4A2UA

Crp(cap) from myco. tuberculosis, with camp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
224
structure length
224
Chain Sequence
b'MDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE TRANSCRIPTIONAL REGULATORY PROTEIN (PROBABLY CRP/ F
publication title A New Crystal Form of Crp from M. Tuberculosis and Conformational Effects of Crystal Packing
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 58
structure length 224
sequence length 224
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4a2uA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4a2uA01
5HDKA 3T1BA 3H3UA 1WQ2A 4LEJA 3D5LA 4R8HA 4JVAA 2YPRA 5DUKA 1U78A 3F8FA 1J75A 4XF1A 4MEYF 2GC2A 3M9AA 3QU3A 5L3CA 2F5EA 2K4JA 1DP7P 1ON2A 1SMTA 5HOOA 4D7SA 1YS6A 5LRRA 1K7AA 2MLGA 3VOEA 2HS5A 4G6DA 4NHJA 2HQRA 3I53A 1FBQA 1ZNPA 1HW5A 2AS5F 2VT2A 1PP7U 4X6QB 1IAWA 2PYTA 3K1PA 5FLXZ 4WXHA 3WW3A 3GEZA 3M7GA 5LBQA 3O14A 1P4WA 4WWCA 4LG0A 4IJAA 4IEYA 5JVTA 1ZRRA 3H7JA 4E70A 2JPCA 2IXKA 3KP5A 4P55A 5FO5A 3DL3A 1NZCA 4S05A 3MQ0A 3LQQA 4H0EA 3IIAA 5I93A 1JHFA 3SFZA 4B29A 4OMZA 3CJXA 3WTTC 1J9IA 3EO6A 2PQ8A 3CUQA 5LGUA 4AVCA 1WGPA 1ZZ8A 2JPBA 2R3SA 4TV7A 1K79A 5AIPA 4PIZA 1XSDA 4YIFA 5DUIA 3WODF 3LSTA 1OFNA 1DUXC 2XLFA 1NE6A 4B09A 3R0JA 2F5DA 4UXAA 5J6XA 4ESBA 5L3DA 5DCFA 2GAUA 4ENMA 3CJNA 4HYEA 1SQ4A 3H1MA 4XFHA 5IT9Z 3D82A 2KXLA 2OA4A 4IF4A 2YR2A 4MNUA 4PGHA 5D5UB 2VT3A 5ICGA 4O9EA 1XSVA 1DPUA 2EV0A 4XBFA 2O8QA 2BNNA 4YRDA 2Q8KA 3IDCB 1ZG5A 2P5VA 5E8IA 3S2WA 3E6CC 2FE3A 1FPQA 3CEWA 4RS8A 2RVCA 4HSLA 2Z3YA 2ISZA 2L01A 1HKTA 2A61A 1WRJA 4AIKA 5FLXK 1PUEE 4RGRA 4A2UA 2ZFWA 2MNGA 3GYHX 2FNPA 3KEQA 1PDNC 1DGWA 2D93A 3GVAA 4Q0PA 4FAGA 4YNIA 2D2WA 4JQFA 1LEAA 2MH2A 3J7AO 3MPBA 2H27A 4WK8F 3M1EA 3M3IA 2ZXJA 2JRTA 5JI6A 3AAFA 4F8AA 3HSFA 3KLOA 1FOKA 2PMUA 1ZG1A 2BGCA 4HDUA 3H50A 4QLCU 1J2XA 2H0VA 4A0XA 3ZMVA 2KRFA 4HF2A 3HIFA 2GA2A 3SZPA 4A0ZA 2MPFA 3I5UA 4IEWA 5CVUA 2P7VB 3ROUA 5KK1A 5ILVA 3KCCA 1MD0A 2E1NA 1RGSA 2CYYA 3JAMK 1LJ9A 4CICA 2WWYA 2CGPA 3L09A 3IWFA 2HQNA 4GCVA 5KHIA 4OINF 5E16A 3F3XA 3RI4A 1ZHFA 1EP0A 1KU9A 1YTYA 2PAKA 4WBBA 2RKHA 2EA4A 4KICA 3C18A 1DDNA 3R61A 2ETHA 2K4BA 4HBLA 5FPZA 4O9GA 5FPXA 2XAHA 5I8SA 3F22A 1RNLA 4IPAA 3SHFA 3FFQA 3SXWA 2ZBKA 3OD0A 2FMYA 1SFXA 5LRSA 3L2HA 1OMIA 2A5YB 1EV7A 5AVPA 3GXOA 3D0JA 3ISPA 4O6JA 5L3FA 3WTVC 4X6RB 2RN7A 4AIJA 2HKOA 1NXMA 1R5GA 3U2RA 1T2KA 5BXXA 1BI0A 2P17A 4Q0VA 2STTA 4PDKA 4NB5A 2IXIA 2IP2A 5CVIA 2C0ZA 4U0YA 3UKNA 4HLYA 2XLGA 1Z1DA 4Q0SA 3BP8A 1W7PD 4A6EA 2FBHA 5F1RA 2VOOA 4JTNA 1CAUB 2QLZA 3LAGA 1BN5A 2CQKA 2LNBA 3QAHA 4ETSA 3KP4A 2GC1A 4UXNA 2Z69A 4AIHA 4ESFA 2Y0OA 2IA2A 1SD4A 1HSJA 1TTYA 4QGNA 4N0BA 3E3VA 3DFGA 3NQOA 4KWLA 4HX7A 5FCCA 4XF9A 5DD4A 4QM9A 1EH6A 3NL1A 2NYXA 4YG2F 3LZZA 2D40A 4EVIA 1FZPB 2HYGD 4YARA 5KVRA 3GWZA 3U10A 1CF7B 3SCHA 4PIYA 1BIBA 2O61A 2K02A 1QQIA 4RB0A 3RYRA 3LOIA 3ELNA 2QBYB 3ML6A 1EPZA 1X8EA 3F6OA 2FSWA 2B0LA 1YYVA 2QQBA 3K69A 1U5TB 4XF0A 1FSHA 4EQQA 3J81K 1ZG3A 2NS0A 3HRSA 3RPQA 1QZYA 3GYDA 2Q4SA 4GGGA 1V70A 1ZRCA 4ONUA 2UXXA 5LHGA 5H6QA 4WVZA 1Q3EA 2IA1A 3IL2A 4O5VA 2MLKA 3HRTA 3GF2A 3EDPA 4A0YA 1S8NA 3MEXA 3QACA 3FZVA 1KQ8A 4L9TA 1J3PA 5ICFA 1DPRA 5CADA 4I7HA 3N4MA 2M30A 1RTVA 4LLOA 4BXUA 3WG9A 1FP2A 4XRFA 1SD5A 2ZNYA 2VQAA 1LR5A 2CV6A 1I1SA 1Q1HA 1O7LA 1O57A 3B02A 3MWMA 4UUVA 3BJOA 5K5QA 1X7NA 4M9SA 4BIFA 4L5JA 2ACJA 5D8KB 4LUKA 3NRVA 3LA2A 4HN1A 5TRDA 4EJOA 1QGPA 4AXOA 3H3ZA 1KU3A 4BHPA 2HYFA 3HHGA 1USSA 5CU1A 3ZN1A 2L02A 3HYIA 2OD5A 5D5VB 1HSTA 2XAFA 