DD2H 1GBJA 4X6OA 3BV9B 1GI4A 1UCYE 2ZZUH 1GHBF 1AN1E 3E1XB 4K8YA 5JBTA 3P8OA 1EJMA 2W5EA 1MCTA 2AIQA 2WUCA 1NU9A 3HKJB 4IC5A 3S9BA 2BHGA 2FEQH 1KXCA 1SC8U 1O36A 4YT7H 1QJ6B 2UUYA 2BTCE 1GI0A 1GBDA 4HTCH 3SUFA 2YMSC 1OWIA 1C1QA 4FUJA 1ELTA 5F8TA 4YT6H 3MQKC 4WH8A 5L2YH 1BRUP 1S0RA 3KHVA 3SZNA 5EOKA 1HJAB 5EG4A 1GJAB 1MABB 5CE1A 2BLQA 1O38A 2GZ9A 1PPBH 2Y7ZA 2H2ZA 1J9CH 2OC8A 4WY3A 4OGXA 1C2GA 3BTGE 1DSTA 1EAXA 1WQVH 5A0CA 3PLPA 2YMSB 1DDJA 1TGTA 3HGNA 2J38A 2PLXA 3S7HB 4DT7B 1D9IA 2VBCA 5FX5A 1VZQH 6GCHG 1PPHE 1K1OA 1E1QD 2BXUH 4I8KA 3SBKA 3LH3A 4FVBA 2QN5T 2ANYA 3DA9B 1LPZB 3FP6E 1GWAA 2IJOB 1ETTH 2C8ZB 3PMJA 2HOBA 1EX3A 3BIUH 3L6PA 1HPGA 2Z3DA 2R2MB 5JBAS 4BAQB 2BY5X 2ESTE 2A4RA 4WXIA 1C1RA 2GD4B 1MU6B 4AGJA 3MNCA 1D6RA 1IQMA 1GJ8B 2LELA 9LPRA 2BLWA 2I6SA 1JWTA 1BQYA 2ANWA 5EW2H 1DS2E 4X1QU 2VH6A 2STBE 1UVOA 2Z7FE 5GDSH 1TBRH 1GL1A 1D3DB 1MTNC 1HB0B 4HFPB 1RD3B 3OAAD 1V2QT 4UE7H 5ESBA 2ZDKA 2EA3A 1RTLA 2ZFTA 3QZRA 3RXKA 3KQBA 6GCHF 3UB0A 3S9CA 1O3CA 2ZU2A 3BTTE 2PGQB 2XWBI 2SGAA 4OS7A 3RXRA 1D6WA 1SQOA 3DSPA 1W0KD 3MTYA 1FMGA 1DM4B 1EKBB 2BLOA 1SMFE 1P57B 3OY5U 1XKAC 4RI0A 2CF8H 2VIQA 1RFNA 3GCTF 2GZ7A 1Y59T 2ALVA 2AEIH 2PKSB 3RC5A 1C5PA 3QZQA 2ZFPH 2BDHA 3SJ8A 1A0HB 1FDPA 4MPWA 3A86A 1A2CH 1WOFA 3SV7A 4Y71A 1DXPA 1QCPA 1XUGA 1O5FH 1TMBH 5JBCS 2A0QB 4MPUA 1A0LA 3RMMH 1GMHF 2W3IA 1SHYA 2TRMA 1P12E 4NCYA 1Y3UA 5DN6D 1H8ED 2BY7X 3G01A 1GMCF 2GVFA 4WMEA 2UWOA 3ENSB 1LTOA 3ODFA 3UFAA 3K9XB 5ABWA 1BBRH 2QYIA 1C1WH 1C1TA 3HK6B 5C94A 2GCTC 3F68H 5B6LA 1T4UH 3N7EA 4D9RA 1DANH 1ELFA 2ASUB 1GI9B 1ARCA 2Y5HA 4A1VA 5J4SA 3HKIB 1FIZA 4X2XA 3W1EA 3F0PA 2P3TB 2H9HA 1EZXC 1CA0C 1LPKB 2A7JA 2NU2E 2FIRH 3TH3H 2HRVA 4X1PU 1FJSA 3SU6A 2OBQA 1A1RA 2QAAA 1Z6EA 3RMNH 3Q3YA 1W8BH 2TPIZ 1O2OA 1OXGA 4ZHMU 5T3HA 2BDYA 1GI5A 3BN9A 1YBWA 4KELA 2F9PA 3NCLA 3TGJE 4NIWA 2KAIA 2YNAA 4M7GA 2THFB 3BTHE 1WCZA 5HIYA 1UVUH 5DP8A 1F5RA 4O3TA 4MPVA 6ESTA 1E0FD 2ZNKH 5EU8A 1E36B 4FOUC 3PTNA 3RXIA 3BTDE 4DG4A 4Q7XA 1GJ6A 1LCYA 3TJUA 2FYRA 1NRNH 1Y3YA 1H8IH 1GJ4H 1YCPM 3RXPA 3U69H 3UQVA 2OC7A 4AC9A 2BYAX 1UTPA 4Y79A 2FOGA 1UTKA 1K1NA 1WYKA 4H6TA 3SU5A 3OE7D 2ZU4A 1WDIA 2RDLA 4U01A 3DHKH 3CP7A 1UHBA 1BTZA 2STAE 2FOMB 5EJLA 