4A25A

X-ray structure dps from kineococcus radiotolerans in complex with mn (ii) ions.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
167
structure length
167
Chain Sequence
b'TTIHDVQTTGLTQDAVTGFDASSRLNAGLQEVLVDLTALHLQGKQAHWNIVGENWRDLHLQLDTLVEAARGFSDDVAERMRAVGGVPDARPQTVAASRIGDVGPDEIDTRACVEAIVALVRHTVDTIRRVHDPIDAEDPASADLLHAITLELEKQAWMIGSENRSPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERRITIN DPS FAMILY PROTEIN
publication title Kineococcus Radiotolerans Dps Forms a Heteronuclear Mn-Fe Ferroxidase Center that May Explain the Mn-Dependent Protection Against Oxidative Stress.
pubmed doi rcsb
source organism Kineococcus radiotolerans
molecule tags Metal binding protein
total genus 70
structure length 167
sequence length 167
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4a25A01
5D8YA 2HR5A 1RYTA 4ZL5A 3QD8A 3R2SA 1JTSA 5FFBA 5FFAA 4TOCA 1O9IA 3KWOA 3R2KA 2FJCA 1EUMA 3BVIA 3F34A 3SH6A 5D8RA 2XJNA 1UVHA 1Z6OM 3R2HA 3PWQC 1RCGA 4DYXA 1O9RA 4TOAA 2C2JA 2C2FA 3RBCA 3A68A 5HJFA 4MUDA 5JACA 4CVPA 3WVUA 2V2IA 4EVCA 3E1QA 4AM4A 1RCIA 1QYBA 1JREA 1F33A 2CIHA 4TO9A 5GN8B 4PGKA 3WVVA 3IS7A 3KA9A 5I4JA 2ZG8X 4TODA 2V2MA 1VJXA 1BCFA 5JKLG 3NP0X 4REUA 4P18A 1IERA 4Z5SA 1VEIA 1N1QA 3F37A 3PW1B 3F32A 3KA6A 1NNQA 1Z4AA 1GWGA 2V2OA 2VZBA 3NP2X 1AEWA 3E2CA 2Z90A 3QVDA 2JD70 5FFEA 3MPSA 1LKOA 5FFCA 1HRSA 3IQ1A 5LBHA 4ZTTA 4ETRA 3ERZA 3RD0A 2CHIA 4PG0A 4EVEA 3AK9A 1Z6OA 1XZ3A 5JKMG 3E6SA 3A9QA 3PVRB 2VXXA 2FG8A 1YUXA 3NOZX 5C6FA 4ZKWA 1JKUA 2XKQA 1JIGA 4ZLWA 3Q4RA 4RC5A 4PG1A 5LG8A 3OJ5A 4XKTA 3O7RA 5LS9A 3QZ3A 3KA3A 3PVRA 2CN7A 1FHAA 1NF4A 2WLUA 4ZJKA 3AF7X 3GVYA 4RC8A 2OC5A 3ISEA 4QUWA 3AJPA 1VLGA 2ITBA 2VXIA 5J8WA 3GE4A 2GYDA 3FVBA 3UOIA 1YV1A 3AF8X 4AM2A 4RC7B 3IS8A 5FEJA 3EZUA 2QQYA 3BVLA 4IWJA 4TOFA 1TJOA 1VEQA 4U3GA 3Q4OA 1TKOA 3KA8A 1VELA 4LPJA 2IB0A 1MOJA 3Q4NA 2YW7A 3F33A 3H7GA 5D8QA 3AJOA 4RC7A 1MFRA 4DYUA 1IESA 3RE7A 3BVKA 3F38A 4ISPA 4MY7A 2Y3QA 4Y08A 1ZS3A 4CYBA 2JD60 4E6KA 2BKCA 4TOGA 4II4B 3O7SA 2V2NA 2FFXJ 1F30A 2ZA8A 5D8XA 3UOFA 2XGWA 5AXSA 5HJHA 4ZKXA 3AK8A 2PYBA 3SIDA 2CLBA 4LQNA 4II4A 4M34A 4CY9A 1QGHA 1H96A 5D8SA 3QHBA 3HL1A 5J9VA 3GHQA 4TOBA 2W0OA 2BK6A 2YW6A 1S30A 1L8IA 2YJKA 3FSEA 1OTKA 1UMNA 4DZ0A 2G4HA 3EZ0A 4XKSA 4M33A 1LB3A 4YKHA 1JGCA 2ZA6A 5E1UA 5GOUA 2V15A 1S2ZA 4IWKA 2Z5RA 2F7NA 3KX9A 4RC5B 2ZA7A 3AJQA 4Z3BA 2V2SA 3BKNA 3E1LA 4DI0A 1JI5A 5JKLA 4XGSA 5LG2A 5D8OA 2HTNA 2GS4A 2IU2A 4CVRA 4ERUA 1KRQA 3BVFA 4A25A 1JKVA 3SE1A 4EVDA 1LKPA 4CMYV 2FZFA 2IY4A 2XJMA 2D5KA 5CMRA 1TK6A 3RGDA 2QF9A 2ZG9X 2BJYA 2V2LA 3PVYA 4ITTA 3RAVA 2FKZA 5GU2X 2CEIA 2UX1A 4MN9A 5JKMA 4CYAA 3TA8A 5ERKA 4KVQA 5D8PA 3HIUA 4KVSA 4M35A 5J8SA 4LPMA 4MKUA 4RC6A 4CVTA 4KVRA 3E6RA 3BT5A 5IX6A 3E1NA 4ZKHA 4EVBA 3KXUA 3PZAA 4XKUA 1RCDA 1L8HA 4TOEA 2BW1A 2WLAA 1NFVA 3R2LA 3BVEA 4DE6A 2C6RA 4CVSA 3PVTA 2CF7A 4LQVA 2GYQA 2RBDA 3AF9X 3F35A 4PGIA 4DYYA 