4EWAA 2A6EF 1BC7C 4L18B 3FMQA 3SZTA 1IN5A 4HVQA 4Q0UA 3IC7A 1V3FA 5BPDA 1KU2A 3KP6A 3NVCA 4U88A 3FM3A 3HT2A 3PNAA 4CO8A 3O3KA 1R58A 2XKPA 2F5FA 3IRQA 4M72A 1CAWA 1R5HA 2KIUA 2PTMA 3MCZA 4OIQF 2OZJA 3KEOA 2GIVA 2V09A 3FE5A 3H8UA 3H9AA 3DN7A 5KBFA 3WTUC 4MGRA 2G7HA 2FMLA 5CVRA 1ZLKA 2ZKZA 3OTFA 1YIOA 1F5TA 2GZWA 1J5YA 5TJJA 4XFBA 4KIGA 4IEXA 4K8FA 3RZZA 1MKMA 1D8KA 2C6YA 3IKVA 2FRHA 1O3QA 4R52A 4XFIA 2WC2A 4KWKA 1CGPA 1T0FA 4LG0B 3SCGA 3ULQB 4IHTA 1SEFA 4I09A 4IRHA 5FD6A 2D5HA 4IRGA 2DCTA 2XKOA 1HXDA 4CYDA 3PFIA 2EB7A 2RV8A 1X8MA 1IN7A 2QWWA 5AIQA 3QP5A 4EJVA 2K86A 3WTXC 2GC3A 2RDPA 3HOSA 5FDBA 3CUQB 4RB2C 4OU0A 4ZYGA 1J58A 1GHCA 4IESA 5BOXA 4Q48A 2VBZA 3CUQC 1ZH5A 2AXLA 2EJRA 3EBRA 2VBYA 1YS7A 5ICEA 3KMHA 3I4PA 3O6BB 4AWXB 3F8BA 2QUFA 4M9XA 2CWEA 3RDIA 1JUHA 1FWZA 3WTZA 3BPZA 5DYMA 1K6OA 2HTSA 2PJPA 5I91A 5L3BA 1P92A 3TQNA 3U9GA 2I45A 4BYYA 3Q5FA 4Y13A 5JAXA 4WF2A 1WKMA 2A6HF 1BJAA 1HKSA 1O3RA 1XSXA 3BY6A 3NEUA 2P4WA 2F5CA 4S04A 4OLLA 4Z2YA 5E18F 2N7GA 4EWDA 1V4RA 2ESNA 5I0TA 3HQXA 5T3NA 2L4AA 3ZMDA 4ON0A 3F8CA 3RNSA 5CYVA 2VONA 4HSJA 3EETA 1K78A 1RC6A 2XUBA 3MYXA 3WW1A 5LEKA 4HX4A 4CXFA 1ZZ6A 2HGCA 1UIJA 2VODA 2M5WA 4EJUA 4QGMA 5JSOA 3P7NA 1U3EM 2J5OA 4LMYA 2FQ3A 3KGZA 3U11A 5DV5A 5E1ZB 2MC3A 1FSEA 3JTHA 1R23A 2V9VA 4IERA 4I2OA 1Z05A 2Z99A 3RKWA 4G6QA 3TO9A 1O5UA 4MH0E 1Z91A 3C3VA 1YWKA 4EWEA 5A2QK 2QVSB 3QP6A 2KIFA 1GQGA 5BPXA 4MGYE 1XD7A 4MUVA 4MX3A 2E9QA 1CAVA 5H20A 1SAXA 1J59A 3GFJA 4BH9A 3E6BA 2MD5A 1FY7A 2ZO4A 2D45A 2VE8A 4MQVA 2LKPA 5JHUA 5HLGA 3RJPA 2V1DA 1D3YA 5HS9A 3JZVA 2GU9A 4LK0F 5EEGA 4IEQA 1TQIA 3TNPB 3DXJF 3PVBB 3BROA 1YFXA 1NHAA 2VE9A 1WSUA 4ENNA 1R22A 5D6FA 1W7PA 5DCMB 2DO7A 3LQRA 1LB2A 1P4XA 2UZKA 2EV5A 1FYLA 4JTOA 4HV5A 2KKOA 3ZN0A 5FLJA 5JR3A 1LDDA 1XGSA 1D8JA 2E7WA 5DDGA 2Y75A 2BNOA 1UCRA 4XSXF 2UYBA 1KU7A 5KHHA 4EM2A 3C3WA 4HF0A 1OI6A 2PN6A 3QOPA 4HOBA 1U12A 4K2EA 2ZMEA 5JSPA 1ZZCA 1XDUA 3NKTA 1PP8F 4YIIA 5E20A 1R1UA 1H0MA 4HVOA 2K0GA 2VC0A 1TNTA 3WU0A 4E2GA 4MHGA 3ZMZA 2EFWA 3EYIA 4QX5A 2EFOA 1OKRA 1XN7A 3ZDSA 4HQMA 3U0ZA 2L4MA 3G73A 2WTEA 2PHDA 1R36A 2ELHA 1U8RA 3ES1A 4NQWA 4L9JA 2JSCA 3ZQ7A 1YW9A 5D6EA 2DQRA 4MGIE 1E2XA 3VODA 2KJCA 4RB1A 4D7TA 3J80Z 1OYIA 4MEXF 3JTGA 5BY5A 2OA2A 4KU8A 2P6SA 4HDVA 1VR3A 4GXOA 4OIRF 1YG2A 1TQ5A 2XHKA 2D5FA 4ZZDA 1I6XA 1Z7UA 3T5XA 5D1IA 1QO0D 1EH8A 3F8MA 1TNSA 2UY8A 4Q47A 1G3TA 3HRUA 1ZGAA 4UVCA 3ABTA 3BB6A 2GH2A 2ESHA 5BPIA 5JSRA 1G3SA 4KIBA 4FX4A 1JXSA 3IDBB 5FQ0A 2KJBA 3RPUA 3TO7A 3JW4A 5C6CA 5FLIA 2QVOA 4LLGF 4OMYA 5K5RA 1BC8C 1NYWA 1X82A 4MGKE 1S7OA 4N9IA 1QXJA 2K9ZA 2ISYA 1T6SA 3GUDA 2VN2A 5LEJA 4XSZF 4EGYA 3HRMA 3MZYA 2P5LC 3WE3A 4WXCA 1S29A 3KP2A 2HJIA 5IT9K 2Q1ZB 4YFNF 2MA3A 3WGGA 4ZU5A 1TBXA 1ZAOA 3W6KB 5J8FA 2ATFA 4CHUA 3OV8A 4ENJA 4EM1A 2PLYA 4WX9A 3V7CA 1T38A 4Q0QA 2O6GE 5ILUA 1LDKB 3ES4A 2HEOA 4M9ZA 4B8XA 1W5TA 4A6DA 2DK8A 3Q9SA 4KNYA 2XL9A 2DI3A 1CAXA 5FB2A 4BHBA 4FT8A 1F4KA 1R00A 3IKTA 1J7KA 3I58A 3SQNA 2HR3A 4PZJA 1OD5A 2DW4A 2VBXA 3VHRA 3L7WA 1ZX5A 3J80K 2DPUA 4LA3A 3BJAA 3EJKA 4UHTA 1ZRFA 1IW7F 5D4SA 4JBAA 1J1LA 4KU7A 1BBYA 5DEQA 1XRUA 4BNCA 5BQTA 5FLHA 4PCQA 3KSCA 4G7OF 2P7CB 3KFWX 4OOIA 3IBMA 4U7BA 3MDPA 4P9FA 2DFIA 2UXNA 4ZYHA 2ET7A 2OZUA 5LGNA 5IT3A 2Z33A 3IRRA 3RKXA 2VPVA 1CAWB 3QPHA 3BU7A 2YX7A 2O8XA 5BUVA 2FA5A 4I0BA 4FX0A 3S7EA 2K7LA 4BAYA 2IXCA 3I0TA 5HI0A 2EA2A 3WW4A 1RI7A 4XFAA 1XE8A 3GFMA 1FX7A 1ZVFA 2ADUA 1XCVA 3DPTA 4U0WA 4KFCA 4Y17A 4RD7A 3CTAA 2VOPA 4L5IA 2J5PA 3L2CA 2DPDA 3FMRA 2ZJ2A 3TDUC 4L0YB 1QZZA 4NVPA 3BWGA 