2G5VA 4O03A 3VGCB 1ELCA 2ZPRA 3Q76A 3UWIA 2BD9A 2BD4A 1S6FA 3SV6A 4B75A 1XXDA 3F1SB 4RKOB 1V2MT 5EJ1A 1E38B 1FY4A 4ISIH 4XRNA 5LPRA 5GCHG 1YC0A 1C2KA 1ETSH 2AYWA 4X6NA 3RLYH 3I78A 1CT2E 3QGNB 3MI4A 3ITIA 1K21H 3QX5H 2Y5GA 4BOHA 1G2MA 1GVKB 1IQLA 2Z3CA 1XM1A 4GCHF 4AGKA 2Z94A 4FUEA 1ETRH 1NFXA 1P04A 3S9AA 1XMNB 1C5WB 3AAUA 1EOLA 4GPGA 1KTSB 3OX7U 1NBMD 3A85A 4TY7A 2P8OC 1UTMA 4K1EA 1P2KA 1ZJKA 1CQQA 1ZMJA 3D49H 3RU4E 1TMTH 3P8FA 1O5BB 1J16A 1P03A 3PMBB 3MYWA 1Z8RA 1RS0A 3GDSA 2A1DB 1YF4A 4Q4LA 5JYIA 3PRDA 4GUXA 8GCHF 3MU4A 3O8RA 3SN8A 3MNBA 5K7RA 2AH4X 1SGDE 1UVSH 4WMDA 2G4UA 4YOIA 1BMLA 2J2UA 2J92A 1S81A 5T6GA 5HIZA 1WUNH 4ACAA 1BTYA 1ZRBA 5A8ZA 2FLBH 1C1OA 4BTUB 2ZTZA 3RM0H 3L33A 3M35A 2Q6FA 4I8LA 2BLVA 3VXFH 1ZR0A 2GJGA 4CRGA 1O2HA 4Y7AA 5EIYA 4A1TA 1E79D 2A5IA 3ZV9A 1O5CB 1EAIA 1C4Y2 2O9QA 3EQ0H 1O2WA 3ZVBA 1C1NA 4F49A 1X7AC 3FO8D 1A46H 2ZFFH 1GBFA 4IMQA 3K6ZA 4CRAA 2WPIS 2ZHQH 1TGSZ 2CGAA 3U1JB 4NZQA 1CBWB 4TPIZ 4YLQH 3TNTA 2W26A 5KGOA 3S0NA 4AG2A 2PTNA 1HDTH 1O5EH 4BAOB 1DICA 2H5DA 2XTTB 5EQQA 1GBEA 3FOAA 5E0HA 1C9TA 4E7RG 3GCHB 3SJKA 1TNHA 2AGEX 5FXLA 2HALA 2A7HA 4ASUD 1K22H 1MU8B 2A5AA 1EP5A 4XBBA 5DJ7A 4YM9A 5EQSA 4ZKNU 1SGIB 4OS1A 2OCVB 2GT7A 1FPHH 1BITA 1F0TA 1ZZZA 3U28C 1QB1A 2M2AA 3LONA 3VGCC 1Z7KA 2CMYA 1GHXH 3LDXH 1MH0A 1MTUA 4JZFH 1WBGB 2OUAA 3KYGA 2CK3D 1ZRKA 3ZVEA 7ESTE 3ZZ5A 4CRDA 1C5MD 4X8TH 1O2NA 1WV7H 1KXFA 2GZ8A 1C5UA 2F91A 4DY7B 2PHBA 1OPHB 3N99A 2AMQA 1TE0A 2QF0A 4ISHH 1MQ6A 1JMOH 2ZU5A 3TLOA 2V3HH 3MOCA 2SNWA 4ISLA 4Q7YA 1ABJH 1O5GH 5F53A 3RXQA 2GCHF 2D2DA 3EAJA 1GG6C 3KQDA 3IWMA 3LGUA 1SGYE 5AFYH 1P3EA 1Z8JB 4CHAC 3URCA 1O3EA 3D62A 1TQ7B 4Y11E 4RN6A 2ZU1A 3GS9A 2VIDA 2H9EH 4FU9A 2EEKA 1JRTA 2KCAA 3W95A 5C3NA 1G32B 1NTPA 5DP9A 1Z6JH 1O3NA 1ZHPA 1LHGH 1G3EA 1C9PA 5IDKA 2FPZA 1UTJA 4AFUA 5A8YA 5E0JA 3TVJB 3R0FA 1DLKB 1SGCA 1K0HA 1SGNE 2FI3E 3A7WA 1TAWA 4NA8A 1P09A 1RTKA 1F7ZA 2RA0A 1DFPA 1DVAH 3F9GA 4DURA 1T8LA 3NWUA 2A2QH 3D65E 1ZTKA 2ZCLP 2C8XB 3LIWA 4OS2A 4U32A 1SR5C 1BMFD 3Q3KA 1SGPE 1V2NT 2EI8A 1A5IA 1A5GH 2XBVA 4WH6A 4CBOA 3A7TA 4JZ1A 4BTIB 1CT0E 1DPOA 1XVMA 2Z9GA 5C2ZA 1PPCE 4ZKOU 1IQEA 1F92A 1YCPH 1YLDA 2P59A 1HJAC 3ZZ8A 3F9HA 1V2RT 5GCHF 3ZZ6A 2J97A 