1JI4A 1B71A 3E1OA 2OH3A 2CHPA 4AM5A 4CMYA 3ES3A 3EGMA 3PWFA 3KA4A 2ZURX 5CMQA 1DATA 1R03A 1DVBA 2CN6A 4M32A 2FL0A 4LQJA 4ZL6A 4MJYA 2YJJA 2Z5QA 1RCCA 1ZUJA 3PW8A 3T9JA 1TKPA 3QB9A 4LPNA 5GU3X 2X170 1RCEA 4ZMCA 2CLUA 3FI6A 2Z6MA 2ZG7X 2XJOA 5GN8A 5ERJA 5E2DA 2V2JA 2Z5PA 5K52A 3E1MA 4ITWA 2WTLA 3WNWA 3R2OA 5K53A 3QHCA 1XZ1A 3SHXA 4ISMA 1S3QA 2FG4A 3R2RA 4IXKA 2V2PA 5GU0X 4TOHA 3Q4QA 1DPSA 3PVYB 4LYUA 3PW1A 3E1JA 4ML5A 3F39A 3VNXA 4LQHA 1LKMA 5HQOA 4OYNA 3PWQA 1SOFA 1BFRA 2JD80 1SQ3A 4TW3A 1YUZA 1JYBA 4R42A 4DASA 4DYZA 3OGHA 4RC6B 3PW8C 3E1PA 2V2RA 1NF6A 3WVWA 3F36A 1J30A 5FFDA 2FHAA 2C2UA 4LYXA 5CZUA 3U90A 5J93A 3ISFA 3UNOA 3R2MA 3PVTB 5GU1X 1BG7A 2C41A
chains in the Genus database with same CATH superfamily
5D8YA 2HR5A 1RYTA 4ZL5A 3QD8A 3R2SA 1JTSA 5FFBA 5FFAA 4TOCA 1O9IA 3KWOA 3R2KA 2FJCA 1EUMA 3BVIA 3F34A 3SH6A 5D8RA 2XJNA 1UVHA 1Z6OM 3R2HA 3PWQC 1RCGA 2V8TA 4DYXA 1O9RA 4TOAA 2C2JA 2C2FA 3RBCA 2MGYA 3A68A 5HJFA 4MUDA 5JACA 4CVPA 3WVUA 2V2IA 4EVCA 3E1QA 4AM4A 1RCIA 1QYBA 1JREA 1F33A 3KHKA 2WWXB 2CIHA 4TO9A 5GN8B 4PGKA 3WVVA 3IS7A 3KA9A 5I4JA 3C23A 2ZG8X 4TODA 2V2MA 1VJXA 1BCFA 5JKLG 3NP0X 4REUA 4P18A 1IERA 4Z5SA 1VEIA 1N1QA 3F37A 3PW1B 3F32A 3KA6A 1NNQA 1Z4AA 1GWGA 2V2OA 2VZBA 2V8UA 3NP2X 1AEWA 3E2CA 2Z90A 2N02A 3QVDA 4YXJA 2JD70 5FFEA 4X0JA 3MPSA 1LKOA 5FFCA 1HRSA 3M6JA 3IQ1A 5LBHA 4ZTTA 3VV9A 4ETRA 3ERZA 4KXRB 3RD0A 2CHIA 4PG0A 3FRSA 4EVEA 3AK9A 1Z6OA 1XZ3A 5JKMG 3E6SA 3A9QA 3PVRB 2VXXA 2FG8A 1YUXA 3NOZX 5C6FA 4ZKWA 1JKUA 4W4LB 2XKQA 1JIGA 4ZLWA 3Q4RA 4RC5A 5HU6D 4PG1A 5LG8A 3OJ5A 4XKTA 3O7RA 5LS9A 3QZ3A 3KA3A 3PVRA 2CN7A 1FHAA 1NF4A 2WLUA 4ZJKA 3AF7X 3GVYA 4RC8A 2OC5A 3ISEA 3D19A 3W54A 4QUWA 3AJPA 1VLGA 2ITBA 2VXIA 5J8WA 3GE4A 2GYDA 3FVBA 2AR0A 3UOIA 1YV1A 3AF8X 4AM2A 4RC7B 3IS8A 5FEJA 3EZUA 2QQYA 3BVLA 4IWJA 4TOFA 1TJOA 1VEQA 2Y44A 4U3GA 3Q4OA 1TKOA 3KA8A 1VELA 3V3KB 4LPJA 2IB0A 1MOJA 3Q4NA 2YW7A 3F33A 3H7GA 5D8QA 3AJOA 4RC7A 1MFRA 4DYUA 1IESA 3RE7A 3BVKA 3F38A 4ISPA 4MY7A 2Y3QA 4Y08A 1ZS3A 4CYBA 2JD60 4E6KA 2BKCA 4TOGA 4II4B 3O7SA 2V2NA 2FFXJ 1F30A 2ZA8A 5D8XA 3UOFA 3L0MA 2XGWA 5AXSA 5HJHA 4ZKXA 3AK8A 2PYBA 3SIDA 2CLBA 4LQNA 4II4A 4M34A 4CY9A 1QGHA 1H96A 5D8SA 3QHBA 3HL1A 5J9VA 3GHQA 4TOBA 2W0OA 2BK6A 2YW6A 1S30A 4YXMA 3KDQA 1L8IA 2YJKA 3FSEA 1OTKA 1UMNA 4DZ0A 2G4HA 3EZ0A 4XKSA 4M33A 1LB3A 4YKHA 1JGCA 2ZA6A 5E1UA 3GGYA 5GOUA 2V15A 1S2ZA 4IWKA 2Z5RA 2F7NA 3KX9A 4RC5B 2ZA7A 3AJQA 4Z3BA 2V2SA 3BKNA 3E1LA 4DI0A 1JI5A 5JKLA 4XGSA 5LG2A 5D8OA 2HTNA 2GS4A 2IU2A 4CVRA 3GGZA 4ERUA 1KRQA 3BVFA 4A25A 3C1ZA 1JKVA 3VVAA 3SE1A 4EVDA 1LKPA 4CMYV 2FZFA 2OKCA 2IY4A 2XJMA 2D5KA 5CMRA 1TK6A 3RGDA 2QF9A 4MXPA 2ZG9X 2BJYA 2V2LA 3PVYA 3UFBA 3C1YA 4ITTA 3RAVA 3C21A 4E40A 2FKZA 3JZAB 5GU2X 2CEIA 2UX1A 4MN9A 5JKMA 4CYAA 3TA8A 5ERKA 4KVQA 5D8PA 3HIUA 4KVSA 4M35A 5J8SA 4LPMA 4MKUA 4RC6A 4CVTA 4KVRA 3FRRA 3E6RA 4YVZA 5JDOA 3BT5A 5IX6A 3E1NA 4ZKHA 4EVBA 3KXUA 3PZAA 