4RAYA 4RGUA 6PAXA 3CDHA 1FBSA 2OQRA 2XL7A 2TDXA 4UNOA 2W57A 1XB4A 2L54A 4IEUA 2XVCA 4ZH4F 3OOPA 3SCFA 1RUOA 2NRAC 5EZWA 1I1GA 2QM3A 1ZLJA 3RYKA 5HVQC 1YHFA 2DU9A 4ZYEA 1BI3A 1EY2A 2QZ8A 4M73A 2UWMA 2R7DA 2QQAA 1YLLA 3I64A 4E2SA 2FQPA 3G3ZA 2FEZA 1GQHA 2LSOA 5HS7A 4GULA 4IHSA 5EEHA 1Y0UA 1TQPA 2PQQA 3FX3A 2YSRA 1O3TA 1P4AA 3C1DA 3D0SA 4ZU4A 4HLTA 2ZKLA 1REPC 2Q2EA 3LA3A 3IHUA 4KN4X 3WTWC 3DF8A 4MQ9F 4IRIA 2GA1A 1EYBA 2PHLA 1K78B 1C0WA 2EWNA 4LK1F 2EV6A 1Q5OA 4WZCA 4I98B 1MJBA 3K1MA 1H1MA 1G4DA 4YSFA 4KUMA 2O3FA 5HDGA 4YYOA 1O5LA 3ERED 3USSA 3TNQA 3ST7A 3BCWA 4HVRA 4QGLA 1E17A 3G7DA 4GO1A 3WGHA 1H9GA 2BV6A 1SFEA 2FF4A 3WTYC 4KYWA 2A07F 3GBFA 3PLQA 1Z6TA 5CLSA 1XMKA 2CSOA 4GYGA 5E8GA 2RNJA 4G9YA 2HWVA 1CF7A 1Y9QA 3CO6C 4U7DA 2PAEA 3EQLF 3F23A 3DQVC 1CAVB 3HT1A 3OF1A 1WA4A 4LA2A 3RIRA 2BE5F 3V8LA 2IW5A 1U5TA 4IEPA 4BQAA 1SD6A 1SD7A 1G3WA 1A04A 1YUDA 4M6YA 5E1XA 4QXKA 2Q0OA 4LLLA 2UY9A 2W84A 3I59A 3KLNA 3VFZA 5L3EA 1O3SA 1DZTA 3WGIA 1J3RA 4YFKF 5HLHA 4Q29A 4Y15A 3DEUA 5KHKA 4A12A 4P9UA 1FNNA 5LHIA 2V1XA 2Z5UA 1XE7A 2NNYA 1QWRA 1QPMA 1UIKA 1TQMA 2D1HA 4Z82A 4TLFA 1FBUA 1W7PB 2YU3A 1BI1A 3ECHA 4M74A 3BPVA 3EQEA 4PJYA 1S3JA 3EUHA 4UBHA 1I27A 1IXSB 3E5UA 1MJAA 2XAQA 3TOAA 4WCGA 4G8XA 3KP7A 1R1VA 1VP6A 1FLIA 4L11A 4PIXA 1MDMA 4I0AA 3SMHA 2ZMEB 1BI2A 2LF7A 1WLTA 4AD9A 1RUNA 2IA0A 4N9HA 3H92A 1XDSA 5H6RA 3I54A 3E5XA 2VECA 1FC3A 2HKXA 1OPCA 4O3MA 4L2NA 2B8MA 2DAOA 1KA8A 2RC4A 1JE8A 3HSEA 1KQ9A 2IXHA 2O1QA 2H6BA 3V8KA 3BJ6A 1WWXA 2COMA 4L9VA 5LLQA 3TOBA 3V4GA 3GZ5A 2XV4S 2A3SA 4ENKA 1YW8A 2MBFA 1XGOA 4LUMA 1QNTA 4G7ZF 4XLPF 4XF4A 2FNAA 4YFXF 3T8TA 2FOKA 1WI9A 1HQCA 2EFQA 2FXAA 2PFBA 4JK1X 5E1WA 2XAJA 4G94A 4CGZA 1G6NA 1W4MA 3BDDA 2P8TA 3RKYA 4UV9A 2GQQA 5JR7B 3RTRA 3KE2A 4M6XA 4AVAA 2CFXA 3R6SA 1AOYA 1BOAA 1GXPA 4XFCA 4IETA 3BZ6A 4ESJA 2X4HA 3MAJA 3C7JA 5FQ0B 2PFWA 1DGRA 2Q30A 4J1XA 3VB2A 1UB9A 2V1UA 4KA4A 1W5SA 2RGVA 5CVJA 3LA7A 4HAMA 1IPJA 1RL3A 1T39A 5F64A 4WXDA 1L0OC 1UW8A 2BNMA 1UD1A 2QDRA 1GVJA 2FBKA 2OPKA 1YFHA 1J0RA 4HLXA 3T0YA 1UHWA 1Q43A 2W24A 3TGNA 2PI0A 3KGLA 3KZYA 1YO5C 4LJZF 1YLFA 4I3PA 1PM7A 5FD5A 2OU2A 3QU6A 1X3UA 4LD5A 1HKQA 3F6VA 5FFXA 2JZYA 2GC0A 3FWEA 1PMIA 1JGSA 3E5QA 4HX8A 5KHGA 1IN6A 1AWCA 2E7XA 4IXAA 2DK5A 1VTNC 2WFPA 3O2PE 3JSOA 3JAMZ 2Z2SB 2OBPA 4PGGA 2OYZA 4LB6B 1ON1A 5K8SA 3K1NA 5E1RA 5I8YA 4KT5C 1CAXB 4EMSA 2V79A 3M70A 1U2WA 1KYWA 4EGZA 3L00A 3CLOA 1H9TA 4ASNA 4UV8A 2H94A 2DLLA 2HDCA 1RIOH 1IF1A 3SHRA 4L9NA 2D1VA 2IPQX 4HN0A 3V7SA 3CO7C 5HDNA 1IN4A 2F4PA 4QM8A 4D0PA 4DINB 4ZU7A 1FXZA 1Y3TA 1B59A 3H1WA 2MHFA 4LGWA 2P6TA 3QRFF 5BMZA 1BM9A 1OYYA 3H1YA 2NNNA 3OGJA 3TDZC 4XEZA 2IXLA 4QMAA 2CW0F 4I02A 1ZREA 4HV6A 1TW3A 2DTRA 2ZNZA 5J8CA 3DPLC 3ZMTA 3CLPA 5C8WA 1IZ1A 4P96A 4AQ2A 4P9GA 1FYKA 1B4AA 3V8JA 1G3YA 1ZZ7A 3ZPLA 4U0VA 5F6FA 2K27A 3FXRA 3K9TA 4IEZA 2GXGA 1IRFA 2QYOA 2EK5A 3DV8A 5BV6A 3CL1A 3BALA 1LKNA 3REOA 1LNWA 4CZZA 3FXUA 2VBWA 1YQAA 4KMUX 1ZGJA 1MZBA 1SFNA 5AONA 4ZZLA 2Y0MA 2Z9OA 1UFMA 2QQ9A 3ZP5A 3WE2A 1KYZA 1S7AA 3BOQA 5D8LB 1QY4A 1UHMA 1P2FA 3T8RA 3HSRA 1TLHB 2HTJA 1O7FA 5D4RA 2GWRA 5J3UA 1XGNA 5DCMA 3BPXA 3LWFA 1L3JA 4CDGA 1T98A 3J81Z 1YFUA 3LAPA 4MGZE 1LVAA 2M87A 1FT9A 2EAAA 3E6MA 2A68F 4EJTA 1YFYA 4IVNA 5CJ9A 5I0SA 3QPTA 1LRHA 4LTAA 3OCPA 4JV4A 2STWA 2P5KA 2XASA 2LDUA 2EA7A 2QNKA 2XLAA 4R1HA 3TKYA 2FU4A 1H1IA 3ACLA 4XF3A 4L0ZB 1J3QA 3LAJA 1Z9CA 1QXRA 3CO2A 3K2ZA 5JCTA 5D5XB 3GFIA 4Z07A 1ZRDA 1UPIA 1FYMA 2DBBA 5LGTA 2JT1A 2ZCWA 1HBXG 1LQ1A 3NW4A 1IRGA 2G9WA 5KHJA 1EH7A 3I7DA 