1O2LA 4JZDH 1QRXA 1TONA 1GDQA 3QN7A 1ZLRA 5IYTA 2J34A 3OEED 4TWYA 4MLFB 4A7IB 3DFJA 1LKBA 1EZQA 1H9HE 1O3HA 1ZPBA 1C2LA 1HAGE 2WV9A 5HM2A 4IW4E 2J95A 1ABIH 2ODQA 3FP8E 2BDCA 3STIA 2QIQA 4WVPE 2GDDA 1IHSH 1HXEH 5DPAA 1XUIA 1V2WT 2JH5D 2PUQH 3TJNA 1EB1H 3HGPA 3ZVFA 2Z9IA 4LZ1H 4X2VA 1N6YA 5EXLA 2WV5A 1VCPA 1ZPCA 4MDSA 1Y5AT 1QR3E 1TBZH 1C4V2 1MUEB 5L6NH 2ZDVH 3H09A 1QQ4A 3PWBA 2PKAA 2PUXB 1GJDB 1QY6A 3IITA 3MHWU 1XUHA 3A7YA 1HBTH 4ZROA 3RXOA 1CGIE 1W3CA 2FOHA 1HGTH 4IBLH 5PTPA 2ZHEH 5GXPA 4ABAA 3NKKA 3GYMA 1GGDC 2WHXA 1SGFG 5GPIB 1P2NA 3U8OH 7GCHF 3SGQE 1NESE 5EQRA 3RMLH 2IPQX 2BQWB 1PQ5A 5I25A 5EJZA 4BAHB 3QTVH 1ARBA 2VWNA 3U1IB 2BMGB 2C90B 1NO9H 1LVYA 6CHAC 5JPMH 2ZPQA 5CHAB 1OP8A 1U6QA 1WXRA 1NZQH 1O2UA 1ZMLA 2RG3A 3PB1E 3DCLA 4B2CA 4X1NU 3FP7E 3F2GA 4CH8B 2DE9A 1FPCH 2BQ7B 1AUTC 1K1PA 2CF9H 3U9AH 1YPMH 4TSFD 1GI6A 3KEEA 2A32A 1GMHG 1GCTB 1BMNH 2ZU3A 4JYTA 4H6SB 3VPKA 2AMPA 1ELAA 7GCHG 1UJ1A 2P8OB 3M5NA 4JK5A 1QHRB 1C1UH 3VXEH 1NFWA 3DT0H 1IQJA 2BVXH 3ZV8A 2WPKS 1O2IA 1MTNB 1C2MA 4BNRA 1FONA 1TA2A 3VG8A 1C1MA 4K60A 4AORA 3A7VA 3RXBA 5H4IB 3VEQB 1ZPZA 1F0SA 2HWLB 1AZZA 4GHQA 2ZP0H 1C2IA 2OP9A 2OC0A 4ABDA 4BTTB 3RC6A 2L74A 1KLIH 1O3BA 3TITA 3A8BA 5C1XA 3Q00A 3LGIA 3KIDU 1YP9A 2TGTA 2BDIA 1A61H 1BTXA 3RXDA 2F9BH 3GICB 1FAXA 2EI6A 1AI8H 4Y6DA 3NK8A 3SU1A 1PQAA 1KXDA 4M9FA 1AVGH 4RKJB 1OYTH 1UVPA 3ZIAD 5LPEA 4WJG2 3GY3A 4I32A 2FM2A 5DK1A 3M5LA 1ESTA 1GDNA 2EC9H 2FO9A 2FP7B 3KGPA 2ZGHA 4X2YA 3SHCH 1CU1A 3AAVA 4AFZA 1SGFA 5AVDA 4KTUA 4SGBE 1DWEH 2A45B 4HI3A 5T6DA 3GCNA 3VB3A 3F2FA 3NXPA 1AB9C 2KZ4A 1FUJA 1VCWA 1BMMH 1GHVH 1J8AA 4INLA 4KTCA 4JZEH 4ABGA 1YPEH 1EPTC 5SGAE 2XNIA 5HMAA 1IQFA 1TOCB 1OYQA 1HAYB 1FY5A 3GDUA 2Q6DA 1BBRK 1BMAA 4MVNA 2BX3A 3A82A 1J17T 1OKXA 1C4U2 4O3UA 5DSFA 1DXWA 3E8LA 4NWLA 1IQNA 1N6XA 1LQDB 1EJAA 1GHAG 1AO5A 1O2TA 1QB6A 1VCQA 4Q7ZA 1JIMA 1AFEH 1YPKH 5E2OA 4ABFA 2ZHFH 1MZAA 1O37A 1OWJA 2ZEBA 3QTOH 4CRBA 1UTQA 1EOJA 2WPLS 2R3UA 3MH5A 2GV7A 3PLKA 1TRMA 1A3EH 3RU4T 3RXLA 3M5MA 1UCYH 3DSOA 2QY0B 1QL8A 1INCA 2WZQA 3PRBA 3ZZ7A 3ZZ3A 3V0XA 3A8CA 1DWDH 5EW1H 2GTBA 2BXTH 1NT1A 1T4VH 3M7TA 5C5NA 2FTMA 2P3UB 5HM9A 1W0JD 3SQEE 2WYJA 5E8EH 1GBCA 4GVUA 1TA6A 1O39A 2FODA 4CH2B 