4XKUA 1RCDA 1L8HA 4TOEA 2BW1A 2WLAA 4W4KB 1NFVA 3R2LA 3BVEA 4DE6A 2C6RA 2G38B 4CVSA 3PVTA 2CF7A 4LQVA 2GYQA 2RBDA 3AF9X 3F35A 4PGIA 4WJG4 4DYYA 1JI4A 1B71A 3E1OA 2OH3A 2CHPA 4AM5A 4CMYA 3ES3A 3EGMA 3PWFA 3KA4A 2ZURX 5CMQA 1DATA 1R03A 1DVBA 2CN6A 4M32A 2FL0A 4LQJA 4ZL6A 4MJYA 2YJJA 2Z5QA 1RCCA 1ZUJA 3PW8A 3T9JA 1TKPA 3QB9A 4LPNA 5GU3X 2X170 3JZ9A 3DBYA 1RCEA 4ZMCA 2CLUA 3FI6A 2Z6MA 2ZG7X 2XJOA 5GN8A 5ERJA 5E2DA 2V2JA 2Z5PA 5K52A 3E1MA 4ITWA 2WTLA 3WNWA 3R2OA 5K53A 3QHCA 1XZ1A 3SHXA 4ISMA 1S3QA 2FG4A 3R2RA 4IXKA 2V2PA 5GU0X 4TOHA 3Q4QA 1DPSA 3PVYB 4LYUA 3PW1A 3E1JA 4ML5A 3F39A 3VNXA 4LQHA 1LKMA 5HQOA 4OYNA 3PWQA 1SOFA 1BFRA 2JD80 1SQ3A 4TW3A 1YUZA 3N6OA 1JYBA 4R42A 4DASA 3LKDA 4DYZA 3OGHA 4RC6B 3PW8C 3E1PA 2V2RA 5JDOB 1NF6A 3WVWA 2CWLA 3F36A 1J30A 5FFDA 2FHAA 2C2UA 4LYXA 5CZUA 3U90A 5J93A 3ISFA 3UNOA 3R2MA 3PVTB 5GU1X 1BG7A 2C41A
chains in the Genus database with same CATH topology
5D8YA 2HR5A 1RYTA 4ZL5A 3QD8A 3R2SA 1JTSA 5FFBA 5FFAA 4TOCA 1O9IA 3KWOA 3R2KA 2FJCA 1EUMA 3BVIA 3F34A 3SH6A 5D8RA 2XJNA 1UVHA 1Z6OM 3R2HA 3PWQC 1RCGA 2V8TA 4DYXA 1O9RA 4TOAA 2C2JA 2C2FA 3RBCA 2MGYA 3A68A 5HJFA 4MUDA 5JACA 4CVPA 3WVUA 2V2IA 4EVCA 3E1QA 4AM4A 1RCIA 1QYBA 1JREA 1F33A 3KHKA 2WWXB 2CIHA 4TO9A 5GN8B 4PGKA 3WVVA 3IS7A 3KA9A 5I4JA 3C23A 2ZG8X 4TODA 2V2MA 1VJXA 1BCFA 5JKLG 3NP0X 4REUA 4P18A 1IERA 4Z5SA 1VEIA 1N1QA 3F37A 3PW1B 3F32A 3KA6A 1NNQA 1Z4AA 1GWGA 2V2OA 2VZBA 2V8UA 3NP2X 1AEWA 3E2CA 2Z90A 2N02A 3QVDA 4YXJA 2JD70 5FFEA 4X0JA 3MPSA 1LKOA 5FFCA 1HRSA 3M6JA 3IQ1A 5LBHA 4ZTTA 3VV9A 4ETRA 3ERZA 4KXRB 3RD0A 2CHIA 4PG0A 3FRSA 4EVEA 3AK9A 1Z6OA 1XZ3A 5JKMG 3E6SA 3A9QA 3PVRB 2VXXA 2FG8A 1YUXA 3NOZX 5C6FA 4ZKWA 1JKUA 4W4LB 2XKQA 1JIGA 4ZLWA 3Q4RA 4RC5A 5HU6D 4PG1A 5LG8A 3OJ5A 4XKTA 3O7RA 5LS9A 3QZ3A 3KA3A 3PVRA 2CN7A 1FHAA 1NF4A 2WLUA 4ZJKA 3AF7X 3GVYA 4RC8A 2OC5A 3ISEA 3D19A 3W54A 4QUWA 3AJPA 1VLGA 2ITBA 2VXIA 5J8WA 3GE4A 2GYDA 3FVBA 2AR0A 3UOIA 1YV1A 3AF8X 4AM2A 4RC7B 3IS8A 5FEJA 3EZUA 2QQYA 3BVLA 4IWJA 4TOFA 1TJOA 1VEQA 2Y44A 4U3GA 3Q4OA 1TKOA 3KA8A 1VELA 3V3KB 4LPJA 2IB0A 1MOJA 3Q4NA 2YW7A 3F33A 3H7GA 5D8QA 3AJOA 4RC7A 1MFRA 4DYUA 1IESA 3RE7A 3BVKA 3F38A 4ISPA 4MY7A 2Y3QA 4Y08A 1ZS3A 4CYBA 2JD60 4E6KA 2BKCA 4TOGA 4II4B 3O7SA 2V2NA 2FFXJ 1F30A 2ZA8A 5D8XA 3UOFA 3L0MA 2XGWA 5AXSA 5HJHA 4ZKXA 3AK8A 2PYBA 3SIDA 2CLBA 4LQNA 4II4A 4M34A 4CY9A 1QGHA 1H96A 5D8SA 3QHBA 3HL1A 5J9VA 3GHQA 4TOBA 2W0OA 2BK6A 2YW6A 1S30A 4YXMA 3KDQA 1L8IA 2YJKA 3FSEA 1OTKA 1UMNA 4DZ0A 2G4HA 3EZ0A 4XKSA 4M33A 1LB3A 4YKHA 1JGCA 2ZA6A 5E1UA 3GGYA 5GOUA 2V15A 1S2ZA 4IWKA 2Z5RA 2F7NA 3KX9A 4RC5B 2ZA7A 3AJQA 4Z3BA 2V2SA 3BKNA 3E1LA 4DI0A 1JI5A 5JKLA 4XGSA 5LG2A 5D8OA 2HTNA 2GS4A 2IU2A 4CVRA 3GGZA 4ERUA 1KRQA 3BVFA 4A25A 3C1ZA 1JKVA 3VVAA 3SE1A 4EVDA 1LKPA 4CMYV 2FZFA 2OKCA 2IY4A 2XJMA 2D5KA 5CMRA 1TK6A 3RGDA 2QF9A 4MXPA 2ZG9X 2BJYA 2V2LA 3PVYA 3UFBA 3C1YA 4ITTA 3RAVA 3C21A 4E40A 2FKZA 3JZAB 