4A24A

Structural and functional analysis of the deaf-1 and bs69 mynd domains
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
47
structure length
47
Chain Sequence
GAMEQSCVNCGREAMSECTGCHKVNYCSTFCQRKDWKDHQHICGQSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DEFORMED EPIDERMAL AUTOREGULATORY FACTOR 1 HOMOLOG
publication title Structural and Functional Analysis of the Deaf-1 and Bs69 Mynd Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 10
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.180 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4a24A00
3QWPA 5EX3A 3OXFA 5CCLA 5EX0A 3RU0A 5HQ8A 3PDNA 4A24A 2JW6A 5CCMA 3OXGA 2OD1A 5HI7A 2ODDA 3MEKA 3OXLA
chains in the Genus database with same CATH superfamily
2NU1I 4DNCA 3UEJA 2ROWA 1AN1I 2FNFX 1OVOA 2CWHA 1W3SA 3HH2C 1NXUA 1Q9BA 1RFHA 1UHAA 1IW4A 1M8BA 5CCLA 2LB7A 1UVFA 1Y8FA 3RU0A 1X74A 2NU2I 2V1CA 2WGCA 4HGUA 3TO7A 1Y1BA 3FC3A 2ORWA 2JW6A 1WGCA 3GOXA 2NU4I 2NU0I 3BJIA 2JZMA 2GIVA 1P9ZA 1XBTA 1TBOA 1SGYI 2DB6A 3KY9A 4GI3C 4A24A 2SGQI 1CHOI 1DS2I 1TIHA 1UUCA 2OZUA 1PJUA 2GKRI 1LR8A 3UGLA 2DKVA 2ERWA 4UXIA 4AMLA 2VRWB 2JXDA 2ENZA 3UGDA 2DIPA 1TURA 2ODDA 1MJAA 5E3PA 4UXHA 7WGAA 1V1IA 1NUBA 2X52A 4FKDA 3TOBA 3TOAA 3PDNA 3R5DA 3VDUA 1SGNI 2KCXA 1XX6A 5E3RA 1BUSA 1SGEI 2GKTI 2J87A 3QWPA 3SGBI 3VDPA 1SGPI 3QAHA 2BUSA 1SGDI 1VDDA 3SEKC 2ENNA 1IY6A 1DS3I 3B4VC 3E2IA 1LR9A 1N13A 2CJSC 1PPFI 4SGBI 3D00A 1KBFA 1M8CA 1R0RI 1CE3A 1Y1CA 2CWGA 2SGPI 3R5CA 1WTJA 1BMOA 1ULKA 2P6AC 3R5AA 2JYYA 2GKVA 1HJAI 5HI7A 2X3TA 3FSYA 1MT1A 1XA6A 1YU6C 1TBQR 1Z2IA 3E59A 2SGEI 1FYBA 3FSXA 4MPIA 1CSOI 2GVIA 1MJ9A 3UEYA 1Z7KB 5JHWC 2N52A 1ULNA 2KMOA 3UFFA 2N17A 2ARPF 1V1HA 2UVOA 1FARA 1R79A 3CXLA 1CGJI 3UOEA 1TGSI 1U5KA 1X4SA 2Y0MA 5CCMA 5HQ8A 5J8CA 5EX3A 4JCVE 4E1PA 1SGQI 3UGIA 3OXFA 1PTRA 1TBNA 2RC4A 2QQEA 3OL0A 3TO6A 3TJQA 1SGRI 2L8EA 2QQDA 4E1RA 2J9RA 1FY7A 2B8TA 5FUXA 1WGTA 1H0ZA 1FAQA 5FUVA 3R5BA 2QQ0A 2QQCA 2JA1A 2ELIA 2LEOA 2PQ8A 2RIJA 1PTQA 1PCEA 1ULMA 1LR7A 2E5RA 5FUWA 4L9MA 1TUSA 5FUYA 4OVOA 1HDLA 1HPTA 2YUUA 2W0TA 1HEVA 2N1AB 2SGDI 1KBEA 2NU3I 1UVGA 2ORVA 2KMPA 2UZ3A 2OD1A 4B6DA 2LUYA 2SGFI 4WP4A 5E3QA 1W4RA 5J8FA 2CWFA 1K7VA 2WVJA 1CT4I 1YTPA 2M5XA 2V1CC 2N71A 4UXJA 1S20A 2B0UC 3OVOA 1CGII 1KMAA 2K9HA 2QPOA 3MEKA 2E73A 2OVOA 2A20A 3OXGA 2OU2A 2XRCA 9WGAA 3SGQI 1OYVI 2WCYA 1IY5A 1K7TA 1P9GA 2F3CI 2L7XA 2YQPA 1OMTA 2KMRA 1MJBA 1TOTA 1OMUA 1CT0I 1WKXA 5EX0A 1TBRR 3TO9A 2V53A 3VE5A 1CT2I 2KMQA 1K7UA 3QTLD 5DAEA 3OXLA