2IXJA 1B1BA 4AQ6A 2HOEA 2OAZA 1ZZ9A 2VC1A 2HZTA 2EFNA 1USTA 2PMHA 1D5VA 3WU1B 2QCSB 3GFLA 5D5WB 1ZZBA 2L3DA 2EVXA 2HFHA 5EFUA 2O0YA 4Q4ZF 2Y48A 4P5OA 1XGMA 1NE4A 1B9MA 1CX4A 3R4KA 2DT5A 1OYWA 3CF6E 3K0LA 3COAC 4HZFA 3UKTA 3N97A 4OIOF 3WW2A 2NAZA 3FHIB 4UVAA 4OIPF 4BHCA 1B9NA 2WV0A 2E1CA 3FF5A 3MZHA 4MZUA 4XETA 2IRFG 3DP7A 4FAHA 3CUOA 4EM0B 3GX4X 3H7YA 3JSPA 3RYPA 1P6RA 3P9IA 3S0MA 1OR7A 3P9CA 3NSTA 1U5TC 4Q5SF 2O03A 2XROA 1IN8A 3DKWA 3I59B 3ZMUA 2Q0AA 5ICCA 3FHZA 5K1YA 2W25A 5HLIA 2H09A 4EJWA 4XLNF 2IT0A 1MJ9A 4META 2B5HA 2UYAA 2ETEA 1IXRC 1Z6RA 2PAMA 1SMYF 4MV2A 5FFZA 5E17F 5J48A 1LEBA 1IPKA 2G7UA 2CAVA 2QJVA 3I71A 4IEVA 3HUGA 1HW1A 3MFKA 4E2QA 1B6AA 1FP1D 4HBNA 4DNCA 2W85A 4MTDA 3NJZA 2PBIA 4ORFA 3LWCA 2GXBA 3LFKA 3PQKA 4RAZA 5JFRA 3GZ6A 1MDMB 3FJSA 1KQ0A 4XFGA 4GYIA 2RQPA 4LULA 4RB3C 4KMFA 2F2EA 2CAUA 4KL1A 2MH9A 4F7ZA 2JTVA 5ERIA 3WTSC 1FI2A 3ZMSA 5ILSA 1ZN2A 2B9UA 4DQ2A 4MTEA 1R1TA 4KIFA 1TW2A 3KP3A 1IXCA 4EV0A 3VEPA 1CAUA 2XIGA 3EYYA 3L9FA 3Q9VA 3F72A 3IWZA 5I0UA 1STZA 2BBYA 4LFUA 2KIMA 3E6DA 4UVBA 2CG4A 4HF1A 1QBJA 1U6GA 3GO5A 2ET1A 3FMSA 4LB5A 4XFFA 1ONVA 3E97A 1O4TA 3GW2A 1ULYA 3R0AA 2BEOA 4UBGA 3SXYA 2A69F 4EROA 5HS8A 2V6CA 1YW7A 2IC1A 5FGMA 4KWJA 2XAGA 2QBYA 4M71A 1S6LA 3P9KA 1L3LA 4HW0A 2PEXA 3FXQA 3U1DA 2M45A 2EFPA 4IEOA 2X0LA 3FZ3A 2YX4A 4AVPA 1GXQA 2FBIA 3S7IA 2LF8A 5ED4A 2DQLA 4J1WA 2QENA 4RGXA 4RGSA 3EHKA 1ZARA 5K5OA 2CO5A 1ODDA 3HTSB 4QWQA 5I8TA 4KN7X 4I01A 1KGSA 2PA7A 5CVVA 5A2QZ 3F8NA 3KZZA 2PG4A 1BIAA 3ABUA 1DZRA 3FM5A 1HW2A 2H6CA 4HA8A 2OZ6A 3V7RA 3HTUA 1IUYA 4HMZA 3HOTA 1ZYRF 5BS6A 3F21A 3M8FA 4LLNA 2XRNA 4HQEA 4G7HF 1XMAA 4FBFA 1YFWA 4FHTA 2IJLA 3M8EA 3B73A 2M1BA 3HHHA 4AVBA 1UCXA 5LHHA 2VXZA 2BYVE 1F1ZA 4H7LA 5L3GA 1JHHA 2R7FA 3R60A 3ECOA 5J7MA 1LDJA 3KETA 2OQGA 1XCBA 1R7JA 4R79A 1F9NA 3TO6A 4ZYDA 4KDPA 3W6JB 3ETQA 2IVMA 3GLXA 1VJ2A 4A5NA 1SFUA 1MGTA 5I0RA 2XGXA 2M8EA 3UKVA 4A5MA 1I5ZA 3ELKA 3PQJA 4OFGA 1RZ4A 5DD8A
chains in the Genus database with same CATH superfamily
3HPNA 3T1BA 1PK6A 4BDZA 4NE9A 4LEJA 4XDQA 1B72A 1SFKA 5FP7A 1J75A 2VCAA 1RR8C 1XPWA 3QU3A 4A3EJ 2JIGA 2K4JA 5HOOA 1OH3A 1RUF2 1LENA 2ADEA 5GLTA 2BHZA 2HS5A 4OQ9A 1DGRN 2V4VA 3ZPYA 4FP2A 5F3EA 4BE3A 3FXLA 3H0GJ 3M1HA 3RI9A 3WG2A 2VT2A 5G04L 1X2MA 4WXHA 1G7YA 3M7GA 5BNOA 4LG0A 3H3VK 3DBHB 3FHQA 3VL9A 1E5HA 4E70A 2IXKA 2Q5TA 3W20A 1YIPA 3IM0A 5FYUA 2IGOA 1QJX3 3DL3A 1M4WA 2V6EA 3MIDA 2VI6A 5I93A 4NOTA 1NCQB 4B29A 3WTTC 1ETWA 1NCQC 1QJFA 3EO6A 4G12A 3UYJA 1WGPA 4R9AA 3WHBA 3K2AA 2BJSA 4TV7A 4PHZA 5AIPA 2VW0A 1XSDA 3C2HA 4DB5A 5IJRA 1VRH3 1OFNA 4Q4W1 4CCEA 1X50A 5EWSA 5FYTA 2FDFA 2XLFA 4BBRJ 1NE6A 1UG2A 1HXS3 3FXJA 3R0JA 4AFBA 5J6XA 1WBLA 5FZLA 4J00A 2VKDA 3KVAA 1IZ3A 4NHKA 3VBRA 1W5CC 1FNYA 3WDXA 3HN1A 3PJRA 1SQ4A 3H1MA 5FZ4A 4ZHNA 5IT9Z 4PDWB 3D82A 4JX5A 1QJU3 4IF4A 2XBO1 3K70C 3N9NA 4PGHA 3KCYA 4PDWC 4Z1VA 2WWUA 2KL4A 3ZYPA 1VZ0A 4YGEA 2IEKA 2O8QA 2JWTA 3WG1A 3S2WA 4B4PA 1GANA 2GMMA 3VBSB 5IAXA 2FE3A 3L2WA 1FPQA 4M3BA 1Y43B 3VBSC 4EJRA 3OYLA 1LGNA 3CEWA 5FKCA 3F95A 4RS8A 2AZ5A 4HPQA 2NPIA 4CUCA 3KCXA 4AVVA 2JVGA 2R041 2L01A 1XB9A 4AG4A 1WRJA 5DZGA 2WO1A 5FLXK 1XU2A 5A3PA 4LE3A 2HWF2 4FASD 2VMFA 4M6VA 3M3OA 3S5AA 4D3WA 1PDNC 1OA3A 4QHZA 4AFAA 4D1QA 5GLUA 3KT4A 3BVCA 1BXHA 3ZQIA 5IK8A 4L0PA 1N1YA 2MH2A 2J1EA 4C90A 4AOCA 1TME3 3M3IA 1ZR2A 5JI6A 5IWFA 3HSFA 2C4XA 3VKNA 3KLOA 3OMYA 1ZG1A 4CCJA 1V54H 1F2NA 3U1KA 2H0VA 4A0XA 4CCCA 4ZDLA 4AVSA 4UYBA 3OS2A 4HF2A 5GM0A 3SZPA 3V0BB 2ZSHB 1NY72 3ROUA 5KK1A 3JRAA 3BCAA 4UW4A 