5GU2X 2CEIA 2UX1A 4MN9A 5JKMA 4CYAA 3TA8A 5ERKA 4KVQA 5D8PA 3HIUA 4KVSA 4M35A 5J8SA 4LPMA 4MKUA 4RC6A 4CVTA 4KVRA 3FRRA 3E6RA 4YVZA 5JDOA 3BT5A 5IX6A 3E1NA 4ZKHA 4EVBA 3KXUA 3PZAA 4XKUA 1RCDA 1L8HA 4TOEA 2BW1A 2WLAA 4W4KB 1NFVA 3R2LA 3BVEA 4DE6A 2C6RA 2G38B 4CVSA 3PVTA 2CF7A 4LQVA 2GYQA 2RBDA 3AF9X 3F35A 4PGIA 4WJG4 4DYYA 1JI4A 1B71A 3E1OA 2OH3A 2CHPA 4AM5A 4CMYA 3ES3A 3EGMA 3PWFA 3KA4A 2ZURX 5CMQA 1DATA 1R03A 1DVBA 2CN6A 4M32A 2FL0A 4LQJA 4ZL6A 4MJYA 2YJJA 2Z5QA 1RCCA 1ZUJA 3PW8A 3T9JA 1TKPA 3QB9A 4LPNA 5GU3X 2X170 3JZ9A 3DBYA 1RCEA 4ZMCA 2CLUA 3FI6A 2Z6MA 2ZG7X 2XJOA 5GN8A 5ERJA 5E2DA 2V2JA 2Z5PA 5K52A 3E1MA 4ITWA 2WTLA 3WNWA 3R2OA 5K53A 3QHCA 1XZ1A 3SHXA 4ISMA 1S3QA 2FG4A 3R2RA 4IXKA 2V2PA 5GU0X 4TOHA 3Q4QA 1DPSA 3PVYB 4LYUA 3PW1A 3E1JA 4ML5A 3F39A 3VNXA 4LQHA 1LKMA 5HQOA 4OYNA 3PWQA 1SOFA 1BFRA 2JD80 1SQ3A 4TW3A 1YUZA 3N6OA 1JYBA 4R42A 4DASA 3LKDA 4DYZA 3OGHA 4RC6B 3PW8C 3E1PA 2V2RA 5JDOB 1NF6A 3WVWA 2CWLA 3F36A 1J30A 5FFDA 2FHAA 2C2UA 4LYXA 5CZUA 3U90A 5J93A 3ISFA 3UNOA 3R2MA 3PVTB 5GU1X 1BG7A 2C41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D8Y A;  2HR5 A;  1RYT A;  4ZL5 A;  3QD8 A;  3R2S A;  1JTS A;  5FFB A;  5FFA A;  4TOC A;  1O9I A;  3KWO A;  3R2K A;  2FJC A;  1EUM A;  3BVI A;  3F34 A;  3SH6 A;  5D8R A;  2XJN A;  1UVH A;  1Z6O M;  3R2H A;  3PWQ C;  1RCG A;  4DYX A;  1O9R A;  4TOA A;  2C2J A;  2C2F A;  3RBC A;  3A68 A;  5HJF A;  4MUD A;  5JAC A;  4CVP A;  3WVU A;  2V2I A;  4EVC A;  3E1Q A;  4AM4 A;  1RCI A;  1QYB A;  1JRE A;  1F33 A;  2CIH A;  4TO9 A;  5GN8 B;  4PGK A;  3WVV A;  3IS7 A;  3KA9 A;  5I4J A;  2ZG8 X;  4TOD A;  2V2M A;  1VJX A;  1BCF A;  5JKL G;  3NP0 X;  4REU A;  4P18 A;  1IER A;  4Z5S A;  1VEI A;  1N1Q A;  3F37 A;  3PW1 B;  3F32 A;  3KA6 A;  1NNQ A;  1Z4A A;  1GWG A;  2V2O A;  2VZB A;  3NP2 X;  1AEW A;  3E2C A;  2Z90 A;  3QVD A;  2JD7 0;  5FFE A;  3MPS A;  1LKO A;  5FFC A;  1HRS A;  3IQ1 A;  5LBH A;  4ZTT A;  4ETR A;  3ERZ A;  3RD0 A;  2CHI A;  4PG0 A;  4EVE A;  3AK9 A;  1Z6O A;  1XZ3 A;  5JKM G;  3E6S A;  3A9Q A;  3PVR B;  2VXX A;  2FG8 A;  1YUX A;  3NOZ X;  5C6F A;  4ZKW A;  1JKU A;  2XKQ A;  1JIG A;  4ZLW A;  3Q4R A;  4RC5 A;  4PG1 A;  5LG8 A;  3OJ5 A;  4XKT A;  3O7R A;  5LS9 A;  3QZ3 A;  3KA3 A;  3PVR A;  2CN7 A;  1FHA A;  1NF4 A;  2WLU A;  4ZJK A;  3AF7 X;  3GVY A;  4RC8 A;  2OC5 A;  3ISE A;  4QUW A;  3AJP A;  1VLG A;  2ITB A;  2VXI A;  5J8W A;  3GE4 A;  2GYD A;  3FVB A;  3UOI A;  1YV1 A;  3AF8 X;  4AM2 A;  4RC7 B;  3IS8 A;  5FEJ A;  3EZU A;  2QQY A;  3BVL A;  4IWJ A;  4TOF A;  1TJO A;  1VEQ A;  4U3G A;  3Q4O A;  1TKO A;  3KA8 A;  1VEL A;  4LPJ A;  2IB0 A;  1MOJ A;  3Q4N A;  2YW7 A;  3F33 A;  3H7G A;  5D8Q A;  3AJO A;  4RC7 A;  1MFR A;  4DYU A;  1IES A;  3RE7 A;  3BVK A;  3F38 A;  4ISP A;  4MY7 A;  2Y3Q A;  4Y08 A;  1ZS3 A;  4CYB A;  2JD6 0;  4E6K A;  2BKC A;  4TOG A;  4II4 B;  3O7S A;  2V2N A;  2FFX