2HGTH 2KR7A 1SSXA 4I7YH 5EPYA 2ZTXA 1GL0E 1GGDB 4RSPA 3K2UA 4X8SH 3Q3XA 2QXIA 2OTVA 1ZSKA 3FVFB 4BANB 3SNAA 1DWBH 8LPRA 1TX6A 1EP6A 1EXFA 2FOEA 2RFKC 3K6YA 1VITG 1WAYB 1ZHMA 1OP0A 2KFWA 4LXBH 3UTUH 4UONA 2Z9KA 3A8DA 1KY9A 2C4FH 1MAXA 2YMSD 5CHAC 2A4QA 2ZFRH 4AB9A 1C5VA 4AFQA 1OP2A 1LDTT 2G5NA 3GCOA 5A0AE 4B2BA 1HIAB 2PSXA 1XUJA 3A81A 1SQTA 2BD5A 2VINA 2PFEA 4Z1MD 5JB9S 1GJ7B 1NRPH 2ULLA 5C1YA 1LVOA 1NFUA 5DP3A 4ABIA 1L1GA 1FQ3A 4ZMAH 2O8MA 1CE5A 1SL3A 1BDAA 2XWAA 1CHGA 1H9LB 2H5CA 3F3BA 3SV8A 4CRCA 1XKBC 2TBSA 3UWJH 5EODA 2W3KA 4XBDA 4CR9A 5HXFA 1P3CA 2C8WB 2P94A 4NFEA 4TPYA 3GY7A 1O3OA 4NWKA 1WTHD 1C2HA 1OWHA 1UK4A 4TY6A 5FHTA 4UEHH 1YYY1 1GMDG 1ZYOA 3T26A 4KTSA 3TH2H 3GY5A 1NBME 2VIVA 3Q77A 1D3PB 1K2I1 2F9VA 3RXGA 1O31A 3BEUA 4YOJA 3RLWH 5C1UA 1ZOMA 2VIOA 1SLXB 4WMFA 4YXWD 1BRAA 3V13A 1BIOA 1L2EA 2Z9LA 3PWCA 1QB9A 3C27B 1MKXK 3ZYEA 3AW1A 2UWLA 3A84A 2OQ5A 1Y3WA 2IJD1 2JETB 1YY3A 2FYQA 1V2ST 2HNTF 3SNCA 1AY6H 3KF2A 3MU5A 5CDFE 2VGCC 1DUAA 2Z6BD 1V2LT 2B0FA 1FXYA 1TX8A 2TGDA 1O5DH 1BHXF 1H1BA 3SJIA 5CHBA 3P8NA 3STJA 2QXJA 2ZGCA 1DLEA 2PP6A 1Z8IB 4WXVA 1ELEE 3OEHD 1M9UA 3LKWA 1LQEA 3K65B 3UY9A 1GJ5H 2ILNA 4AX9H 1G3CA 3MNSA 4DOQA 2JETC 4ZAEA 4CHAB 1C5LH 1GCTC 3SJ9A 1DX5M 1SLWB 1XUKA 3P92A 3U98H 5HGGA 3U8RH 3FAOA 1O2QA 3TH4H 2SGDE 2QC2A 4SGAE 2C3SA 4YESB 2DUCA 1O32A 5A0BA 1QBOA 1B7XB 2OK5A 3M36A 4ISOA 1HCGA 2A7CA 1N8OC 1TABE 1TRNA 1K1JA 3ZVAA 3SNDA 1MTWA 1SGEE 2BD8A 2CHAC 2HPPH 3SU3A 2B5TB 1CGHA 3H7TA 2ANKH 1CT4E 1Y3XA 2GGVB 2WPJS 3CS0A 1WU1A 1WTGH 3SOSA 3UNRA 1P2OA 5F8XA 3LU9B 1QRZA 1GBBA 4NG9H 1ZSJA 1TFXA 1RIWC 2BVSH 2GP9B 3RXUA 4FU8A 1G36A 2PTCE 1OS8A 2EY4C 3UOUA 7LPRA 2L6OA 2SGQE 4UFFH 1S84A 1ZJDA 2VNTA 2QCYA 1UHBB 3GDVA 2FOFA 3M3TA 3P17H 1O2YA 2QE7D 4NGAH 3ATKA 3C1KA 3GY4A 4H4FA 1IOEA 2UWPA 4ABBA 2LP6A 1VITH 1NY22 1S6HA 4FUIA 2BOKA 4B6FA 5FCRA 3EGKH 4E7NA 3PTBA 3QLPH 4F48B 2VU8E 3EE0B 3U8TH 3GY6A 4I8GA 1FV9A 3KQCA 3RXJA 1DE7H 1SLUB 4LZ4B 4NSVA 3BTEE 2B8OH 3ATWA 2ZO3H 1KTTB 2J9NA 3ESTA 4OS4A 3TK5A 3UQOA 2ZFSA 5C20A 1ELVA 1H8HD 1BZXE 4TYDA 4FUDA 1HAXB 3L3TA 2JIZD 1O2XA 3SYJA 2H9TH 4B1TA 5C0TA 2RCEA 1XX9A 3VB7A 1C5RA 1TRYA 1AVWA 2V3OH 1ELGA 1EZUC 4X6PA 4AYVB 3CENA 1AE5A 4U30A 1ANEA 