chains in the Genus database with same CATH topology
2NU1I 3UEJA 2ROWA 1AN1I 2FNFX 1OVOA 1W3SA 3HH2C 1RFHA 1IW4A 1M8BA 5CCLA 1UVFA 1Y8FA 3RU0A 1X74A 3FC3A 2V1CA 4HGUA 1Y1BA 2ORWA 2JW6A 3GOXA 2NU4I 2NU0I 3BJIA 2JZMA 1XBTA 1TBOA 1SGYI 2DB6A 3KY9A 4GI3C 4A24A 2SGQI 1CHOI 1DS2I 1TIHA 1UUCA 3UGLA 1PJUA 2GKRI 1LR8A 2ERWA 4UXIA 2VRWB 2JXDA 2ENZA 3UGDA 2DIPA 1TURA 2ODDA 4UXHA 1V1IA 1NUBA 4FKDA 3PDNA 3VDUA 1SGNI 2KCXA 1XX6A 1BUSA 1SGEI 2GKTI 2J87A 3QWPA 3SGBI 3VDPA 1SGPI 2BUSA 1SGDI 1VDDA 3SEKC 2ENNA 1IY6A 1DS3I 3B4VC 3E2IA 1LR9A 1N13A 2CJSC 1PPFI 4SGBI 3D00A 1KBFA 1M8CA 1R0RI 1CE3A 1Y1CA 2SGPI 1BMOA 2P6AC 2JYYA 2GKVA 1HJAI 5HI7A 1XA6A 1MT1A 1YU6C 1TBQR 3E59A 1FYBA 2SGEI 1CSOI 2GVIA 3UEYA 1Z7KB 5JHWC 2N52A 2KMOA 3UFFA 2N17A 2ARPF 1V1HA 1FARA 1R79A 3CXLA 1CGJI 1TGSI 1U5KA 1X4SA 5HQ8A 5CCMA 5EX3A 4JCVE 4E1PA 1SGQI 3UGIA 3OXFA 1PTRA 1TBNA 2QQEA 3OL0A 3TJQA 1SGRI 2L8EA 2QQDA 4E1RA 2J9RA 5FUXA 2B8TA 1H0ZA 1FAQA 5FUVA 2QQ0A 2QQCA 2JA1A 2ELIA 2LEOA 1PTQA 1PCEA 2E5RA 1LR7A 5FUWA 4L9MA 1TUSA 5FUYA 4OVOA 1HDLA 1HPTA 2YUUA 2W0TA 2N1AB 2SGDI 1KBEA 2NU3I 1UVGA 2ORVA 2KMPA 2UZ3A 2OD1A 4B6DA 2LUYA 2SGFI 1W4RA 2WVJA 1CT4I 1YTPA 2M5XA 2V1CC 2N71A 4UXJA 2B0UC 3OVOA 1CGII 1KMAA 2K9HA 2QPOA 3MEKA 2E73A 2OVOA 2A20A 3OXGA 2XRCA 3SGQI 1OYVI 2WCYA 1IY5A 2F3CI 2L7XA 2YQPA 1OMTA 2KMRA 1TOTA 1OMUA 1CT0I 5EX0A 1TBRR 2V53A 3VE5A 1CT2I 2KMQA 2NU2I 3QTLD 5DAEA 3OXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWP A;  5EX3 A;  3OXF A;  5CCL A;  5EX0 A;  3RU0 A;  5HQ8 A;  3PDN A;  4A24 A;  2JW6 A;  5CCM A;  3OXG A;  2OD1 A;  5HI7 A;  2ODD A;  3MEK A;  3OXL A; 
#chains in the Genus database with same CATH topology