J;  1F30 A;  2ZA8 A;  5D8X A;  3UOF A;  2XGW A;  5AXS A;  5HJH A;  4ZKX A;  3AK8 A;  2PYB A;  3SID A;  2CLB A;  4LQN A;  4II4 A;  4M34 A;  4CY9 A;  1QGH A;  1H96 A;  5D8S A;  3QHB A;  3HL1 A;  5J9V A;  3GHQ A;  4TOB A;  2W0O A;  2BK6 A;  2YW6 A;  1S30 A;  1L8I A;  2YJK A;  3FSE A;  1OTK A;  1UMN A;  4DZ0 A;  2G4H A;  3EZ0 A;  4XKS A;  4M33 A;  1LB3 A;  4YKH A;  1JGC A;  2ZA6 A;  5E1U A;  5GOU A;  2V15 A;  1S2Z A;  4IWK A;  2Z5R A;  2F7N A;  3KX9 A;  4RC5 B;  2ZA7 A;  3AJQ A;  4Z3B A;  2V2S A;  3BKN A;  3E1L A;  4DI0 A;  1JI5 A;  5JKL A;  4XGS A;  5LG2 A;  5D8O A;  2HTN A;  2GS4 A;  2IU2 A;  4CVR A;  4ERU A;  1KRQ A;  3BVF A;  4A25 A;  1JKV A;  3SE1 A;  4EVD A;  1LKP A;  4CMY V;  2FZF A;  2IY4 A;  2XJM A;  2D5K A;  5CMR A;  1TK6 A;  3RGD A;  2QF9 A;  2ZG9 X;  2BJY A;  2V2L A;  3PVY A;  4ITT A;  3RAV A;  2FKZ A;  5GU2 X;  2CEI A;  2UX1 A;  4MN9 A;  5JKM A;  4CYA A;  3TA8 A;  5ERK A;  4KVQ A;  5D8P A;  3HIU A;  4KVS A;  4M35 A;  5J8S A;  4LPM A;  4MKU A;  4RC6 A;  4CVT A;  4KVR A;  3E6R A;  3BT5 A;  5IX6 A;  3E1N A;  4ZKH A;  4EVB A;  3KXU A;  3PZA A;  4XKU A;  1RCD A;  1L8H A;  4TOE A;  2BW1 A;  2WLA A;  1NFV A;  3R2L A;  3BVE A;  4DE6 A;  2C6R A;  4CVS A;  3PVT A;  2CF7 A;  4LQV A;  2GYQ A;  2RBD A;  3AF9 X;  3F35 A;  4PGI A;  4DYY A;  1JI4 A;  1B71 A;  3E1O A;  2OH3 A;  2CHP A;  4AM5 A;  4CMY A;  3ES3 A;  3EGM A;  3PWF A;  3KA4 A;  2ZUR X;  5CMQ A;  1DAT A;  1R03 A;  1DVB A;  2CN6 A;  4M32 A;  2FL0 A;  4LQJ A;  4ZL6 A;  4MJY A;  2YJJ A;  2Z5Q A;  1RCC A;  1ZUJ A;  3PW8 A;  3T9J A;  1TKP A;  3QB9 A;  4LPN A;  5GU3 X;  2X17 0;  1RCE A;  4ZMC A;  2CLU A;  3FI6 A;  2Z6M A;  2ZG7 X;  2XJO A;  5GN8 A;  5ERJ A;  5E2D A;  2V2J A;  2Z5P A;  5K52 A;  3E1M A;  4ITW A;  2WTL A;  3WNW A;  3R2O A;  5K53 A;  3QHC A;  1XZ1 A;  3SHX A;  4ISM A;  1S3Q A;  2FG4 A;  3R2R A;  4IXK A;  2V2P A;  5GU0 X;  4TOH A;  3Q4Q A;  1DPS A;  3PVY B;  4LYU A;  3PW1 A;  3E1J A;  4ML5 A;  3F39 A;  3VNX A;  4LQH A;  1LKM A;  5HQO A;  4OYN A;  3PWQ A;  1SOF A;  1BFR A;  2JD8 0;  1SQ3 A;  4TW3 A;  1YUZ A;  1JYB A;  4R42 A;  4DAS A;  4DYZ A;  3OGH A;  4RC6 B;  3PW8 C;  3E1P A;  2V2R A;  1NF6 A;  3WVW A;  3F36 A;  1J30 A;  5FFD A;  2FHA A;  2C2U A;  4LYX A;  5CZU A;  3U90 A;  5J93 A;  3ISF A;  3UNO A;  3R2M A;  3PVT B;  5GU1 X;  1BG7 A;  2C41 A; 
#chains in the Genus database with same CATH topology
 5D8Y A;  2HR5 A;  1RYT A;  4ZL5 A;  3QD8 A;  3R2S A;  1JTS A;  5FFB A;  5FFA A;  4TOC A;  1O9I A;  3KWO A;  3R2K A;  2FJC A;  1EUM A;  3BVI A;  3F34 A;  3SH6 A;  5D8R A;  2XJN A;  1UVH A;  1Z6O M;  3R2H A;  3PWQ C;  1RCG A;  2V8T A;  4DYX A;  1O9R A;  4TOA A;  2C2J A;  2C2F A;  3RBC A;  2MGY A;  3A68 A;  5HJF A;  4MUD A;  5JAC A;  4CVP A;  3WVU A;  2V2I A;  4EVC A;  3E1Q A;  4AM4 A;  1RCI A;  1QYB A;  1JRE A;  1F33 A;  3KHK A;  2WWX B;  2CIH A;  4TO9 A;  5GN8 B;  4PGK A;  3WVV A;  3IS7 