1DOJA 1C2EA 1QFKH 2RDEA 5C17A 1O3PB 2P93A 3BTWE 2D26C 2J98B 5I46H 3RM2H 5IK2D 1RTFB 5ESTE 1QRWA 5J4QA 3LC3A 3EA9A 2BX4A 1UTLM 1S85A 1O3GA 3EA8A 3PLBA 1P11E 4ACBA 4ZH8A 1O0DH 5FAHA 3MH7A 2G52A 3VB5A 2AMDA 1ZTLA 2UUKB 1BB0B 3JZ1B 4X1RU 1F2SE 1G3DA 4VGCB 1EB2A 1LHDH 1O2JA 1QA0A 3KNXA 4UFEH 3BF6H 1T8OA 3OU0A 1NRRH 3E0PB 1DY9A 3LJOA 1B0FA 2C8YB 3A83A 4Y8XA 4CREA 2HVXA 1E37B 1ORFA 3PV5A 1Y5BT 2PWXA 2Y81A 4O9VA 4X8UH 1G2LA 3SQHE 1SKYE 2FI5E 2Y82A 2JDID 1K1LA 1TPAE 1TX7A 3H5CB 1NS3A 6CHAB 1NROH 2BD3A 1GBKA 2P16A 1BTHH 2C93B 3GISB 3QDZB 4IMZA 1SOZA 4IS5A 1QA7A 1BTWA 5DGJA 1CA8B 4P00A 2Y80A 2ZPSA 3QO6A 3ATLA 4THNH 2FXRA 1O2SA 2BY8X 3BTKE 1DSUA 3TNSA 2OC1A 1RIWB 1GMDF 1AQ7A 5FBIA 1HAVB 3T29A 1G9IE 4K3JA 4YTAA 4DT4A 1HAVA 1BOQA 4A6LA 1IHTH 1XVOA 4GCHG 1AIXH 1GI1A 3SZEA 3TK9A 1GVLA 4NIVA 1V2UT 2BZAA 1C5NH 4JCNA 4I8JA 2HNTE 1LHEH 3W94A 1OX1A 1ZMNA 1NFYA 2W7SA 3RDZA 1YPGH 1C5QA 2UUJB 3LPRA 3LGYA 1W2KH 1FX0B 4CRFA 3MH4A 2ZC9H 4FUCA 3I29A 2NWNA 1W12U 2V6NA 1TYNA 1YPJH 2B9LA 2GX4A 1COWD 2O8TA 1IQKA 1DT2A 2ZCHP 3FZZA 5E0GA 1TNLA 4TWWA 4NZLA 1AU8A 1YPHC 5EPNA 2BM2A 1P2QA 3BG8A 4INHA 1SQAA 4DVAU
chains in the Genus database with same CATH topology
1O30A 1P9UA 3OFND 4ZKRU 1PYTC 1P2IA 1TNKA 1P8VC 4AOQA 2VIPA 1ZSLA 2QXHA 4IC6A 2ODPA 1HFDA 2BY9X 2O8LA 1CVWH 1KMHB 2BY6X 1AMHA 4GAWA 4A1XA 4FUGA 1BTUA 1XXFA 1GBMA 1O2KA 1CBWC 2J5UA 2ZA5A 3A89A 1TGBA 4XD7D 1GPZA 1QJ1B 2H1UA 3M5OA 3RUOA 2FS8A 1BJUA 1C5OH 2PSYA 4AN7A 2A5KA 1EUFA 4I8HA 4K1TA 3BTFE 1RJXB 4K2YA 1ELDE 2J4IA 2V0BA 1O3KA 1P9SA 1AE8H 1YGCH 3BTQE 3EA7A 1C2JA 1TNIA 4Z0KA 2ZG0H 5E2PA 2SFAA 3ATMA 1K9OE 1KYNA 3GY2A 4MNXA 2XRCA 2LPRA 1G37A 1Y3VA 2Q6GA 2WPHS 1MCVA 2KCPA 1QBVH 1EJNA 3R3GB 2FTLE 1F0UA 1MKXH 3ZVCA 1JOUB 2V7QD 1TNJA 2AGIX 4CR5A 2HNTC 3AK5A 1EATA 1GHYH 5EGMA 2ZHDA 3IG6B 5K0HA 2CHAB 2Z3EA 4JYVH 1AGJA 1KLJH 2VJ1A 4PROA 1W13U 2CN0H 3MU8A 3SGBE 1W14U 2XBXA 1TPOA 1TWXB 1A7SA 4K69A 4Y8YA 1Q3XA 2BVRH 5FPYA 2ZDLA 1OSSA 1THPB 1J14A 2CXVA 1V2TT 1TLDA 3OYPA 1GHZA 1GI3A 3HK3B 4Y0ZE 2SGEE 1SGTA 1ID5H 1V2JT 1UO6A 1DY8A 1H9IE 2OLGA 2VIWA 1PFXC 1O2VA 2VGCB 2ZWLH 3WWBA 1O3IA 4ZXXH 3N7OA 1MBQA 1Q31A 3SW2B 1UCYK 4B76A 1UTNA 1YPHE 3UOPA 4YZUA 4AG1A 1GHWH 5T1VA 1MTVA 1K1IA 