5ILVA 3KCCA 1MD0A 3RZJA 5IOZA 5IVFA 2E1NA 1OR7C 2WWYA 4CICA 3H3LA 3L09A 3BTZA 1QJZA 1XNCA 5E16A 3UNPA 3WLUA 4Y7NJ 3ZXLA 1BMV1 1IS4A 2BWCA 1KU9A 3A7QA 2JG8B 4KICA 3R61A 3LPGA 2JG8C 3LSKA 5DM7F 2BZTA 4G6TB 5GZGA 3F22A 2JKBA 3PNVA 3SXWA 4Q5OA 4CP0A 3OD0A 2FMYA 1SFXA 5LRSA 4BLIA 1UELB 2DODA 4HEA2 4BBSJ 4KMQA 1HB4A 5L3FA 3OGSA 4AHWA 2CDPA 3WTVC 1IQAA 2RN7A 5IPAA 4AIJA 1D7PM 3CCMI 4QU2A 1R5GA 2IUWA 5BXXA 4PDKA 4XUQA 2Q2EB 5LA0A 3D6EA 3I2DA 2G19A 1FPN3 3L2VA 3V42A 2XLGA 2CTVA 4PLOA 3O1UA 5FZ3A 5F7UA 1PUFB 3U78A 4JTNA 2WLQA 1CAUB 2QLZA 3WX5A 1BN5A 2LNBA 3QAHA 2ID3A 2Z69A 4AIHA 1IDYA 3MO4A 3CZJA 2IA2A 1HSJA 1TTYA 2WR9A 2WNUB 3E3VA 2RR12 4KWLA 2CGOA 4JDNA 2QF7A 4JDMA 5A6QA 4JGYA 1S0FA 3NL1A 2R0HA 2VPLA 3LZZA 4EVIA 1OQYA 5KVRA 4E7JA 2JE8A 2HWD2 3GWZA 3FLRA 1CF7B 4PIYA 4DPNA 1MH4A 2O61A 3HNYM 1UWWA 1EPZA 1X8EA 3DYPA 2AXTC 2DJNA 1W9TA 4OVEA 3F6OA 3VZKA 5IVYA 3OYHA 3K69A 2NOJB 3WNNA 2VULA 3VZMA 3Q8BA 3UT0A 3J81K 5EEAA 1R091 4TTGA 1ZG3A 1NUKA 1WCQA 2J1VA 3HRSA 1UX7A 1SCRA 1Z0XA 3K4NA 3IZOA 4MVTA 4XKCA 2YPJA 2DYCA 4ONUA 1J09A 5FOJB 1X19A 5LY2A 3UR3C 3O0VA 2V4AA 1KDMA 4Y20B 1WW6A 4O5VA 3HRTA 5J1XA 3GF2A 3MEXA 3AMPA 3QACA 4F3JA 3FBYA 5ICFA 4RFRB 4YZ3A 4I7HA 3OPWA 4NPLA 1RTVA 3BG6A 4JYKA 1H0BA 3L9JT 3T2QA 1QQP1 2CV6A 4TWTA 4A45A 5GLWA 2L9RA 3OYFA 3FUOA 1GZWB 1VBB2 3MWMA 5KCMA 2PHWA 4M9SA 4G9SB 3AM2A 3ZDVA 4DFSA 4L5JA 4QU1A 3ZFFA 3AYDA 3A01B 3NRVA 3A0HC 2VQTA 4EJOA 2WNVB 2R061 2VD7A 1X33A 3VD5A 2WNVC 3JD71 1JZ3A 5F6KA 2MEV3 3B94A 5CFDA 1PJRA 5F8PA 2X5IA 3JBG3 5GPCA 3M3CA 2Q8OA 3W5MA 2OD5A 2RS13 3A03A 4Y5Z0 4L18B 3FMQA 4RBOA 4HVQA 4Q0UA 3WG3A 4RLQA 2HWB1 5C9AC 2LR8A 1E3PA 1KU2A 4CYCA 4IV3A 4U88A 3PNAA 3W5NA 2K46A 1W90A 2C5DA 4CO8A 3JRGA 5JWPA 2K40A 3KV6A 2XKPA 1R5HA 2W1UA 2ZC2A 2KIUA 4DJAA 1GOFA 2PTMA 2OZJA 3QOEA 1QA6A 1J83A 2RVAA 5IYDJ 2YBSA 2V09A 2I10A 4MGRA 1QPIA 5B66C 4PT6A 4NUBA 2K2SA 4RS5B 2GZWA 3K3NA 2ZGMA 4K8FA 1X1BA 4HNUA 2IGNA 2FRHA 4XFIA 5GPAA 2WABA 3H9JA 1SEFA 4CE8A 3WNXA 4IRGA 1F8VA 2XKOA 4CYDA 5KC6A 4B4RA 2QWWA 5AIQA 2VZ3A 4EJVA 2K86A 4M3GA 5FTTC 4DXTA 1IG3A 4W97A 2C9KA 2CWSA 3B9CA 4OMDA 1V9U1 1WJFA 1YI9A 2GNDA 3ABKH 3MZ8A 4RSUA 2AXLA 2DMTA 5FLVA 2VBYA 2YZ4A 1ASJ1 1JJ8C 4PSXA 1UYZA 1OC1A 2NVXJ 1JUHA 1G2HA 1K5MA 4D9JA 3D5SC 3HWJA 3TQNA 3U9GA 3MLKA 2KRHA 3A4CA 4IUGA 3K4MA 4E7ZA 2RS31 5E3MA 4CCKA 2ECBA 2XUEA 4LBQB 1JZ2A 3NEUA 1AR72 2P4WA 4OLLA 5E18F 2EZHA 2HWC1 4EWDA 1W8OA 5E89A 1DLLA 2CV1A 3F8CA 2A5ZA 4QX2A 1RC6A 3ALQA 3ASIA 3MD2A 3WW1A 1GOGA 5ISLA 1VBC2 5IUQA 3KHBA 2LH9A 1UIJA 3W58A 4S2GA 5J40A 1UMZA 5JSOA 3P7NA 1FTTA 1HF0A 2J5OA 4LMYA 2AO9A 2FQ3A 4UFJA 1NK3P 1CPNA 3OYAA 1FSEA 2ZXWH 1XYNA 2Z99A 1PO23 2WB1A 1L7LA 1WH7A 1E0EA 1NA1A 5FZCA 1P7IA 3MKYB 4ITVA 3QP6A 2KIFA 1GQGA 1YC61 2MG4A 4XLAA 5BPXA 1JUPA 4RA2A 4ASMB 2WBKA 2E9QA 1MSFC 3H42B 5FUPA 4BH9A 3S16J 1FY7A 2D45A 5M5WJ 4MQVA 5JHUA 3TW7A 4FTSA 4AFCA 5EEGA 4BXSV 3JRIA 3TNPB 3DXJF 3PVBB 1YFXA 2TBVA 1PGSA 2OV7A 3I2KA 1FMD3 5KXCA 1NHAA 4LNVA 5T52A 4QQLA 1W7PA 3LQRA 4W50A 1LB2A 1NCRA 3R0RA 2JDAA 4RYDA 1CIWA 2K85A 4HV5A 1VAVA 5JR3A 1LDDA 5DDJ3 1SBDA 4IE5A 1JYWA 3FXMA 4A3XA 5CIRA 4XTPA 3OYIA 3I55I 1VAMA 5KHHA 2K9MA 3JUUA 1R4MB 3RZOJ 3LSDA 2OQ6A 3IP4B 4KG0A 1R1UA 1KONA 1H0MA 3ATGA 2EF6A 4AEKA 1TNTA 3WU0A 3B9IA 4FFGA 3ZMZA 1MEC1 4RHV1 2EFWA 4XYXA 3EYIA 2QDNA 1LPQA 3LSMA 4QB2A 2Z79A 4FOWA 2WTEA 4FSJA 1CPMA 4FXGB 2ELHA 1YRNB 2WQ8A 4NQWA 1Z0HA 3PU8A 4L9JA 2FOWA 3QYBA 5D6EA 1Q1VA 1R083 2QE3A 2JA8J 4O65A 1OYIA 1DFQA 1RUI2 2NVUB 2OA2A 5DAPA 2C24A 3K2OA 2P6SA 4QAWA 1BEV1 3JQXA 