4A2UA

Crp(cap) from myco. tuberculosis, with camp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
224
structure length
224
Chain Sequence
MDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A New Crystal Form of Crp from M. Tuberculosis and Conformational Effects of Crystal Packing
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords PROBABLE TRANSCRIPTIONAL REGULATORY PROTEIN (PROBABLY CRP/ F
total genus 58
structure length 224
sequence length 224
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4a2uA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4a2uA01
2JPBA 2Q4SA 2QQ9A 4TV7A 3KMHA 4ZU5A 2PA7A 2FBIA 1B6AA 4U7DA 2FMLA 3DQVC 4CGZA 3ZMZA 2FQPA 3E97A 1ZRDA 2BV6A 2ET1A 2D93A 2MH9A 4UV8A 3CLOA 2JTVA 1OYYA 2D5FA 2XKOA 1Y0UA 1R5GA 3V8LA 1SFUA 3LZZA 4UHTA 2CO5A 3E5UA 5CVUA 3GLXA 1KQ8A 3IDBB 1CF7B 1ZRFA 2V1XA 2XL9A 5I93A 2X0LA 1WSUA 1O3RA 2Q1ZB 4KWKA 1H9GA 4ORFA 5AVPA 1ON1A 5KHHA 3WU0A 2CG4A 1NZCA 3KP3A 3WGIA 1XE8A 2ZCWA 3BROA 1H0MA 4YSFA 3RKWA 3H1WA 3LWFA 1K7AA 5KK1A 1FYKA 1P4XA 3TOAA 4HZFA 3LOIA 2VECA 1FYLA 1IN8A 3ML6A 2EFQA 3LA7A 4KL1A 1RIOH 4XF3A 1EH8A 2EFNA 3VODA 1EPZA 4JTOA 1RI7A 2XROA 2YPRA 3TO7A 4WX9A 2E1CA 1DGRA 5DCMB 2E9QA 1VP6A 3WTVC 1MD0A 1LKNA 2E7WA 4HLTA 4PZJA 2PEXA 3ZMDA 1CAVA 5KHJA 4ZZLA 1HW1A 1IF1A 2CAUA 4MQVA 2XLFA 2PFBA 1ON2A 4OMZA 1YWKA 3L00A 4UVBA 4U0VA 2GIVA 3IKVA 3H1MA 1MZBA 2NAZA 4BXUA 1WWXA 2EA7A 1CAUA 4HX7A 4NB5A 2QBYB 4Q5SF 4KWLA 3L2CA 4GYGA 2GC2A 4RAYA 2UZKA 4UUVA 5HDGA 3GZ5A 2P6SA 5D8KB 2FA5A 4ESBA 3Q9SA 1Z9CA 4EM0B 4E2QA 3HIFA 2DQLA 1V70A 4QXKA 4EWEA 1UB9A 5EEHA 3JSPA 4DNCA 2RKHA 4MTDA 4PJYA 1YW7A 1ZHFA 2RN7A 3QRFF 1UHWA 5CLSA 4Q0VA 3FE5A 2HKXA 1I5ZA 2PI0A 1XD7A 3LA3A 1XMKA 5H6QA 4EV0A 4WK8F 3BJ6A 4MUVA 2K4JA 1YTYA 2XAGA 3CUOA 3NL1A 1HSTA 3I58A 1U8RA 5HDNA 1USTA 2XUBA 1QO0D 4KU8A 4HBNA 4L18B 3CL1A 1YFHA 4IEWA 2OPKA 2IA1A 3K0LA 4PIXA 2RDPA 1E17A 5FPZA 2EVXA 4HLXA 2N7GA 1OD5A 2LF7A 3HRMA 1ZN2A 3MAJA 3IRRA 5DD8A 1GXQA 1NE4A 2PFWA 5FFXA 3BU7A 2P6TA 1XGSA 2IRFG 2ESHA 1OFNA 3IIAA 1O5LA 5JAXA 4EQQA 1SD5A 2H94A 2PMUA 5I0SA 3G73A 1TW3A 2A69F 3CTAA 2O0YA 1XCVA 1PP8F 4RGRA 4M9XA 2KRFA 1L3LA 1KU7A 4LA3A 1FI2A 5E8GA 2BYVE 3BY6A 4WXDA 1NE6A 2HOEA 5C6CA 4FAGA 4RGXA 2JRTA 2MBFA 1JHFA 2G7UA 5L3FA 4PIYA 3JAMK 3HSFA 2K0GA 1KYWA 3TNQA 4ZYGA 2VBZA 5K5OA 3K1MA 2QYOA 4UXAA 1RNLA 4D0PA 1ZGJA 2MC3A 4HDVA 4B09A 1R22A 5DDGA 2FNAA 5L3BA 2B0LA 3J81Z 1MKMA 1R1TA 2XAFA 3BPZA 3QPTA 1UIJA 1XGNA 1FLIA 2FXAA 4RD7A 1EY2A 3IWFA 2MH2A 2X4HA 3WODF 5J7MA 2EJRA 2EB7A 1IW7F 2PQQA 3WW4A 1QQIA 1FP2A 2XVCA 4HN0A 4I2OA 3TO9A 5L3CA 1ZNPA 2IT0A 4BIFA 4R8HA 1IN4A 3I4PA 4IRHA 3V7CA 4IERA 2P17A 4G6QA 5D5WB 2F5DA 4FX0A 3HOTA 3HHHA 1ZYRF 1TQPA 1G4DA 5CYVA 4KYWA 4YIIA 4XFGA 1ZVFA 3S7EA 4XFBA 2B5HA 1MJBA 4L0YB 3D5LA 5ICEA 2OQRA 3JW4A 5A2QK 2D1VA 4I3PA 3KSCA 2HDCA 2ETHA 4L9TA 3KLNA 3ETQA 2DO7A 1H1IA 2HYFA 4HLYA 4F7ZA 3U9GA 4IXAA 1XCBA 3BJOA 2OA4A 3R6SA 2L4MA 1HBXG 5HS7A 4OIPF 3I59B 4IETA 4OU0A 1G3YA 2O61A 4MZUA 1YQAA 2Z69A 4LLNA 3WW1A 4UBHA 4RB0A 1BIBA 2RQPA 3NQOA 1YO5C 4BHBA 2DQRA 3FZ3A 1NXMA 1S6LA 1RC6A 4LD5A 1ZLKA 3KZZA 1HKTA 2H6CA 3GFMA 5LHIA 1Y9QA 3KGLA 2XLGA 2OQGA 1VR3A 1FPQA 5BV6A 4QGNA 1ZG5A 2J5OA 4Y13A 2PTMA 4N9IA 1G3SA 2W85A 4AXOA 4H0EA 4MHGA 1CAXA 3I54A 3UKVA 1JHHA 1Z6TA 4WXHA 1WKMA 4A5NA 1J0RA 3ES4A 1SMYF 2A6HF 2M30A 2MNGA 2VBXA 3GYHX 5AONA 2XAJA 5D5XB 2D40A 3N4MA 5LHGA 4KDPA 1J58A 3KP2A 3QU3A 3LWCA 2WC2A 1EV7A 2NNNA 4HV5A 3O3KA 1AOYA 1FWZA 1QPMA 3ELKA 3LAPA 1J3PA 5CVJA 4HW0A 2P5LC 3VEPA 3BCWA 3E6CC 1SD4A 1MDMB 4UXNA 1WA4A 2PBIA 2ZMEB 3EQLF 1J3QA 4NQWA 4XF0A 2UYAA 2PHLA 3V4GA 1QNTA 1ZG3A 2UWMA 3R0JA 2K02A 2JZYA 5DYMA 1WQ2A 3ELNA 3WG9A 2GH2A 2ZO4A 2PG4A 2DK8A 5JVTA 3D82A 3CLPA 2HTJA 1CX4A 1LR5A 1D5VA 5F64A 4AWXB 2OAZA 1O3TA 1CAVB 5I8YA 1FSHA 5E1XA 1F5TA 3HTUA 1Q5OA 4M71A 4Q0PA 4BAYA 3EBRA 1ZGAA 3ULQB 4M73A 3RYRA 3TDUC 3PVBB 1Z1DA 2R7DA 3GZ6A 3EUHA 2NNYA 4YFNF 4K2EA 5I91A 2OD5A 4NHJA 2Z99A 1ZZCA 5HVQC 2GXBA 2ACJA 3RKYA 3FXRA 5FFZA 4G7HF 1LNWA 3RYPA 2A61A 5L3DA 5HLGA 3H3ZA 5LEJA 1BM9A 3E6BA 1IN7A 3RJPA 1STZA 2FE3A 5LLQA 1FXZA 5JSPA 3DF8A 4WWCA 2NYXA 3ECOA 2DAOA 5ED4A 2PN6A 3FZVA 2BNOA 1IRFA 1K78A 2VOOA 3KP4A 1X7NA 2VBWA 1QZYA 5LRRA 1LEAA 3KP7A 4M9ZA 1ULYA 5CVVA 4I02A 2Q8KA 4XSZF 1TQMA 2RGVA 1Q1HA 1UCXA 4IJAA 3WE2A 4ONUA 3MQ0A 3R0AA 4L5JA 4LJZF 2Z3YA 4QWQA 2ZKLA 4S04A 4Q0UA 3F8CA 3I71A 1OYIA 3U10A 4XSXF 2XGXA 4ENNA 1HSJA 2HFHA 4AIHA 3ECHA 4PDKA 5FLXK 1CF7A 3IBMA 3WTSC 1IN6A 1I27A 2ETEA 1XRUA 4X6RB 5E16A 3CO7C 1JGSA 4MQ9F 4OIRF 4RGUA 2A68F 1FYMA 2QCSB 3TO6A 4A0YA 1FC3A 2XKPA 2KJBA 4PCQA 3ZMUA 3ES1A 4RB3C 3HT1A 4LFUA 4JVAA 3GXOA 1TQ5A 2Y0OA 3BJAA 1FBSA 1O3QA 4AIKA 3RPUA 5I0UA 4IESA 3V8KA 4YIFA 3M1EA 4ZU4A 2ZBKA 4HSLA 4IEPA 2V09A 4HF0A 5FDBA 1SAXA 4KNYA 3WU1B 4X6QB 2O8XA 4P9FA 1BN5A 4IPAA 2VPVA 3SCGA 3BPXA 2GAUA 4RS8A 5HLIA 2VONA 3WGGA 1YW9A 2FBHA 3GW2A 4Z07A 1HKSA 3LSTA 3FJSA 2COMA 3OV8A 3MPBA 1ZZ9A 3FXUA 3R60A 1NHAA 4HN1A 1JUHA 3SMHA 4FT8A 3I0TA 4R52A 4TLFA 3NVCA 3VB2A 3FM3A 4META 2PAKA 4KN4X 3K9TA 4ZU7A 2L01A 1ZARA 2GC3A 5E1RA 3S0MA 