4A2UA

Crp(cap) from myco. tuberculosis, with camp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
224
structure length
224
Chain Sequence
MDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A New Crystal Form of Crp from M. Tuberculosis and Conformational Effects of Crystal Packing
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords PROBABLE TRANSCRIPTIONAL REGULATORY PROTEIN (PROBABLY CRP/ F
total genus 58
structure length 224
sequence length 224
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4a2uA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4a2uA01
2F5DA 4RAYA 4PGGA 5HDKA 3MYXA 2UYAA 4EWAA 5EZWA 3JAMZ 4H7LA 2Z5UA 1DPRA 4ZYDA 1BI2A 5J6XA 4Q29A 1ZN2A 2DQRA 5FGMA 2DPDA 2IXLA 4U7BA 4KL1A 4Q4ZF 2D40A 3IHUA 3SXYA 1O57A 1HW2A 4HF2A 2CYYA 1TW2A 3FMSA 2HS5A 2LSOA 1P4XA 3MEXA 4A12A 3J81K 1D3YA 4KICA 4KA4A 1FNNA 2BE5F 2PA7A 5FQ0B 4IPAA 1Q3EA 2HQNA 4RS8A 1LDKB 5CVVA 3W6KB 1ZX5A 1P4WA 1MZBA 1BIAA 1U2WA 1LQ1A 1K7AA 1SMTA 1O4TA 1G3TA 1YYVA 3GXOA 4A0ZA 3K0LA 4XFBA 4JV4A 4N9HA 1R5HA 5CYVA 3H3UA 1W7PA 4AXOA 5BXXA 4CDGA 4BXUA 1XGNA 1XMAA 2XVCA 3IKVA 1LDDA 1SFEA 3ETQA 4KT5C 3FMRA 2XL7A 4RD7A 5HLGA 1T39A 1XMKA 3GFJA 3M7GA 3I59A 1GVJA 5K5OA 2H09A 2NYXA 2VT2A 1YW8A 1MGTA 3EETA 5BV6A 3WGGA 2JTVA 2ET7A 2VBZA 5D4RA 2P5VA 1SAXA 1YLLA 1TLHB 2Z69A 4QLCU 1IRGA 1Z1DA 1IAWA 2RGVA 4LLGF 3NVCA 4CO8A 2DW4A 2QBYA 5E1RA 1DUXC 1T0FA 5DCMB 3FXRA 3WODF 1R22A 3EDPA 4AQ6A 2V1XA 3DF8A 1YWKA 2HDCA 3KP6A 3BROA 1I1SA 4WZCA 1CAXA 3J81Z 4O9GA 4MGRA 4YG2F 1IN5A 1K78B 3GLXA 2BYVE 1L3JA 3KMHA 3RIRA 3MZHA 3CUQB 4M6YA 2ZXJA 1RUOA 3HRUA 1XE7A 5E1XA 5K5RA 4J1XA 2D1VA 3ABTA 3PNAA 1EH6A 1J1LA 4Z82A 1HKTA 2HKXA 3CJNA 2GXBA 4TLFA 3LWCA 2VE8A 3ISPA 3BJ6A 4G6DA 5BS6A 2D5FA 4UVAA 1KYWA 1Z05A 2MD5A 4CZZA 2OU2A 4ZU4A 1Z6RA 4NB5A 4AQ2A 1PUEE 1PP8F 3P9CA 4J1WA 3CLOA 5F6FA 4R52A 4RGSA 3TQNA 5F1RA 3BPZA 1FT9A 5I0TA 5DDGA 4XSXF 1G3WA 3I53A 2G7UA 2JZYA 1ZYRF 5JSOA 2HTJA 1TQ5A 1RI7A 2NS0A 3WU0A 5J48A 1NHAA 3WU1B 2UY9A 2CSOA 4IEYA 2HJIA 2QJVA 1FYKA 2MA3A 2Q4SA 1KQ0A 1PM7A 3SQNA 2ESNA 5D8KB 2VPVA 2EB7A 5JI6A 1B59A 1XCVA 2XAJA 1HKQA 4MGKE 1U12A 2DAOA 4HSJA 2ADUA 1WQ2A 3SMHA 4L2NA 4XLPF 5AIQA 3MWMA 1R58A 4CYDA 3HSEA 3V7CA 1YFWA 3HUGA 1R1VA 3F8BA 3EYYA 3H7YA 5FLJA 3RZZA 2J5PA 4LG0B 3GEZA 5J8FA 3E6BA 1J3PA 2ESHA 1TQMA 2VXZA 3DKWA 5HS8A 2Q1ZB 4KIFA 1IXRC 3OOPA 1GXQA 2QENA 4GYIA 2ZMEA 3M3IA 4UBGA 1KU3A 3KLNA 3QPTA 4AIJA 2M45A 4ZYGA 3JTGA 4BQAA 2UXXA 2CW0F 3E97A 3U2RA 2FBKA 2QLZA 1OYIA 1BM9A 4BH9A 1O5UA 4Q0QA 2B0LA 5CVUA 3ZDSA 3S7IA 2V9VA 4I0AA 4XFIA 4HMZA 3RDIA 4UXNA 2B8MA 1QXRA 1XDUA 1U6GA 4KNYA 2PQQA 2Z99A 4MTDA 4HLYA 4CICA 1FPQA 1Q43A 4B29A 4HN0A 3DV8A 4WXDA 5DUKA 5DV5A 3H1WA 3V7RA 1BC8C 5FDBA 3J7AO 5E8IA 1ZG1A 2VOOA 5LEJA 2HQRA 1G3SA 3I71A 1S7OA 2CFXA 4PIYA 3HTSB 1YUDA 1U5TB 3SZTA 1J7KA 4Q47A 5L3DA 3S7EA 1X8MA 3F8NA 1YHFA 2O3FA 2XL9A 3ZMDA 5BUVA 5DD4A 1WGPA 3KEQA 4FBFA 1W7PB 4K8FA 5E1WA 2K02A 5L3CA 3GZ6A 2IA1A 1LB2A 4PZJA 3KZYA 2VQAA 2L3DA 3I58A 2IXIA 3JZVA 1UD1A 2R7FA 4Z2YA 2H0VA 4XF9A 1XGOA 3DEUA 1TTYA 1HW1A 3KEOA 1ZRDA 4XFCA 4JQFA 2QM3A 5ICGA 4KMUX 4OIPF 5DUIA 4QM9A 4G94A 1EV7A 1L3LA 1TW3A 2P6TA 1S8NA 2Y0OA 3CO2A 2UWMA 1FY7A 2YU3A 2Z3YA 4LB6B 2A07F 4S04A 4LULA 3DP7A 5C8WA 3RTRA 2QBYB 2HWVA 4ZU7A 3LSTA 3U1DA 3WGIA 3HIFA 3H3ZA 1FP1D 1IW7F 5FO5A 3QOPA 1MJ9A 3BU7A 3B73A 3ZQ7A 3QP6A 2MPFA 2E1NA 3W6JB 1HSTA 2CWEA 4A2UA 3CTAA 4P96A 2OZJA 3WTUC 4YIIA 3BPVA 5JVTA 2UY8A 2GU9A 2LF8A 4TV7A 3LA7A 3HOTA 4IRHA 1SEFA 1R1TA 4MNUA 1QO0D 1I6XA 3OTFA 1CAUB 4Y13A 3GX4X 3ZP5A 2AS5F 1EH8A 3OD0A 2E9QA 4RGXA 4G7ZF 2A6EF 3U0ZA 1ONVA 3L7WA 2FRHA 3KP2A 4LD5A 2V6CA 2PMUA 4OU0A 4N0BA 3KGLA 3MZYA 1V70A 3GF2A 2GA1A 1XCBA 2GC1A 2TDXA 2ET1A 2K86A 4MQVA 2QQ9A 4ESBA 3KP3A 5FQ0A 4H0EA 3GFMA 4B8XA 3I5UA 2IVMA 5BPIA 3FE5A 1E2XA 4EGZA 4OMYA 3WW4A 5C6CA 5BQTA 1TQPA 4P5OA 4KWLA 1SD5A 2RVCA 3FXQA 2C6YA 3L9FA 5LRSA 2VONA 2DK8A 4G9YA 4RGUA 5JFRA 2IXHA 4XF3A 3FX3A 2X0LA 4GULA 3DXJF 3H1YA 3QAHA 5LHGA 1RGSA 5I93A 4RGRA 4BHPA 3JAMK 2ZBKA 4RB0A 4QXKA 1Y0UA 4O5VA 2F5EA 4EWEA 3C1DA 2ISYA 1Z6TA 3L09A 4RAZA 5KK1A 4L0ZB 4LUKA 4QM8A 4META 4G7OF 3M8FA 4HVOA 2IA0A 3F23A 3EBRA 4JK1X 5L3FA 1T38A 4A5NA 2V79A 5EFUA 5ICFA 4UV8A 4JTNA 4HDUA 2HGCA 2O6GE 4D0PA 3RJPA 3L2HA 3VB2A 4JTOA 1CAVA 4Q0VA 3QPHA 4NQWA 4LFUA 3EQLF 2HYGD 1IRFA 3K1NA 2VECA 2OBPA 1CAWB 4YSFA 3TDUC 5CVJA 3TO7A 1JE8A 5KHHA 1F9NA 1KYZA 3N4MA 2HYFA 5E17F 2NRAC 3R61A 4ON0A 4A0XA 2ZFWA 2RKHA 2RQPA 2W24A 3TO6A 1KQ9A 5D1IA 3PQJA 1UB9A 1IZ1A 2XAQA 3I54A 2B9UA 2HTSA 1RL3A 4FAGA 1ZLJA 5CVRA 1A04A 2L4MA 1H9TA 2FA5A 1B1BA 1TNTA 3TOBA 4MGZE 3CUQC 4A6EA 5FB2A 1QBJA 4QGNA 1U5TC 4XBFA 3L2CA 4KN7X 4MZUA 5IT3A 4WXHA 3REOA 1WI9A 2FEZA 2RN7A 2PLYA 2IRFG 1ZZBA 3KETA 3SFZA 4WBBA 4EGYA 2CGPA 1Z91A 1IF1A 2L02A 4Q0SA 2OAZA 2BNNA 1BI0A 2P7VB 4HX4A 5ICEA 5CADA 1WKMA 3C18A 3H7JA 4IEUA 3IBMA 3SHFA 4IEVA 1MJAA 5IT9Z 3RKXA 4ESFA 3DL3A 4U0WA 3KZZA 3NSTA 2F5FA 3RNSA 1UHWA 3E5XA 2VC1A 5FFZA 1LDJA 2EWNA 5HLIA 3WTVC 3TO9A 3TNPB 3FJSA 2QQBA 2YX4A 2QVSB 4IRIA 2PAEA 2K27A 2PHDA 3BOQA 3P7NA 5FPXA 4L9VA 3T8RA 