4A24A

Structural and functional analysis of the deaf-1 and bs69 mynd domains
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
47
structure length
47
Chain Sequence
GAMEQSCVNCGREAMSECTGCHKVNYCSTFCQRKDWKDHQHICGQSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DEFORMED EPIDERMAL AUTOREGULATORY FACTOR 1 HOMOLOG
publication title Structural and Functional Analysis of the Deaf-1 and Bs69 Mynd Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 10
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.180 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4a24A00
2JW6A 5HQ8A 3OXLA 3OXFA 5EX0A 3RU0A 2OD1A 2ODDA 5EX3A 5CCMA 5CCLA 3PDNA 4A24A 3MEKA 3OXGA 5HI7A 3QWPA
chains in the Genus database with same CATH superfamily
4L9MA 1VDDA 3RU0A 2GIVA 2RC4A 3UGDA 1BMOA 3R5DA 1OVOA 2WVJA 3OL0A 3R5BA 3BJIA 2N17A 2RIJA 1MJAA 1TBRR 1FARA 2VRWB 1Q9BA 2OD1A 4OVOA 3SGQI 3QAHA 1NXUA 2SGFI 7WGAA 1TOTA 1OYVI 2J9RA 1PTRA 1Y1BA 3KY9A 5J8CA 1P9GA 1KBFA 1CT4I 3UFFA 1PJUA 1S20A 2UZ3A 1CHOI 2ORWA 3TOBA 1CT0I 1Y1CA 2LEOA 1Y8FA 2QQDA 2QQCA 1W4RA 2E5RA 1SGYI 1TBQR 2NU2I 1SGQI 1UHAA 4GI3C 4HGUA 9WGAA 1TBOA 2E73A 1OMUA 2UVOA 3SGBI 1ULNA 4E1RA 2ODDA 2V1CA 2X52A 1RFHA 1PPFI 1V1IA 2GVIA 2SGEI 1TUSA 5HI7A 2NU1I 2WCYA 3OXLA 1R79A 2ARPF 4SGBI 3TO9A 3VDPA 1IW4A 2KCXA 1FAQA 1Z2IA 1FYBA 2KMPA 1W3SA 1K7VA 1XA6A 2JZMA 1H0ZA 1AN1I 2OZUA 3MEKA 1K7TA 1CGJI 2CWFA 3OXFA 1BUSA 2GKTI 1CGII 2DB6A 1HJAI 3TOAA 3D00A 1X74A 2YUUA 1K7UA 1N13A 1CE3A 2KMOA 5E3PA 2F3CI 3R5AA 2QQEA 3CXLA 2N71A 3TJQA 2CWHA 2V53A 2ROWA 2JA1A 1DS2I 4AMLA 1YU6C 1MJ9A 3B4VC 1PTQA 2J87A 2B0UC 3OXGA 3E2IA 1CT2I 1P9ZA 2LB7A 2SGQI 5JHWC 3UOEA 1NUBA 3SEKC 3UEJA 2ORVA 2LUYA 1OMTA 1V1HA 2WGCA 1MT1A 3GOXA 3QWPA 2N52A 2YQPA 1X4SA 2OVOA 1SGRI 2FNFX 3VDUA 1UVGA 2QQ0A 1UUCA 1Z7KB 4A24A 1SGEI 1PCEA 2GKVA 2OU2A 2JW6A 1M8CA 4FKDA 2B8TA 2QPOA 2DKVA 1ULMA 5DAEA 1LR8A 1TURA 2ERWA 5EX3A 2K9HA 1XBTA 4DNCA 3FSXA 1KBEA 1LR9A 1WGCA 3VE5A 4JCVE 5HQ8A 1HEVA 1TBNA 2KMQA 3OVOA 3UGLA 3FSYA 3FC3A 1U5KA 2JXDA 5FUWA 3UEYA 2P6AC 1IY6A 1WTJA 1IY5A 3E59A 1KMAA 2ENNA 2GKRI 1TIHA 2CJSC 2L7XA 2X3TA 4UXJA 5FUYA 1M8BA 2CWGA 3TO7A 2Y0MA 1FY7A 1SGDI 5CCMA 5E3RA 3HH2C 5EX0A 1R0RI 2PQ8A 1ULKA 3TO6A 1XX6A 2L8EA 1HDLA 1DS3I 1CSOI 2NU0I 2SGDI 5J8FA 4WP4A 2V1CC 2ELIA 2NU3I 3QTLD 1HPTA 4MPIA 4E1PA 2XRCA 4UXIA 1LR7A 2NU4I 5FUVA 2M5XA 3R5CA 4UXHA 1SGPI 3UGIA 2W0TA 5FUXA 5CCLA 2KMRA 1MJBA 2DIPA 2N1AB 2SGPI 2ENZA 1WKXA 4B6DA 1YTPA 2A20A 2JYYA 3PDNA 1TGSI 2BUSA 1WGTA 5E3QA 1UVFA 1SGNI