5J8FA 4MX3A 3E3VA 5F1RA 2IXHA 1FBUA 1HW2A 4XF9A 1QZZA 5CVIA 5E8IA 2GWRA 3M8EA 4JK1X 2FRHA 2OBPA 1T38A 2QZ8A 3OD0A 2TDXA 4ESFA 4XFFA 2KIFA 1U3EM 2W57A 4P5OA 4MEXF 3CEWA 4OLLA 3FMQA 5FQ0A 4L5IA 3K69A 3SZTA 5FGMA 3CUQA 4CO8A 1Z7UA 3T8TA 2VODA 1HKQA 5K1YA 1O7FA 3FHZA 4IVNA 1XGMA 3MZHA 4LB6B 3HUGA 2IXLA 2GQQA 4G7OF 3F8FA 4M9SA 5TRDA 2M5WA 4KT5C 3P9IA 3F8BA 2E1NA 4P96A 2IA2A 1W4MA 2D2WA 1K78B 4GXOA 5JHUA 2JSCA 3DP7A 2FEZA 2FQ3A 4U88A 4E2GA 1KYZA 5T3NA 2DPUA 3ERED 4IEUA 4IEVA 4Q0QA 4CDGA 3I64A 2W84A 5D6FA 2P7CB 1VJ2A 2K9ZA 5BQTA 4IEXA 2CFXA 4YNIA 5FPXA 2G7HA 1DGWA 4IEYA 1P4AA 5KBFA 1UHMA 4O5VA 4ENKA 3ZPLA 2VE9A 4ZYEA 1BC7C 3IDCB 3K2ZA 1B4AA 1EH6A 4MGRA 1ZRRA 4IRGA 4FAHA 3KEOA 5ICCA 5LBQA 4OMYA 4L2NA 1PP7U 1B59A 2ZXJA 5DV5A 3N97A 3RTRA 2A5YB 3F3XA 3EHKA 3H8UA 1XGOA 3NW4A 4XFIA 2RNJA 1KQ9A 2YX4A 2NS0A 3CJXA 5DD4A 1FT9A 2VC0A 4OFGA 3PLQA 1EYBA 5AIPA 1ZH5A 5ILSA 4LTAA 3IHUA 3D0SA 2M8EA 4JQFA 2OU2A 1T98A 3NEUA 3ST7A 1J75A 2H0VA 3ZMSA 2ZMEA 4WZCA 1U5TB 4M6XA 5ICFA 1EP0A 3GVAA 3P9CA 1DZRA 1KU2A 5FD5A 3BPVA 1B1BA 3TKYA 2PAMA 2QQBA 5E1ZB 4GULA 3QOPA 2J5PA 2HTSA 2UXXA 2G9WA 1XE7A 1CGPA 3H50A 3U11A 3TOBA 3HOSA 4QLCU 2AXLA 5CVRA 1LRHA 3B02A 2GZWA 1OYWA 5BPDA 3RZZA 2K4BA 1GVJA 2MPFA 2V79A 4LG0A 3T5XA 1I6XA 2CGPA 4WCGA 2IVMA 3GX4X 4QM8A 2H6BA 4I98B 2MLKA 2Q30A 1PMIA 1PM7A 2YX7A 1X8MA 2EA4A 2O8QA 1XDSA 2Y75A 3GFJA 3CDHA 5JSOA 2IP2A 2M87A 1SD7A 2LSOA 4GYIA 1W7PD 5J8CA 2GC0A 2GU9A 5D6EA 4BHCA 3F6VA 1Q3EA 3COAC 2IXKA 2XLAA 2JPCA 5HLHA 3KEQA 5BPXA 5LGTA 3GFLA 2ESNA 2HR3A 1OMIA 2IXJA 2L02A 1GQHA 3KETA 3WTXC 3ZQ7A 1X3UA 3ZP5A 1HQCA 3M3IA 2VC1A 3MDPA 5E20A 4MGYE 5FLXZ 3LQRA 3ABTA 3P7NA 3J80Z 2WV0A 5FLIA 1R23A 2A6EF 3HRUA 4QX5A 2KIUA 1KGSA 2QENA 4GCVA 3MEXA 1Z91A 1IXCA 1J59A 1ZZ6A 1IZ1A 2MA3A 4QMAA 2XHKA 4YFXF 1ZZ7A 4R1HA 3I7DA 3ISPA 4HAMA 2DFIA 4IF4A 4BHPA 5D8LB 3OF1A 1BBYA 3QU6A 1YFXA 1S8NA 5JCTA 2CYYA 3BWGA 3ACLA 4E70A 4EJWA 2ET7A 3UKTA 1FNNA 2QVSB 2RVCA 1JXSA 5K5QA 3F72A 2BE5F 3V7RA 3DFGA 4A6EA 4G94A 4Q48A 4IHSA 2HJIA 2VE8A 2Q0OA 4LK0F 4K8FA 2QVOA 5HOOA 1GQGA 3BALA 2F5CA 2STWA 5I8TA 5J48A 3C3WA 6PAXA 3FX3A 2IXCA 3BP8A 1FP1D 1U6GA 4MTEA 1BI1A 3USSA 2OA2A 1VTNC 1YS7A 4KIGA 3GF2A 1G6NA 4WVZA 1BIAA 3QACA 2GA2A 1XN7A 2CQKA 1YUDA 1MJAA 3KP5A 1KQ0A 2WTEA 1FX7A 1XSXA 5TJJA 1CAWB 1W5SA 2P5KA 3NSTA 3LQQA 4ETSA 2L54A 2C6YA 1RUOA 3EETA 5IT9Z 1ZRCA 3SFZA 4RB1A 3SHFA 3M8FA 2F2EA 4Q47A 1XDUA 1TTYA 4D7TA 3HQXA 3EDPA 4KN7X 3RDIA 2HYGD 4A12A 2IXIA 4OOIA 2DK5A 2PYTA 3EO6A 3MFKA 4KMUX 1SQ4A 4E2SA 1UIKA 1SMTA 5ERIA 1BI3A 1DZTA 1QWRA 1QGPA 4HOBA 5H20A 2WWYA 2EFPA 2IW5A 2V1DA 1G3WA 2ISYA 1XSVA 2PLYA 3CUQB 4ZH4F 1W7PA 4FX4A 3I59A 1S29A 4U0YA 3PQKA 2O03A 3JZVA 4XBFA 1YFUA 4IEQA 2RV8A 4AIJA 1KU3A 1SEFA 5E1WA 1P92A 2MLGA 4B29A 1IAWA 1YIOA 4XF4A 3WE3A 1WI9A 4KICA 2HS5A 2CW0F 4L0ZB 1R5HA 3IC7A 1XMAA 2DTRA 2OZJA 2V1UA 1R36A 2ATFA 1F4KA 4I0AA 3T0YA 5JR3A 1I1SA 2DU9A 3BZ6A 4AVPA 2ZFWA 1YLLA 3M7GA 2Z33A 3FMRA 2W25A 4GO1A 2VT2A 3U1DA 2D5HA 3OCPA 2EV0A 4HQMA 3DL3A 1Y3TA 4G8XA 1LVAA 4XFCA 4IHTA 5D5VB 4KIFA 5D5UB 4NVPA 1E2XA 2P8TA 5H6RA 1J9IA 5FO5A 3K1PA 1SFEA 1QXJA 2NRAC 1OKRA 1R58A 5JFRA 2QDRA 2EAAA 1UW8A 1UFMA 4MGIE 1SFNA 2IA0A 1MDMA 3MCZA 3OTFA 3RNSA 3GWZA 1H1MA 4P55A 4J1WA 4XLNF 3WTWC 1DPUA 1F9NA 1RUNA 1G3TA 2LDUA 3IL2A 4DINB 3F6OA 2FU4A 5E17F 4ENJA 3R61A 4A2UA 1D3YA 1WGPA 4HX4A 3GUDA 4P9UA 2OZ6A 1U2WA 4HDUA 3NJZA 4LK1F 2XL7A 4ESJA 4CZZA 3FFQA 4UNOA 2B8MA 1U5TA 2P7VB 3SXYA 3AAFA 3CJNA 3Q9VA 2VN2A 4L9JA 3F22A 1ZZ8A 4ZYDA 2MHFA 4BNCA 4HVQA 4RB2C 3PQJA 3SXWA 1OR7A 3FF5A 3LFKA 3KFWX 3G3ZA 3M9AA 1S3JA 2FMYA 5A2QZ 2ISZA 2MD5A 5BUVA 2KXLA 1YW8A 2KIMA 5BMZA 1KU9A 2VBYA 2OZUA 5EEGA 1NYWA 4A0XA 4EWDA 4A0ZA 3EYYA 3ZDSA 2LKPA 4N9HA 5KHGA 3OOPA 3UKNA 3J80K 2A07F 4I0BA 4HSJA 4LLLA 3SCFA 3VHRA 2P4WA 2DT5A 5HS9A 5K8SA 1P6RA 3V8JA 1ONVA 3KGZA 4XF1A 1P4WA 1TNTA 4P9GA 3HSEA 4J1XA 2ADUA 4EGZA 4QM9A 1W7PB 5BXXA 1YS6A 1ZREA 4EM2A 1RL3A 3K1NA 1LDJA 2H27A 3W6KB 3KLOA 1F1ZA 2BGCA 1L3JA 4YG2F 1BJAA 5K5RA 1X8EA 5HS8A 4KU7A 1DPRA 1IPKA 5ICGA 2O1QA 3FWEA 4ZYHA 1IRGA 4UBGA 4HF1A 4Y17A 4UVCA 2QM3A 5KHIA 3C18A 4ASNA 4KMFA 4L9VA 1T39A 3B73A 2XAHA 1UCRA 1QXRA 3F8NA 3H3UA 2D1HA 2B9UA 4OIQF 2GXGA 4PGGA 4FBFA 3FXQA 4IEZA 4O9GA 3BB6A 4O9EA 4UVAA 1BI0A 1J3RA 4AVAA 4BH9A 1S7OA 5EFUA 1LJ9A 1YYVA 4EGYA 4CXFA 3HYIA 4Z2YA 4N0BA 5KHKA 1P2FA 1R00A 1U78A 1YFWA 3EJKA 2YU3A 4L9NA 3IKTA 2AS5F 2QUFA 1MJ9A 2XIGA 1J7KA 4LUMA 3ABUA 5D4RA 3EYIA 2Z5UA 4Y15A 4MEYF 2XV4S 3TGNA 3DKWA 1W5TA 2FOKA 5J6XA 3E5QA 5HDKA 1FY7A 3E6DA 1ZLJA 2XRNA 1O57A 1FSEA 2ZJ2A 2WFPA 3I5UA 3J81K 1O5UA 1I1GA 5JR7B 5DCMA 4EJTA 3C3VA 1U12A 1DDNA 2V6CA 3KP6A 3HHGA 4JBAA 1IN5A 3E5XA 3LAGA 1LEBA 4G6DA 4M6YA 1USSA 3JTHA 2QWWA 5I0RA 3VFZA 2IPQX 2HEOA 2VT3A 2EA2A 3HT2A 4JV4A 3REOA 2ZNZA 3EQEA 2RC4A 3MZYA 4MGZE 2QBYA 2L4AA 4MGKE 4LUKA 3PFIA 2Q0AA 4BQAA 3S7IA 3S2WA 1TNSA 2HWVA 4UV9A 1FZPB 4Z82A 3C1DA 4D7SA 3QP6A 2O6GE 4CHUA 1U5TC 4GGGA 3SZPA 2XAQA 1XB4A 4HYEA 1R1UA 2GC1A 4KUMA 1TBXA 3QAHA 4XLPF 4HVRA 3DV8A 4KA4A 4YYOA 4EJOA 3L9FA 3DXJF 4JTNA 4ON0A 2HKOA 2UY9A 4KFCA 3L09A 4MH0E 