 2NU1 I;  4DNC A;  3UEJ A;  2ROW A;  1AN1 I;  2FNF X;  1OVO A;  2CWH A;  1W3S A;  3HH2 C;  1NXU A;  1Q9B A;  1RFH A;  1UHA A;  1IW4 A;  1M8B A;  5CCL A;  2LB7 A;  1UVF A;  1Y8F A;  3RU0 A;  1X74 A;  2NU2 I;  2V1C A;  2WGC A;  4HGU A;  3TO7 A;  1Y1B A;  3FC3 A;  2ORW A;  2JW6 A;  1WGC A;  3GOX A;  2NU4 I;  2NU0 I;  3BJI A;  2JZM A;  2GIV A;  1P9Z A;  1XBT A;  1TBO A;  1SGY I;  2DB6 A;  3KY9 A;  4GI3 C;  4A24 A;  2SGQ I;  1CHO I;  1DS2 I;  1TIH A;  1UUC A;  2OZU A;  1PJU A;  2GKR I;  1LR8 A;  3UGL A;  2DKV A;  2ERW A;  4UXI A;  4AML A;  2VRW B;  2JXD A;  2ENZ A;  3UGD A;  2DIP A;  1TUR A;  2ODD A;  1MJA A;  5E3P A;  4UXH A;  7WGA A;  1V1I A;  1NUB A;  2X52 A;  4FKD A;  3TOB A;  3TOA A;  3PDN A;  3R5D A;  3VDU A;  1SGN I;  2KCX A;  1XX6 A;  5E3R A;  1BUS A;  1SGE I;  2GKT I;  2J87 A;  3QWP A;  3SGB I;  3VDP A;  1SGP I;  3QAH A;  2BUS A;  1SGD I;  1VDD A;  3SEK C;  2ENN A;  1IY6 A;  1DS3 I;  3B4V C;  3E2I A;  1LR9 A;  1N13 A;  2CJS C;  1PPF I;  4SGB I;  3D00 A;  1KBF A;  1M8C A;  1R0R I;  1CE3 A;  1Y1C A;  2CWG A;  2SGP I;  3R5C A;  1WTJ A;  1BMO A;  1ULK A;  2P6A C;  3R5A A;  2JYY A;  2GKV A;  1HJA I;  5HI7 A;  2X3T A;  3FSY A;  1MT1 A;  1XA6 A;  1YU6 C;  1TBQ R;  1Z2I A;  3E59 A;  2SGE I;  1FYB A;  3FSX A;  4MPI A;  1CSO I;  2GVI A;  1MJ9 A;  3UEY A;  1Z7K B;  5JHW C;  2N52 A;  1ULN A;  2KMO A;  3UFF A;  2N17 A;  2ARP F;  1V1H A;  2UVO A;  1FAR A;  1R79 A;  3CXL A;  1CGJ I;  3UOE A;  1TGS I;  1U5K A;  1X4S A;  2Y0M A;  5CCM A;  5HQ8 A;  5J8C A;  5EX3 A;  4JCV E;  4E1P A;  1SGQ I;  3UGI A;  3OXF A;  1PTR A;  1TBN A;  2RC4 A;  2QQE A;  3OL0 A;  3TO6 A;  3TJQ A;  1SGR I;  2L8E A;  2QQD A;  4E1R A;  2J9R A;  1FY7 A;  2B8T A;  5FUX A;  1WGT A;  1H0Z A;  1FAQ A;  5FUV A;  3R5B A;  2QQ0 A;  2QQC A;  2JA1 A;  2ELI A;  2LEO A;  2PQ8 A;  2RIJ A;  1PTQ A;  1PCE A;  1ULM A;  1LR7 A;  2E5R A;  5FUW A;  4L9M A;  1TUS A;  5FUY A;  4OVO A;  1HDL A;  1HPT A;  2YUU A;  2W0T A;  1HEV A;  2N1A B;  2SGD I;  1KBE A;  2NU3 I;  1UVG A;  2ORV A;  2KMP A;  2UZ3 A;  2OD1 A;  4B6D A;  2LUY A;  2SGF I;  4WP4 A;  5E3Q A;  1W4R A;  5J8F A;  2CWF A;  1K7V A;  2WVJ A;  1CT4 I;  1YTP A;  2M5X A;  2V1C C;  2N71 A;  4UXJ A;  1S20 A;  2B0U C;  3OVO A;  1CGI I;  1KMA A;  2K9H A;  2QPO A;  3MEK A;  2E73 A;  2OVO A;  2A20 A;  3OXG A;  2OU2 A;  2XRC A;  9WGA A;  3SGQ I;  1OYV I;  2WCY A;  1IY5 A;  1K7T A;  1P9G A;  2F3C I;  2L7X A;  2YQP A;  1OMT A;  2KMR A;  1MJB A;  1TOT A;  1OMU A;  1CT0 I;  1WKX A;  5EX0 A;  1TBR R;  3TO9 A;  2V53 A;  3VE5 A;  1CT2 I;  2KMQ A;  1K7U A;  3QTL D;  5DAE A;  3OXL A; 