5FD6A 1USTA 2B5HA 2MLKA 1REPC 1X8EA 2EFNA 4LK0F 4OOIA 2EAAA 4LMYA 5AIPA 3ECOA 2DCTA 3D0JA 1YFUA 4O6JA 4IEXA 1YLFA 2CQKA 4A0YA 2Y0MA 2QVOA 3H8UA 3TNQA 1O3RA 1BJAA 2EK5A 2FQ3A 4FHTA 3LZZA 5F64A 2NAZA 5EEHA 2STTA 4I02A 1RNLA 4OFGA 1JHFA 2PEXA 2COMA 2FSWA 2XHKA 2FE3A 1X7NA 1HXDA 2YPRA 1CAVB 1UCXA 3SCFA 2ZO4A 3P9IA 2DQLA 1ON1A 3QRFF 5D6FA 2GC0A 5I8SA 1FLIA 4HX8A 4M9XA 1RZ4A 1YIOA 2MLGA 1QQIA 4WXCA 3H92A 3WW3A 3AAFA 4BIFA 3LWFA 1ZNPA 4DQ2A 1NZCA 2ZJ2A 2KIFA 1FBQA 3WTZA 4ZZDA 5JSRA 3O6BB 3SXWA 1JGSA 4MH0E 3ZMSA 1IN4A 5LRRA 2Y48A 3KGZA 5TRDA 2UYBA 5L3BA 5A2QZ 1OI6A 4E2SA 3GYDA 4KN4X 3NW4A 1PP7U 2GWRA 4KYWA 4IESA 2FBHA 1L0OC 3ECHA 1NE4A 4LG0A 3TGNA 5JHUA 4EVIA 1STZA 2PAKA 4HYEA 4FX0A 3P9KA 2EV0A 1QY4A 2IXCA 2IJLA 1FWZA 3H9AA 2YX7A 1FSHA 3LQQA 2OYZA 1CX4A 3RI4A 1NXMA 4MTEA 1RIOH 1ZVFA 1FYMA 4RB3C 3MFKA 4YRDA 1EYBA 4GO1A 1O5LA 3KE2A 3ES1A 3QACA 5I0SA 4I98B 3LAPA 1XD7A 4IEOA 4IETA 4L9JA 2UXNA 2CG4A 1QZYA 1LVAA 2PI0A 1NYWA 4WF2A 1CAUA 4JBAA 4EJOA 1RC6A 4HLTA 3VFZA 4QWQA 3CJXA 3EYIA 1BI1A 3M8EA 2A6HF 2XAGA 1SD7A 2PN6A 1IN6A 2Z2SB 4JVAA 2PHLA 1I5ZA 3Q9SA 4Q0UA 3QP5A 2XAHA 1KU7A 2MBFA 4E2GA 2PTMA 2OA4A 3GVAA 2W85A 4HV5A 3ELNA 3Q9VA 3V8LA 2ZMEB 3T8TA 1ZZ6A 2DT5A 2PBIA 3MCZA 4AWXB 1ZRFA 1MDMA 4I3PA 3FHZA 3PLQA 3R0AA 3GUDA 4RB1A 5K8SA 3EQEA 5BY5A 2DTRA 4R79A 4UXAA 2A68F 3R0JA 2HZTA 4MGYE 1O7FA 4EQQA 1Q1HA 4WVZA 1JUHA 5HI0A 2DU9A 4HZFA 2XIGA 2GC3A 1WLTA 3BP8A 1ZZ7A 4EM1A 3ZMUA 3COAC 2FOKA 5LHIA 1YTYA 1K78A 1OYYA 1WWXA 1ZGAA 5AVPA 4IHTA 2M1BA 4L9TA 1R1UA 1S6LA 3F6VA 2HFHA 2DFIA 1AOYA 1O3TA 1FP2A 4Y15A 4MEXF 2VOPA 5LEKA 4HF1A 4XRFA 5D6EA 1OMIA 2STWA 3CDHA 4KIBA 3S0MA 3T5XA 3PQKA 4Q48A 4L5JA 4IF4A 3V4GA 5I0UA 4HQMA 1DDNA 2WV0A 4WK8F 5FLHA 1MDMB 2EVXA 1SQ4A 2CO5A 4DINB 3IIAA 2WC2A 1YS7A 1SFUA 3MDPA 2RV8A 4HAMA 5E20A 2ELHA 1X82A 1GXPA 3RPUA 1WA4A 3IRQA 3ABUA 3LA2A 4BAYA 1ZREA 4I2OA 4P55A 1XSXA 5JSPA 1QXJA 1J59A 3KP7A 2OZ6A 4L9NA 3CUOA 1XRUA 4F7ZA 2Q0OA 1FXZA 2A3SA 4KU7A 4ZYHA 4OIQF 1KU9A 2N7GA 2BNOA 3WTWC 4YYOA 2W57A 2P5LC 3LAGA 2K4JA 1QNTA 4B09A 5BPXA 2X4HA 4HA8A 2FXAA 5D4SA 2ISZA 2HOEA 3I64A 4GXOA 1FSEA 3ZMZA 5L3EA 4UNOA 2WFPA 4ETSA 2HEOA 3KLOA 1DPUA 3BALA 1J3QA 4EV0A 2D1HA 3IWFA 2Q2EA 4D7TA 3MPBA 1ODDA 3IWZA 2M30A 2K9ZA 4QX5A 3NEUA 3MQ0A 4MEYF 2M87A 1AWCA 4IHSA 3R4KA 1D8JA 3I0TA 5ED4A 2W84A 2R3SA 2FF4A 2OD5A 2FNAA 2KJCA 4K2EA 2M5WA 1YFYA 5CJ9A 3FXUA 2XKOA 3NKTA 3IKTA 4UVBA 3LA3A 3JW4A 4I09A 5HDGA 1I27A 3RKYA 4KMFA 2H6BA 3F6OA 5LHHA 3FM3A 4BHCA 1CAWA 1ZARA 5ILSA 4E70A 2OPKA 2DLLA 1EH7A 2GC2A 5BPDA 4OMZA 5HDNA 5FCCA 3FZ3A 3KSCA 4HV6A 2RC4A 1XSDA 4S05A 3ROUA 4NVPA 2IXKA 4HBNA 4Y17A 1VJ2A 4QGLA 1T6SA 2VE9A 4PIZA 4YIFA 3T0YA 4XEZA 4MQ9F 4HQEA 4AD9A 3HQXA 1VR3A 2PAMA 1JXSA 2PYTA 3HRTA 4LA2A 4QMAA 2YR2A 4P9UA 3RYRA 2EFWA 2EV5A 2QZ8A 4M9ZA 2ZCWA 2GIVA 1B9MA 3C3WA 2XRNA 1Z7UA 2J5OA 1GQHA 1SFNA 5I8YA 1TBXA 4OIRF 5ICCA 1G6NA 1H1MA 3EO6A 2ACJA 1OD5A 5E8GA 1CF7A 4LJZF 4IEWA 3G7DA 3DN7A 3HTUA 2A69F 4GGGA 3MAJA 2C0ZA 1OR7A 1QWRA 2KRFA 1R36A 4IERA 2A5YB 3FWEA 4HX7A 4L18B 3HT1A 2KKOA 3HSRA 3WTXC 1EPZA 2XUBA 1ZG3A 3TOAA 3WW2A 1O3QA 2PMHA 3D82A 2QYOA 4ZU5A 3L00A 4G8XA 4KUMA 3IDBB 4PJYA 2EFOA 1Q5OA 1J5YA 5ERIA 4EM2A 5IT9K 1PDNC 3DPTA 4XLNF 4CHUA 2L01A 1U8RA 2F2EA 5DCMA 1ZRCA 4CGZA 3CL1A 1V4RA 4ENNA 1HW5A 1LKNA 3EUHA 1WSUA 2BEOA 1U78A 2HKOA 4M71A 3BWGA 4KWKA 1S3JA 4IEQA 4F8AA 5LGTA 2D45A 3CF6E 1B9NA 3LOIA 4EM0B 1W5SA 4KIGA 2RDPA 2L4AA 5D5WB 2E7WA 4AVAA 4FT8A 5K1YA 1QZZA 2F5CA 5ILUA 1GHCA 4EJTA 1T98A 4EWDA 1ZZCA 3K1PA 4PIXA 5H6RA 2FBIA 3BB6A 5KHGA 3PVBB 2K7LA 2VBYA 3ACLA 2BNMA 3BY6A 4A6DA 4LTAA 4I0BA 4IVNA 1XGSA 3WTTC 2G9WA 1XB4A 2BGCA 5H20A 1MKMA 2DI3A 5BOXA 2K4BA 3DFGA 4KDPA 4D7SA 1P6RA 2XLFA 1XSVA 3KP4A 3ZMTA 2LKPA 3WTSC 3IC7A 2KIUA 3JTHA 3QU3A 3LFKA 2EV6A 2JRTA 2CAVA 2NNYA 3FHIB 4HSLA 2EA7A 4AIKA 4LLNA 4ENKA 4LLOA 5JAXA 1C0WA 1K6OA 2O8XA 1H0MA 4LA3A 4YFKF 4R1HA 3NRVA 3ERED 3R60A 3ELKA 5L3GA 4IEPA 4KU8A 2GXGA 4G7HF 4M9SA 1KU2A 5LGUA 1YG2A 3FMQA 1KGSA 2ZNZA 1CF7B 1U5TA 3B02A 2O1QA 2LF7A 1KQ8A 3BJAA 2Z33A 5KHKA 1S7AA 5E18F 2I45A 2XLAA 2L54A 2XGXA 2ATFA 1T2KA 1ZGJA 5LLQA 3SZPA 3UKTA 3GYHX 1HQCA 5LGNA 4LEJA 3TKYA 1Y3TA 4QGMA 1D5VA 2F4PA 2UZKA 1BN5A 1P92A 3E6MA 2FNPA 2EFQA 2O03A 1J2XA 2PJPA 2P17A 4MV2A 2XKPA 3BPXA 3QU6A 2XROA 3JSPA 3G3ZA 3M1EA 5JR7B 1CAXB 3LAJA 1TQIA 1IPJA 4FX4A 4MX3A 3H1MA 2IA2A 2Q30A 3O2PE 2GA2A 3Q5FA 1R23A 2VBXA 1SFXA 6PAXA 4LK1F 3UKNA 5D5UB 5HS9A 3K2ZA 5J3UA 2V09A 1W4MA 3V8KA 3DPLC 1V3FA 2VN2A 2XASA 2H6CA 4HBLA 4M74A 2P7CB 1UFMA 2QDRA 4WCGA 1OKRA 3FF5A 1YFHA 4OINF 5K5QA 1R7JA 1XE8A 4IEZA 4OLLA 1XN7A 1LEBA 4XSZF 2GAUA 4U7DA 5DYMA 5FLXK 1R5GA 3FZVA 4LGWA 4L0YB 2D93A 1F4KA 2KXLA 1ZG5A 3ZPLA 1UIKA 2H94A 4XF4A 5E16A 1W7PD 3OCPA 3HRMA 4XFHA 4LUMA 1FBUA 2ETHA 2NNNA 4GYGA 3RKWA 1I1GA 1UIJA 1EY2A 5FLIA 5CLSA 4BNCA 4OIOF 4LB5A 4EROA 1KA8A 1O3SA 1DZRA 4ORFA 1W5TA 5BMZA 1YW7A 2EFPA 2QQAA 5HVQC 4EMSA 1IN8A 3H50A 2PG4A 2OZUA 1IN7A 3RYKA 3VHRA 3HYIA 1YS6A 1LJ9A 3ES4A 5KHIA 4IXAA 3E5QA 3OF1A 1ZZ8A 2FMLA 4HW0A 1MD0A 2V1UA 1QGPA 2IC1A 5D5XB 4ESJA 2EA4A 1J9IA 5KHJA 3EHKA 