chains in the Genus database with same CATH topology
4L9MA 1VDDA 3RU0A 3UGDA 1BMOA 1OVOA 2WVJA 3OL0A 3BJIA 2N17A 1TBRR 1FARA 2VRWB 2OD1A 4OVOA 3SGQI 2SGFI 1TOTA 1OYVI 2J9RA 1PTRA 1Y1BA 3KY9A 1KBFA 1CT4I 3UFFA 1PJUA 2UZ3A 1CHOI 2ORWA 1CT0I 1Y1CA 2LEOA 1Y8FA 2QQDA 2QQCA 1W4RA 2E5RA 1SGYI 1TBQR 2NU2I 1SGQI 4GI3C 4HGUA 1TBOA 2E73A 1OMUA 3SGBI 4E1RA 2ODDA 2V1CA 1RFHA 1PPFI 1V1IA 2GVIA 2SGEI 1TUSA 5HI7A 2NU1I 2WCYA 3OXLA 1R79A 2ARPF 4SGBI 3VDPA 1IW4A 2KCXA 1FAQA 1FYBA 2KMPA 1W3SA 1XA6A 2JZMA 1H0ZA 1AN1I 3MEKA 1CGJI 3OXFA 1BUSA 2GKTI 1CGII 2DB6A 1HJAI 3D00A 1X74A 2YUUA 1N13A 1CE3A 2KMOA 2F3CI 2QQEA 3CXLA 2N71A 3TJQA 2V53A 2ROWA 2JA1A 1DS2I 1YU6C 3B4VC 1PTQA 2J87A 2B0UC 3OXGA 3E2IA 1CT2I 5JHWC 2SGQI 1HDLA 1NUBA 3SEKC 3UEJA 2ORVA 2LUYA 1OMTA 1V1HA 1MT1A 3GOXA 3QWPA 2N52A 2YQPA 1X4SA 2OVOA 1SGRI 2FNFX 3VDUA 1UVGA 2QQ0A 1UUCA 1Z7KB 4A24A 1SGEI 1PCEA 2GKVA 2JW6A 1M8CA 4FKDA 2B8TA 2QPOA 5DAEA 1LR8A 1TURA 2ERWA 5EX3A 2K9HA 1XBTA 1KBEA 1LR9A 5HQ8A 3VE5A 4JCVE 1TBNA 2KMQA 3OVOA 3UGLA 3FC3A 1U5KA 2JXDA 5FUWA 3UEYA 2P6AC 1IY6A 1IY5A 3E59A 1KMAA 2ENNA 2GKRI 1TIHA 2CJSC 2L7XA 4UXJA 5FUYA 1M8BA 1SGDI 5CCMA 3HH2C 5EX0A 1R0RI 1XX6A 2L8EA 1DS3I 1CSOI 2NU0I 2SGDI 2V1CC 2ELIA 2NU3I 3QTLD 1HPTA 4E1PA 2XRCA 4UXIA 1LR7A 2NU4I 5FUVA 2M5XA 4UXHA 1SGPI 3UGIA 2W0TA 5FUXA 5CCLA 2KMRA 2DIPA 2N1AB 2SGPI 2ENZA 4B6DA 1YTPA 2A20A 2JYYA 3PDNA 1TGSI 2BUSA 1UVFA 1SGNI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JW6 A;  5HQ8 A;  3OXL A;  3OXF A;  5EX0 A;  3RU0 A;  2OD1 A;  2ODD A;  5EX3 A;  5CCM A;  5CCL A;  3PDN A;  4A24 A;  3MEK A;  3OXG A;  5HI7 A;  3QWP A; 
#chains in the Genus database with same CATH topology