2R5ZB 1VR3A 3SLIA 1I6XA 4NIAA 5D1IA 1QO0D 4ZS3A 4EN6B 1G3TA 2E1MC 3HRUA 3WQ7A 3CCUI 1W04A 5C7GA 3RPUA 3TO7A 3QWLA 5FLIA 4OMYA 1BC8C 4DEQA 3SJMA 3PVNA 1QXJA 3U1XA 4EGYA 1MS9A 4W65A 1AR81 2WFF1 3HGYA 1W8HA 3RVHA 5A6XA 1AUYA 2Q1ZB 2VQLA 2MA3A 2TEPA 3OR1C 3OOUA 2X10A 1R64A 4CHUA 4FPJA 1QHGA 1A36A 4NO4A 2OW4A 4EM1A 4R9BA 2VVEA 1T38A 4AQTA 4Q0QA 3L2RA 1OA4A 5HCAA 4B8XA 1W5TA 3Q9SA 2VZVA 1QH7A 3HBKA 5FB2A 2MYSA 3I9V2 1WCDJ 4YEJA 5IK7A 5HPOA 2JENA 3DPRA 2D43A 1PMJX 4M0HA 3KX2A 3SH4A 3SQNA 1RUF3 2HR3A 1XNTA 2VBXA 4MGTA 1JI8A 4AI0A 1H6XA 1LEDA 2YYOA 1OA2A 2FZ2A 3PM1A 4LA3A 3VZOA 2OS2A 4EEFG 2VMGA 4K1ZA 4D5CA 5DEQA 5BQTA 2KDOA 2RMU3 3OS0A 4CDXB 4Q4X1 2W52A 1UZYA 1ULGA 4CDXC 1FV3A 4NIDA 1UZWA 3IBMA 4AI3A 3MVPA 2EH3A 1UY1A 2A73B 1JZ6A 2W1QA 1C1FA 4C8DA 5L9RA 5LGNA 4FOQA 4J01A 3IRRA 3RKXA 2VPVA 4RR3B 3OYWB 2Y6HA 3BU7A 4UB6C 2XF5A 4RR3C 3OYJA 2O8XA 2FA5A 1TL8A 4FX0A 3S7EA 4NNJA 3BI3A 3K7AJ 4BAYA 2IXCA 1CESA 4YLZA 3EXUA 3WW4A 3ZSLA 1SEUA 3JB4C 3KLSA 3AFGA 1IUFA 2WA0A 1MZ5A 3PTYA 2ADUA 1OCZH 1JJ6C 4XBNA 1SLLA 2DFEA 1F36A 4U0WA 1UNBA 4MGQA 4KFCA 4GKYA 2DURA 2PHUA 4V2GA 3VBUB 1APNA 4XR6A 3D5RC 2AC1A 3VBUC 1HCRA 5BNPB 3AJYA 4ASKA 5BNPC 3DEEA 3FMRA 5FYSA 4P14A 2WQZC 3ACGA 4RGAA 4B48A 3HL2A 3JRFA 1XB4A 2L54A 5A1LA 1UZ0A 2NRAC 5IAVA 1UU5A 2VJ4A 2QM3A 5M0TA 4MIMA 2ZX2A 3BQYA 4KBBA 3EB7A 2DU9A 2ZMNA 2B45X 3IAS2 2QZ8A 3OWTA 1EY2A 2KD7A 3NNFA 3GGLA 3DGTA 2QQAA 3I64A 3UL2A 2LSOA 5HS7A 2WJSA 4IHSA 4I0WB 5EQUA 1TQPA 5J09A 1FMWA 2UU8A 2RAEA 2HNHA 2EZKA 1ZBE2 3C7EA 3BT9A 3C1DA 3OIOA 5HXVA 1SCSA 2VUDA 5LA9A 1YXWA 4A6SA 1X4OA 5F1JA 1IV8A 2AEYA 2JDMA 4MQ9F 2ZGTA 1WKYA 3AZVA 2PHLA 1RYYA 1XMXA 1EAH2 3TOJA 1QOTA 1Q5OA 3N05A 1XC5A 1JN2P 1S1AA 4KUMA 2YMZA 5HDGA 3PO3J 1O5LA 4XUNA 3USSA 3TEYA 4DEVA 4Y5TA 4N53B 2CQQA 3ZYRA 3G7DA 4GO1A 2P3YA 3WGHA 2VNRA 4Y22B 3PUHA 1VQ7I 4IE4A 3NJVA 5F08A 2A07F 1Z6TA 2UUZA 2XB6C 1YJKA 1FIPA 4XC9A 3OPZA 4RQPB 1X1PA 4PJLA 1VQ5I 1EF4A 1H8TB 2CWMA 3OS1A 4RQPC 3OF1A 3OY8B 3LSJA 4QX1A 4Q4V2 4LA2A 2BE5F 4UF0B 3V8LA 4CDWC 1G3WA 1YUDA 5D8AB 3QH6A 2Q0OA 4XOTA 5D8AC 4YVSB 3M4FA 1O3SA 5F2SA 1RUC2 4YFKF 4Q29A 4YVSC 3DEUA 1NLSA 2GNBA 4A12A 3MIBA 1VQ6I 3BUCA 4BJTA 1TQMA 2F17A 4Z82A 3O8HA 4IGQA 5LW9A 5FIXA 2X48A 4NN0A 3HXLA 5IP6A 3NWTA 2WA3A 1GNHA 5FYMA 5F3IA 1IXSB 3PUQA 3E5UA 4JX6A 5CKQA 3POGA 3THTA 1VP6A 1H88C 1S0GA 3WHTA 1ZK8A 1U0AA 5E3OA 5E3NA 2O7OA 4AD9A 2YY1A 4UUSA 4B7KA 3AKRA 5BYNA 3E5XA 3L2UA 5M5XJ 2WINB 3FC0A 4K40A 1OPCA 1GBGA 1MMAA 3BTCA 1UL9A 1KA8A 2WB1N 4B8EA 1C3HA 1JE8A 4W8JA 3HSEA 3SEQA 5A33B 4JGZA 2COMA 4QPIA 5A7OA 2A3SA 2P6HA 4ENKA 2MBFA 1XGOA 2EINH 2FDGA 4LUMA 4XLPF 2FNAA 1QJY1 4YFXF 3MBWA 1MMDA 1HQCA 5ANNA 1JHJA 4D7NA 3WQBA 2PFBA 2L9LA 2WO7A 2Y69H 3RKYA 2V5YA 2VZUA 4NROA 4A3JJ 4C9YA 4GXLA 3AVSA 5FZDA 3THCA 5DUWA 3R6SA 1AOYA 1RMU3 4WVWA 4S2HA 3CU7A 4ESJA 4K9SA 3OSDA 4XLHA 5FQ0B 5L73A 1OQ1A 4Q4Y3 1UB9A 2V1UA 1VBB3 3AB0A 2VR4A 3IKWA 2RGVA 4A3FJ 1MBHA 1OLME 2J22A 3PSFA 4ANJA 1T39A 1JKOC 4YGBA 2QKDA 1L0OC 4IGOA 2VXJA 1GVJA 4N43A 2OF7A 3TGNA 2D6OX 3KZYA 1YLFA 4MO7A 5FD5A 3R4DB 2H0BA 1OFSA 3QU6A 1HKQA 2GC0A 3O1RA 3FWEA 1BW6A 3JRHA 1UU6A 3E5QA 4PCRA 5ACA1 4XQFA 4HX8A 5KHGA 4CP9A 3WR0A 3NNJA 3AJZA 1VTNC 4AC0A 2BBVA 2VUAA 2OYZA 3K1NA 3LFIA 1SDDB 4PF5A 2JECA 1JYCA 4XW3A 1LECA 5DG2A 2HWE1 4UV8A 1UX6A 4IXLA 2DLLA 2RDQA 2HDCA 4LBMA 4DNYA 4L9NA 4FQZA 3ZXJA 1SBEA 4HN0A 3V7SA 5HDNA 1YE9A 4QM8A 4D0PA 1VBD2 1F5JA 2Y34A 1W8FA 4BE1A 2WZPP 4ZU7A 3DPUA 2A3WA 1Y3TA 2MHFA 1HV0A 4LGWA 3CCEI 1VQPI 5A7SA 2DMQA 2UV1A 2XB5A 4LITA 3OBAA 