A;  3KA9 A;  5I4J A;  3C23 A;  2ZG8 X;  4TOD A;  2V2M A;  1VJX A;  1BCF A;  5JKL G;  3NP0 X;  4REU A;  4P18 A;  1IER A;  4Z5S A;  1VEI A;  1N1Q A;  3F37 A;  3PW1 B;  3F32 A;  3KA6 A;  1NNQ A;  1Z4A A;  1GWG A;  2V2O A;  2VZB A;  2V8U A;  3NP2 X;  1AEW A;  3E2C A;  2Z90 A;  2N02 A;  3QVD A;  4YXJ A;  2JD7 0;  5FFE A;  4X0J A;  3MPS A;  1LKO A;  5FFC A;  1HRS A;  3M6J A;  3IQ1 A;  5LBH A;  4ZTT A;  3VV9 A;  4ETR A;  3ERZ A;  4KXR B;  3RD0 A;  2CHI A;  4PG0 A;  3FRS A;  4EVE A;  3AK9 A;  1Z6O A;  1XZ3 A;  5JKM G;  3E6S A;  3A9Q A;  3PVR B;  2VXX A;  2FG8 A;  1YUX A;  3NOZ X;  5C6F A;  4ZKW A;  1JKU A;  4W4L B;  2XKQ A;  1JIG A;  4ZLW A;  3Q4R A;  4RC5 A;  5HU6 D;  4PG1 A;  5LG8 A;  3OJ5 A;  4XKT A;  3O7R A;  5LS9 A;  3QZ3 A;  3KA3 A;  3PVR A;  2CN7 A;  1FHA A;  1NF4 A;  2WLU A;  4ZJK A;  3AF7 X;  3GVY A;  4RC8 A;  2OC5 A;  3ISE A;  3D19 A;  3W54 A;  4QUW A;  3AJP A;  1VLG A;  2ITB A;  2VXI A;  5J8W A;  3GE4 A;  2GYD A;  3FVB A;  2AR0 A;  3UOI A;  1YV1 A;  3AF8 X;  4AM2 A;  4RC7 B;  3IS8 A;  5FEJ A;  3EZU A;  2QQY A;  3BVL A;  4IWJ A;  4TOF A;  1TJO A;  1VEQ A;  2Y44 A;  4U3G A;  3Q4O A;  1TKO A;  3KA8 A;  1VEL A;  3V3K B;  4LPJ A;  2IB0 A;  1MOJ A;  3Q4N A;  2YW7 A;  3F33 A;  3H7G A;  5D8Q A;  3AJO A;  4RC7 A;  1MFR A;  4DYU A;  1IES A;  3RE7 A;  3BVK A;  3F38 A;  4ISP A;  4MY7 A;  2Y3Q A;  4Y08 A;  1ZS3 A;  4CYB A;  2JD6 0;  4E6K A;  2BKC A;  4TOG A;  4II4 B;  3O7S A;  2V2N A;  2FFX J;  1F30 A;  2ZA8 A;  5D8X A;  3UOF A;  3L0M A;  2XGW A;  5AXS A;  5HJH A;  4ZKX A;  3AK8 A;  2PYB A;  3SID A;  2CLB A;  4LQN A;  4II4 A;  4M34 A;  4CY9 A;  1QGH A;  1H96 A;  5D8S A;  3QHB A;  3HL1 A;  5J9V A;  3GHQ A;  4TOB A;  2W0O A;  2BK6 A;  2YW6 A;  1S30 A;  4YXM A;  3KDQ A;  1L8I A;  2YJK A;  3FSE A;  1OTK A;  1UMN A;  4DZ0 A;  2G4H A;  3EZ0 A;  4XKS A;  4M33 A;  1LB3 A;  4YKH A;  1JGC A;  2ZA6 A;  5E1U A;  3GGY A;  5GOU A;  2V15 A;  1S2Z A;  4IWK A;  2Z5R A;  2F7N A;  3KX9 A;  4RC5 B;  2ZA7 A;  3AJQ A;  4Z3B A;  2V2S A;  3BKN A;  3E1L A;  4DI0 A;  1JI5 A;  5JKL A;  4XGS A;  5LG2 A;  5D8O A;  2HTN A;  2GS4 A;  2IU2 A;  4CVR A;  3GGZ A;  4ERU A;  1KRQ A;  3BVF A;  4A25 A;  3C1Z A;  1JKV A;  3VVA A;  3SE1 A;  4EVD A;  1LKP A;  4CMY V;  2FZF A;  2OKC A;  2IY4 A;  2XJM A;  2D5K A;  5CMR A;  1TK6 A;  3RGD A;  2QF9 A;  4MXP A;  2ZG9 X;  2BJY A;  2V2L A;  3PVY A;  3UFB A;  3C1Y A;  4ITT A;  3RAV A;  3C21 A;  4E40 A;  2FKZ A;  3JZA B;  5GU2 X;  2CEI A;  2UX1 A;  4MN9 A;  5JKM A;  4CYA A;  3TA8 A;  5ERK A;  4KVQ A;  5D8P A;  3HIU A;  4KVS A;  4M35 A;  5J8S A;  4LPM A;  4MKU A;  4RC6 A;  4CVT A;  4KVR A;  3FRR A;  3E6R A;  4YVZ A;  5JDO A;  3BT5 A;  5IX6 A;  3E1N A;  4ZKH A;  4EVB A;  3KXU A;  3PZA A;  4XKU A;  1RCD A;  1L8H A;  4TOE A;  2BW1 A;  2WLA A;  4W4K B;  1NFV A;  3R2L A;  3BVE A;  4DE6 A;  2C6R A;  2G38 B;  4CVS A;  3PVT A;  2CF7 A;  4LQV A;  2GYQ A;  