5D1IA 2EFWA 1YFYA 4I09A 4XFAA 3DPLC 2XASA 5BS6A 2DW4A 2Y48A 1O3SA 3E6MA 3LAJA 4M74A 4RAZA 4F8AA 5HI0A 1KA8A 3WW3A 1S7AA 1AWCA 4LMYA 3IWZA 3MYXA 3GO5A 3TNPB 5BY5A 4YFKF 5F6FA 2BNMA 2VOPA 2QNKA 1A04A 1T6SA 1ZAOA 2DBBA 3WTTC 4FHTA 3RKXA 1YHFA 1D8KA 2R3SA 3RYKA 2FNPA 3JAMZ 3KCCA 1T0FA 2ZNYA 2HZTA 2F4PA 3TDZC 4U0WA 3ZMVA 3F8MA 1ZG1A 1IXSB 2QJVA 3SCHA 1V3FA 2EWNA 1LB2A 4IEOA 1YLFA 4HVOA 3RPQA 2PHDA 3WTZA 3ZN0A 2ZKZA 4HMZA 1GHCA 4LULA 2FBKA 2F5FA 3SQNA 3JTGA 1V4RA 1R1VA 3F21A 4AQ6A 3HRTA 5CU1A 4HV6A 1O7LA 2Z2SB 5JSRA 3WTYC 1PDNC 1OPCA 3TQNA 3O14A 5D4SA 4DQ2A 5BOXA 2ELHA 4WBBA 2HQRA 3GEZA 1FOKA 3OGJA 4PGHA 1EH7A 1HXDA 5BPIA 2H09A 1O4TA 2BBYA 2W24A 4LGWA 1J1LA 1L0OC 5LGUA 1IPJA 5LHHA 5L3EA 4HF2A 4QGMA 2V9VA 1D8JA 4H7LA 2IC1A 3DPTA 2PAEA 1ZZBA 2QLZA 2L3DA 1RGSA 5I8SA 2YSRA 5I0TA 2OYZA 3QP5A 3O2PE 3Q5FA 4HQEA 5J3UA 4O6JA 1TQIA 2DLLA 3C7JA 4EWAA 4LG0B 2R7FA 1REPC 4EM1A 3H92A 2K27A 4QGLA 5CJ9A 3GYDA 2DPDA 4HBLA 1QBJA 3HRSA 4KIBA 4HX8A 1UPIA 1RZ4A 3PNAA 4EMSA 4XEZA 3CUQC 2UY8A 4O3MA 3GFIA 3KZYA 1QY4A 2EK5A 2Y0MA 3SHRA 3DN7A 4WXCA 4Q0SA 4YARA 2PMHA 4EJUA 5EZWA 5AIQA 3D0JA 2IJLA 3NRVA 3P9KA 1DP7P 3U2RA 3ROUA 3FHIB 4BYYA 1K79A 4R79A 4CICA 2GA1A 2CAVA 2PJPA 1TLHB 3HSRA 1IUYA 3FM5A 4XRFA 3VOEA 4XFHA 1WLTA 1SD6A 2HGCA 4AVCA 4XETA 4EJVA 3IRQA 5L3GA 4U7BA 3DEUA 2E7XA 5FD6A 1Z05A 4EVIA 3J7AO 3NKTA 1UD1A 3I53A 4AVBA 3RI4A 4A5MA 2KJCA 1XSDA 1GXPA 5CADA 3LA2A 3WTUC 3R4KA 5IT9K 3U0ZA 3F23A 2A3SA 2KKOA 4LA2A 1WRJA 4Q4ZF 1T2KA 4EROA 3L2HA 3BOQA 2M45A 1BI2A 1FBQA 4ZZDA 1TW2A 4I01A 1H9TA 2C0ZA 1LQ1A 2LNBA 1CAXB 2PQ8A 1K6OA 3ZN1A 2CSOA 3L7WA 3WW2A 3WGHA 1OI6A 2D45A 3GBFA 1LDDA 4YRDA 4HA8A 3T1BA 3RIRA 5FLHA 1BOAA 4OIOF 5DCFA 1IXRC 2K7LA 2Z9OA 4LEJA 4CYDA 3G7DA 2UXNA 4AD9A 1J5YA 5DUIA 2F5EA 5ILUA 5FB2A 2BEOA 1BC8C 4MNUA 3V7SA 2VQAA 4OINF 3CO2A 2M1BA 4G9YA 4WF2A 2I45A 4G7ZF 5LGNA 2BNNA 5FCCA 3H7JA 1ZX5A 4IRIA 2Q2EA 3H9AA 2LF8A 1JE8A 4B8XA 1CAWA 3ZMTA 1LDKB 2DCTA 1B9NA 4LB5A 3W6JB 4PIZA 3FMSA 5JI6A 2HQNA 2STTA 1CAUB 4LLOA 3JSOA 1J2XA 2EV6A 3QPHA 3CF6E 1DUXC 5LEKA 2FSWA 3H7YA 3MWMA 2QQAA 5E18F 5ILVA 2CWEA 2FF4A 3KE2A 1Z6RA 1HW5A 2YR2A 4S05A 5C8WA 3CO6C 1RTVA 1ODDA 2EV5A 5DUKA 5LRSA 5IT3A 3M70A 2DI3A 2CV6A 2O3FA 3T8RA 2UYBA 3BDDA 4AQ2A 5KVRA 4A6DA 4L11A 2K86A 5FLJA 3HTSB 1PUEE 4RGSA 1R7JA 1YG2A 2EFOA 4KWJA 1X82A 1C0WA 3H1YA 5FQ0B 4ENMA 5DEQA 2JT1A 2P5VA 1MGTA 3O6BB 4Q29A 4MV2A 2VXZA 1Q43A 1SFXA 4M72A 4I7HA 1B9MA 4LLGF
chains in the Genus database with same CATH superfamily
1EUUA 2XMLA 4TV7A 5DG2A 5JPMB 4Z6YA 1UX7A 1Y0UA 3CHXA 3LZZA 5CVUA 3KYCB 4NWVA 3IDBB 4C91A 5FK8A 1ZRFA 4ZYAA 2UU8A 4AVZA 3MKLA 2ZBJA 2I5UA 1RHI2 2X0LA 1WSUA 2ZXIA 3WEZA 4KWKA 3PUBA 4ATEA 4JKKA 2RM23 2CG4A 4KNCA 3KP3A 3ECQA 4XURA 3MN2A 2QBXA 3WGIA 2AXTC 4JX0A 4BB3A 2RR11 3PSFA 4DPNA 4HG2A 3RKWA 5FUIA 3M1CA 5GPCA 3A01B 1K7AA 3CMYA 3ABLH 5KK1A 4CXXA 1FYKA 1D1CA 1RUI3 1D7PM 2WO1A 3BTIA 3INAA 3LOIA 5A3OA 1FYLA 4XJ8A 2QQKA 1IG0A 4GZ9A 2M3AA 3VSKA 3LA7A 3J7LA 4QQPA 1RIOH 2VXRA 3ZFGA 3VGIA 3M8LA 2MEV1 1EPZA 1RI7A 1MBGA 2BY0A 4K21A 1WCMJ 3RZOJ 4YZ1A 3TO7A 1T08B 3NARA 2G4IA 1DGRA 3K4LA 1FOD1 1VP6A 1SLAA 1HV0A 1LKNA 4Q1PA 4KJZA 4EN8B 4ZZLA 3M07A 5F3IA 5JZGB 4UFIA 2QKMB 2LG4A 1KQRA 3K75B 1UAIA 1IF1A 2L9RA 4OMZA 1ON2A 4C2TA 4Q8LA 1MS3A 2CV0A 1JTZX 4BPZA 4CDQC 4BXUA 5FZOA 1WWXA 3O12A 2QBYB 5JMOA 2A05A 4N4NB 1T6BX 4Q4X3 2P6SA 5LD2C 5FROA 5D8KB 4GXLA 2FA5A 1XPWA 1Z9CA 2DQLA 3WP3A 4QXKA 3IDEA 4EWEA 3P6BA 1SVLA 3ZN5A 3HEIA 2OUHA 3KWVA 1LNSA 4AZZA 3IZOA 1UHWA 1MBJA 5CLSA 2FDFA 4Q0VA 3HKZN 3LSHA 1QF3A 1XMKA 1GT0C 4EV0A 4WK8F 3BJ6A 4MUVA 5LCWL 3KZ4C 3HOYJ 5FY9A 5GZCA 4NOTA 4YW1A 5JI9A 1W6MB 5FKLA 3DKXA 4PIXA 1UYYA 2B9VA 2EVXA 4UF0A 3O1MA 3Q9OA 1DG6A 4UAPA 3I3MA 1OD5A 2VULA 5BNPC 2LF7A 3HRMA 3I8TA 1ZN2A 3VYTB 3J7ZI 4IGPA 1ZYBA 2MABA 3AL0C 3MAJA 1FMD2 5DD8A 4XONA 4LNVA 3V42A 5EXOA 2P6TA 1AX2A 3ZFEA 4C90A 2ESHA 4NC7A 2RR12 2HOSA 3GJBA 3V56A 1IRZA 4OCTA 2EINH 4C3JJ 3IKWA 3Q8BA 2ZGSA 2A69F 2O0YA 1VRH1 2DYRH 1XCVA 2VGDA 1PP8F 2GXAA 4M9XA 2KRFA 3A2KA 1LEMA 2WRAA 3Q8CA 2A6XA 4GMP3 4WXDA 2LFBA 1NE6A 3BODA 3RQ4A 4PDWB 1TP4A 2JRTA 2MBFA 2JG8A 1KYWA 1JUSA 5K5OA 1QOOA 4HPKB 1MBEA 4D0PA 1FOD2 3HDDA 4BQ1A 2MC3A 1APLC 5FYCA 3ZPOA 2XAFA 3RPUD 1LFUP 2FXAA 3D5SC 1EY2A 4PLOA 1UY4A 1RMU3 1WW7A 2BHZA 2MH2A 3LSIA 3O8GA 4NDLA 4I0WB 4IE0A 2W91A 1IW7F 2VB6A 3B6AA 1QQIA 3U78A 5KNLA 4TLGA 3ZRGA 2Y34A 3ZFFB 4YG0A 3PUIA 4R8HA 4BIFA 5HV0A 2GH8A 3ASNH 1W2TA 3GXUA 3M3CA 1TQPA 3A02A 1SLCA 4NIDA 3M4FA 5GM0A 3BOPA 5C7GA 4ZS3A 2WA4A 3NJVA 3J7MA 4NUBA 3PO2J 1HQNA 2ZAHA 3U4XA 4YGCA 1VQMI 2VPLA 2ZZJA 3KLNA 3ETQA 2YB7A 1SAUA 5FRAA 4K1ZA 5GLVA 4HLYA 3OGVA 4F7ZA 3U9GA 1XCBA 4NMIA 2Y2ZA 3WQ1A 2OA4A 3R6SA 2L4MA 2R7QA 4LLFA 2GBYA 1KS4A 4OIPF 3I59B 1WLDA 3MIEA 2O61A 1YQAA 5F6LB 2BVVA 4LLNA 3JU9A 4L99A 1DCSA 3WW1A 2LYCA 1BIBA 1HN0A 2RQPA 4BHBA 1YIFA 2WKKA 2DTZA 1ZLKA 3I97A 2XRLA 3B3QE 4E7JA 4BBSJ 5J1UA 4XLEA 4LOTA 3GTJJ 2W1WA 4IV1C 2VMFA 2W85A 1W0UA 1CAXA 3WNMA 5APAA 5H9SA 2ZMLA 2OW4A 2D40A 1H4HA 2VE1A 5LHGA 2LW8A 1ZKGA 3UL2A 1ZQ3P 1PJRA 1SCSA 4CH7A 3LWCA 3FISA 1B72A 