1FOD2 4XEZA 1SFOJ 1Z7S2 1AL21 3FFZA 2WQ4A 3S5QA 2DTRA 5J8CA 3U07A 3HNMA 2NP0A 2ZX3A 3KV4A 5J37A 4RN5A 1FYKA 1B4AA 2DV9A 1COV1 1ZZ7A 2EZLA 4O7XA 2X53S 3ZPLA 3T4VA 2K27A 4IEZA 2GXGA 2VASA 5BV6A 4RGGA 1ODMA 1LKNA 5FYZA 4BY1J 4LHKA 1EA3A 5CFCB 5FO9B 4QD2A 3PVEA 2VBWA 4LXLA 2K9NA 4BEHB 3AMMA 1NCQA 1UG0A 1AR93 5AONA 3N9LA 2Y0MA 5IVBA 1AL0G 2QQ9A 1S7AA 1AR73 1UHMA 1LAJA 1RJ7A 4XMYA 2GN3A 3S3NA 1W99A 3LQCA 1I50J 3POIA 2VNOA 5J3UA 1XGNA 3B6CA 5K7HA 3BPXA 3HOUJ 4QQPA 5F0FA 4CPBD 1LNSA 3J81Z 3PSIA 1GP4A 4MGZE 2IS2A 1LVAA 1VBC3 2JDKA 4Y1VA 2EAAA 1RUG2 2W95A 2A68F 4EJTA 4XHXA 4DO0A 3LSHA 4A3IJ 1PGL1 2JE7A 3JRBA 2B7EA 4RAFA 4PDWA 2P5KA 2XASA 2LDUA 4LO4B 4NAMA 2QNKA 3KB5A 4R1HA 3PMEA 1H1IA 2LROA 3CCYA 1IGOA 5FMCA 1G9AA 3LNQA 3OB8A 1VBA2 1GMMA 3GFIA 3VBSA 3KF3A 2V4JC 1VQ4I 1UPIA 2DBBA 2JG9B 1TEIA 2GMEA 4KJZA 2JG9C 2G9WA 5KHJA 1EH7A 2QKLB 2IXJA 2V7FA 4HRIA 3PO2J 2L0KA 2OAZA 1USTA 2PMHA 1ODNA 2QEXI 3GFLA 4BQXA 2L3DA 1WJDA 2HFHA 4PJJA 1FAYA 2O0YA 4Q4ZF 1XGMA 2M4KA 2YDEA 2R93J 3K0LA 3AZYA 3HKZA 4FTEA 1U5ZA 3LIHA 1TWCJ 5JIAA 4BIOA 3M4OJ 3FHIB 3LE0A 4UVAA 3OGRA 3FBIB 5M5YJ 2WV0A 4NAOA 2VLAA 1T6GC 1I5PA 2OTLI 4RLFA 3MZHA 1RETA 4BPZA 3ZIXA 1IKQA 3V0BA 3GX4X 3H7YA 4X6AJ 2AGSA 4Q4W2 4XLEA 1OR7A 5K4LA 4N90A 4JX4A 4CEYB 2EIJH 4XL9A 1IN8A 3DKWA 2J7MA 3I59B 4LK6A 2JA6J 1Y1WJ 2RDSA 4CEYC 5ICCA 4AUXA 3FHZA 5K1YA 2W25A 3JXSA 4ABZA 2B5HA 2JG8A 2XBO2 3C7FA 3HOWJ 2ETEA 1Z6RA 4Q8KA 2WN3A 3WUCA 4LO6B 4GWIA 1AR62 2DDBA 3I71A 4IEVA 1DCSA 1HW1A 3MFKA 2P3JA 3VSLA 1X1DA 4DNCA 2KRCA 2W85A 3WSOA 1XYOA 4ORFA 2VXDA 3LWCA 4INDA 1Y7BA 3PL0A 4RAZA 3W21A 1MDMB 2CQNA 3C2UA 2PLV3 4QWNA 1KQ0A 2RQPA 1MQTC 5GALA 2MH9A 2Z42A 3OBZA 1VQNI 2JTVA 4PUSA 4E7HA 1BKZA 2LY1A 3QPSA 3ZMSA 2HEWF 1PUFA 2VQUA 5B1BH 3KP3A 1IXCA 1CAUA 1JYIA 2DVGA 5FWJA 3Q9VA 1OVSA 2LVSA 4IE6A 2I2SA 1STZA 2BBYA 1ETVA 4A3KJ 2VC9A 4LO8A 2JDYA 1QBJA 4AM3A 3CCLI 3FMSA 1KJLA 2QCOA 1BBT2 3ON7A 1OXCA 1IQDC 2Y6GA 4BCUA 3R0AA 4UBGA 3SXYA 1GLNA 2VBPA 1YW7A 2IC1A 1B8IB 4YGDA 2GBYA 3UJQA 1S6LA 4BM8A 2JDHA 3A2KA 2ZEWA 4WVVA 1UZZA 3AP9A 3AMNA 5FO8B 1BMV2 2IZWA 4LIUA 2M45A 2EFPA 4BKXA 3OIPA 4AGVA 2YX4A 4HFSA 4X1EA 1GXQA 4LBOA 2LF8A 5ED4A 3EHKA 2HWF1 4B44A 1YQ8A 2CO5A 2XWBB 2VU9A 1GNYA 2PXJA 1POV0 5HBAA 4HNVA 4KN7X 1KGSA 3R4SA 2PA7A 4IEJA 2LRPA 4Y20A 2PG4A 1DZRA 2H6CA 2COBA 1R1A3 4AEMA 2EXKA 1CVNA 1SC7A 2WIIB 2XRNA 3UK9A 3BTIA 1WW5A 1V6JA 3M8EA 3CP2A 3HJEA 5D21A 1BR1A 3CMEI 1NY71 1JHNA 1GZWA 4FVVA 2BYVE 5JZGC 3O0WA 3S6PA 5L3GA 1JHHA 1DQ6A 3A01A 2QQWA 2O5RA 4R79A 2WNVA 4QPOA 1UOBA 4DIQA 3GLXA 1SFUA 1MGTA 5I0RA 4LKSA 3VHOA 5C33A 4H7MA 1DIWA 5F5AA 2M8EA 2OQ7A 3UKVA 1AJKA 1JKQC 3PQJA 3K4LA 4TLGA 5DD8A 3AX4A 1MZ6A 5JLWA 5J3LA 5K0UB 2BV4A 4LO5B 4JVAA 2H8RA 5DUKA 2JDUA 2QSFX 4FCAA 1AYM2 4MXWB 5L3CA 4V19K 1DP7P 4JOMA 1ON2A 4D7SA 5LRRA 2HBTA 2MLGA 4CU6A 4NHJA 4M0NA 2HQRA 1AX2A 4RS5A 1FBQA 1ZNPA 3QCWA 1HW5A 3ZOBA 1PP7U 3GTJJ 2PYTA 3K1PA 4GMP1 3GZAA 4ZKTB 1MNDA 1T2XA 5LBQA 3O14A 2HYXA 1P4WA 2BY0A 2D97A 1I1EA 1NZIA 4AIDA 2JPCA 1X9PA 5FK7A 5LA2A 5L7OB 4P55A 2RR11 1HRV2 1YQCA 5FO5A 1H89C 3HQRA 4IE7A 1WJCA 1QQP2 4H0EA 4BQQA 3IIAA 1JHFA 1PIV2 2W68A 3CJXA 2HWD1 5A32B 5LGUA 1DZQA 4AVCA 1ZZ8A 1ZBE3 2VBBA 4KISA 2Z5WA 4LOSA 1P8JA 4M3FA 1K79A 1ULFA 4YIFA 4NBQA 2FJ1A 5DUIA 3C7HA 4XQ4A 3WODF 2LYCA 3WQ1A 3LSTA 1MBKA 1V6OA 3F0CA 3JD72 1GUIA 3FXKA 1EAH3 1P7JA 2WV1A 4UXAA 4ESBA 1OCTC 5DCFA 4LBQA 2HWB2 1RIRA 5D5UB 1RUH3 3BIEA 1VQKI 2W1SA 1XSVA 1QRYA 3GBWA 3WDTA 3A1YA 1GP5A 2VZPA 2FDKA 4YRDA 2SLIA 4XRSA 3IDCB 2P5VA 1JZ8A 5E8IA 4A42A 