#chains in the Genus database with same CATH homology
 2NU1 I;  3UEJ A;  2ROW A;  1AN1 I;  2FNF X;  1OVO A;  1W3S A;  3HH2 C;  1RFH A;  1IW4 A;  1M8B A;  5CCL A;  1UVF A;  1Y8F A;  3RU0 A;  1X74 A;  3FC3 A;  2V1C A;  4HGU A;  1Y1B A;  2ORW A;  2JW6 A;  3GOX A;  2NU4 I;  2NU0 I;  3BJI A;  2JZM A;  1XBT A;  1TBO A;  1SGY I;  2DB6 A;  3KY9 A;  4GI3 C;  4A24 A;  2SGQ I;  1CHO I;  1DS2 I;  1TIH A;  1UUC A;  3UGL A;  1PJU A;  2GKR I;  1LR8 A;  2ERW A;  4UXI A;  2VRW B;  2JXD A;  2ENZ A;  3UGD A;  2DIP A;  1TUR A;  2ODD A;  4UXH A;  1V1I A;  1NUB A;  4FKD A;  3PDN A;  3VDU A;  1SGN I;  2KCX A;  1XX6 A;  1BUS A;  1SGE I;  2GKT I;  2J87 A;  3QWP A;  3SGB I;  3VDP A;  1SGP I;  2BUS A;  1SGD I;  1VDD A;  3SEK C;  2ENN A;  1IY6 A;  1DS3 I;  3B4V C;  3E2I A;  1LR9 A;  1N13 A;  2CJS C;  1PPF I;  4SGB I;  3D00 A;  1KBF A;  1M8C A;  1R0R I;  1CE3 A;  1Y1C A;  2SGP I;  1BMO A;  2P6A C;  2JYY A;  2GKV A;  1HJA I;  5HI7 A;  1XA6 A;  1MT1 A;  1YU6 C;  1TBQ R;  3E59 A;  1FYB A;  2SGE I;  1CSO I;  2GVI A;  3UEY A;  1Z7K B;  5JHW C;  2N52 A;  2KMO A;  3UFF A;  2N17 A;  2ARP F;  1V1H A;  1FAR A;  1R79 A;  3CXL A;  1CGJ I;  1TGS I;  1U5K A;  1X4S A;  5HQ8 A;  5CCM A;  5EX3 A;  4JCV E;  4E1P A;  1SGQ I;  3UGI A;  3OXF A;  1PTR A;  1TBN A;  2QQE A;  3OL0 A;  3TJQ A;  1SGR I;  2L8E A;  2QQD A;  4E1R A;  2J9R A;  5FUX A;  2B8T A;  1H0Z A;  1FAQ A;  5FUV A;  2QQ0 A;  2QQC A;  2JA1 A;  2ELI A;  2LEO A;  1PTQ A;  1PCE A;  2E5R A;  1LR7 A;  5FUW A;  4L9M A;  1TUS A;  5FUY A;  4OVO A;  1HDL A;  1HPT A;  2YUU A;  2W0T A;  2N1A B;  2SGD I;  1KBE A;  2NU3 I;  1UVG A;  2ORV A;  2KMP A;  2UZ3 A;  2OD1 A;  4B6D A;  2LUY A;  2SGF I;  1W4R A;  2WVJ A;  1CT4 I;  1YTP A;  2M5X A;  2V1C C;  2N71 A;  4UXJ A;  2B0U C;  3OVO A;  1CGI I;  1KMA A;  2K9H A;  2QPO A;  3MEK A;  2E73 A;  2OVO A;  2A20 A;  3OXG A;  2XRC A;  3SGQ I;  1OYV I;  2WCY A;  1IY5 A;  2F3C I;  2L7X A;  2YQP A;  1OMT A;  2KMR A;  1TOT A;  1OMU A;  1CT0 I;  5EX0 A;  1TBR R;  2V53 A;  3VE5 A;  1CT2 I;  2KMQ A;  2NU2 I;  3QTL D;  5DAE A;  3OXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...