 4L9M A;  1VDD A;  3RU0 A;  2GIV A;  2RC4 A;  3UGD A;  1BMO A;  3R5D A;  1OVO A;  2WVJ A;  3OL0 A;  3R5B A;  3BJI A;  2N17 A;  2RIJ A;  1MJA A;  1TBR R;  1FAR A;  2VRW B;  1Q9B A;  2OD1 A;  4OVO A;  3SGQ I;  3QAH A;  1NXU A;  2SGF I;  7WGA A;  1TOT A;  1OYV I;  2J9R A;  1PTR A;  1Y1B A;  3KY9 A;  5J8C A;  1P9G A;  1KBF A;  1CT4 I;  3UFF A;  1PJU A;  1S20 A;  2UZ3 A;  1CHO I;  2ORW A;  3TOB A;  1CT0 I;  1Y1C A;  2LEO A;  1Y8F A;  2QQD A;  2QQC A;  1W4R A;  2E5R A;  1SGY I;  1TBQ R;  2NU2 I;  1SGQ I;  1UHA A;  4GI3 C;  4HGU A;  9WGA A;  1TBO A;  2E73 A;  1OMU A;  2UVO A;  3SGB I;  1ULN A;  4E1R A;  2ODD A;  2V1C A;  2X52 A;  1RFH A;  1PPF I;  1V1I A;  2GVI A;  2SGE I;  1TUS A;  5HI7 A;  2NU1 I;  2WCY A;  3OXL A;  1R79 A;  2ARP F;  4SGB I;  3TO9 A;  3VDP A;  1IW4 A;  2KCX A;  1FAQ A;  1Z2I A;  1FYB A;  2KMP A;  1W3S A;  1K7V A;  1XA6 A;  2JZM A;  1H0Z A;  1AN1 I;  2OZU A;  3MEK A;  1K7T A;  1CGJ I;  2CWF A;  3OXF A;  1BUS A;  2GKT I;  1CGI I;  2DB6 A;  1HJA I;  3TOA A;  3D00 A;  1X74 A;  2YUU A;  1K7U A;  1N13 A;  1CE3 A;  2KMO A;  5E3P A;  2F3C I;  3R5A A;  2QQE A;  3CXL A;  2N71 A;  3TJQ A;  2CWH A;  2V53 A;  2ROW A;  2JA1 A;  1DS2 I;  4AML A;  1YU6 C;  1MJ9 A;  3B4V C;  1PTQ A;  2J87 A;  2B0U C;  3OXG A;  3E2I A;  1CT2 I;  1P9Z A;  2LB7 A;  2SGQ I;  5JHW C;  3UOE A;  1NUB A;  3SEK C;  3UEJ A;  2ORV A;  2LUY A;  1OMT A;  1V1H A;  2WGC A;  1MT1 A;  3GOX A;  3QWP A;  2N52 A;  2YQP A;  1X4S A;  2OVO A;  1SGR I;  2FNF X;  3VDU A;  1UVG A;  2QQ0 A;  1UUC A;  1Z7K B;  4A24 A;  1SGE I;  1PCE A;  2GKV A;  2OU2 A;  2JW6 A;  1M8C A;  4FKD A;  2B8T A;  2QPO A;  2DKV A;  1ULM A;  5DAE A;  1LR8 A;  1TUR A;  2ERW A;  5EX3 A;  2K9H A;  1XBT A;  4DNC A;  3FSX A;  1KBE A;  1LR9 A;  1WGC A;  3VE5 A;  4JCV E;  5HQ8 A;  1HEV A;  1TBN A;  2KMQ A;  3OVO A;  3UGL A;  3FSY A;  3FC3 A;  1U5K A;  2JXD A;  5FUW A;  3UEY A;  2P6A C;  1IY6 A;  1WTJ A;  1IY5 A;  3E59 A;  1KMA A;  2ENN A;  2GKR I;  1TIH A;  2CJS C;  2L7X A;  2X3T A;  4UXJ A;  5FUY A;  1M8B A;  2CWG A;  3TO7 A;  2Y0M A;  1FY7 A;  1SGD I;  5CCM A;  5E3R A;  3HH2 C;  5EX0 A;  1R0R I;  2PQ8 A;  1ULK A;  3TO6 A;  1XX6 A;  2L8E A;  1HDL A;  1DS3 I;  1CSO I;  2NU0 I;  2SGD I;  5J8F A;  4WP4 A;  2V1C C;  2ELI A;  2NU3 I;  3QTL D;  1HPT A;  4MPI A;  4E1P A;  2XRC A;  4UXI A;  1LR7 A;  2NU4 I;  5FUV A;  2M5X A;  3R5C A;  4UXH A;  1SGP I;  3UGI A;  2W0T A;  5FUX A;  5CCL A;  2KMR A;  1MJB A;  2DIP A;  2N1A B;  2SGP I;  2ENZ A;  1WKX A;  4B6D A;  1YTP A;  2A20 A;  2JYY A;  3PDN A;  1TGS I;  2BUS A;  1WGT A;  5E3Q A;  1UVF A;  1SGN I; 