3E5UA 3GZ5A 1UHMA 2LDUA 2ZKZA 2Z9OA 5FFXA 2FQPA 4N9IA 3U11A 1CGPA 4O9EA 3HSFA 3VOEA 2K0GA 1IXCA 1H1IA 1ZHFA 5FD5A 2OQGA 2FU4A 1IPKA 4ZYEA 3U10A 3F8MA 4UUVA 1FOKA 1FYLA 4UVCA 2IW5A 4E2QA 5DEQA 3JSOA 2MH9A 2BV6A 1BC7C 4HDVA 2IPQX 3ZN0A 1P4AA 4PDKA 4LLLA 1BBYA 3IDCB 4ONUA 1S29A 3SHRA 4UHTA 1XGMA 4FAHA 2P4WA 1VP6A 4EJUA 1X3UA 4RB2C 3M9AA 4U0YA 4P9FA 4UV9A 3WG9A 3S2WA 3BCWA 1P2FA 4ASNA 1SD6A 5FLXZ 4AIHA 5CVIA 3GWZA 2D5HA 4ZZLA 1J75A 3BZ6A 2LNBA 3ST7A 4YFNF 3U9GA 2KJBA 1VTNC 2E7XA 2XAFA 2P8TA 2DK5A 2VT3A 3IRRA 1HSJA 2A61A 3K1MA 1FX7A 2G7HA 4BHBA 1LEAA 1OYWA 1RUNA 3CLPA 2ZNYA 4HVQA 2GH2A 4XFFA 4KWJA 3E3VA 1G3YA 2KIMA 5J8CA 3ZMVA 1LNWA 3IL2A 1FC3A 5KBFA 1O7LA 2HR3A 3OV8A 1Z9CA 4MHGA 2GZWA 5J7MA 3HHHA 3KCCA 4I01A 3CEWA 1WRJA 5FPZA 2VBWA 4HLXA 5A2QK 4HN1A 3KP5A 3HT2A 3NL1A 5JCTA 3J80K 4XF0A 1F5TA 1DGWA 3DQVC 2OA2A 5D8LB 1EP0A 1JHHA 4X6RB 3O14A 3F22A 5AONA 2O8QA 2JSCA 4M73A 1HBXG 1D8KA 3C3VA 4R8HA 2FMYA 2O0YA 5LBQA 1FZPB 4XFAA 3V7SA 3F8FA 2P5KA 5JR3A 4EJVA 4PGHA 4P9GA 3EJKA 4Z07A 2GQQA 3NQOA 2R7DA 4IJAA 2ETEA 1UPIA 1UCRA 4L11A 5I91A 5I8TA 5E1ZB 3WE3A 5DCFA 1TNSA 3V8JA 2MC3A 3E6CC 1J58A 4ENJA 1U3EM 5HLHA 2M8EA 2Q8KA 2PQ8A 1IXSB 4MGIE 2DPUA 3VODA 1FBSA 3FFQA 3C7JA 1B6AA 4G6QA 2ZKLA 3GFLA 3N97A 2CV6A 3O3KA 1QPMA 3K69A 3HOSA 1DP7P 4EJWA 3I7DA 3I4PA 1ON2A 1PMIA 3D0SA 3R6SA 5TJJA 3T1BA 5D5VB 2MNGA 3HRSA 2MHFA 1DZTA 2P6SA 4GCVA 3RYPA 2PFWA 2XV4S 5EEGA 2EJRA 2MH2A 1ZRRA 4KFCA 2QCSB 2DBBA 3NJZA 2BBYA 3CO7C 2VODA 2CAUA 4M6XA 4AVPA 1NE6A 3K9TA 3BJOA 1YO5C 4L5IA 2VC0A 1R00A 1G4DA 1BOAA 1SD4A 2E1CA 3SCGA 3GW2A 2JPBA 3GO5A 2Y75A 1ZLKA 1ULYA 2JT1A 2V1DA 5CU1A 1E17A 1YFXA 5I0RA 4A5MA 2AXLA 3OGJA 1BIBA 2JPCA 4CXFA 1Y9QA 4WX9A 4IRGA 3FM5A 4M72A 2W25A 5KVRA 1LR5A 2QNKA 3USSA 3BDDA 1OFNA 3SCHA 4YNIA 1USSA 3F8CA 3I59B 1YQAA 2OQRA 1ZH5A 1UW8A 2QWWA 3WE2A 3ULQB 2QUFA 3GBFA 2IP2A 3LQRA 3J80Z 4X6QB 2WWYA 4YFXF 3ML6A 3PFIA 3WTYC 1J3RA 3RPQA 3TDZC 1ZZ9A 3GFIA 4AVCA 4PCQA 4UBHA 3CO6C 4WWCA 4HVRA 3M70A 4Q5SF 3CUQA 2XLGA 2RNJA 4I7HA 1FI2A 3E6DA 4XF1A 2YSRA 3UKVA 1SMYF 3WW1A 4U88A 1OPCA 4AVBA 2DO7A 3F21A 1BI3A 4HOBA 2WTEA 4BYYA 1IUYA 1ZAOA 4HF0A 2EA2A 3WGHA 5DD8A 3F72A 4Q0PA 4MUVA 3D5LA 2O61A 1F1ZA 1B4AA 4NHJA 4XFGA 3G73A 2IT0A 1XDSA 3KFWX 4YARA 4DNCA 3VEPA 1MJBA 3ZN1A 2IXJA 2PFBA 4O3MA 4ZH4F 2Q0AA 5ILVA 5HOOA 1LRHA 1K79A 1RTVA 4XETA 1J0RA 5T3NA 1DGRA 1YW9A 4U0VA 2D2WA 3F3XA 3HHGA 5H6QA 1GQGA 2H27A 1H9GA 1HKSA 5HS7A 4ENMA
chains in the Genus database with same CATH superfamily
2LY9A 1AR71 3AP9A 1NX9A 4FPYA 3JAMZ 2CNAA 1UOGA 1BI2A 5J6XA 3S14J 4Q29A 1VRH1 2W87A 5T55A 2X6WA 4Q4ZF 3FXOA 3SXYA 1CESA 4Q4V1 3CC7I 4XPVA 4D5FA 3MEXA 4C90A 4A12A 1NLSA 1ZBA1 2I2SA 5IY5H 3CMGA 3OBRA 3RCOA 1Q3EA 3AP5A 3LB9A 5CVVA 5DAVA 3EMRA 2ZACA 4L92A 4JDMA 3MN2A 1BIAA 4GFBA 5CAZA 4P5HA 1K7AA 2IS4A 2EPFA 4BLJA 4XICA 4ISRA 1ZRIA 3DTIA 4A0ZA 2PJRA 3KT4A 4N9HA 1G7YA 5CYVA 1UYXA 5HCBA 1PYVA 3H3UA 1PVEA 1AHSA 3HDDA 4CCNA 5IP7J 1JODA 5BXXA 4PDWB 2X1CA 4CDGA 4BIOA 4BXUA 1XMAA 2XVCA 3IKVA 3NQHA 4H2AA 1ZBE3 2LBFB 3FMRA 2XL7A 3VBFB 2ZJPF 2WBKA 2XJUA 3M7GA 4W6XA 1GVJA 3NNFA 3AYEA 2H09A 2NYXA 1ZM1A 2KZGA 1K83J 3ASNH 3WGGA 2ARBA 2R7VA 2HOAA 2JTVA 4URTA 4XLEA 1TME2 2P5VA 1SAXA 3OS0A 1UU4A 1TLHB 1POGA 1IRGA 1VFCA 1Z1DA 2XQRA 1V6MA 5DCMB 3VKOA 4NIDA 1TL8A 1K42A 3EDPA 3NAPA 3LEGA 5A80A 2HDCA 4QPGB 3K4AA 4JQRA 3SH3A 3N9OA 4Q4W3 4DXTA 1MSFC 3RIRA 3CCVI 3MZHA 2PMWB 2HDDA 4RLQA 4COYA 4C2UA 3OYWA 2HXOA 1EH6A 1REFA 4QD2A 2HYXA 2CW8A 2VH9A 1Y4WA 1L7LA 3PFYA 2VD7A 5LCWL 4TLFA 1GZ9A 3LEKA 4B47A 3BJ6A 1T95A 3AL0B 4G6DA 4UOJA 2F5VA 3I3LA 1V5FA 1RUH2 1KYWA 3VLBB 1PJRA 1Z05A 3ZYBA 3AZWA 3ENRA 3HZJA 1JT6A 1Z6RA 4NB5A 4XUTA 1PUEE 3P9CA 2RAEA 3IT8A 2WAQA 3CCSI 4Q4X2 4ES8A 4RGSA 5F1RA 3BPZA 1FT9A 1T33A 5I0TA 2G7UA 2JRMA 2C9AA 5JSOA 2KFDA 1TQ5A 1XJAA 5JOXA 5HPOA 4RGGA 2NLRA 1W6OB 4F52A 3BG6A 1RUC2 2UY9A 4ATEA 3FLTA 4NUBA 4QB2A 1CQ9A 4YEJA 4BE0A 4Y52J 2Q8DA 1FYKA 1BEV1 1KQ0A 3T08A 5D8KB 3NAUA 4AM3A 3JBG1 3EPZA 1XCVA 1HKQA 5HLTA 4MGKE 5C3QA 4UT5A 5K7PA 4HSJA 1GYKA 4XLPF 4AVTA 5LB6A 3KS7A 3HNYM 5B4XA 1R1VA 1SCSA 1RKTA 5J8FA 2Y6JA 3E6BA 2PHFA 3LFMA 5JVVA 1B09A 2F4IA 2ZMEA 1F15A 3M3IA 5F39A 4A7YA 3EUKL 2RREA 5K4LA 5IATA 2UXXA 1X1BA 2P3YA 4V2VA 4IE6A 2DU1A 3U2RA 2HWD2 2XOMA 3O7OA 2QLZA 3C8XA 1LAJA 3A0KA 1O5UA 5BYNA 2JE9A 4Q0QA 1W9FA 1H88C 1PIV2 3S7IA 1TC3C 3AC0A 3ABZA 5D21A 3RFRA 3VKMA 3D8CA 1R6RA 5FZ3A 1RHI3 2B8MA 1RC9A 3FBYA 3HMYA 3AZYA 3RKQA 1IGNA 3DYPA 1REDA 1Q43A 5G05L 5E3MA 1YQ6A 4B29A 1PZ7A 4QHBA 2IZWA 3CCQI 3U78A 3B3QE 5F9TA 2VOOA 5LEJA 5LBBA 1AL21 1SEUA 5FZOA 2IBDA 2HQRA 1G3SA 5LW9A 1S7OA 2RQQA 1H6YA 5A6ZA 2CFXA 3HTSB 1YUDA 3SKVA 1ND3B 1U5TB 3FXKA 3B6AA 2D3SA 3IH3A 2O0OA 5DD4A 2BXZA 4JRAA 4K8FA 5E1WA 2ZMNA 4QTRA 4IV3A 3OPZA 2R5ZB 2IA1A 2ID6A 3IMMA 5EJ1B 4M3CE 4CCEA 2HQ5A 2IXIA 1QJU2 4COZA 1TTYA 1HW1A 3BC8A 1WW4A 3IAQA 4OIPF 1L3LA 1S8NA 4E4DX 2Y0OA 1VF9A 2JVHA 1QJY2 3RRDA 1XU1A 4NQWB 2UWMA 4GJYA 4CUBA 2K9LA 1FY7A 2HYJA 3JRHA 4S04A 4DYQA 4QXBA 3PSFA 1RUF2 2F6BA 3BZCA 3GLLA 3WGIA 3OYHA 4EN8B 3PNYA 3MV11 4FPKA 1FP1D 1YHQI 3QOPA 3Q3SA 