1PK6A 4LBQA 4B4CA 2UWAA 2Y6LA 1MQTC 1AOYA 3ELKA 3WG4A 2CYFA 1MACA 2LREA 3VEPA 3BCWA 1SCRA 5DAPA 3E6CC 1SD4A 3VBUC 1AR81 3AKRA 2ORXA 5A3MA 1GYKA 3OD4A 2F6BA 4RQPA 4NQWA 3V4GA 5FYMA 5JMCA 5C9AB 2KA3A 3ORJA 3WG9A 1VI0A 4F93B 2XB5A 2BVMA 1IQAA 1FJLA 2DK8A 1UZVA 2CDPA 3TEXA 5JVTA 2VZTA 3D82A 3R05A 4J00A 4P00B 3BQZA 1CX4A 1ULEA 1LR5A 1W8UA 1IGNA 1CAVB 2KZGA 5FIXA 3QOEA 1FSHA 3S3MA 1F5TA 3LB9A 3HTUA 1PIV2 1G2HA 3JCUC 3TDUC 2NNYA 1F15A 3JD73 3S32A 2OD5A 1MZ5A 3AYDA 4BLIA 5IVFA 1Q8QA 2WDBA 5FPAA 5HVQC 1NA1A 2ACJA 1C57A 3FXRA 2XBO3 4G7HF 4MO7A 3J9SA 1TT0A 4HONA 1FMD1 1BM9A 1IN7A 3RJPA 4FCYA 1TME3 4OWRB 3LEIA 2FE3A 4WM7C 1QJX1 1MNEA 3OUHA 5F39A 1ULPA 4PBPA 3TWIA 4O7XA 4CUAA 5GKAC 5FJKA 2VOOA 2RM21 5F27A 3KP7A 5JVVA 1ULYA 2M4GA 1WFXA 3OPZA 4FP3A 2HVRA 1PMHX 2VKDA 3PDQA 3VBHC 4UFLA 3WDTA 4L5JA 4D5FA 3AXDA 3PO3J 3U10A 1UU5A 2MEV2 1U5YA 4PJJA 4B4RA 1HSJA 1AR71 3KIOA 3ECHA 2ZHKA 4NC6A 1GNHA 3WTSC 2XH6A 1XSRA 1IN6A 4CXYA 2QDNA 4JGYC 1MMAA 1OLRA 3LQCA 4CCJA 2VO5A 3LFMA 1WJAA 3H36A 1JGSA 5HPOA 4OIRF 5FY7A 1U8BA 2PLV2 2CJJA 4CEWB 4Y24A 3TO6A 4M01A 1C1LA 4QX8A 2P0WA 3A0HC 2KJBA 3BYWA 4Y20A 3ES1A 4QKFA 3HT1A 4JVAA 2E1MC 3GXOA 2W0XA 5FTTC 1XNDA 2HDWA 4RGGA 3LCPA 4YIFA 1GDTA 4IEPA 3BCAA 2V09A 2YHJA 4UOJA 3VN4A 1RUE2 2O8XA 4P9FA 2Y9YA 1ULFA 2XVGA 2WIIB 5ANNA 2HYJA 5GLWA 4RS8A 1C8M2 4NRMA 3S93A 2KLOA 2WN2A 2V7FA 3CCVI 1YW9A 5J40A 2FBHA 3OYWB 5F3CA 3ZQGA 1NHAA 2CSGA 2W95A 3RZMA 4TLFA 3NVCA 2VBDA 4QTRA 3AZVA 5A7QA 5CNAA 4XACA 4KN4X 3K9TA 3CJQB 5BNQA 3I2GA 2HEWF 2L01A 1ZARA 2C4XA 5E1RA 1T33A 3I55I 4YZ3A 1KFUL 2WO7A 3L2QA 4X8PA 2IXHA 3UGGA 3ZXJA 4GWJA 4LBJA 3VPRA 4H4KC 2QZ8A 4XFFA 1BEV3 5IYBJ 3AZXA 2A3XA 3K69A 3SZTA 1MS5A 1I50J 4YM3A 1B8IA 4GH4C 5F8PA 4QPIA 5EIYB 1JZ3A 2FQ4A 2ZSIB 5K1YA 2RS13 5F5QA 3LIGA 3AYCA 3MZHA 2GQQA 5FYTA 2K9LA 4WM7A 3F8BA 2VZ1A 3FLPA 4DUVA 2IA2A 3ZIXA 3KT4A 5KHDA 1QMJA 1VQLI 3VBHB 2BOJA 1HDPA 4XYXA 3TEWA 3RI9A 2ZXQA 1OCZH 3PIGA 1VBC3 4IEUA 4IEVA 3ZQIA 5A1AA 4CDGA 2D6PA 3I64A 5FKOA 3VYUB 4LXLA 4CPBD 2AC1A 5D6FA 5A3PA 2E7TA 2P7CB 2K9ZA 2LH9A 2ERFA 2G7HA 2X1CA 1UHMA 1RVF1 4A93J 3OYIA 3IDCB 4IRGA 3KEOA 5ICCA 5DV5A 5L36A 5FLMJ 4FPJA 3NV4A 4HL0A 1AX1A 1XGOA 3H8UA 3ZYJB 4QQHA 4YW3A 2EPFA 3T2PA 3CNAA 4X8NA 3VLBB 2R5ZB 2RMU1 3ZSEA 1GICA 2JJ6A 4H2AA 1JUIA 4IHXA 2L5QA 1QIQA 4FPLA 4IQPA 4IEJA 4XMYA 4DNYA 3CU7A 4AAXA 2B4KA 5FY8A 1VQNI 2Z4FA 3A23A 2NMOA 4XLAA 1U5TB 4IZZA 3SEZA 4LOCA 1EP0A 5LK5A 3TKYA 3W3CA 3OS1A 2DCJA 2UXXA 1W9WA 3WF0A 1WWYA 2R5YB 3U11A 3ZFFA 3MFAA 4Y26A 5KR7A 2AXLA 2WSUA 5D2AA 5CVRA 1UZYA 3B02A 5BPDA 4Q1RA 3RZZA 1IG7A 5IYYA 3M7AA 1H88C 3UKGA 3K48A 4BQ3A 2WNVB 3N7JA 2VW1A 2ZGNA 4LG0A 5KAIC 3HG9A 4NRQA 4LOSA 4WCGA 1G9CA 1XOYA 1US2A 4FE7A 4QM8A 5F3GA 4NRPA 3WHTA 1I5PA 2ZJPF 3WNOA 4OZXA 2D98A 4FFIA 1X8MA 1R092 3LF7A 2VXJA 3GFJA 1JU3A 1OCCH 2IP2A 2HWE2 5LY1A 2Y0IA 3I3BA 4GYIA 5TGTA 3BZKA 4DXTA 2GNTA 2X6WA 2GC0A 4C9YA 1W2OA 3F6VA 4OMDA 1OQDA 4FPKA 5HLHA 3WUCA 3LL7A 4AFCA 4IQJA 5FP7A 2YFUA 3OB8A 4P9YA 3A0NA 1JU4A 3WV6A 1JBCA 3BG6A 1GQHA 1B35C 4XCAA 3K4CA 3WTXC 1X3UA 1HQCA 2HVQA 2QQLA 2VC1A 3O0VA 3K10A 1HLCA 4TN7A 1BMV1 3P7NA 5C3OA 2WV0A 1RVF3 1LOAA 1MEC1 4MOAA 4QX5A 3GZNB 2KIUA 2DVDA 3URFA 1KGSA 3MEXA 4B8EA 2BBVA 3UYJA 1OOPC 1GOGA 2DYCA 5J4VA 4YFXF 3APBA 2QQUA 1NCQB 3CMAI 5BNOA 4CSWA 2WLPA 1RINA 2NVTJ 2EXKA 1BBYA 1R1A3 1S8NA 3CD6I 3JBG1 2CYYA 5FZEA 4LHLA 3OYEA 3SC7X 1LHUA 1XYPA 5H9PA 2RVCA 4FQGA 2W9XA 1W03A 2J1UA 2BE5F 3V7RA 4CDUA 2HJIA 2R16A 4QHZA 3VD3A 5B2GB 3OBAA 1QNWA 1WCQA 4NHYA 1UMIA 5A6YA 6PAXA 3FX3A 3BP8A 1YYNA 1XG1A 3H8OA 2VUAA 3BTYA 1E3HA 2OA2A 1YS7A 3FXOA 2WAAA 1G6NA 2CQKA 1YUDA 5C3EJ 5F6KA 5EV7A 2WV1A 1LULA 2YC0A 3KCXA 4IOAF 2P5KA 2BJSA 3HOWJ 1GQPA 4ZS2A 1RUOA 5FBJA 1M4WA 3EETA 1RJ8A 4BBRJ 4CYCA 4JGYB 3SHFA 3M8FA 2F2EA 4Q47A 1ZR4A 1W2NA 3KEYA 2HYGD 2M4KA 4HPQA 3NAPA 4A12A 2GMMA 4KMUX 1NCRA 4ZY9A 3ZXFA 5ERIA 1BR4A 4HOBA 2WWYA 2EFPA 5F0HA 2IW5A 4NAOA 3NRUA 5A3LA 1XSVA 4DOZA 1AR73 2PLYA 1SBEA 1S29A 3PQKA 4JRAA 2V1NA 2RJLA 4RA2A 4IEQA 2RV8A 2VLAA 4AI2A 2L7KA 3N9OA 1QZEA 1P92A 1ODNA 2MLGA 2VJIA 2DF7A 3KV6A 2R0FA 4CZCA 3JRCA 3WE3A 4KICA 1GZWA 3CCYA 2A5ZA 1R5HA 1LGCA 2A6ZA 1POGA 1SHWB 4B7EA 3I3EA 4I0AA 1TME1 5JIAA 1VPHA 1I3QJ 2DFBA 2ZFWA 4LO5B 1YLLA 2D6OX 2EIGA 3FMRA 2W25A 1TG7A 4GO1A 3OUIA 2ZEWA 4HQMA 4BM8A 2W52A 5DAWA 2Y26A 3GBWA 1JJ6C 2WS92 4R9BA 5H6RA 1J9IA 3W2WA 2WNOA 1EUTA 1QXJA 3BR6A 4ZDLA 1CIYA 1FIAA 1OKRA 2EAAA 3PMEA 2WY7Q 1UW8A 1PO22 2DCKA 3CDZB 2IA0A 1MDMA 3OTFA 3VD7A 5BNOC 4MO3M 1ULDA 1H1MA 1KGYA 4LQRA 5JXHA 3EPZA 1DPUA 1F9NA 1RUNA 1G3TA 3F6OA 4P02B 2MGQA 3R61A 4M3CB 4FE4A 1H0BA 4HX4A 4P9UA 3NO8A 4HDUA 4N8MA 3RZDJ 1H8TC 3NJZA 1JZ2A 1POQA 3HOVJ 4CZZA 3S15J 2NM1A 4E9KA 2QQVA 3SXYA 1IDYA 3AAFA 4N53B 2VN2A 3F22A 4A3LJ 2DA4A 3BC8A 1PIV3 1VF9A 3R4UA 2CUJA 3AJYA 4MXWB 2QSHX 4DS0A 1AXYA 4XDQA 1UL9A 1H9PA 3LFKA 4BMBA 2O14A 1S3JA 2MD5A 2ZMEC 2JIJA 2ZEZA 1ALYA 2F5VA 2JDNA 2VY0A 2ES3A 2X1DA 3VZKA 5EEGA 5BNNB 1JYNA 5FRNA 1URXA 4CEYA 1W8NA 1JYCA 3W20A 3OSFA 3SITA 2VNVA 4IV3C 1ORKA 2DT5A 3GDBA 5J37A 1ONVA 1TNTA 2PJRB 4BK5A 3PIPF 1REEA 1GBGA 