#chains in the Genus database with same CATH homology
 4L9M A;  1VDD A;  3RU0 A;  3UGD A;  1BMO A;  1OVO A;  2WVJ A;  3OL0 A;  3BJI A;  2N17 A;  1TBR R;  1FAR A;  2VRW B;  2OD1 A;  4OVO A;  3SGQ I;  2SGF I;  1TOT A;  1OYV I;  2J9R A;  1PTR A;  1Y1B A;  3KY9 A;  1KBF A;  1CT4 I;  3UFF A;  1PJU A;  2UZ3 A;  1CHO I;  2ORW A;  1CT0 I;  1Y1C A;  2LEO A;  1Y8F A;  2QQD A;  2QQC A;  1W4R A;  2E5R A;  1SGY I;  1TBQ R;  2NU2 I;  1SGQ I;  4GI3 C;  4HGU A;  1TBO A;  2E73 A;  1OMU A;  3SGB I;  4E1R A;  2ODD A;  2V1C A;  1RFH A;  1PPF I;  1V1I A;  2GVI A;  2SGE I;  1TUS A;  5HI7 A;  2NU1 I;  2WCY A;  3OXL A;  1R79 A;  2ARP F;  4SGB I;  3VDP A;  1IW4 A;  2KCX A;  1FAQ A;  1FYB A;  2KMP A;  1W3S A;  1XA6 A;  2JZM A;  1H0Z A;  1AN1 I;  3MEK A;  1CGJ I;  3OXF A;  1BUS A;  2GKT I;  1CGI I;  2DB6 A;  1HJA I;  3D00 A;  1X74 A;  2YUU A;  1N13 A;  1CE3 A;  2KMO A;  2F3C I;  2QQE A;  3CXL A;  2N71 A;  3TJQ A;  2V53 A;  2ROW A;  2JA1 A;  1DS2 I;  1YU6 C;  3B4V C;  1PTQ A;  2J87 A;  2B0U C;  3OXG A;  3E2I A;  1CT2 I;  5JHW C;  2SGQ I;  1HDL A;  1NUB A;  3SEK C;  3UEJ A;  2ORV A;  2LUY A;  1OMT A;  1V1H A;  1MT1 A;  3GOX A;  3QWP A;  2N52 A;  2YQP A;  1X4S A;  2OVO A;  1SGR I;  2FNF X;  3VDU A;  1UVG A;  2QQ0 A;  1UUC A;  1Z7K B;  4A24 A;  1SGE I;  1PCE A;  2GKV A;  2JW6 A;  1M8C A;  4FKD A;  2B8T A;  2QPO A;  5DAE A;  1LR8 A;  1TUR A;  2ERW A;  5EX3 A;  2K9H A;  1XBT A;  1KBE A;  1LR9 A;  5HQ8 A;  3VE5 A;  4JCV E;  1TBN A;  2KMQ A;  3OVO A;  3UGL A;  3FC3 A;  1U5K A;  2JXD A;  5FUW A;  3UEY A;  2P6A C;  1IY6 A;  1IY5 A;  3E59 A;  1KMA A;  2ENN A;  2GKR I;  1TIH A;  2CJS C;  2L7X A;  4UXJ A;  5FUY A;  1M8B A;  1SGD I;  5CCM A;  3HH2 C;  5EX0 A;  1R0R I;  1XX6 A;  2L8E A;  1DS3 I;  1CSO I;  2NU0 I;  2SGD I;  2V1C C;  2ELI A;  2NU3 I;  3QTL D;  1HPT A;  4E1P A;  2XRC A;  4UXI A;  1LR7 A;  2NU4 I;  5FUV A;  2M5X A;  4UXH A;  1SGP I;  3UGI A;  2W0T A;  5FUX A;  5CCL A;  2KMR A;  2DIP A;  2N1A B;  2SGP I;  2ENZ A;  4B6D A;  1YTP A;  2A20 A;  2JYY A;  3PDN A;  1TGS I;  2BUS A;  1UVF A;  1SGN I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...