3S16J 4E8DA 1VBD1 3QP6A 2MPFA 2PQSA 2E1NA 3CLQA 3FFZA 1HSTA 3UL2A 4RGKA 4A2UA 4QKBA 4NDLA 1SVMA 4KITB 3BPVA 4QKFA 2GU9A 1TMF1 3LA7A 3BTAA 1BMV2 3H42B 4MLOA 2CWMA 1SEFA 1N47A 1I6XA 4GRIA 3C2UA 1VQPI 2AS5F 4XBQA 3T0AA 4G7ZF 1J83A 3DXUA 1ONVA 5DTDA 4OI2A 3T1MA 4DOUA 3TWIA 3KP2A 2V6CA 4XKVA 5EP9A 5HODA 1V70A 2GA1A 1IOAA 3PVOA 5JI7A 4MQVA 1WMEA 1AYN2 3GFMA 3M3QA 1HB4A 2IVMA 2K3FA 3FE5A 4EGZA 3PM1A 4OMYA 4COVA 4BXFA 5BQTA 3LSEA 1TQPA 4P5OA 3LL7A 1SD5A 3FXQA 4LG3A 5C44J 2ZX2A 5DAPA 4XF3A 3FX3A 5JHFA 4GULA 2C24A 2E7QA 1QU0A 3DXJF 2PHXA 3H1YA 1RGSA 4RGRA 1E3HA 2UURA 2OV7A 2ZTNA 1E3PA 4B44A 4DMIA 2Y31A 4JX5A 1X33A 3WDXA 2ISYA 5DXDA 3L09A 5B2GB 4OUEA 4L0ZB 5H9QA 4META 1V0AA 9ANTA 2GIZA 2A75A 4JK1X 4DPNA 3DBHB 1RUJ3 1T38A 4A5NA 5ICFA 2XVLA 5ACA3 1H2LA 2O6GE 2R6QA 3WNNA 3DTEA 3D5SC 1CAVA 5FUIA 3QPHA 2WWSA 2HYGD 1ND3C 2EXIA 1WLWA 5FRNA 2VJJA 2UWCA 1S2EA 5CVJA 3MLLA 5C9AB 4HOOA 4KQ7A 1MEC1 3HPHA 1TMF2 2VQUA 5AFBA 1UX6A 1QEXA 2BUKA 4IV1A 2NRAC 4ZTFA 3IN9A 2A7AA 3VUOA 2V4VA 2VE1A 5DZFA 2EIKH 1UB9A 3CD6I 4TTGA 4GB31 2XAQA 4A44A 4PF1A 3K51A 4FAGA 1QJU1 1ZLJA 1KDMA 4IL7A 2ZEZA 1A04A 3F95A 2L4MA 3UNGC 4GH4B 3BOWA 4IL6C 1QBJA 1U5TC 2JE7A 4XBFA 4KN7X 4NHKA 5IT3A 4YVSC 3REOA 4N53A 1HN0A 2MD0A 3U37A 2TBVA 2PLYA 1ZZBA 2WA4A 3KETA 2AQEA 1H4GA 1H8VA 1UOBA 4WBBA 1SPPA 1GR3A 3MZ8A 1CZVA 1JOPA 3MW3A 2OAZA 2BNNA 2P7VB 2VMCA 4RQPA 4IEUA 2JJ6A 5JLXA 4JKKA 1MJAA 1JOBA 3ZSMA 1IS4A 3R05A 3RKXA 3ETPA 3ZXAC 3VDXA 1NA1B 3VHOA 1UHWA 2WSUA 3L2VA 4QXHA 3PNTA 4BEHB 2VOWA 3LDBA 4UUSB 1VB2A 1X1PA 3WTVC 5AC93 1QQP3 3TNPB 3FJSA 2BQPA 2QVSB 3VDCA 4IRIA 3VBFA 4OI0A 2K27A 3AXEA 2ZGUA 1UY2A 4ZONA 4L9VA 2LFBA 2CUJA 3HOVJ 1X58A 2QSFX 2QZ2A 2XB5A 4OOIA 4LMYA 3ECOA 1RUJ1 2CGNA 4IEXA 2QQ8A 2DT7B 1D5YA 2Y0MA 3H8UA 2MEV3 2HWC2 4CCOA 3THDA 2EK5A 1HDKA 5EEHA 4E4HA 2STTA 1J1TA 2R062 4OFGA 2PEXA 2XHKA 1WGXA 3BYWA 3AL0C 4D7MA 1Q8QA 2BBVA 1PHMA 2XONA 5IVCA 3CCRI 1CJDA 3JD73 3EUHC 2ZFUA 2Y2ZA 1X1DA 3SCFA 4FOQA 5JR2A 1YCIA 5ABJB 5JZGA 2VQGA 5I8SA 1SVLA 2YXSA 3O1TA 5CG8A 1YIOA 5L7OC 3AAFA 3LWFA 4B3XA 3GTJJ 4XHXA 2XXZA 2HXIA 1ORKA 4S0HB 4XW3A 1FBQA 4XLAA 3VBUC 1W8ZA 3O6BB 4QQ2A 2DN0A 4MH0E 3HOYJ 2Y48A 3KGZA 2K46A 5A2QZ 4FXKB 1OI6A 3K48A 4E2SA 5J1XA 5K7HA 3DU6A 3JBG2 4Z2WA 4KN4X 1VBA3 3T2PA 1W2TA 4YZ1A 1FTTA 5KHDA 1L0OC 1GWKA 4A3CJ 5JHUA 3B9IA 1OVPA 2ZHNA 1STZA 1CD3G 3NNGA 4K6BA 2V1NA 3P9KA 4AE2A 4IOAF 3VHNA 2EV0A 1TMF3 1WMXA 2CQXA 4WM7C 1GVDA 3H9AA 3J7ZI 3AVRA 1H30A 1AHDP 1TP4A 5FP3A 1FMWA 1JTXA 3KZIC 4CEYB 4RQPB 2LROA 1D4M2 4J6GA 4Q4V3 4XJUA 4I99C 3MLJA 3WD5A 1WH7A 1EYBA 1HQWA 1O5LA 3GHMA 2V73A 5I0SA 1R082 2D98A 4L9JA 2UXNA 2CG4A 1NYWA 4XILA 1VMHA 4HLTA 3ACGA 4KJZA 2XJTA 5FKNA 5IP6A 2OJED 2PN6A 1X19A 1QJFA 1VRBA 2PHLA 1W8UA 4Y1ZA 1I5ZA 5FZ0A 1VBC2 5FXVA 5IOZA 2MBFA 5A1LA 2JG9A 2W85A 2WBMA 4HV5A 2AYHA 1HB1A 2ZMEB 3TYJA 3T8TA 1ZRFA 2RJ2A 4I3PA 4QX1A 3GUDA 3B6CA 5DG2A 5H9PA 2DTRA 1ND2B 3R0JA 2IS1A 1Q1HA 1B35C 4WVZA 3QWLA 4RMNA 2JVGA 5FZ7A 2E2IJ 2XIGA 5BNOB 1R49A 3AKQA 1WLTA 1IZ3A 3FHQA 2NQYA 5FPAA 3COAC 2FOKA 1MMGA 1WWXA 1ZGAA 1CN1A 3AXDA 2M1BA 2YBPA 4XUPA 2VM9A 4JCKA 3L2QA 1DQ4A 5C9AC 3LSRA 2W1OA 1NG6A 2DBIA 4HF1A 1HRV3 1JGGA 3WHBA 3PQKA 2R7SA 2IGKA 4Q48A 5FYTA 4CDUA 2A3XA 1PO12 5GAEJ 4B48A 2WV0A 3T3YA 3CBNA 5LASA 2R0FA 2W47A 3VBFC 3KV5A 4PLOA 5DUVA 2A71A 1GXPA 3RPUA 3IRQA 3VBHB 5A7WA 1W8WA 4BAYA 1O59A 3VL9A 5FZ4A 3TL4X 3POSA 2ZC2A 3A0NA 4OUSA 4AI1A 4AZZA 4E7ZA 1V9U3 3LQCA 2OZ6A 4L9NA 1RUI1 4IQJA 3JCUC 4IE7A 4DQAA 1AF9A 1BJZA 2K9NA 4Y4YA 4EZ4A 2RJLA 3N9PA 2ARCA 2BNOA 1OQEA 1TEIA 4QPWA 2M2EA 3E0JB 4IO9F 2DF7A 2RM22 4XBLA 5BNPC 4B09A 2KT0A 1JU3A 2WQZC 4FPEA 3BZKA 1W03A 2WFPA 3VGIA 1HLCA 2VI6A 1J3QA 1G9DA 4D7TA 4AEDB 5F3GA 2OX0A 4YW6A 1FPN1 1ODDA 3LPGA 3I4IA 4GDFA 3N9LA 4N7UA 2R063 2KISA 2WNUA 1WW6A 2ZEWA 1X2MA 2P2KA 2VXRA 3HOUJ 3SEZA 5C5UA 5ED4A 2CQNA 3J7NA 3FXLA 4KG8A 1JHJA 2FNAA 4AHWA 1GZWA 4MIMA 1YFYA 3FXUA 1MR5A 4GMP1 1MVEA 5LA9A 4XQFA 2OPTA 3ZFGA 4XJ8A 3JW4A 2XB6C 5HDGA 1I27A 3RKYA 1OFSA 1QJU3 3K2OA 5FZ8A 3FM3A 3PUQA 3BU0A 2QTWB 5C8CA 2KIQA 2EXJA 1QQP2 2EICA 2GC2A 5BPDA 4OMZA 3MO4A 2NS8A 3ACIA 1UXXX 3KSCA 4C0HA 3KT1A 4HPKA 3CIHA 5K0UA 2QGUA 2E51A 3S3MA 5FBZA 2EZHA 1R1A2 2GP3A 2VE9A 4PIZA 1OUSA 2DUQA 4XEZA 3OOXA 4MQ9F 4AD9A 2LR8A 2A1XA 1KGYA 2VUCA 4K40A 2IS6A 2CDPA 1GV9A 2AO9A 1B8IA 3HRTA 5GPCA 4QMAA 1PO21 1F31A 4P9UA 1JTZX 3RYRA 3UGGA 4D6RA 1M06G 2ZCWA 1BKZA 4NN0A 3VBSC 3WG2A 1GQHA 1VMJA 4JGYB 1TBXA 3EO6A 1W6MB 2ACJA 1S7EA 5IUQA 3WG4A 2GLOA 4LBQD 3ZSKA 5E8GA 2HOTA 1CF7A 4LJZF 1OURA 2A69F 4GGGA 4OHWA 1OF4A 1QWRA 2W46A 1W9WA 3ZR5A 2KRFA 4LBQB 1R36A 2A5YB 3FWEA 3WP3A 1YJWI 1PGSA 3HSRA 2JDHA 1S5LC 1FOD1 3CHXA 2CV0A 1SBFA 1TE1B 2P81A 1W9YA 2XUBA 2W00A 3W3CA 4M00A 4IGQA 2JA7J 1LHUA 4BMBA 5FZKA 4UB8C 1J5YA 2VNGA 5FPUA 2YU9J 3PUSA 1DYKA 2YBKA 1NTCA 3B93A 2BPA2 3S1NJ 4TSVA 3GJAA 3DUIA 4QX0A 4HONA 1NK3P 1BR4A 1TWHJ 1U78A 1EAH3 3TBDA 1HN1A 2E60A 4P9XA 4ZZ5A 4EM0B 1OLMA 2L4AA 5D5WB 4BU2A 5FMOL 1QHHD 4FT8A 5IVBA 4KBBA 3AFHA 2F5CA 1T98A 2JDPA 4LMFA 1Z3YA 5FYUA 4DB5A 2DJIA 4PIXA 3LE0A 3FUQA 3LSGA 3PVBB 3BY6A 3L1PA 