4KG8A 4QM9A 1VQ5I 1RL3A 1RR8C 3K1NA 1LDJA 2H27A 2PHWA 3KLOA 2WNVC 3SJMA 4N90A 4QXHA 4GWIA 2O1QA 3FWEA 4ZYHA 5CEHA 4HF1A 4B1LA 2Z79A 3UNPA 5FJ8J 5LA1A 4NHKA 2PMZA 5C8CB 4OI4A 2Z1DA 1T39A 2XAHA 4XNFA 1QXRA 3F8NA 3DUIA 1RYYA 3VKFC 2GXGA 4O9GA 2XJVA 4UVAA 1V54H 1YNAA 1J3RA 3LOCA 4BH9A 1S7OA 5EFUA 4EGYA 3HYIA 5KHKA 3AYEA 2WS91 5FZ9A 3HN3A 1YFWA 5FY5A 4L9NA 2W1QA 2QUFA 4FFGA 1RXGA 1K5MA 1UU6A 4LUMA 3Q0WA 3O1TA 2NS8A 3EYIA 3H0GJ 4MEYF 3TP3A 4PCRA 3LKJA 2C9AA 5T5PA 3WNLA 4HK9A 4CDUB 2KFDA 4ZDPA 2CDOA 1FY7A 4PK4A 5EJ3A 2BXZA 1GP4A 2F4LA 3RGBA 1WW6A 4GQ7A 2WFPA 4H7MA 1UY2A 4XVHA 3BLYA 4M0NA 1N75A 4EJTA 3C3VA 1EPWA 1RHI1 4JAAA 3ZYIB 3KP6A 3HHGA 2A1XA 2PX9A 4RFRB 2JENA 3PVOA 5B66C 5I0RA 3MLJA 4NPRA 5ACA3 4B3AA 2FX0A 2CHHA 1GV2A 2VT3A 1YRNA 4B48A 2W87A 4JX5A 3O1UA 1SC7A 4QB1A 1COV2 1XU2A 1ZGWA 4LPLA 5JOXA 3MZYA 2QBYA 2ZHMA 1V00A 2HWVA 5CA6A 1FZPB 3RKQA 3EB7A 5HNHA 2WS93 4D7SA 2ZXWH 3QP6A 4GKYA 2GMPA 1U5TC 2R49A 3AFHA 2O8KA 3CZ6A 3K4JA 5FZBA 2XAQA 4HYEA 2VVEA 2JQ7A 2CH0A 2ARBA 5I0DA 3DV8A 1WCSA 1ND3C 3DXJF 1MSEC 4JTNA 4ON0A 4KFCA 2F17A 4MH0E 4YVWB 5D1IA 3DEEA 4BQ5A 4PQQA 1VQ4I 3FBMA 2BVLA 4JGZA 2DW4A 4OI2A 3JR9A 4GMP1 2JA8J 2XJSA 1NAEA 1S7AA 1NLQA 4LBMA 3MYXA 2DCZA 4M4PA 1W8WA 2QQJA 2WN3A 1Y56A 3J8F1 4ARYA 3A4UA 1T6SA 2XG3A 4DO0A 3KV9A 3AMPA 2B9SA 4BIOA 3RYKA 3NMBA 3JAMZ 1I3HA 1T0FA 2ZNYA 3TDZC 4NN0A 1T8IA 3H1CA 3RMXA 2R7UA 1OH3A 1SLBA 1Q8PA 3RPQA 2P2KA 2HEYF 1GHCA 4LULA 1R4NB 3JTGA 3IT8A 1G86A 1CQTA 3AK0A 1RKTA 3B93A 4AQ6A 1RUC3 2JUGA 1WLWA 5CU1A 4NHMA 2W1UA 3WQBA 3BUCA 3OYCA 4B44A 2E1OA 3PTYA 1SVOA 4DQ2A 3O14A 3GHMA 1SZBA 1QU3A 2ELHA 4CCNA 2VMCA 1HXDA 5BPIA 2H09A 2MEV3 4A6SA 2W24A 1L0OC 2E34A 1E5IA 2VL4A 4HF2A 2BFUS 1RPWA 2NPIA 3POFA 3AKQA 4H7LA 5F3EA 1ZZBA 2A3YA 2L3DA 2R0HA 1YJ9I 5I0TA 2WZPP 5J36A 3QP5A 3O2PE 3Q5FA 4O6JA 4BQNA 4XHXA 1TQIA 3S1MJ 2K27A 1VBC2 2ZABA 4AYBN 3ZN4A 1JYWA 3VBSB 5C3SA 4EMSA 3CUQC 4O3MA 4AHYA 5E88A 2OUMA 3NWKA 3BKZA 2Y0MA 3DN7A 4HNTA 5FAXA 2PMHA 5FYZA 4ZPIA 4COYA 1Z21A 3I4NJ 2BPA2 3ABKH 1DLCA 1C8M3 4WM8C 2DV9A 1ENRA 3NRVA 5T5LA 3VYSB 3ROUA 3FHIB 4QB2A 4BYYA 3OYHA 3S6PA 4WVMA 1GFF2 4R9CA 1RUI1 4LE3A 1LENA 3HSRA 1IUYA 3FM5A 1ODMA 1W2AX 4XFHA 2VIXA 4AVCA 3ZFGC 4EJVA 4BE2A 2RR13 3IRQA 3ZFEC 2VMEA 5L3GA 4U7BA 1PGL1 1S5LC 5FD6A 4DOUA 5DAVA 4L9BA 1A5JA 1UD1A 3IH4A 3JRBA 1LU2A 3AP9A 2PN5A 2DFHA 3TN92 3THDA 5CADA 5SV5A 2YG0A 3R4KA 2R071 4GWNA 1WRJA 4Q4ZF 4PSWA 3HOUJ 3L2HA 1GZTA 1LHNA 3OYNA 1BI2A 4ZZDA 1H9TA 3IMMA 2ZTNA 2N8GA 4RMNA 4DBRA 2G9ZA 2CSOA 3N9PA 1OI6A 1BVP1 1BZWA 1X1CA 1S2EA 4FQ4A 4UW4A 4YRDA 2VZUA 2Y6GA 1UQXA 2GSYA 4OAYA 2VOKA 1GR3A 4RR3C 2B7EA 4HG6B 5FZFA 1IXRC 4CYDA 3G7DA 2W46A 3FHNA 1ETQA 4AD9A 1B72B 1PK6B 1W6QB 4M3CF 4JQRA 1BC8C 2ZGMA 3CO2A 2M1BA 2I45A 4AI8A 5ABJC 4FCAA 3H7JA 5FMBA 5DZFA 3U4SA 2Q2EA 2ZGOA 1OCRH 5M5YJ 3WG7H 2GNMA 3SEPA 3OIOA 3S1RJ 2DCTA 4QPYA 2BOIA 5AFBA 3W6JB 3OYWA 5FMOS 4JGYA 3J4UH 2STTA 1CAUB 1J2XA 4A3GJ 2WZR2 4RQPC 1XYOA 2WL1A 3MIBA 5ILVA 5C33A 4NJ4A 1YI7A 2WADA 1STMA 5IT3A 4QQ2A 2CV6A 3VUOA 3S1NJ 2WO2A 3M2MA 4CCMA 2O3FA 4DXRA 2OKXA 4OUMA 1PX3A 4AQ2A 4A6DA 2JD9A 2DT7B 5FLJA 4FTBA 5FXXA 2R041 1R7JA 4D9JA 5C9AC 2EFOA 4KWJA 2JDAA 3D4KA 4JDMA 1C0WA 2EALA 4ENMA 3S2DJ 5DEQA 1LPQA 2WT0A 3EUHC 2JT1A 5DDJ1 5A3NA 2YBPA 4YW6A 2R92J 4OVEA 2VCAA 2VL8A 4MV2A 3DPRA 1SFXA 2WFF2 4M72A 2X5IA 5IWFA 1Y1VJ 4LKSA 4Y52J 4ZU5A 4DUWA 4U7DA 2LTPA 3WP5A 3DQVC 4UW5A 5ANQA 3K4DA 2BV6A 1QGLA 2MH9A 2D5FA 1R5GA 5FZAA 3V8LA 1OURA 1U9OA 3OEBA 4XM3A 1VAVA 3P3PA 4YZ4A 2JJ7A 3N05A 2DYSH 1PM4A 3KV5A 3I3QA 3MUY1 1C5HA 4AFDA 4A3FJ 1H9GA 5F5AA 4W6XA 2JA6J 3M8JA 3PUFA 1BL0A 1NZCA 5H2FC 2AQFA 4KMQA 5AC91 2WT2A 1XE8A 2JD4A 1H0MA 2RM22 2HWC1 4QXBA 3H1WA 3U14A 2LKXA 3LWFA 2Y0SA 4H3WA 2IGNA 5C5TA 2W94A 5LA9A 4F3JA 5KXDA 2JVHA 1QJEA 4AHXA 4RBOA 3TOAA 3WX5A 2VECA 3DGTA 1NLRA 2EFQA 3PVNA 4NQWB 4ATFA 1UZ0A 1AR72 1EH8A 2EFNA 2IS2A 2Y64A 4X0GA 4XICA 2YPRA 4RFT0 2E1CA 5HNFA 4II2A 2OJED 1WGXA 3WINE 1POV1 2IXSA 1UMHA 4HLTA 5T55A 3ZMDA 1PVC1 1GOFA 1VBB2 1JKQC 2E51A 2XUEA 2XVKA 4A3MJ 4PFOA 4MQVA 3CF5F 2XLFA 5JZGC 2JDKA 1YRNB 2JG9C 1AJKA 3ABMH 2ZB9A 5K7ZA 3MF6A 2RREA 1MZBA 4A42A 3G1OA 4NB5A 2IS4A 1DDLA 2GIZA 4GRIA 1VRBA 4JKLA 4RAYA 1SPPA 4UUVA 4NBQA 5C4WA 3U1XA 3AVRA 1IV8A 2WNVA 2E5ZA 4UW6A 1V70A 4OMCA 4XZUG 2WQ4A 3OYJA 1GMMA 5F2SA 2RKHA 4PJYA 5FR3A 1YW7A 2RN7A 2FCTA 2OUJA 2BFUL 2QQIA 3N36A 2K4JA 1YTYA 1PGL2 2DFFA 3I58A 4AEDB 1USTA 5LBEA 4U2AA 1QO0D 4KU8A 3OYLA 5DUVA 1QRYA 2WYFA 4IEWA 4XRMA 4NHXA 2DVFA 4ZZ5A 3RQ0A 5A7WB 4CCOA 3DWLE 3K0LA 4BQ4A 2RDPA 5FPZA 2ZFUA 2WWSA 3K3NA 1GLNA 1Y6IA 4J19A 3L1PA 2WNUB 1OCTC 4V2GA 2RS11 3DU6A 3GZAA 5JAXA 1W8TA 1SD5A 4M3BA 3VBOC 5I0SA 1TW3A 2DFCA 1UOFA 2HLEA 1SFPA 3GZEA 4YIRX 4LA3A 5L9VA 1ULCA 1FI2A 1B35A 2BYVE 3BY6A 2E35A 2F4IA 2BRTA 5IVYA 3WVJA 3HSFA 2K0GA 1QVUA 2DMTA 3TNQA 3SYTA 3MLKA 2VBZA 2QYOA 3DYOA 3MKYB 4XKVA 1RNLA 3JRDA 2CGNA 2LS6A 4KI5M 4XUOA 3W21A 4B09A 2DMUA 2ECCA 2WY8Q 5GZDA 1R22A 4S2FA 2OS2A 2FNAA 3CIHA 5L3BA 1QA6A 3T30A 1I3AA 3QPTA 4YFZA 3W5NA 1UF2C 4XLHA 1WJBA 2OVUA 2I8DA 4PSXA 4LO6B 2A6TA 5G04L 2X4HA 