1GBAA 3QUMP 2O8UA 4FUHA 4UFGH 1FN6A 1L4ZA 1YPLH 2PKAB 1ACBE 2FZZA 1AWHB 2ODYB 2RA3A 3BIVH 2XXLA 1FN8A 4U2WA 2KM0A 1C5SA 3D23A 2BQ6B 2FOBA 2NU3E 3P6ZB 4Y0YE 3WWFA 2EI7A 4KGAA 4MTBA 4ASHA 3ZYDA 2P95A 1TBQH 1MMJN 1E35B 2GDEH 4H42U 1AD8H 1AZ8A 3TJVA 3F0OA 2BDGA 1Y8TA 3P8GA 2BDBA 4NFFA 4E06H 1C2DA 2VWLA 5DP4A 1P0SH 2ALPA 5JBBS 1LO6A 1FNIA 4OS6A 4O97A 3KL6A 2FDAA 1ANBA 1G30B 2ZGXH 5FPSA 2AERH 3MNXA 2ZFQH 3M7UA 2BZ6H 3CS7A 2KCOA 4NA9H 3TPIZ 2XW9A 3PO1B 2BD7A 2HLDD 3TIUA 1EAWA 3TJOA 1D4PB 2XCFA 2FS9A 1HNEE 1NPMA 4B6EA 2YOLA 4JK6A 1PYTD 3PMAB 1KSNA 3RMOH 4GLYA 1S6LA 3S7KB 2QGRA 3A87A 1P01A 5FCKA 2XOKD 4BXWA 1GCDA 8GCHG 3A7ZA 1HAHH 3I77A 3LGTA 3SHAH 1SI5H 3PO1C 2QF5A 3PV4A 3AASA 4MNWA 4FVDA 3GYLB 2JKHA 1SHHB 2GMTB 4X0WU 2CJIA 1P06A 4UFDH 1UK2A 1IAUA 2QV1A 1KXBA 1JIRA 1HAIH 1KLTA 2UUFB 4LOYH 3ZZCA 3SGAE 2QF4A 1MKWH 1LHCH 2F3CE 1GBLA 3VB6A 5TCAA 2ZGJA 2VVVA 4A92A 2F4LA 2K8IA 1EAUA 1PPZA 5BPEA 4ZHLU 2FMJA 5DP5A 4AYYB 2XNDD 3T27A 1MQ5A 4K8BA 2FWWA 2TGAA 1BHXB 1TGCA 4X6MA 4ZHAA 1EFRD 1P02A 1ESAA 5DKMA 1SFQB 2GMTC 3MU1A 1SGRE 1Z8GA 2IPHA 3HATH 3OY6U 1LMWB 2ZIQH 3MWIU 3SU0A 3T28A 1GI8B 1MBMA 6LPRA 1PQ7A 1NU7B 1C5TA 3LC5A 4XFQA 3MO3A 3UNQA 1LHFH 3ZZ9A 3LOXA 1KXAA 4D76A 3LJJA 1GBIA 3T25A 4JYUH 1CO7E 2BDAA 1W10U 3KQEA 3RC4A 4UDWH 1YLCA 1Z1IA 2ZHWH 3GY8A 5ETXA 3V12A 8ESTE 4A5TS 1C5ZB 4Y8ZA 3FFGA 1HAOH 1THSH 1IQHA 1O3JA 2JH6D 1VR1H 2HLCA 5L30H 2A4OA 3URDA 2XBWA 1B5GH 3EDXB 4J1YA 3E0NB 4B73A 1V2PT 1A0JA 4E05H 1O34A 2D8WA 2R9PA 5CMXH 3E16B 4X1SU 3FKSD 1UVTH 2ZCKP 5TJXA 4FETA 1O2MA 3LGVA 4Y10E 1ZGIA 2R3YA 4DIHH 1W0ZU 3ZZDA 1C1PA 3BEFB 1P2JA 1SPJA 1YKTA 3SI4H 3LT3A 1Q2WA 2DE8A 1VJ9U 4YOGA 3NPSA 1D3QB 2J94A 2G4TA 5EXNA 2A31A 3ZZBA 2OXSA 3RXHA 1SVPA 4GSOA 1LPGB 4J2YB 2WV4A 1LVMA 4HGCA 2W6JD 3MFJA 3M7QA 3P70B 1QL7A 8KME2 1E1RD 4B74A 1UMAH 2FX4A 2Q1JA 5G4BA 1GDUA 1BUIA 1TALA 4OM9A 1B0EA 2R0KA 2F43B 1GG6B 2BB4A 3PV2A 5GIBA 1C5YB 1O2ZA 3SNEA 3SI3H 1VGCB 2ZECA 3E3TA 2QA9E 1NC6A 3H7OA 2AHME 2VB0A 3A80A 1QURH 3SUEA 3VB4A 3RXVA 5F03A 4ABEA 3BG4B 3PM3A 1GJCB 2XC4A 3MO6A 5GWZA 1ZTJA 1OWDA 1UTOA 4D9QA 1OOKB 1FZZA 1T32A 4DGJA 1HV7A 2OINA 1H4WA 1KDQB 1AKSA 1AKSB 1HAZB 2ZDNA 2GT8A 4Q80A 3BSQA 1BJVA 2FOCA 3SUGA 1C2FA 3BG4C 