5J4VA 3PVEA 1WZ2A 2G9ZA 2ZJCA 2G9WA 5HXVA 3WNLA 5CEHA 3NJXA 3IB3A 1T8IA 2K4BA 3DFGA 4KDPA 3RG0A 1DZQA 3WTSC 4BE2A 1IS5A 2D43A 5FYSA 3H5RA 3HWJA 2EV6A 5K7ZA 2R7XA 3CZUA 3USUB 3K77A 2L9VA 3KHCA 2PXJA 2JD4A 3OS1A 3G1OA 4WVWA 2EA7A 4AIKA 1UOJA 4LLNA 1FJLA 1FV2A 4TN7A 4LA3A 2I5UA 3H9QA 2CV1A 2YPDA 5L3GA 4XE9A 1SCRA 4KU8A 4PLMA 4PDWC 1KFUL 5L73A 4M9SA 1KU2A 3R0RA 3GJBA 1YG2A 3WEZA 2ZNZA 1COV1 3ZXKA 3B02A 2ZSIB 4UF0B 4UW4A 4JGYA 5DS9A 1S7AA 4NC8A 2VBDA 5JOYA 3B94A 2DA1A 1T2KA 3M7AA 1HX6A 1PIV3 2NVQJ 2PLV1 3J7MA 4L97A 1LCLA 2UZKA 1BN5A 1P92A 4CP0A 3K4ZA 5FWJA 1AX0A 5ANQA 3VWBA 1JKOC 4P9WA 3JSPA 3AMMA 3BOPA 4LOTA 2BHYA 5JR7B 3AKSA 3MIFA 1CAXB 2XGEA 3LAJA 3VBSB 4JC1A 2VY0A 2DA7A 1DDLA 1XPWA 3C7FA 2GA2A 2R073 2P6CA 5FYVA 2Z42A 4D69A 3PJRA 1PVC2 5F32A 3K2ZA 3ZIWA 5J3UA 1W4MA 5F0FA 4R9CA 2XASA 1CZSA 2LG4A 2W52A 2K40A 2P7CB 4K1YA 2HEWF 4WCGA 1U5XA 1OKRA 4HG6B 5F3EA 3HNMA 5K5QA 4IEZA 4AEDC 4IKFA 2GAUA 2W1WA 1AXYA 5FLXK 2PHRA 3WHCA 1POQA 4LGWA 2D93A 2IUWA 1F4KA 1I3QJ 1AR61 4OHXA 5DMYA 4Q4X1 3EXUA 3BIEA 2C4XA 3MICA 3RWNA 5HNFA 3OUIA 1RUD1 4LUMA 3VDDB 4ET7A 1FBUA 4PDWA 2ETHA 4FQZA 3WP6A 2HLEA 1WPKA 4BWOA 2X10A 5GZDA 5C3PA 1EY2A 4GB32 3CF5F 4BNCA 4LB5A 4EROA 3OUHA 2Y33A 4Q4X3 1O3SA 3V64A 4UAPA 4O7XA 2EFPA 2QQAA 4BISA 4W97A 2FZ2A 1WCDJ 4CDWB 1HKDA 3H50A 2Y64A 5K7FA 3D6EA 4IE0A 2C26A 2L0KA 5KHIA 4IXAA 5T52A 3E5QA 3OF1A 2FMLA 3AL6A 2V1UA 2K5CA 2QQIA 1AR63 5D5XB 3MD2A 3EHKA 3D5RC 1UHMA 2WT0A 5FKMA 1BA5A 2R7EB 1DIWA 1YJ9I 4E7SA 1CGPA 3BT9A 2K0GA 1H1IA 2OQGA 4CCCA 5JIAA 2DFBA 4UI9L 4PUSA 2E19A 4UUVA 4UVCA 2ZX3A 1OQ1A 4E2QA 3W2VA 1YX3A 1GNZA 2ID4A 3JSOA 4PFOA 2BVMA 2BV6A 4HDVA 3JRDA 3DECA 1S0GA 1KONA 4PDKA 1F4AA 1BBYA 3GCWA 2ECCA 3GBWA 4UHTA 4HANA 1GU3A 1G9FA 3JXSA 3UETA 4RB2C 4U0YA 1KITA 5BNOC 1GZTA 4A3KJ 1ULEA 4ASNA 2DA2A 5FLXZ 4AIHA 3GWZA 2D5HA 1T2XA 4Y24A 1LJ7A 3KD4A 4CEYA 4CYCB 3BZ6A 4URAA 2JK3A 4YFNF 2KJBA 1VTNC 2JENA 4RFT0 3FXJA 2P8TA 4C91A 1MZ5A 2IXSA 3IRRA 1WA6X 3CCEI 4AVZA 2A61A 2P3IA 2VZUA 4LBKA 3J26N 4XBNA 2WO2A 3CLPA 1ACCA 4HVQA 2WV1A 1X36A 5L36A 4KWJA 3E3VA 1G3YA 2YG0A 1RUD2 2KIMA 2E2HJ 1YI7A 3IL2A 3ONQA 5KBFA 3H0DA 1UYPA 3JB8A 4MHGA 2W9XA 4L5EA 4C0BA 1W99A 4BK5A 2QDNA 2KRCA 4HLXA 3OSGA 1NLRA 2WO3A 3NL1A 3Q8BA 4BK4A 5JCTA 4A3GJ 1KRIA 1NUKA 4XF0A 1F5TA 3DQVC 2OA2A 4X6RB 2Q8EA 2H8WA 1AKHA 1DCSA 1JXNA 2O8QA 3ZXDA 4OAZA 2JSCA 4XIDA 4R8HA 1PZ9A 4AI2A 1W05A 2ENRA 3V7SA 1K3IA 2P5KA 2QQOA 2ZPXA 1W6PB 4FO9A 5JPMB 1N1YA 2HOSA 2R7DA 3RZHA 4IJAA 2ETEA 2OQ7A 5HXMA 3GCXA 4P08A 1UCRA 4HRIA 1YXWA 2R7OA 2CYFA 1S0EA 3HC7A 2VLAA 3E6CC 2LYCA 1J58A 2X09A 5HLHA 3ZFGC 3AZXA 4MGIE 1YQ5A 3FFQA 1FBSA 3C7JA 3PUBA 1HJFA 2VR4A 2ZKLA 3GFLA 4YGEA 3JRFA 1ZR4A 1MEC3 5FIXA 5F04A 3LGRA 1SBDA 1OT5A 1R081 4FP3A 2VO5A 4EJWA 4ZY9A 5TJJA 5D5VB 1ZGWA 1NCRA 3HRSA 3NV2A 1AR82 3AG4H 2PFWA 5EEGA 2R042 2Q8OA 4AFDA 4M6XA 5E8AA 4QQOA 2VW1A 2G19A 1TWFJ 4Q8KA 1BOAA 1VQ6I 2AUYA 2LVSA 3SCGA 2VZSA 2JPBA 1UAIA 2Y75A 1ZLKA 1MNMC 2V1DA 4KI5M 1NQJA 2VTXJ 2P1BA 3HNBM 3OPWA 4LNVA 3OGJA 2JPCA 5TGTA 1FEXA 1LOFC 5B3SH 4HKWA 1I1EA 4XONA 5EG0B 1WI3A 2QNKA 2YY1A 1OOPB 4ITCA 2EAKA 4YNIA 3FN9A 4RR3C 1S0BA 1FOD3 2E1MC 2DVAA 5KC6A 4P9IA 3F8CA 3IPVB 5IOYA 3DF0A 4P9YA 1K5MA 1O4XA 5J1UA 3OGVA 3GBFA 3J80Z 4FPCA 2WWYA 1HIXA 4YFXF 1BYHA 1AA7A 3WTYC 1XBFA 1C5IA 2AEYA 3GFIA 4UBHA 5GJ6A 1WD3A 2EIBA 2VOXA 2L2OA 3BI3A 1Y8QB 1QNYA 4I7HA 3E6DA 3BKZA 4BQXA 3I3DA 4U88A 1OPCA 1VNDA 5FKKA 1DQ6A 4QQHA 3F21A 5EEAA 2V6EA 2W68A 4FP2A 3H8OA 2WDBA 3KF3A 3K4KA 4GB33 4LK7A 4FVVA 5DD8A 2BZTA 4MUVA 1GT0C 4X8PA 1QOSA 1KQRA 3A01A 2WWJA 1PGL2 2IT0A 1XDSA 4BQOA 2CGOA 3RZKA 4DNCA 3VEPA 4OVEA 3ZN1A 3JU9A 2PFBA 2JUGA 3E1F1 1LRHA 3DKXA 1RTVA 4JZRA 4RL7A 1VQ9I 1YRZA 4DXRA 3HHGA 2R041 2WADA 2RS53 4V19K 2GBYA 2DDUA 1ERDA 3NRUA 4QPGC 4EWAA 3BR3A 4F92B 3WNPA 1MBHA 5EZWA 2ERFA 2JWTA 4UY8I 5GZFA 1DQ2A 3S5QA 4U7BA 4KL1A 1PK6C 3A4UA 1H2NA 3IHUA 1FPN2 4XC9A 3B5LB 4QPQA 5A7QA 1MZ6A 5FLMJ 5A7SA 2LSOA 2BGPA 3J81K 1PX4A 2ZGKA 4YG3A 1H89C 5FQ0B 5HCHA 4IPAA 4AVSA 3C7GA 2R49A 3CC2I 1P4WA 2R4GA 3CZ6A 2D97A 1NA1C 1SMTA 2WFF1 4CZCA 3K0LA 2CHHA 4XFBA 4ITVA 1SFPA 5GTHC 3ZOIA 4AHXA 4XUQA 4GXLA 1LDDA 1SFEA 2A70A 4KT5C 4AEDA 2Y60A 4CDQA 3FHNA 4C1XA 1T39A 1GICA 5K5OA 3RMYA 2P34A 2VT2A 1YW8A 2R061 2WYFA 5D4RA 1V54H 4QLCU 1IAWA 5FO8B 2LTNA 4Y7NJ 3VL8A 1JYNA 5E1RA 3FXRA 3WODF 1AYM1 1R22A 1GP4A 5GAHJ 1Y6IA 2V1XA 3DF8A 1YWKA 4H14A 4HK8A 2AXTC 3WUCA 1N1TA 3U4SA 1CAXA 1OF3A 2FHRA 4YG2F 1K78B 1OCRH 2BYVE 4C1WA 4M6YA 4CU8A 4Y5TA 2VMHA 5LWBA 1RUI3 2D1VA 2X6YA 4TLGA 3G71I 4KMQA 1J1LA 4Z82A 3F9KA 1HKTA 4BJTA 3ITQA 2E6VA 5FP4A 3LWCA 2VE8A 2IFWA 1W3XA 3ABMH 4UVAA 2DFCA 1X3ZB 1VIWB 2MD5A 4BQNA 5JPNB 2OU2A 4LKSA 4ZU4A 2VMDA 3GZUC 5F0CA 2WS93 4A69C 4R52A 2FBEA 2E7TA 4Q26A 1MMNA 1A6IA 5DDGA 3I53A 3O1RA 1ZYRF 1BVP1 4Z2AA 1RI7A 1HA8A 1UMZA 1GNYA 1YRNB 3MPPG 3BPSA 1I5PA 3OIQA 1AR93 1OA4A 2X1DA 2VOVA 2ZXWH 1R083 4IEYA 3RI8A 4JX6A 2AC1A 4QIWN 4D5CA 3QQAA 3SQNA 1PNFA 4QPOA 2VPVA 2EB7A 1YIJI 4WM8A 4PHZA 1PK6A 1RIRA 1RXFA 2DYCA 2JQ7A 1U12A 1ULPA 4FCYA 4XM3A 3SMHA 3BR2A 3TN92 4E4SA 3HSEA 1XMXA 