5J7MA 4FQZA 1UKRA 2EB7A 2PQQA 2VQUA 4Y5SA 4Y4RA 1GV9A 4Q5OA 5IFPA 1PIV1 4D6SA 4HN0A 1AHSA 4GH4A 2NQYA 4RR3B 3D6EA 2BW8A 3TO9A 1DBNA 4IRHA 2P17A 5D5WB 2Z5WA 4FX0A 3HOTA 3HHHA 4A3XA 2CU7A 3ZSLA 4GJYA 2OX0A 4XFBA 2WWJA 1HDKA 3ZYPA 4L0YB 2FMDA 1ZK8A 2E19A 3D5LA 5ICEA 4FPYA 2ZJRF 5A2QK 1RUG1 2HDCA 1ETKA 1U5ZA 1E3PA 2JDZA 3HJRA 2XSJC 3H8XA 3G2BA 1NT0A 1XJAA 5DDJ2 3ZOBA 4IXAA 3QYEA 5CFCA 2FD5A 3SH4A 5A33A 3BJOA 5FXVA 1VQPI 2D3RA 2X6OA 2WZEA 1K42A 4CUCA 1HBXG 5HS7A 4I99C 2DDBA 2F4MB 2Z69A 4QHBA 1Z7LA 4RLQA 3L2RA 4XLFA 1RUH2 4AUXA 3SDBA 1IOAA 2DQRA 2GP5A 1NXMA 1S6LA 1DP0A 3MW2A 2NOGA 1WVRA 2H6CA 1YITI 2XLGA 1TEIA 2HEVF 4K3UA 5K0UB 3WP4A 1VR3A 2BP6A 2ZX2A 1Y4WA 1W05A 4AXOA 1ETWA 5BNPA 1OKQA 3I54A 1N3OA 2D6KA 1JHHA 1DQ4A 4A5NA 1J0RA 3ES4A 2A6HF 2MNGA 3T2QA 2GN7A 2VQLA 5D5XB 3GYHX 2F6CA 5EZGA 1DGWY 5L9RA 1X19A 4Q4X2 3N4MA 4KDPA 5F7UA 1O4YA 5FBZA 1V5GA 3M3EA 2WC2A 1EV7A 2NNNA 4HV5A 3O3KA 1E0EA 2V72A 3ME2A 4YVSC 1QPMA 1ENQA 5CQEA 5CVJA 2NXNB 2AQEA 1S55A 4D1QA 4NHLA 1MDMB 1RC9A 4UXNA 1WW4A 4CP1A 3HPGA 1A8MA 2ZMEB 2ZGUA 2FBEA 1ZBA1 2UYAA 3CF2A 1JMUB 3GCWA 4Z2WA 4X1EA 1ZG3A 3R0JA 5DYMA 4E4DX 3ELNA 2GH2A 4AVTA 2ZO4A 5LBCA 3FMGA 1Y43B 4HKWA 1HB2A 1UYXA 1LOFA 2DDAA 1Y9GA 3WNNA 1D5VA 5F64A 4CDUC 1O3TA 5GZEA 2DU0A 2G19A 4GA9A 3CZJA 4FASD 4Q0PA 1GWMA 4GKXA 1WLCA 3GZ6A 3KT1A 2CRGA 1JYVA 1BYHA 3UT0A 4BJ0A 4NHJA 2Z99A 4CP9A 1MMGA 3RKYA 2RS32 5FFZA 3ONQA 1UY0A 4XIKA 1NG7A 4LHSA 3TB0A 3MF9A 1R1A1 3LSPA 3WOGA 2DFEA 3BT9A 5LLQA 2O7OA 3ITQA 5G05L 4WWCA 3ECOA 2G9GA 1K78A 3KP4A 1BQPA 1X7NA 2L9LA 3OYDA 4E8CA 4M9ZA 4OI1A 4W8JA 4XUPA 1R1ZA 4ZONA 2Q8KA 1D0HA 2RGVA 3LE0A 4D7NA 5J3LA 1UCXA 2VUMJ 1VB4A 3R0AA 3CJTB 3ZXGA 5KWRA 4S04A 2D6LX 5FKNA 3I71A 4YG6A 2XGXA 4ENNA 1ETXA 3MICA 2HFHA 4AIHA 5FLXK 1CR7A 4NWWA 4AQTA 4LO4B 1FNZA 1BK1A 2ETEA 1DP3A 2ZJQF 3ALQA 3CO7C 1W36C 1QJU3 4MQ9F 4QSHA 3RCOA 1RUJ2 5FY4A 2SBAA 3HR9A 1ZA4A 1PO11 4PF5A 4PI2A 1G8WA 4F92B 4CRQA 5EYRA 2WJSA 5JLXA 3M1EA 4ZU4A 4FOYA 2VCBA 4HSLA 2Y33A 1TMF2 5FDBA 4X6QB 1EV12 1POV3 3ZFGB 4BDYA 2CY6A 2GAUA 3IAM2 4YZ2A 5HLIA 5JR2A 2VONA 1RKWA 3HPNA 3RMYA 3LSTA 1TNFA 3FXUA 1FOYA 4DYRA 1RMU1 1JUHA 4BQWA 3F9KA 3SMHA 4FT8A 4C3HJ 1Q1VA 3I0TA 1FTZA 3MV11 2PAKA 2CU5A 4PUSA 3B01A 3KM5A 4ZU7A 4ZC3A 4CDWC 5IK4A 2GC3A 2RVAA 4HANA 2UUZA 4TXWA 1XTAA 2Y6FA 3S0MA 2WB1A 4A7ZA 5J8FA 1UHSA 1DYKA 5F1RA 1QZZA 5KXBA 4BY7J 5E8IA 2GWRA 4BDVB 1LOBA 2FRHA 4C0HA 3O1VA 1OFCX 5JXIA 3OD0A 2TDXA 2KIFA 1U3EM 1QOTA 5SV8A 4P5OA 3CEWA 4OLLA 1A6IA 4MFEA 4OHVA 1IKQA 5FGMA 5LATA 2ENRA 4XR6A 3CUQA 3HOZJ 4J6GA 1Z7UA 2KRHA 1HKQA 4LT5A 3KPHA 4NIGA 4YVSB 1W1WE 4E7ZA 2WA3A 1G7YA 4C3IJ 1XGMA 3HUGA 3C7OA 2IXLA 5CPRB 1Y0NA 3F8FA 1H89C 4XAAA 3MMYB 3C2UA 1OCPA 1AA7A 2BWCA 1GVDA 5L7OB 2E1NA 3GLLA 3DLLF 4P08A 1W4MA 2EXIA 1F35A 2J1AA 5JHUA 2FEZA 3PM1A 4U88A 5F0CA 2XGEA 2ZSHB 2W92A 5DDJ3 4MLOA 5T3NA 3ERED 3A21A 2L7ZA 1W90A 1X2NA 5FP9A 1R71A 2W84A 1VBC1 3RG0A 4XC9A 1A8DA 2R043 5BQTA 3HL2A 2CFXA 4YNIA 3AJZA 4ENKA 4A3ZA 1BC7C 3J8F2 3K2ZA 1ZRRA 1EH6A 3KD4A 2BQPA 2PHRA 2DA5A 4OMYA 4DIQA 2GN3A 4ISRA 1PP7U 2JE7A 1Z0HA 4BDZA 1GV5A 2A5YB 5B4NA 1NQDA 5IAVA 4WVVA 1KQ9A 2YX4A 4K1YA 2H1LA 3CJXA 1KFXL 3HBKA 3CC7I 2E6VA 4C1WA 1K12A 5DZEA 1G59A 4S2DA 2HOTA 4COZA 3THCA 5F2WA 3IHUA 2WBMA 3NV2A 1P8JA 1C5IA 2VQGA 3SH5A 3HJEA 5A1FA 1FOWA 1JTXA 3ZSMA 3ZMSA 2ZMEA 1KZHA 3WHUA 5DZGA 3D5RC 3GVAA 4PHZA 1UZZA 1KU2A 3LPGA 3N9NA 4ZJZA 1RIRA 1F4HA 5C44J 2DTWA 2QQBA 2PHXA 2HTSA 2D5VA 1XE7A 1CGPA 3H50A 1AR62 3TOBA 3HOSA 1AL0G 2BVBA 2M7BA 3WDXA 3PTRB 2R1DA 1OYWA 3QD6A 2YS9A 4LITA 1GVJA 5DXDA 2MPFA 3BIWE 3TEDA 4INDA 3KX2A 4QDQA 3RSNA 1X3ZB 1V6IA 3I56I 5M0TA 1QQP1 1FV3A 2YZ4A 2H6BA 1HJGA 5CQGA 2Q30A 1ERDA 3DTKA 1PMIA 1XS9A 4FTEA 1QU0A 2BY3A 4E4ZA 2M87A 1PVC2 1W7PD 5A7NA 2RDNA 4D69A 5FZKA 2M2EA 1Q3EA 3BR0A 2DUOA 1DGRM 5DUWA 1S7EA 1LOFC 3GFLA 2ESNA 1CESA 2HR3A 1OMIA 3RZKA 2L02A 4UB6C 3M3IA 3MDPA 5E20A 4MGYE 3LQRA 3ABTA 2DURA 1G9AA 3J80Z 4N4OB 5FLIA 2NVXJ 3GTQJ 3HRUA 3T3YA 2ZS6B 2QENA 1JHNA 1Z91A 1IXCA 2WQZC 2BW3A 4RAFA 4BMEA 1IZ1A 2MA3A 4XJUA 2ADDA 4R1HA 3I7DA 1PO12 4XUQA 3KVAA 1ENSA 1QQP3 1TNRA 2W39A 1DU3D 3QLQA 4N43B 1W36D 1D1BA 3HGYA 3BWGA 2SLIA 3ACLA 2X09A 3ZQHA 1JKRC 3OYBA 2QVSB 2XBO1 1W2UA 1FATA 2JXAA 3F72A 1R1A2 4A6EA 4G94A 4Q48A 4RSUA 4LK0F 3DPUA 2QVOA 2HH9A 1XE0A 5HOOA 1O6UA 4DY3A 2F5CA 5I8TA 5FYYA 3ZGKA 3C3WA 1FNYA 2IXCA 1FP1D 1U6GA 2MD0A 1DQ2A 5FZ8A 5JOYA 4XUTA 1VTNC 4XBLA 5FO9B 4KIGA 4LK6A 1JYTA 2VJ4A 1BIAA 2GA2A 1XN7A 4TYSA 3N35A 3KP5A 4JDOA 4Q4Y3 5JOZA 3U37A 3CQZJ 3GHNA 3SFZA 4RB1A 2G1MA 1XDUA 4LK7A 3HQXA 3EDPA 1XNKA 1AR83 3POEA 4LBKA 2KT0A 1Y1WJ 1SQ4A 4FPGA 1SMTA 5FKCA 3LFUA 1DZTA 1QGPA 4RGAA 1Y7BA 4Q4V3 1GOHA 2Z16A 2V1DA 1YXWA 5A33B 3J8F3 3VDDA 1AXKA 2VKHA 3BG7A 1W7PA 1N3QA 2AO9A 4UUTA 4U0YA 3FLTA 2O03A 3JZVA 5T52A 4AEMA 3JRHA 4Q4W2 5FPLA 4AIJA 2ZGPA 1KU3A 5E1WA 3NWTA 4JOMA 4OYUA 2JDMA 4BWOA 3ERMA 3QODA 1IAWA 2LY2A 4XF4A 1VFCA 2HS5A 1QPIA 4BQYA 2VW2A 4MADA 3OYGA 3RRDA 2DTRA 2OZJA 2ATFA 2EXJA 1NK3P 2DU9A 3BZ6A 5DAXA 3F0CA 2OTLI 2Z33A 2QEXI 1MQTA 2L9VA 5CFDA 1OF3A 1LFPA 1Y3TA 3DL3A 4G8XA 4XFCA 