2RBD A;  3AF9 X;  3F35 A;  4PGI A;  4WJG 4;  4DYY A;  1JI4 A;  1B71 A;  3E1O A;  2OH3 A;  2CHP A;  4AM5 A;  4CMY A;  3ES3 A;  3EGM A;  3PWF A;  3KA4 A;  2ZUR X;  5CMQ A;  1DAT A;  1R03 A;  1DVB A;  2CN6 A;  4M32 A;  2FL0 A;  4LQJ A;  4ZL6 A;  4MJY A;  2YJJ A;  2Z5Q A;  1RCC A;  1ZUJ A;  3PW8 A;  3T9J A;  1TKP A;  3QB9 A;  4LPN A;  5GU3 X;  2X17 0;  3JZ9 A;  3DBY A;  1RCE A;  4ZMC A;  2CLU A;  3FI6 A;  2Z6M A;  2ZG7 X;  2XJO A;  5GN8 A;  5ERJ A;  5E2D A;  2V2J A;  2Z5P A;  5K52 A;  3E1M A;  4ITW A;  2WTL A;  3WNW A;  3R2O A;  5K53 A;  3QHC A;  1XZ1 A;  3SHX A;  4ISM A;  1S3Q A;  2FG4 A;  3R2R A;  4IXK A;  2V2P A;  5GU0 X;  4TOH A;  3Q4Q A;  1DPS A;  3PVY B;  4LYU A;  3PW1 A;  3E1J A;  4ML5 A;  3F39 A;  3VNX A;  4LQH A;  1LKM A;  5HQO A;  4OYN A;  3PWQ A;  1SOF A;  1BFR A;  2JD8 0;  1SQ3 A;  4TW3 A;  1YUZ A;  3N6O A;  1JYB A;  4R42 A;  4DAS A;  3LKD A;  4DYZ A;  3OGH A;  4RC6 B;  3PW8 C;  3E1P A;  2V2R A;  5JDO B;  1NF6 A;  3WVW A;  2CWL A;  3F36 A;  1J30 A;  5FFD A;  2FHA A;  2C2U A;  4LYX A;  5CZU A;  3U90 A;  5J93 A;  3ISF A;  3UNO A;  3R2M A;  3PVT B;  5GU1 X;  1BG7 A;  2C41 A; 
#chains in the Genus database with same CATH homology
 5D8Y A;  2HR5 A;  1RYT A;  4ZL5 A;  3QD8 A;  3R2S A;  1JTS A;  5FFB A;  5FFA A;  4TOC A;  1O9I A;  3KWO A;  3R2K A;  2FJC A;  1EUM A;  3BVI A;  3F34 A;  3SH6 A;  5D8R A;  2XJN A;  1UVH A;  1Z6O M;  3R2H A;  3PWQ C;  1RCG A;  2V8T A;  4DYX A;  1O9R A;  4TOA A;  2C2J A;  2C2F A;  3RBC A;  2MGY A;  3A68 A;  5HJF A;  4MUD A;  5JAC A;  4CVP A;  3WVU A;  2V2I A;  4EVC A;  3E1Q A;  4AM4 A;  1RCI A;  1QYB A;  1JRE A;  1F33 A;  3KHK A;  2WWX B;  2CIH A;  4TO9 A;  5GN8 B;  4PGK A;  3WVV A;  3IS7 A;  3KA9 A;  5I4J A;  3C23 A;  2ZG8 X;  4TOD A;  2V2M A;  1VJX A;  1BCF A;  5JKL G;  3NP0 X;  4REU A;  4P18 A;  1IER A;  4Z5S A;  1VEI A;  1N1Q A;  3F37 A;  3PW1 B;  3F32 A;  3KA6 A;  1NNQ A;  1Z4A A;  1GWG A;  2V2O A;  2VZB A;  2V8U A;  3NP2 X;  1AEW A;  3E2C A;  2Z90 A;  2N02 A;  3QVD A;  4YXJ A;  2JD7 0;  5FFE A;  4X0J A;  3MPS A;  1LKO A;  5FFC A;  1HRS A;  3M6J A;  3IQ1 A;  5LBH A;  4ZTT A;  3VV9 A;  4ETR A;  3ERZ A;  4KXR B;  3RD0 A;  2CHI A;  4PG0 A;  3FRS A;  4EVE A;  3AK9 A;  1Z6O A;  1XZ3 A;  5JKM G;  3E6S A;  3A9Q A;  3PVR B;  2VXX A;  2FG8 A;  1YUX A;  3NOZ X;  5C6F A;  4ZKW A;  1JKU A;  4W4L B;  2XKQ A;  1JIG A;  4ZLW A;  3Q4R A;  4RC5 A;  5HU6 D;  4PG1 A;  5LG8 A;  3OJ5 A;  4XKT A;  3O7R A;  5LS9 A;  3QZ3 A;  3KA3 A;  3PVR A;  2CN7 A;  1FHA A;  1NF4 A;  2WLU A;  4ZJK A;  3AF7 X;  3GVY A;  4RC8 A;  2OC5 A;  3ISE A;  3D19 A;  3W54 A;  4QUW A;  3AJP A;  1VLG A;  2ITB A;  2VXI A;  5J8W A;  3GE4 A;  2GYD A;  3FVB A;  2AR0 A;  3UOI A;  1YV1 A;  3AF8 X;  4AM2 A;  4RC7 B;  3IS8 A;  5FEJ A;  3EZU A;  2QQY A;  3BVL A;  4IWJ A;  4TOF A;  1TJO A;  1VEQ A;  2Y44 A;  4U3G A;  3Q4O A;  1TKO A;  3KA8 A;  1VEL A;  3V3K B;  4LPJ A;  