3QOEA 3JRIA 3HUGA 1TNFA 3EYYA 3H7YA 5FLJA 2B63J 4RR3B 3RZZA 3F2ZA 1BBT2 1S4CA 4AFCA 2XAUA 3M3OA 2R0QC 2VXZA 2Q1ZB 1B8IB 1MMDA 1IXRC 4GYIA 3AMPA 2O7OA 3VD3A 2WZR1 2HWC3 3VBOB 4AIJA 3VZJA 2M45A 1U8BA 5A3WA 5JZGC 3MIEA 3ZXJA 3MW2A 4Y26A 3LFUA 2FBKA 3QYBA 5FY7A 2IGNA 1BM9A 5CPRB 4BH9A 1CX1A 5FKOA 1LHNA 4XQWA 3DBLB 2R5YB 2B0LA 3POIA 5CVUA 2GDFA 5IAXA 5KXEA 2JDKA 5A3OA 2IGMA 4XFIA 3HOBA 2QQPA 2M3AA 4UXNA 4RSUA 1QXRA 2OQ6A 1U6GA 4S2GA 1DGLA 2PQQA 3OIPA 4V2GA 1TT0A 2VMIA 5JMOA 1QXPA 3HAGA 3DV8A 5DV5A 4U36A 3V7RA 2GNBA 2IFRA 3ZSLA 3J7AO 5DDJ2 5E8IA 4XDQA 4FPHA 5GZCA 3KCXA 1RINA 3SH5A 2PLV3 2VKEA 4PIYA 2DU0A 3OL3A 3SZTA 1J7KA 1KFXL 1BOBA 5L3DA 1TZLA 3QCWA 2JWPA 2LRPA 3VKLA 4MGSA 4A3IJ 4RR3A 5BUVA 5FXZA 4RBOA 1W7PB 2BP6A 5F08A 2BY3A 4PZJA 1SZBA 2O14A 3N7JA 3RMXA 4UW5A 2L3DA 2NMOA 3I58A 3V0AB 2H8RA 1R4MB 2H0VA 2JB4A 3KEOA 1ZRDA 2HWD3 3ABLH 4WV8A 3MKZA 4XFCA 5GLTA 2GNDA 2QM3A 2HWF3 3VD9A 5IYBJ 1AR81 1EV7A 4NPRA 2R16A 5ABJA 4CDXB 2YU3A 4LB6B 3JRAA 2A07F 1TWCJ 3DP7A 4IE5A 1NG7A 1VBA1 5C8WA 3MKYB 2QBYB 1CIYA 4ZU7A 1JUSA 4SLIA 5IVFA 1NQDA 2TEPA 4IDZA 3OYMA 3OEAA 3TP0A 2EZLA 5FO5A 3SFIA 5M0TA 4K1ZA 3BU7A 5ISLA 4EEFG 3K70C 2XSJC 3QPSA 4QDRA 3I2DA 3CTAA 4P96A 1WH5A 3VSLA 2X29A 3KQRA 4A3BJ 2JB8A 2D6MA 2VCMA 2UY8A 2GN7A 4F3JA 4FSJA 2IVJA 3HOTA 1R1TA 4BOWA 3PO3J 3GX4X 1WJEA 2Y0IA 4RGXA 3U0ZA 3CU7A 3O12A 3H1CA 4BEHA 4UUSA 3S3NA 3MZYA 3K3OA 4YW3A 3HG9A 2IS2A 4RS5A 2HWB1 3KP3A 4B8XA 3I5UA 3OYLA 1VQ4I 3WW4A 1K6YA 2LOOA 1BBT1 3ALQA 3ZIXA 5C6CA 3WY6A 4B4PA 2YMZA 5LA0A 2VONA 3PIOF 2IXHA 5LHGA 5EGOA 2WL1A 3NJVA 5IWFA 3VD4A 4BHPA 1IQDC 3JAMK 2OCEA 1MACA 4EWEA 3C1DA 1Z6TA 2ZXIA 2COBA 2LTPA 4QM8A 1NY71 3EBRA 2YC2A 5A3PA 3FISA 1LODA 3J7YJ 4UV8A 5A32B 4JTNA 1AYN1 2MSYA 1XTAA 3EUAA 4CZSA 3RJPA 3L2HA 3V0BB 5C4WC 4Z1VA 4NQWA 3K1NA 2VECA 4CDXA 2ORXA 1W3VA 1UG0A 5IYYA 3VHPA 3LEMA 5KHHA 2X6XA 1KYZA 4JOMA 2Y6HA 1AYN3 5FYHA 1Z67A 2LM3A 4LR4A 2P3KA 2TUNA 3WNOA 3IZOA 2PHWA 3R61A 4ON0A 2QEXI 3V0BA 1EJ9A 1XNBA 4BPZA 3TO6A 1ALYA 1KQ9A 3NV1A 5D1IA 3ZFGB 1QJY3 1ND2A 1IZ1A 2BVLA 3T09A 3JREA 2RDSA 5DN2A 2B9UA 5T50A 1RL3A 3A21A 1SLBA 2F4OB 1D0ZA 2ARAA 3MIGA 3RZGA 1H9TA 1TNTA 3TOBA 4MGZE 3CUQC 5IK8A 1DU6A 3ZN6B 1IGOA 1PGW2 4CXWA 1V5EA 2M4KA 4NPMA 2LD5A 1P8JA 1QZEA 4W6YA 5B1BH 1BBT3 1RUC3 1MSEC 3OEBA 4OQ8A 2FEZA 3BTCA 3ZOBA 3FBIB 4DW6A 2O8OA 1Z77A 4J19A 4O65A 3JD72 2ZS6B 2CGPA 5FR3A 1MS5A 4B3AA 1KD7A 3F0CA 3FHAA 4BM8A 1X1AA 1PO13 3NWKA 1LNSA 3C18A 4IX7A 1B72B 4PJ0C 3PTYA 5IT9Z 4ESFA 3DL3A 4EN0A 1CR7A 2G4IA 1RUI2 3NSTA 2F5FA 2MEV2 3O5SA 2ES3A 3S15J 3MLKA 1AR92 2Y6KA 3MF9A 1JZ7A 2ZGSA 3LNQA 3JRBA 2QQBA 3OGGA 3GTMJ 1A6QA 4C30A 4FQGA 1USTA 1X8EA 1OR7C 1G9AA 1E5RA 4CDQC 2ZZQA 5AIPA 3PUHA 1S0FA 2Y9ZA 2DCTA 1W2NA 1YFUA 3WF1A 4Q4W2 3LEIA 3WUDA 2CQKA 4BL0B 1F5FA 2QVOA 1O3RA 1BJAA 1IV6A 4OUMA 4FHTA 4K8RB 3LZZA 2NAZA 4I02A 5JUVA 3OUJA 1TG7A 2OW4A 5IPAA 2WY7Q 5GZEA 3TP3A 4G4FA 1X7NA 5FYIA 4LORA 1IC8A 4M6VA 2WAFA 2V26A 4PK4A 1UCXA 1UY3A 1W6OA 1DGRN 3P9IA 2DQLA 3CQOA 1S2BA 3QRFF 2WAQN 3MKWB 4YZ2A 2GC0A 3VBHC 1FLIA 4HX8A 4WM7A 1WBLA 2MLGA 3WDYA 3H92A 2QUOA 4Q1PA 5GLWA 3HQRA 4SBVA 1QQP1 4DQ2A 1NZCA 5CNAA 4PFPA 2ZJ2A 3WTZA 4XOTA 3SXWA 4RDUA 3D4KA 2UYBA 2EIDA 5DZEA 2JA5J 5BNNA 2UWBA 5E3NA 5ANNA 2GWRA 4KYWA 2IAIA 4IESA 2LP0A 2FBHA 3ECHA 1NE4A 4L99A 1W90A 3TGNA 2DVBA 3AM2A 2JIJA 3X2QH 2PAKA 3HL2A 1C28A 4FX0A 2W1QA 1QY4A 2ADDA 2JA8J 3SDGA 3JUUA 4OYUA 5M5YJ 3SEEA 4NIHA 3LQQA 3OMYA 4A3XA 2YROA 2XVKA 3MFCA 5FMCA 2M7BA 1RIOH 2HBTA 4ZC3A 1UX7A 1WJDA 1BJQA 1RKWA 4DYCA 4GO1A 2VQ0A 3KE2A 2XSDC 2WIIB 3LIGA 2WB1A 3WV6A 4TYSA 2PI0A 4N53C 4CA9A 3CCMI 1BI1A 2BERA 3M8EA 2A6HF 2DXIA 4NHMA 2CQ7A 4Q1RA 2Z2SB 3LCPA 3V42A 4LPLA 4DUXA 3Q9SA 1XX5A 4Q0UA 2XAHA 2DMPA 4JRLA 2F4LA 1FOYA 4E2GA 2OA4A 1MS9A 1Y7BA 4TWTA 4QKDA 3ELNA 4V2FA 3WVJA 2BFUS 2V4AA 2PBIA 4AWXB 2WFF2 3J7LA 4E6KG 2WNEA 1W8NA 2ZGPA 5CKTA 3R0AA 1W06A 3NWTA 1HOMA 3GTPJ 4CP9B 2R32A 1O7FA 1XYPA 4JDNA 3NNLA 1JUHA 2RMU3 1QJEA 2BVBA 2GC3A 4YW7A 1W36D 1D7PM 1PO11 4EM1A 1VBC3 3WINE 2RG4A 1AR91 1H9PA 1K78A 3FUOA 1OCPA 2Y34A 5C4WB 2VU9A 4IHTA 3S6PA 4ASMB 3KEYA 1W8OA 4MXWA 2E36A 1O3TA 3ZRGA 3A03A 2VOPA 5EZHA 5JI9A 4R4ZA 4ZHNA 2BZDA 1HC8A 3T5XA 1R4NB 4BBRJ 2X51A 4CP1A 2FJ1A 3OYEA 3PTRB 1MDMB 4XZPA 2CO5A 4DINB 3RZJA 2WC2A 4EE2A 1P9QC 2P3JA 1SFUA 1W6MA 3MDPA 3OBZA 5E20A 3JRGA 1NOVA 2SBAA 1C1LA 3NJYA 1WA4A 3OSDA 3ABUA 3LA2A 1ZREA 4I2OA 5FZ9A 1D2SA 3WDWA 2VKVA 4R9DA 1H9WA 2XJVA 2GOMA 1QXJA 1RYYA 1XG1A 2KRHA 2Y26A 4XLHA 5A1AA 5EIYB 5GM0A 1ZBE1 3DEWA 2GM4A 1UZYA 2N8GA 3WOGA 2VGDA 3TBIA 3NARA 4II3A 1XNDA 4CU7A 4MHUA 2FXAA 1AJOA 3MIBA 5D4SA 4G6TB 3BIWE 4LHSA 1FSEA 4UNOA 1SBEA 1DG6A 3KLOA 2M4GA 5FY4A 1G86A 2D1HA 1MBKA 3CDZB 3QYEA 2ZXQA 4NMIA 3AKZA 1RJ8A 4QX5A 5C5TA 5FYYA 4MEYF 1AWCA 2E71A 4PQQA 4NNJA 2FUG2 4Q4Y3 5C71A 4E7JA 1D8JA 1DP0A 4PT6A 1VQ7I 1GKBA 2KJCA 1HB2A 2M5WA 5CJ9A 1LGCA 1PUFB 3S1QJ 3PMSA 1COV3 1LHVA 4UW3A 2PJRB 3OIOA 5FZAA 4E70A 5EYYA 2OPKA 2DLLA 1EH7A 3AJZA 5KC5A 4MXWB 3ZXFA 3A0BC 5HDNA 1DYPA 1SDDB 1AL0G 1XSDA 3T2TA 3ROUA 4NVPA 1UKRA 2RR11 1ETQA 2ARXA 4QGLA 4YIFA 2ID3A 1QH7A 