5D5VB 4KIFA 3LIHA 2DOFA 3OOUA 3KZIC 4NVPA 5FP4A 1E2XA 3C7EA 3K1PA 2JDHA 3BTAA 5ACA1 2OC6A 1XXNA 1R58A 3LEKA 2J1TA 4D7MA 4G12A 1UFMA 3GNEA 4MGIE 2AACA 4F55A 1YEWA 3MCZA 4XXPA 3GCXA 3PIOF 2E2JJ 1RHI3 4P55A 3V0BA 4LKFA 3OWTA 4DINB 4UFMA 1TZLA 2BOLA 4AFBA 4QKDA 5JHFA 4ENJA 1WGPA 3ON7A 1U2WA 2VW0A 4OUEA 3ZX7A 2XL7A 3VKMA 4CTEA 1YQ2A 2X29A 4UNOA 1LOCA 2B8MA 1CD3G 5EEAA 1XPXA 3CMMA 2KP6A 5L73A 1LAJA 4ZYDA 4GB32 4Y5TA 1POV0 1UN1A 4YEJA 3AP5A 4RB2C 1JJ8C 1DF0A 3SXWA 2C5DA 1OR7A 3CCEI 1K5JA 3G3ZA 3M9AA 2FMYA 2KXLA 5D21A 3POSA 3WNPA 2KIMA 2Y6HA 1ZBE2 5BMZA 2EIKH 3TBIA 2NMNA 1U9NA 4CYCB 2A3WA 1WJCA 2OQ7A 2RDQA 4EWDA 2TBVA 3MIDA 3EYYA 4I30A 2LKPA 1JT6A 1PVXA 2AEYA 3C7FA 1PO13 2BDRA 4NNJA 4UUSB 3E7LA 1H2NA 3BG9A 2M0CA 3K4AA 2A07F 4I0BA 3SCFA 2FDGA 1QJU1 4A7KA 2P4WA 5K8SA 5IATA 4XF1A 1K83J 1OUXA 3HSEA 4J1XA 2ORZA 3H5RA 3DEMA 3FUOA 3GJAA 2QQPA 2EIEA 3N9LA 2WAQA 1YS6A 1ZREA 1Z3XA 2IGMA 5J09A 3W6KB 5IPAA 4XBNA 1LHOA 4YG2F 2WFF1 5A32A 1X8EA 2IEKA 1OBNA 5HS8A 1HB3A 3MW4A 3POGA 5ICGA 3VD4A 1W06A 4XMAA 3JCIA 3OGSA 1H6XA 3GCMA 1MEC2 1CJDA 4L9VA 3ZKYA 2JICA 2E53A 3B73A 4J25A 4EN6B 3BR1A 2QQ8A 4K8RB 3WLUA 4PGGA 3OGRA 4CCCA 3BR5A 1D0GA 2QGUA 1BI0A 2RHPA 1YYVA 1FPN2 1MS9A 4QX7A 4BEHB 2ID3A 2CGOA 4DYCA 2EQRA 4YM1A 2XB0X 3IKTA 3ASOH 2AS5F 5B1AH 5B4XA 3V65A 2VQHA 2DVBA 4N43A 2LP0A 5D4RA 3KHCA 1WJDA 1BCXA 3TGNA 1B35B 2FOKA 2Q2EB 4B3XA 1JZ5A 5FYHA 3E6DA 1N47A 3RZJA 2ZOEB 1QVTA 2XRNA 1O57A 4M0HA 1AXZA 3I5UA 1XSQA 3JRIA 1HDDC 4B47A 3AP7A 5JR7B 3O7OA 3BPSA 2YGLA 1V6OA 1VQOI 1U12A 1XQNA 3T1LA 1V6KA 1DDNA 4IHVA 1DIWA 2M34A 2O8OA 4L8QA 3E5XA 2OPWA 1USSA 4QD2A 2VJJA 4P5HA 4YGEA 4F3QA 4EE2A 2EA2A 3HT2A 3J26N 1F5JA 1GWKA 5CKMA 5F37A 4YLZA 4AR2A 3VBOA 5EGOB 3EQEA 4MGZE 4FVVA 4A3JJ 2XGDA 2ZMKA 2QA4I 1ASJ2 4B3NA 4ZZ8A 5A7PA 1HKDA 3NAPB 3HGGA 3GTPJ 1ZTRA 3KLSA 2YU1A 2X10A 3THPA 4XN0A 3QAHA 1X1DA 2W68A 2HWF2 3VHPA 4COWA 4YYOA 4EJOA 4FSJA 3CCMI 2VXDA 2E2IJ 1GNYA 5DMYA 1VQ8I 4I09A 3DPLC 4XQFA 4YELA 2QFEA 5BS6A 3O1PA 4I3GA 1O3SA 3LAJA 3PJQA 3VZJA 4UFHA 3BTJA 2EIBA 4LBNA 1JZ6A 4RAZA 3TL4X 4F8AA 2WABA 2FUG2 4RS5A 1PUFB 2EF6A 1S0EA 1WMDA 3BTXA 1HN1A 5FRMA 3GO5A 1UG0A 3HOXJ 2YC4A 5FPVA 5F6FA 1UY1A 4Y1YA 2QNKA 1C28A 1A04A 1ZAOA 1GWLA 2DBBA 3H9JA 1AR61 2K9QA 3A03A 2FDHA 3MGUA 2CQ7A 2BZDA 1F5FA 1OISA 1LB2A 4XKWA 5HCBA 5K0UA 3CP2A 1YLFA 1WCDJ 3VBRB 4HVOA 4I76A 3BTCA 2YYOA 3WTZA 2CQQA 4A3CJ 2ARCA 4HMZA 2F5FA 3OPTA 3SQNA 1CX1A 4FPFA 1AKHB 4XQ4A 4HV6A 4XW3A 1O7LA 2JN6A 4V2WA 2Z2SB 1VMJA 2WO3A 2O0OA 3SH3A 1PDNC 4N7IA 4AGVA 2NLRA 4S0HB 2RAEA 3DBRB 4QXCA 4AE2A 5IK8A 4M4RA 2HQRA 3GEZA 1FOKA 1SBDA 1YO8A 3OBTA 1RR7A 4W6WA 4XQDA 3Q8EA 4BACA 4PGHA 3PUHA 1EH7A 1KXGA 1R9TJ 3AC0A 4PLNA 2BBYA 5IK7A 3W6VA 1OJLA 4A3KJ 1NCQC 2YU2A 4QGMA 4YM0A 3Q0VA 2JB8A 2B63J 1AYM3 2ZEXA 3RS6A 3WHCA 4COVA 3NNJA 2YSRA 1R082 2OYZA 4DJAA 4OHWA 1BLZA 3VD9A 1A3KA 2MC4A 3IPVB 4UFJA 1YI9A 3C7JA 2L2OA 1REPC 1Q8OA 3SEEA 4QGLA 2IS6A 3GYDA 4XOPA 1OD3A 2IUWA 4HBLA 1QBJA 2DPDA 3HRSA 4HX8A 1RZ4A 3DTEA 2A75A 3A7QA 1PYVA 4XEZA 2JRMA 4R9DA 2X85A 3K4BA 4D6RA 1S0GA 1QY4A 3DEWA 2V6EA 4ZXKA 1COV1 1MEC3 3VYRB 1WHUA 3ZPYA 3SHRA 2I74A 4WXCA 2XWJB 5CG8A 4E8DA 4EJUA 5AIQA 1X3WB 2IJLA 4J01A 2RNGA 1K79A 2OV7A 3W59A 1Q8VA 1QXPA 4CICA 4Z2AA 2GA1A 3NWSA 4PJMA 2PJPA 3T1MA 1W5CC 1L7QA 1UNBA 1A34A 1JOJA 1WLTA 5D8AC 3OBZA 2XXZA 4AEDA 2AHQA 4JP0A 4WZFA 4A3EJ 2Q5TA 5GAGJ 1XBFA 3DEUA 3ACIA 2E7XA 4EVIA 4BJ6C 1OF4A 1MBHA 3VD5A 4AVBA 2YXSA 3RI4A 2VTXA 5C3QA 1CPMA 1S1AA 3LA2A 2VBPA 5IT9K 4RM2A 3F23A 1CPNA 4LA2A 2ARAA 3BOQA 1Z0XA 1LHVA 2M45A 2LTNA 2ZPXA 1FBQA 1TW2A 4I01A 4ET7A 2C0ZA 2OCEA 5ACA2 1WD3A 1LQ1A 3S1QJ 4JC1A 2A71A 2Q8OA 3U21A 3A01A 4P9LA 3OJBA 3MZ8A 1QJY2 4TZDA 4HA8A 3T1BA 1H8VA 4JCKA 1BOAA 4OIOF 1KDMA 5DCFA 1R4MB 3ZMNA 2VQCA 1LJ7A 1GLHA 4LEJA 2FDJA 4W97A 5DUIA 5ILUA 4EN0A 3H5NA 2NP0A 5L19A 3IM0A 3VKOA 5KXCA 4OINF 1K61A 5FP8A 2A5WA 2ZACA 4G9YA 1VBE3 4G7ZF 3MLLA 2CUZA 4D5CA 4IV3A 3H9QA 2BNNA 3WU2C 3HB9A 1PVC3 1FPN3 3H9AA 2EIMH 2NYYA 2LF8A 1JE8A 4HNUA 4CU9A 4QU2A 4A4AA 4D94A 3VB9A 1T6GC 3PJRA 2JWTA 4PIZA 3ZCOA 3JSOA 2EV6A 3QPHA 1BOBA 3ZQQA 2FSWA 2RJ2A 4CEWC 4DYQA 5E6HA 3KE2A 2YR2A 5EP9A 2EV5A 1I39A 2DI3A 3IPVA 1VBD3 3BIEA 1YC61 3SEQA 3LDRA 1JT0A 3B5LB 2KD7A 5FQ0B 2XJPA 3QH6A 1GSLA 3WHBA 3CP8A 2VD7A 1DU0A 2HYXA 3O6BB 3TN91 1X1PA 2QKLB 1SACA 4PI0A 2LOOA 2BHYA 5FZ3A 1GP5A 1I1EA 3ZDSA 4Q0UA 2NZ9A 4LLGF 2RMU3 3GALA 1DQ5A 2QQ9A 2R6QA 2RS31 4KBZA 3H9GA 2PA7A 4WM7B 3ZMZA 3DTIA 1ZRDA 3P5BA 1OQYA 4XQWA 2D93A 1MQTB 3CLOA 2JTVA 3L2YA 3E0JB 2V9PA 1SFUA 1E57A 2X6XA 4UHTA 1S0FA 2CO5A 3E5UA 3GLXA 3GTLJ 3HQUA 4F83A 5LA0A 2V1XA 2R072 3ZYBA 3H3LA 2XL9A 3JRFA 2E33A 4NO4A 2W7NA 5B3SH 2Q1ZB 2I07B 1ON1A 2FCVA 2XAUA 1OXCA 1DYOA 3WU0A 3VV1A 1PO23 3DPRC 3BROA 2JECA 4C2UA 5GLZA 3TW7A 3CMEI 4AW7A 3HMYA 2RDRA 4PT6A 1P4XA 1W3VA 4XJZA 4BUPA 1HRI2 4FETA 3I2IA 4OHZA 3IUOA 3HNYM 1LEDA 3AZZA 1YX5A 1IS3A 2HWB3 4XF3A 2XSDC 4BQXA 4D6QA 3MKWB 5FKMA 2KZVA 3VODA 4JTOA 5C70A 3AKSA 2XROA 2XJQA 2EBIA 4WX9A 1ETYA 2TRTA 3NNMA 4RR3A 4AIDA 5HCHA 2E9QA 3FBNB 3WTVC 1MD0A 2DBNA 4DZPA 3R4SA 5E3OA 2PEXA 