1NN6A 1O3FA 1GBHA 1T7CA 5DP7A 2AFQB 1O2RA 3F9EA 2XBYA 1FY8E 3RXFA 3HPTB 2PKSC 1TB6H 1WSSH 4IN2A 1TGNA 1MKWK 2TIOA 3P95A 4TT3D 1QGFA 1NRSH 1GVZA 3JZ2B 2R0LA 4XSKU 3KCGH 5LH8A 3GCTG 2QF3A 2O8WA 3PROA 2GKVE 4R0IA 1MD8A 3KN2A 1HJ9A 3RXTA 5DP6A 1TIOA 5A8XA 2ZQ1A 1FLEE 1SLVB 1F0RA 2F9OA 2XYAA 1QNJA 1TOMH 4OGYA 1W7GH 3AVZA 2A2XH 4I33A 1C1SA 4B2AA 1FY1A 4DIIH 4BAMB 1G3BA 1GI7B 1V2KT 2G8TA 4Y76A 4OS5A 5A2MH 2ZTYA 2FX6A 4BXSA 3QWCH 1JRSA 2A4GA 5LGOA 3SJOA 1PJPA 2GCTB 1T8NA 3EYDA 3MU0A 1LKAA 3DUXH 4B71A 2ZDAH 1ANCA 3B9FH 3TGIE 1K1MA 2HPQH 1EASA 3DFLA 5HKKD 3M3VA 2BOHB 5FX6A 1FI8A 1L1JA 2XC5A 4ZUHA 1O3LA 1FAKH 1KIGH 3UREA 3QK1A 1HJ8A 1T8MA 1QIXB 4WWYA 3A8AA 1TQ0B 2WPDD 4ISNA 1W7XH 3SNBA 1CHOF 1HIAA 1GBTA 2M5TA 2WINI 2Z9JA 1BBRE 2ZF0H 2G00A 1CSOE 3ATIA 2CV3A 1HYLA 2K1QA 4XBCA 5L2ZH 1YM0A 1PPGE 3E90B 1O5AB 2G51A 4NIYA 4DCDA 3E6PH 1T31A 4MNYA 4MQAA 3T62A 1ESBA 2B7DH 3UR9A 2ANMH 1RGQA 3UIRA 1V3XA 1EPTA 3AW0A 3RP2A 4F4OC 1GHAF 1GHBG 3LH1A 2OQUA 1O3AA 1V2VT 3GOVB 2JJ1D 2BD2A 7KMEH 1CHOG 2GCHG 1C5XB 2P3FH 1FIWA 3MH6A 1NRQH 1OWEA 2SNVA 3A7XA 3ZZAA 1EZSC 1BA8B 1N8OB 1BT7A 2ZGBH 2F9NA 4D7GA 4Q2KA 3MMGA 3M61U 1TNGA 4X8VH 1A3BH 1GI2A 4K5ZA 4R8TB 5JDUB 4ZKSU 1CGJE 1S0QA 1P05A 4CBNA 1L4DA 3B8JA 2K0QA 3NRLA 2XC0A 1KXEA 1MTSA 5LPFA 2W7UA 3ELAH 1AUJA 4FUBA 1HXFH 1Z1JA 1AWFH 2FESH 1YCPK 3NZIA 1GJ9B 1O33A 2OD3B 4AFSA 2PV9B 5DG6A 4I31A 2F9UA 1SB1H 2NU0E 4XOJA 3RXAA 4IN1A 4DW2U 2ZKSA 4NIXA 1DITH 2LNCA 4MPXA 4JZIA 1IQIA 5AF9H 3LGWA 3ZZ4A 1K28D 1PPEE 3WW7A 1EPTB 5EXMA 1Z71A 1S82A 4ZXYH 2ZQ2A 1BRBE 3ODDA 2ZDMA 4KP0A 4Z6AH 1SGQE 1MZDA 2I6QA 3PYHA 3UPEA 5C0UA 5FL7D 2F83A 1F5KU 1GMCG 4D8NA 1H8DH 3O8BA 2G55A 2AS9A 1HUTH 2QXGA 5TCCA 4MNVA 1OWKA 2KAIB 3MO9A 2FI4E 1AHTH 1O2GH 3OTJE 4HZHA 3WY8A 1NM6A 4FU7A 4Q63A 1IQGA 2ZI2H 1SOTA 4XE4A 4AB8A 3SORA 2PGBB 2JJ2D 3RXCA 3ZVDA 1E34B 4ABHA 2IOTA 2GV6A 4NA7A 3FN8A 5JB8S 2Y7XA 4FXGH 1AB9B 4FUFA 1O3MA 4NSYA 1WQSA 1HLTH 1CA0B 3A88A 1BCUH 1N1LA 1DUEA 4INKA 2WUBA 3F9FA 5DO4H 1A4WH 2NU1E 1D3TB 3T2NA 2H6MA 3SV9A 2Y5FA 5C67A 1OHHD 3UUZA 4XDEA 3RXEA 3GCHC 5AFZH 1AFQB 2D1JA 5GNDA 1TPSA 4VGCC 1QJ7B 1TPPA 4GHTA 4YO9A 2IN2A 1SBWA 3V3MA 5FPTA 4LK4A 3NUMA 1RXPA 3BEIB 5A09A 1RRKA 1ZGVA 1S83A 2AIPA 