2PAMA 2FDFA 4D6SA 4FOYA 1LULA 1GV5A 1UO9A 2BU9A 4XDPA 1RB8G 2YR2A 2EFWA 4RHV2 2DMNA 1YIPA 2QZ8A 2D6OX 2JIGA 1B9MA 3KWVA 1IG3A 3C3WA 3P6BA 2XRNA 2KL4A 2YB7A 1E5IA 1W2OA 3OYWB 1Z0HA 4EJRA 3LSPA 4BZ4A 1IDYA 4WM8C 5F5QA 1SFOJ 3ZYHA 2XPUA 5DDJ1 2DJNA 1FOD2 3N9NA 3T30A 1VQMI 1WLCA 4JP0A 2O9LA 5AFEA 3LD8A 4P9LA 2QQNA 1JBCA 4HX7A 4B3NA 3RGBA 4IGPA 5F2SA 1WJFA 5FKLA 3WW2A 1ZG3A 1LU2A 3D82A 2LLKA 1NCQB 5CKMA 5ERIA 1QA6A 5IT9K 2LRDA 1RR8C 2R1BA 3LSJA 4KH9A 4CGZA 1LOAA 3CL1A 5DUXA 3RZLA 1E57A 1HW5A 1LKNA 4BKXA 1OKOA 1WSUA 4NRQA 1LOBA 1UYYA 3I55I 4NO4A 4M71A 4F8AA 5J36A 5LGTA 3SQOA 1B9NA 4KIGA 2JG9C 4XRSG 2E7WA 3GTKJ 5K1YA 3MBWA 2Y0SA 5L7OB 4EJTA 2AHQA 1ZZCA 3WG1A 3ACLA 2BNMA 4YVWB 2BGOA 1MQTB 3KB5A 4LTAA 1IHMA 5T5LA 1KXGA 2ZGQA 2WO1A 1XB4A 2BGCA 5J1RA 3G2BA 1MKMA 1OOPC 2J1AA 2DTYA 4TZDA 3LSDA 4ZDLA 1VBD3 1B72A 1AZDA 1JTYA 3ZMTA 3D1NI 4OWRB 1HDPA 1LOEA 2CH0A 3RQ0A 2PHTA 1UG2A 3K4CA 3LFKA 3NV4A 4F55A 3ZXEA 2JRTA 2VL8A 1WCUA 3WCSA 2HWF1 5FP9A 4LBQA 4RHV1 4JX4A 2ZOEB 1C0WA 3SISA 1RHI2 1H0MA 4R1HA 3ERED 4OMDA 4C9YA 4IEPA 3I3MA 3W20A 2GXGA 1XOYA 3B01A 5LGUA 2X1EA 1KZHA 1KGSA 3WZ1A 1K4TA 1VAVA 3L2RA 1YQ2A 3U14A 4Q4Y1 1Q8PA 4CCDA 1JZ6A 3BJAA 4UWDA 5CFDA 5E18F 2I45A 3W9AA 3W2AA 4XZUG 4XAEA 5LLQA 3UKTA 1GP6A 1OLQA 1UMIA 2JXAA 3HXLA 3TKYA 5FXXA 1Y3TA 1D5VA 1TT5B 2YFZA 4AL9A 2F4PA 5CFDB 1MH3A 2DCEA 5FXWA 3ZYIB 3E6MA 3LSHA 3IAS2 1WW7A 5FZOB 2EFQA 1LECA 4IV1B 1J09A 3UGFA 4XRMA 3G3ZA 3M1EA 2W91A 2CMPA 3CMAI 5SV5A 4MX3A 4EYUA 4QPIA 3H1MA 3H0OA 2RR13 3VB9A 2VBXA 1AR62 1RUF3 6PAXA 1D0GA 3UKNA 5HS9A 3PU3A 4IE4A 1OH4A 2VNRA 1V3FA 4I30A 4M74A 1UFMA 3OYIA 2QDRA 3JD71 2RDRA 4OINF 2WABA 4OLLA 2A6ZA 3OB8A 4BQ2A 4U7DA 5DYMA 2WJSA 5FZCA 4II2A 3DPRB 4L0YB 2KXLA 2C9KA 3G6JB 1ZG5A 2H94A 3OCPA 3NO8A 3HRMA 3BODA 2E32A 3RKWA 1C8M2 5FTTC 4BJ0A 4M4RA 2R7QA 3ABKH 2ZGTA 1W5TA 3VZOA 5BMZA 2R1DA 1JJ8C 1C3HA 4RGAA 3RYKA 3VHRA 3HYIA 1LJ9A 4D8MA 2AR6A 3POEA 4E8CA 3U1KA 3OGSA 3U1XA 1OCZH 1QGPA 2IC1A 4Y4RA 1MS0A 1J9IA 5EJCA 3LSKA 5DAXA 1Q56A 3E5UA 1DF0A 2TCTA 1ASJ1 2GNTA 1PVXA 1DQ0A 3ZQQA 2AZ5A 1XU2A 2FDHA 1GLHA 1FV3A 1GDTA 1Y1VJ 2BXYA 3HSFA 1BEV2 1IXCA 5FAXA 1ULCA 3PL8A 4CA0A 4ZYEA 2QQVA 3CKHA 2WKKA 4KGQA 4NJ4A 2BOLA 1H4HA 5D8AA 2A3YA 1LENA 4GKXA 2DBNA 1BC7C 4IHWA 3ZN0A 1UZZA 5A7PA 1P4AA 4XAAA 2M0CA 1S29A 4WM7B 5T5JA 1XGMA 2WQ4A 4FAHA 3GBGA 3A01B 1X3UA 3M9AA 2RDQA 4P9FA 1JUMA 4UV9A 3BCWA 3BR1A 4YM2A 4YZ5A 3MVPA 1TWGJ 4AC0A 1LEDA 1WBFA 1J75A 3ILFA 4AU7A 4MO3M 3ST7A 4BQQA 3U9GA 2L9SA 2FDIA 2ILMA 3BLYA 2ZMKA 2XAFA 1JI6A 4P00B 1DBNA 4JGZA 2OCCH 1FX7A 2LY1A 3VBOA 1MVQA 4BHBA 1LEAA 4QX8A 1LHOA 2ZNYA 3ZR8X 2GH2A 4XFFA 3FDYA 5J8CA 3ZMVA 4J25A 1LNWA 1OCOH 2HR3A 3OV8A 2VL4A 5J7MA 3HHHA 3QODA 2DMTA 3KP5A 3V65A 3J80K 3Q8AA 4ZTJA 3WG7H 1X9PA 5GLZA 3N3HA 3O14A 4A3JJ 3FMGA 3H5NA 5KAFC 4M73A 1HBXG 2OVUA 3ZM8A 3DU5A 2O0YA 5F27A 5LBQA 3KCYA 4GWMA 3UGHA 5C9AA 2YV8A 1A35A 5ACA1 5JR3A 4PGHA 3A4CA 1RITA 2B4KA 1YRNA 2OS2A 5J40A 1UPIA 5BNPA 5A70A 1BR1A 5E1ZB 4MOAA 1OA2A 2LY2A 2MC3A 4GMP0 2YDEA 2R7UA 4QX2A 3S17J 3K4MA 2V9KA 1IXSB 2DPUA 5KXCA 3VODA 2RM23 3J7AY 3AK0A 1OQYA 5A6XA 2PMZN 3ZX7A 1ZBA2 2E7AA 5AC91 3K69A 5KCMA 2VZ1A 4AFAA 1GNHA 3I7DA 3I4PA 1ON2A 2FOWA 1G59A 1MMSA 1DZTA 4EN6B 3P3NA 2RM21 2MH2A 2CU5A 2QCSB 2DBBA 3NJZA 2BBYA 1MH4A 3K9TA 4UFLA 2AENA 5HCAA 1YO5C 3TEWA 4XUNA 2VC0A 1R00A 3ZYRA 2I10A 1G4DA 1SD4A 4CYCA 3MW4A 2DFHA 1VBE1 1N25A 1EV13 1ULYA 5BNNC 4AHYA 5BNOA 2XF7A 2JKBA 1OLTA 3AP4A 5DG1A 4M01A 1Y9QA 4DYRA 4IRGA 1KS5A 3JQXA 4NAOA 4Y1XA 1LR5A 3WG3A 1EV11 4CXXA 3IUOA 4IV3C 1EF4A 2A6WA 3BDDA 4LOCA 2A5ZA 3WNMA 2WNVA 1Y39A 2HWE2 4YM1A 1GWLA 3AKTA 3SZGA 4XOGA 1ZH5A 3C2BA 3WE2A 2VOKA 2FZ1A 4AEJA 3CCUI 1OOPA 2YC4A 2WA0A 2VMFA 1R1A1 4B7EA 3M8LA 1JOJA 1J3RA 3TDZC 2VQHA 2XR4A 3CO6C 4WWCA 5GKAC 4Q5SF 1BZWA 2KZVA 4YGCA 1BW5A 4CH7A 2WFF3 4XKCA 3AKPA 1WCQA 1H0BA 4C3JJ 1F43A 2LKXA 1ZAOA 4HF0A 4JYKA 5J98B 4RM2A 2DA5A 5FZIA 2VNOA 5H9SA 3ZYGA 4Q0PA 1JN2P 1F1ZA 4XFGA 2J1UA 2XBO3 3G73A 1CJPA 4YARA 1WWYA 1MJBA 2JDAA 3HJRA 5DABA 3QD6A 3A1YA 4ZH4F 4MO7A 5T3NA 2G9GA 3VSKA 1Y1WJ 4NR1A 4V2WA 2VQCA 2H27A 5CB7A 1CZTA 3OYKA 2E63A 2F5DA 4PGGA 4DFSA 2WNVB 5HDKA 1A78A 3MYXA 5EV7A 2IGOA 3A7QA 4AK3A 4F3QA 4D7YA 1OLRA 4H7LA 2Z5UA 1SG3A 1DFQA 5FGMA 3O1VA 5FZ6A 1YITI 1R092 1VALA 2D40A 4HF2A 4PSXA 3Q0UA 2XWJB 3C7OA 4DUVA 4U2AA 1TW2A 3FMSA 1P4XA 1D3YA 4Z8BA 1JHNA 1I9RA 2EILH 4KICA 4KA4A 1FNNA 2K9SA 2X5IC 3VZLA 2D6NA 4Y22A 2RS31 3HPNA 1ZX5A 2ICWG 2X85A 2NVTJ 2HDWA 2W2IA 1G3TA 1YYVA 4ZYAA 2VBBA 3G6EI 1W7PA 1XSQA 4AXOA 4M0NA 4BQWA 1I6HJ 2E5NA 2VJ5A 4PI0A 1XGNA 3ME2A 3HKZA 1U0AA 2FQ4A 4LIUA 3ETQA 2PHUA 2WT2A 4HNUA 5CG9A 4RD7A 5IVJA 4DEVA 5HLGA 3GFJA 3O1SA 4B7KA 1PIV1 1LOGA 2WUHA 1LGNA 1VBA2 3EETA 1FNZA 2Q1MA 1YOVB 4DIQA 2ET7A 1PX3A 1OA3A 2VBZA 3B00A 3WSOA 1YLLA 2JG8C 4LKFA 1X1CA 2QKLB 1WJ5A 4LLGF 2LC2A 2QBYA 2DW4A 1T0FA 4CVUA 3H9GA 3K46A 2HZDA 2OKXA 4AQ6A 5DM6F 1EAH1 3AFGA 4M3GA 3KP6A 3I2FA 3BROA 1SLCA 1I1SA 4WZCA 1APNA 1K5JA 5JMCA 1QGLA 1IN5A 3GLXA 4DEQA 3KMHA 2X9DA 3MIHA 3CUQB 1XB9A 1SFYA 3O1MA 3HRUA 5E1XA 3PO2J 4J1XA 1YX5A 2XGDA 4YVSA 