1W6OB 1CAVA 5TSWA 5E3MA 1OOPB 1VE0A 1Z78A 2DJNA 1HW1A 1V0AA 2Y8KA 5C8CC 1ITYA 1D5YA 1JW6A 2QSGX 2QKDA 4DZJA 1YWKA 3L00A 3G4SI 2GIVA 3N9MA 2P81A 5EQUA 3AFKA 2EA7A 3IAQA 4HX7A 4Q5SF 4KWLA 3L2CA 4DY5A 2Q8EA 2GC2A 2RQQA 2IVJA 1WJFA 3T4HB 1QHHD 5HDGA 3GF6A 3ZXKA 5KCMA 4C8DA 3I2OA 1DQ6A 1OLQA 4ESBA 4EM0B 3KCYA 4RL7A 4E2QA 3HIFA 1X50A 4Q27A 2D7FA 3I4MJ 4CU6A 3AKTA 1DQ0A 1QJU2 2VASA 4DNCA 1UMZA 1WMEA 1W9SA 1OA2A 4XRSA 2XC7A 4S2GA 3KV4A 2K46A 2VCCA 1XD7A 5LFAA 3LA3A 5H6QA 2ZGKA 3VBUA 3GMEA 3CUOA 3EMRA 3CCJI 2R7TA 4B1RA 1PUFA 1HSTA 2HYKA 4GDFA 4QX3A 3HN1A 1OLTA 3PNYA 5GALA 4E7IA 2NVYJ 3SFIA 5LW9A 1TMF3 1X2MA 4QPGC 3SKJE 4L18B 3CL1A 1YFHA 2OPKA 1ACCA 5A70A 2IGOA 1VBE2 1GKBA 4KITB 2KPMA 3ZN6A 2VZVA 3WDUA 3ZQCA 5E89A 3ZSJA 1S72I 3IRRA 1KRIA 1GXQA 4EN7B 2PFWA 3BU7A 4BEHA 3NV3A 2E26A 3IIAA 3TEYA 2ARXA 2E5NA 2H94A 1AJOA 3KHBA 4A7YA 3CTAA 5IUQA 1SDDB 1D1AA 4MIMA 2ZHLA 3Q8AA 1VQ7I 1L3LA 1KU7A 4FPCA 2P3YA 2QQOA 5E8GA 4UWDA 3UJOA 2HOEA 4AF9A 5C6CA 4FAGA 1JHFA 2YBKA 5DG1A 3JAMK 5D8AA 5GP9A 1VAMA 2ZC2A 4BY1J 2FZ1A 3FXMA 4FO9A 1CWPA 1AR92 4AHZA 4HDVA 2HZDA 5DDGA 3U07A 2B0LA 3J81Z 1R1TA 1QJY3 2JEMA 1NQJA 1WW5A 3BPZA 3H3VK 1UIJA 1RESA 1XGNA 4H55A 3RSJA 5EG0B 4LJHA 1TWAJ 2JVGA 4BL0B 3WODF 4MGSA 1AL21 5KC6A 2EJRA 3MPPG 3EYPA 3JD71 5LWBA 1HRI1 3OOXA 5EGOA 1RUF2 3H0DA 3ETPA 1ZNPA 2BUKA 1K3IA 3QPSA 4K20A 2WAFA 4CDWB 4G6QA 2F5DA 4BQQA 1G4DA 3ZR6A 3A4CA 2Y69H 4XFGA 1ZVFA 3S7EA 4KBBA 1RUC1 1V6MA 5A3WA 1MJBA 2G9FA 3SLIA 4W65A 3K4KA 2J22A 2OQRA 3PL0A 3NNGA 2Z42A 3ZXDA 2DO7A 1W3XA 2KL4A 4LKEA 1NCRB 3DKQA 2VTXJ 3NAUA 2E2HJ 5A3TA 1NLSA 3AP6A 4IETA 4OU0A 1G3YA 1PZ9A 5GLUA 4MZUA 2L9SA 4DBQA 4RB0A 1W0NA 3T0DA 4EZ4A 3NQOA 1SG3A 1RC6A 5C4JJ 3T0BA 3KZZA 5HODA 3GFMA 3UJQA 5LHIA 1Y9QA 3KGLA 1E5HA 2DN0A 2OQGA 2E7QA 1ZG5A 4ASMB 4Y13A 1G3SA 4TWTA 1SDWA 1WH5A 2VZ3A 5CG9A 4H0EA 4NE9A 5F1JA 3UKVA 2R063 1VMFA 1WKMA 2D44A 4OQ8A 2L0KA 3D3AA 5GTHC 2LRPA 2VBXA 3ZO0B 2XAJA 1XX5A 4MSVA 4A45A 2DA1A 4IQ4A 3QU3A 4ITCA 4PFPA 2Q1MA 1FIPA 4CZSA 3LAPA 1J3PA 4HW0A 1T95A 4DB5A 2P5LC 4KGGA 5EJ1B 1HRV1 1ETVA 5E3NA 2PBIA 1MS0A 1J3QA 4XF0A 2PHLA 1QNTA 1O59A 5LY2A 2CW7A 2MW8A 2UWMA 2YY1A 4BXSV 2K02A 2JZYA 1H8TA 2A6VA 4M3CA 5K9YA 4LE4A 1H9WA 1X36A 5A1LA 1HLVA 1HRV2 2GALA 3KB5A 1A6QA 4AWXB 2OAZA 5E1XA 1D4M3 5A7SA 1Q5OA 4M71A 3SZGA 2HWB2 1UX6A 1VRH3 2ZJCA 3EBRA 1ZGAA 3ULQB 1Y39A 3RYRA 2PMZN 3PJYA 3VHOA 3PHMA 4YFNF 3ZIWA 5I91A 3OYKA 1RJ7A 4Y7NJ 1IPSA 1VB2A 2ILMA 4O65A 3KQRA 3BZCA 2XPJA 3OY8A 5L3DA 2QZ2A 1S0JA 5HLGA 3MO4A 2WLQA 4V2VA 3E6BA 4DZGA 1STZA 3AYAA 1S2KA 2KDZA 2NYXA 5ED4A 2PN6A 3FZVA 2R7ZJ 1IRFA 1S0DA 3LD8A 3FL7A 4KT6A 2BU9A 1LEAA 1UJ8A 2K2SA 1S0CA 2HPIA 1YIJI 4KH9A 4JHTA 5JXGA 3ILRA 4XSZF 2PJRA 3WE2A 3ASIA 3MQ0A 2ZGRA 4Y1ZA 1W39A 2Z3YA 4QWQA 3OS2A 1RB8G 3SDGA 1OYIA 3VZMA 4BU2A 2DVAA 5HLTA 2JG9A 2HU9A 1BMV2 3RWNA 4QDRA 1I27A 2Q8DA 5K0UC 4X6RB 5E16A 2WSVA 5IAXA 2YFZA 4Q4X1 5C4WC 4QPQA 1RUD1 3IH2A 4RGUA 2A68F 1WZ2A 2X05A 3I2DA 4A0YA 1BK0A 1FC3A 2XKPA 4RB3C 1AU7A 2Y0OA 4ZDOA 1FBSA 1O3QA 1CZTA 1UOGA 3RPUA 1QH6A 3ZLIA 4HKOA 4IESA 4FXGB 2ZBKA 2MSYA 1PVEA 1W8HA 4HF0A 1SAXA 1BW5A 4KNYA 3WU1B 1VBD1 1IDZA 4IPAA 2R30A 3SCGA 3BPXA 4K40A 2LC2A 5EHDA 3WGGA 1WUVA 1IGOA 3DCFA 4Z07A 3FJSA 3OV8A 3MPBA 2VOTA 3T2OA 1ZZ9A 4GJZA 3R60A 2CUFA 1W9FA 3VB2A 4XILA 4OZOA 4BA6A 3FM3A 1UXZA 4META 1LODA 2VBBA 3AP4A 5FZHA 2G0EA 3ZSKA 2ZAAA 1HB4A 1H8TB 2VVFA 4OHXA 3NKGA 3S2HJ 4HXCA 2WB1N 3POBA 3DXUA 5IOYA 1T38A 1H30A 2R4GA 3HVDA 2X5IC 2W57A 2XPVA 4L5IA 1FOD3 4UW3A 4E4SA 3S57A 3AG3H 1GNZA 3VDAA 3PURA 3DPRB 3TBDA 3FHZA 4NIAA 4LB6B 4G7OF 2FDKA 4AVSA 1OQEA 2M5WA 4DW6A 4WVWA 3P9IA 1XB9A 1H8AC 4M3GA 1UZWA 2BGOA 4Q4Y2 2D2WA 1KITA 1HXS1 1NXD1 3ACGA 4OQ9A 2HBUA 2HWD3 1K78B 3C7GA 5DTDA 2JSCA 3CLQA 3BG5A 1NA1C 3AKPA 2FQ3A 4E2GA 1KYZA 1W0TA 1W6MA 4DMIA 1IZ3A 1AR82 1FMVA 1WZXA 1WMXA 2DCYA 5HCFA 2F48A 4P1WA 1VJ2A 2ADEA 3JXSA 4IEXA 5FPXA 1DGWA 2H8RA 1P4AA 5KBFA 4QU1A 3FBYA 2VE9A 4C30A 4ZYEA 1B4AA 4MGRA 3TOJA 5LBQA 4L2NA 1HC8A 3N97A 1VALA 3RTRA 3UGFA 3EHKA 3CDIA 1LUJB 3NW4A 4BZ4A 3GGLA 1MNMC 2NS0A 1D4M2 3HC7A 5FV3A 3OS0A 2P4EA 4NPLA 4DFSA 2XOMA 4Z1VA 5FUPA 4Y33A 3C7HA 1AHDP 1NKGA 2VC0A 4OFGA 3PLQA 1EYBA 4FFHA 3MD2A 5AIPA 1WBFA 5ILSA 1ULOA 4LTAA 2V5DA 3D0SA 1VBB3 4Q26A 1V5FA 4JQFA 2OU2A 3FIWA 1T98A 1P9QC 2VCMA 3ST7A 2H0VA 3FC0A 3JRGA 4RQPB 3HWJA 4WZCA 4M6XA 5ICFA 5C9AA 3ZKUA 2WAEA 2ELJA 3P9CA 2CTVA 1DZRA 5FD5A 3BPVA 1B1BA 2GDFA 5T50A 2PAMA 2WYSA 2EAKA 4GULA 5H9RA 2G9WA 1FYUA 1SLTA 3ZXSA 3USUB 3HZJA 1RUF1 1R6RA 4QLCU 1LRHA 5F5IA 2GZWA 2K4BA 2AH2A 1D0YA 5C4WB 1A35A 4EJRA 2V79A 5IOZA 1D2QA 1J09A 1MS1A 3T5XA 3VWBA 5ABJA 2IVMA 1RITA 2W2IA 2GNDA 4ES8A 4I98B 1ENHA 4MG2A 2XF7A 2BERA 2Q8CA 2O8QA 1OA4A 5HCAA 3CDHA 5JSOA 1W0PA 1SD7A 2LSOA 3TW6A 3ZQLA 1R091 1IKPA 5K7PA 5KXEA 4II3A 1XNAA 5CKTA 5FY1A 3CKHA 2GU9A 2KQRA 5D6EA 1OPOA 3BN6A 4LBQD 2B46X 1HXS3 4WM8B 2XLAA 1HOMA 3UETA 4JGZB 3IV5A 4ZXEA 2CV2A 2EIDA 1QEXA 4WVMB 1IC8A 3S8PA 1MW7A 3VDCA 3T0AA 3DKYA 5EYXA 4FXKB 4HEA2 2HDDA 3KETA 3ZQ7A 3ZP5A 1RVF2 2IAIA 3ZFEB 1QHGA 2WWUA 2W1OA 3MBWA 1R23A 3O0XA 4HNVA 1L7LA 1TME2