4IGDA 3E91A 1DWCH 4X2WA 3SO3A 1AFQC 3TGKE 3B23B 1V2OT 3S69A 1THRH 4F55A 1Y5UT 2OBOA 3OSYA 2VVUA 2W6ID 1BTPA 4UD9H 3RU4D 1W0YH 2AGGX 3M3SA 4BAKB 1EQ9A 2WSSD 2TGPZ 4MG3A 3VFEA 4ABJA 1VJAU 1FY3A 1XUFA 3F6UH 2FLRH 9ESTA 3SU2A 3SU4A 1SG8B 5AHGH 1BRCE 2PW8H 1L1NA 3UR6A 1O35A 1GJBB 4Y7BA 1UK3A 5GJ4B 4DJZB 2Y6TA 1QTFA 1TMUH 5HYOA 1PPFE 1JXPA 1P2MA 4KKDA 2KCYA 5F6MA 3FZDA 1A5HA 2SGPE 1VITF 5C5OA 1MD7A 1P10A 2G81E 1C1VH 3QGJA 2VWMA 1HRTH 1O2PA 4D7FA 3O8DA 3FANA 3RXSA 3BTME 3TU7H 4AZ2B 2XCNA 3O8CA 3F2HA 1L0ZA 1MAYA 1JBUH 2WYGA 1QL9A 5F8ZA 2NU4E 1AVXA 2YNBA 5B6OA 1QBNA 5FBEA 3OTPA 2PR3A 1ZHRA 2R2WU 1HAPH 4ZCNA 3UNSA 2VVCA 2JH0D 5T6FA 3N7DA 1LVBA 3T5FH 3SV2H 1SFIA 1O3DA 3V7TA 2WPMS 1J15A 5BRRE 1F5LA 2VWOA 4YLUA 3SUDA 2V35A 4QT8C 2SGFE 2FOAA 1QQUA 4ESTE 1KDQA 1ELBA 4WF8A 3ZVGA 1PQ8A 1W11U 1VGCC 4K1SA 2VH0A 3M37A 3TK6A 3PMHB 4JMYA 1S5SA 3RXMA 1V6DA 1ANDA 3DD2H 1GBJA 4X6OA 3BV9B 1GI4A 1UCYE 2ZZUH 1GHBF 1AN1E 3E1XB 4K8YA 5JBTA 3P8OA 1EJMA 2W5EA 1MCTA 2AIQA 2WUCA 1NU9A 3HKJB 4IC5A 3S9BA 2BHGA 2FEQH 1KXCA 1SC8U 1O36A 4YT7H 1QJ6B 2UUYA 2BTCE 1GI0A 1GBDA 4HTCH 3SUFA 2YMSC 1OWIA 1C1QA 4FUJA 1ELTA 5F8TA 4YT6H 4WH8A 5L2YH 1BRUP 1S0RA 3KHVA 3SZNA 5EOKA 1HJAB 5EG4A 1GJAB 1MABB 5CE1A 2BLQA 1O38A 2GZ9A 1PPBH 2Y7ZA 2H2ZA 1J9CH 2OC8A 4WY3A 4OGXA 1C2GA 3BTGE 1DSTA 1EAXA 1WQVH 5A0CA 3PLPA 2YMSB 1DDJA 1TGTA 3HGNA 2J38A 2PLXA 3S7HB 4DT7B 1D9IA 2VBCA 5FX5A 1VZQH 6GCHG 1PPHE 1K1OA 1E1QD 2BXUH 4I8KA 3SBKA 3LH3A 4FVBA 2ANYA 2QN5T 3DA9B 1LPZB 3FP6E 1GWAA 2IJOB 1ETTH 2C8ZB 3PMJA 2HOBA 1EX3A 3BIUH 3L6PA 1HPGA 2Z3DA 2R2MB 5JBAS 4BAQB 2BY5X 2ESTE 2A4RA 4WXIA 1C1RA 2GD4B 1MU6B 4AGJA 3MNCA 1D6RA 1IQMA 1GJ8B 2LELA 9LPRA 2BLWA 2I6SA 1JWTA 1BQYA 2ANWA 5EW2H 1DS2E 4X1QU 2VH6A 2STBE 1UVOA 2Z7FE 5GDSH 1TBRH 1GL1A 1D3DB 1MTNC 1HB0B 4HFPB 1RD3B 3OAAD 1V2QT 4UE7H 5ESBA 2ZDKA 2EA3A 1RTLA 2ZFTA 3QZRA 3RXKA 3KQBA 6GCHF 3UB0A 3S9CA 1O3CA 2ZU2A 3BTTE 2PGQB 2XWBI 2SGAA 4OS7A 3RXRA 1D6WA 1SQOA 3DSPA 1W0KD 3MTYA 1FMGA 1DM4B 1EKBB 2BLOA 1SMFE 1P57B 3OY5U 1XKAC 4RI0A 2CF8H 2VIQA 1RFNA 3GCTF 2GZ7A 1Y59T 2ALVA 2AEIH 2PKSB 3RC5A 1C5PA 3QZQA 2ZFPH 2BDHA 3SJ8A 1A0HB 1FDPA 4MPWA 3A86A 1A2CH 1WOFA 3SV7A 4Y71A 1DXPA 1QCPA 1XUGA 1O5FH 1TMBH 5JBCS 2A0QB