2ZB9A 2DMQA 3PNAA 2DCYA 2NXNB 1UF2C 2HKXA 3CJNA 5A7WB 1HJGA 2GXBA 2WZ8A 1A31A 2D5FA 2QA4I 4E9KA 4CZZA 1N77A 1US2A 2CDOA 4Y3OA 1PP8F 4J1WA 1LOCA 2DDBA 4AW7A 2RR12 4GZ9A 3CLOA 5F6FA 3LDRA 1Z78A 4E7KA 1U9OA 3T0DA 4XSXF 1JYCA 1K5MC 5L19A 1XYOA 2JZYA 1GMMA 1UL9A 4XACA 3PSIA 2JDUA 1APLC 4NPLA 1V9U1 5E89A 1JZ5A 2DT6A 4FCAA 1KS4A 4ZKTB 1XNKA 3WU1B 4QT6A 3WF0A 4A41A 2JSPA 2QJVA 2BY2A 3H3LA 2Q4SA 1PM7A 4BDZA 2VPLA 3PMEA 1I39A 5GADJ 4UW6A 4AQSA 1B59A 2VKHA 2XAJA 2DAOA 1WQ2A 4L2NA 1HB3A 5AIQA 1W8HA 3GNEA 4CYDA 1R58A 3GALA 3V7CA 3RSJA 4RS5C 2ZGRA 5IYDJ 4OHZA 3BTLA 4LG0B 2QQUA 4HL0A 1BR2A 2MYSA 2WO7A 3C7EA 1TQMA 5FY5A 3DKWA 5HS8A 2DCKA 4BY1J 3MGUA 2XRLA 1GXQA 4BACA 1XC5A 2LREA 2WSVA 1KU3A 4UBGA 4Z92B 3KLNA 4QXCA 3AMHA 1AR83 4RYDA 2XDVA 3CJIA 1MBGA 4ZYGA 4BDYA 4XMAA 2CW0F 4ASLA 3E97A 1SLIA 2UV1A 3WT3A 2VUAA 3N9QA 4BB3A 4FFGA 1OYIA 1NH3A 2JG8A 1JH5A 5IAVA 5LBFA 2PMZA 1U5YA 1T08B 3ZDSA 3QH7A 2V9VA 1SLLA 4I0AA 3I9V2 1W39A 4N43A 3RDIA 3S1MJ 4D0QA 5LD2C 1XDUA 2O5RA 2LMDA 3N7MA 5EJZB 4MTDA 4CICA 1R1ZA 5GPAA 2D3RA 4HT1T 4L8QA 5JIUA 1GZWB 3CJQB 1C4RA 3H1WA 1BC8C 2VUMJ 1JYXA 5FDBA 1F2NA 3I71A 2R0HA 3JB4C 4XQ4A 2EBIA 4HPQA 3S7EA 5FP8A 2M0MA 3F8NA 1OPMA 2WZR3 4AAXA 2XL9A 3AYDA 3WXPA 1WGPA 3KEQA 1OD3A 2I74A 1LESA 1Y43B 3GZ6A 1LB2A 2QE3A 4A3ZA 4IW3A 1RHI1 3BG9A 2L9NA 2R7FA 2ME0A 4QQLA 1U9NA 3UJOA 3PU8A 2FCTA 1JUPA 3A23A 5DUIA 4G94A 1PMHX 3T0BA 4COWA 1CPMA 1TW3A 5BNPB 4PBPA 5GZGA 2F6CA 3CO2A 1AR72 2Z3YA 4LULA 3IM0A 1LFBA 1V6IA 5B5EC 3ZN5A 3LSTA 4CDUC 3H3ZA 3ZSEA 1CVNA 4CRQA 2RV9A 5EF6A 3PURA 3RPUD 3B73A 3ZQ7A 4DJAA 4ANJA 4DZJA 5D8AB 2OZJA 2XPVA 3WTUC 4CEYC 2R043 5FZBA 3HPGA 4TV7A 3I2HA 1QVUA 3HEFA 4IRHA 4MNUA 4JAAA 3CMEI 3OTFA 1CAUB 4Y13A 1HXS1 1O4ZA 3ZP5A 5I0DA 3I2IA 2JDYA 3OD0A 5FPLA 1MEC2 2E9QA 3POYA 1HF0A 3CP8A 2W7NA 3L7WA 5FZLA 3TEXA 2FRHA 3OYJA 3FKJA 3KGLA 2GC1A 2ET1A 2X5IB 2QQ9A 2OC6A 4H0EA 3JQWA 2DYRH 2W82A 1E2XA 3KV4A 5J09A 2NZ9A 3TEDA 2RVCA 4QDQA 3L9FA 1NKGA 1ITYA 3NNJA 2DK8A 1BW6A 4QU1A 1VLNA 5JFRA 3ZVXA 2X0LA 3S2HJ 5F6LB 3MUY1 2DFFA 2AEZA 3ZKYA 4FQ4A 4B1RA 4QXKA 1DQ5A 1RJ7A 4RAZA 3HBLA 4XLFA 5KK1A 3OYNA 1RUE2 4LUKA 3H35A 4LK6A 2K9MA 3ORJA 3WDVA 1ENHA 1UMHA 2WR9A 2IA0A 2PX9A 4LITA 4BLIA 3T2OA 3T1LA 4JX0A 2HGCA 3VBUA 2P4EA 5HV4A 3VB2A 4JTOA 3OJBA 4JGZB 5JXGA 1MS3A 4XOPA 3JR9A 2J1EA 2OPWA 4C2MJ 4AQTA 4BXXJ 1CAWB 4YSFA 3DTKA 3TDUC 5BNGA 5LK5A 5K0UB 1JE8A 2LALA 2JDNA 3S8PA 5C4XJ 3N4MA 4QPGA 4XQDA 3GMEA 3K6GA 3J7HA 5FY0A 2WRAA 2E33A 4F91B 3N7LA 4U87A 5E17F 3WR0A 5C3RA 2RQPA 1FOXA 2W24A 1X4PA 2ZGMA 2CRGA 3VZKA 4MVTA 2WNUB 3I54A 2G9FA 1HXS2 5CVRA 4XN3A 2W95A 4AYUA 4BDVB 2FA5A 1B1BA 3ON7A 4A6EA 1UYZA 2QQMA 4QGNA 3H36A 3L2CA 1D0YA 4K20A 4MZUA 2WS92 1ZR2A 3GTQJ 1WI9A 2CUFA 1WFXA 2RS51 5JXIA 4XJAA 4CDWA 2TNFA 4EGYA 1RVF3 1A8DA 4GKYA 1IF1A 4UUTA 4XURA 1BI0A 3FL7A 4TXWA 1SPPB 4M4PA 1XSRA 4HX4A 4AWDA 1CQTA 2W1SA 2XF5A 3OYDA 4YW5A 3SHFA 4IEVA 2I07B 3J8F3 2ZGNA 2VQTA 4GAZA 1IPSA 3KYDB 2HEVF 2VC1A 2ZJQF 1QF3A 2HVSA 1LDJA 3ZXSA 4GALA 1UMQA 3FK7A 4FPGA 5IJRA 2ZHMA 2VBPA 3CCLI 2JJ7A 1RUE1 2YX4A 1F4HA 2PAEA 3UJQA 2PHDA 3Q0VA 4MXVA 1JMUB 3P7NA 5JOWA 3T8RA 1K45A 5FD6A 3ZQLA 1HRI1 3B9CA 3WF2A 5IT6A 3NAPC 5FRAA 3HUGB 1REPC 4CEWC 3CP2A 4LK0F 4WVMB 3K4LA 3WP4A 2LK2A 1BCXA 3KPHA 2R93J 5FLVA 1H8TB 2VUDA 1IG7A 1YLFA 3IH4A 4AGRA 4A0YA 5A33B 1QHDA 1NAEA 4PSWA 3TNQA 2FDJA 3ECQA 4ARXA 3O0VA 2FQ3A 1O8SA 5F64A 3IIIA 5IFTA 4L9BA 3M4FA 2COMA 2L7MP 2FSWA 1W5CC 1WKYA 3I2OA 3DKYA 3KYCB 1OBNA 1LE8A 2C6SA 4HSRA 1IKQA 3K10A 3VYUB 4DRVA 2ZO4A 2W48A 3PDQA 1PMJX 3VBRC 4M9XA 1RZ4A 1QQIA 3WW3A 4BIFA 1N75A 3OD4A 4FXGB 1ULDA 4OULA 4YPJA 1W0PA 1XPXA 2DTWA 5JSRA 1JGSA 5CKQA 5LRRA 3I97A 3E1SA 5T54A 5F6KA 5TRDA 1ONAA 2GMEA 4RQPC 3IMNA 4Y5SA 3Q8EA 1PP7U 3FXMA 2X8KA 1ND3A 3DXTA 3KT7A 2E35A 4EVIA 5HNHA 4B43A 3GZTB 1M1EB 4W50A 3WNKA 1AVBA 2WLQA 4IV1C 2IXCA 2IJLA 1D1CA 2P0WA 1A6CA 4QPYA 1VQ5I 1H8AC 3Q0WA 4CU9A 1FSHA 1OCCH 4GMP3 3BG3A 5FZDA 1X50A 4RAGA 2OYZA 3LDKA 1CX4A 4UFIA 1YQCA 1DP3A 1NXMA 3ZQHA 1ZVFA 4RB3C 3FC0A 4HG2A 1QJX3 4QAWA 2YUEA 5LBCA 3AX4A 4A6SA 3KF5A 1EA3A 4I98B 2DVFA 4IETA 1QZYA 1LVAA 2DVGA 3S57A 1CAUA 5FPBA 4JBAA 4EJOA 3R4SA 4QWQA 4BBSJ 5FZMA 2BWCA 2XAGA 1J84A 3DCFA 1QOOA 4ARYA 4PCRA 4A7ZA 3BG7A 2IEKA 2BW8A 1KU7A 1IV8A 3HJEA 3GVAA 2WLPA 4P02B 4AEMA 3V8LA 5K0UC 1Y9GA 1Z7S3 4H7MA 3MCZA 1MDMA 3GZNB 2WAEA 2A6YA 1F5JA 1VB4A 4CDUB 5BY5A 4UXAA 2A68F 4RN5A 2ZMLA 2HZTA 3AZVA 2Y6LA 5J47A 1XC6A 2DU9A 3D3AA 1YE9A 4E7HA 2Y6FA 4Y20B 2XB0X 5FY9A 1SANA 3BP8A 2DODA 3HVDA 3RQIA 4AFMA 2HI3A 4YG6A 1O4YA 5LHIA 1YTYA 1MNDA 5AVPA 5LY1A 1UXZA 1PO22 3DLAA 4L9TA 1Y8RB 1S6LA 3F6VA 2HFHA 1SDWA 2AQFA 1AOYA 2EZKA 4YRVA 4P14A 5TISC 4MEXF 5IVVA 2VZVA 5LEKA 4XRFA 1OMIA 2CL2A 2STWA 2WA3A 5FYBA 3SITA 3CDHA 3S0MA 3OPTA 4IV3B 3RJRA 2VIXA 1BMV1 3ZPOA 4IF4A 4HQMA 3IH2A 2NS7A 4WK8F 5FLHA 1SQ4A 3DPRC 4H4KC 1DU0A 5CFCC 3APBA 3KHBA 2RV8A 2A6TA 4HAMA 3E7LA 2IVIB 4FPFA 1JZ8A 5F1JA 1VQKI 1GSLA 5LBEA 1O8PA 2JA2A 1W6QA 4CCJA 4P55A 2KQRA 1ZBE2 4CUGA 3KVAA 3VYRB 3I49A 1C5HA 2VNVA 5JSPA 4BS9A 2Y69H 1J59A 3KP7A 1N3PA 2ZSHB 2BY1A 2FDKA 3CUOA 2KLOA