2IB0 A;  1MOJ A;  3Q4N A;  2YW7 A;  3F33 A;  3H7G A;  5D8Q A;  3AJO A;  4RC7 A;  1MFR A;  4DYU A;  1IES A;  3RE7 A;  3BVK A;  3F38 A;  4ISP A;  4MY7 A;  2Y3Q A;  4Y08 A;  1ZS3 A;  4CYB A;  2JD6 0;  4E6K A;  2BKC A;  4TOG A;  4II4 B;  3O7S A;  2V2N A;  2FFX J;  1F30 A;  2ZA8 A;  5D8X A;  3UOF A;  3L0M A;  2XGW A;  5AXS A;  5HJH A;  4ZKX A;  3AK8 A;  2PYB A;  3SID A;  2CLB A;  4LQN A;  4II4 A;  4M34 A;  4CY9 A;  1QGH A;  1H96 A;  5D8S A;  3QHB A;  3HL1 A;  5J9V A;  3GHQ A;  4TOB A;  2W0O A;  2BK6 A;  2YW6 A;  1S30 A;  4YXM A;  3KDQ A;  1L8I A;  2YJK A;  3FSE A;  1OTK A;  1UMN A;  4DZ0 A;  2G4H A;  3EZ0 A;  4XKS A;  4M33 A;  1LB3 A;  4YKH A;  1JGC A;  2ZA6 A;  5E1U A;  3GGY A;  5GOU A;  2V15 A;  1S2Z A;  4IWK A;  2Z5R A;  2F7N A;  3KX9 A;  4RC5 B;  2ZA7 A;  3AJQ A;  4Z3B A;  2V2S A;  3BKN A;  3E1L A;  4DI0 A;  1JI5 A;  5JKL A;  4XGS A;  5LG2 A;  5D8O A;  2HTN A;  2GS4 A;  2IU2 A;  4CVR A;  3GGZ A;  4ERU A;  1KRQ A;  3BVF A;  4A25 A;  3C1Z A;  1JKV A;  3VVA A;  3SE1 A;  4EVD A;  1LKP A;  4CMY V;  2FZF A;  2OKC A;  2IY4 A;  2XJM A;  2D5K A;  5CMR A;  1TK6 A;  3RGD A;  2QF9 A;  4MXP A;  2ZG9 X;  2BJY A;  2V2L A;  3PVY A;  3UFB A;  3C1Y A;  4ITT A;  3RAV A;  3C21 A;  4E40 A;  2FKZ A;  3JZA B;  5GU2 X;  2CEI A;  2UX1 A;  4MN9 A;  5JKM A;  4CYA A;  3TA8 A;  5ERK A;  4KVQ A;  5D8P A;  3HIU A;  4KVS A;  4M35 A;  5J8S A;  4LPM A;  4MKU A;  4RC6 A;  4CVT A;  4KVR A;  3FRR A;  3E6R A;  4YVZ A;  5JDO A;  3BT5 A;  5IX6 A;  3E1N A;  4ZKH A;  4EVB A;  3KXU A;  3PZA A;  4XKU A;  1RCD A;  1L8H A;  4TOE A;  2BW1 A;  2WLA A;  4W4K B;  1NFV A;  3R2L A;  3BVE A;  4DE6 A;  2C6R A;  2G38 B;  4CVS A;  3PVT A;  2CF7 A;  4LQV A;  2GYQ A;  2RBD A;  3AF9 X;  3F35 A;  4PGI A;  4WJG 4;  4DYY A;  1JI4 A;  1B71 A;  3E1O A;  2OH3 A;  2CHP A;  4AM5 A;  4CMY A;  3ES3 A;  3EGM A;  3PWF A;  3KA4 A;  2ZUR X;  5CMQ A;  1DAT A;  1R03 A;  1DVB A;  2CN6 A;  4M32 A;  2FL0 A;  4LQJ A;  4ZL6 A;  4MJY A;  2YJJ A;  2Z5Q A;  1RCC A;  1ZUJ A;  3PW8 A;  3T9J A;  1TKP A;  3QB9 A;  4LPN A;  5GU3 X;  2X17 0;  3JZ9 A;  3DBY A;  1RCE A;  4ZMC A;  2CLU A;  3FI6 A;  2Z6M A;  2ZG7 X;  2XJO A;  5GN8 A;  5ERJ A;  5E2D A;  2V2J A;  2Z5P A;  5K52 A;  3E1M A;  4ITW A;  2WTL A;  3WNW A;  3R2O A;  5K53 A;  3QHC A;  1XZ1 A;  3SHX A;  4ISM A;  1S3Q A;  2FG4 A;  3R2R A;  4IXK A;  2V2P A;  5GU0 X;  4TOH A;  3Q4Q A;  1DPS A;  3PVY B;  4LYU A;  3PW1 A;  3E1J A;  4ML5 A;  3F39 A;  3VNX A;  4LQH A;  1LKM A;  5HQO A;  4OYN A;  3PWQ A;  1SOF A;  1BFR A;  2JD8 0;  1SQ3 A;  4TW3 A;  1YUZ A;  3N6O A;  1JYB A;  4R42 A;  4DAS A;  3LKD A;  4DYZ A;  3OGH A;  4RC6 B;  3PW8 C;  3E1P A;  2V2R A;  5JDO B;  1NF6 A;  3WVW A;  2CWL A;  3F36 A;  1J30 A;  5FFD A;  2FHA A;  2C2U A;  4LYX A;  5CZU A;  3U90 A;  5J93 A;  3ISF A;  3UNO A;  3R2M A;  3PVT B;  5GU1 X;  1BG7 A;  2C41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...