3E6CC 4Y1UA 4YM1A 1AX1A 1U9OA 2P3IA 4TZDA 4HG6B 2RVCA 1QVTA 1GZ9A 3CJQB 3TWIA 4HSLA 2Z3YA 4Q4V3 1JMUB 2X05A 2A61A 4AIKA 4A2UA 2ZFWA 4A3CJ 3IDAA 1DDLA 3GYHX 3KEQA 2LTPA 3FXOA 1DGWA 2D93A 1HXS1 2P34A 4Q0PA 1IRXA 1LEAA 3IH4A 4E27A 1ZBA3 2XGEA 5EGOB 3OR2C 3M1EA 4JGYC 1V9U2 3ZMVA 2QKMB 2KRFA 4OWRB 4OYUA 2FDHA 1ASJ2 1VB4A 3I5UA 4IEWA 5CVUA 3SDBA 3FHNA 4PFOA 3VPRA 4JRLA 1JZ4A 1K6YA 1RGSA 3H5NA 3JAMK 2CGPA 3IWFA 2ORZA 4F92B 3RI4A 4MHUA 3WU2C 1EP0A 2W91A 1KDKA 1PNGA 3PUAA 4WBBA 1JYNA 4B4QA 5EP9A 2EA4A 4A7ZA 3C18A 3I3BA 2ETHA 2RM22 4IV1B 3WNKA 1W6NB 2BVVA 5FPXA 2HWC2 4GAZA 2OUMA 4XZPA 3T08A 1RNLA 4IV1C 1PVC1 3POEA 2ZBKA 4KITB 3HAGA 5FZBA 5H2FC 3ISPA 4QXCA 4O6JA 5FPUA 4PF1A 3MKZA 3CJIB 4ZXEA 2NYYA 2WT1A 4G3YC 5LBBA 1TG7A 2NM1A 3CJIC 2GIZA 3ABMH 3W3CA 2HKOA 1NXMA 2VVDA 5GZEA 4Q0VA 5FAXA 2STTA 2IXIA 3A4UA 2RV9A 1UY3A 4CUGA 2C0ZA 4FPOB 1AYN3 3UKNA 3FLPA 1UPSA 4HLYA 4W6WA 1Z1DA 1YRNA 3DEMA 1UMHA 2FBHA 5F1RA 1V6KA 3BODA 3LAGA 5FZIA 3G6JB 4XN3A 2XWJB 3HKZN 3K4CA 3SDGA 5DUVA 4DY3A 4ZXKA 3MIEA 1ENXA 3OYEA 1W3VA 2YPDA 3NQOA 4XF9A 5DD4A 2R5ZA 1EH6A 3SFIA 2DTWA 3X2QH 4YG2F 3ME2A 2FD5A 2J42A 3VL8A 3CZUA 3U10A 5FZ8A 1QQIA 1U5XA 1RUD3 3ELNA 4GKXA 5F6LB 1OPMA 4CEWB 3NNLA 2B0LA 1YYVA 2QQBA 4CEWC 3RJ2X 4DRRA 5LK5A 1U5TB 4BQOA 3CLQA 5FBZA 1PVXA 4E4DX 1CD3G 3VGIA 2ZJCA 1LFBA 1APLC 5CKMA 2W94A 3O1OA 4C0BA 4GGGA 1V70A 3WNLA 2VCBA 2H8WA 2UXXA 3APBA 2DCJA 5H6QA 1PGW2 1Q3EA 4PQ9A 3I4IA 2IA1A 1W9SA 5FPVA 2HEYF 4UWDA 1NT0A 4DW6A 3IMNA 4HXCA 4HANA 3FZVA 2Y31A 1J3PA 4CH7A 1DPRA 5CADA 3N4MA 1ZYBA 1E57A 4E4HA 5B5EC 1VBD3 1FP2A 1MEC2 3MUZ1 4RHV2 5T5JA 2VQAA 1LR5A 1I1SA 3CF2A 1Q1HA 1O7LA 2D6LX 5L9BA 3H5AA 2CY6A 3T2TA 3TN91 5FZ0A 5JHFA 1PM4A 1VPHA 1PZ9A 1FOD3 1HQNA 4BIFA 1Z7S3 1T6BX 5D8KB 2ZGPA 1WA6X 4AXOA 4EYUA 3H3ZA 2KDZA 2BXYA 2E71A 4BHPA 4A3ZA 5CU1A 5FRMA 2XJRA 3ZN1A 5TSWA 1SLBA 1RUJ3 2F6BA 4CDXA 1W9WA 1FYUA 4ZPIA 5A3NA 4OMCA 1HSTA 2A6EF 1BC7C 1UOJA 1JUIA 2WT0A 2Y64A 2QQOA 1K83J 3KP6A 3HT2A 3V65A 3MICA 1R58A 4BA6A 5JXIA 4M72A 4RR3A 3OYWA 4SBVA 5FYHA 3WG4A 5GZCA 1CQTA 3TB0A 4DUXA 3FE5A 3H8UA 5KBFA 3DN7A 4AE2A 3BU0A 2FMLA 4Y3OA 1U5YA 2CJJA 1D4VB 3OTFA 1OF4A 4XFBA 4Y5SA 4Y26A 3CDIA 2WFF2 4IEXA 2OKXA 2C6YA 1QZEA 3IKVA 3CDLA 3J8F3 1K4SA 4R52A 2WC2A 3I2OA 5LCWL 4NC7A 1RUG3 4IRHA 5FD6A 2D5HA 2DCTA 1S9HA 4XICA 3VBUA 2YC4A 1GV5A 1O4YA 1X8MA 2E31A 2CQXA 5BNPA 2RS11 1OH4A 2ZZJA 1HRI3 5KXEA 2GC3A 4KG8A 3PNTA 5FDBA 2ZB9A 3CUQB 5M3FJ 1MZFA 4RB2C 1OQEA 4OU0A 4ZYGA 1J58A 4IESA 3CUQC 4GH4B 2R16A 1XX5A 2L5QA 5ICEA 3MI8A 4GH4C 3KMHA 4AWXB 1OISA 4NPRA 3F8BA 2VOXA 3SISA 4GZ9A 1K6OA 1UYPA 1JYVA 3AYCA 3WDVA 4Q4X2 5DAWA 4BDYA 5A7NA 4MOAA 4UFIA 3O1VA 1ORKA 2A6HF 1FX5A 1HKSA 1E5IA 4S04A 2N7GA 3ZYBA 2ESNA 3VN4A 5I0TA 3HQXA 2EZIA 1DGWY 1MS0A 2L4AA 3BIWE 5CYVA 3EETA 2XUBA 3MYXA 4D7YA 4A6OA 5FZFA 3I8TA 2PN5A 2KM2A 5FREA 1ZZ6A 4BJ6C 1UYXA 2W47A 2HGCA 2VODA 2M5WA 4EJUA 2JQ7A 1RB8G 3K46A 4Q8LA 4G4FA 2DU1A 3KGZA 4Q4W3 5JOWA 2ICWG 3LL7A 5FP9A 1RRJA 5IYCJ 4Y22A 2VOKA 1R23A 2ZX1A 5C70A 2V9VA 3LDKA 2TRTA 3QYFA 3KQ4B 1O5UA 2BDRA 4MH0E 1Z91A 1YWKA 5A2QK 1I3AA 2QVSB 4C91A 4RQPA 2VJJA 1XD7A 4MUVA 1H8TA 3OY8A 1J59A 3GFJA 2MD5A 4UF0A 3RJPA 5JVVA 5D8AA 1D3YA 5HS9A 1K4TA 4DRVA 2XGDA 4LK0F 2A05A 3ZYJB 4YVSA 4AHXA 2DUQA 1NG7A 1REFA 4CXWA 2M7BA 3BROA 2OUHA 3QH7A 3HMYA 3CF5F 4GRIA 2R043 2VE9A 2EIEA 1KGYA 4CTEA 5C3OA 4H3WA 1R22A 2PMZA 4F55A 3ERMA 5D6FA 3HBZA 2DA3A 3LKJA 5DCMB 4XOPA 4GWJA 2E53A 2XHNA 2ZBJA 2QQ8A 2EV5A 1W9FA 3RI8A 5IFTA 1XGSA 1RITA 2MC4A 4OUMA 4XQWA 4COYA 2E7WA 5DDGA 2KZGA 2UYBA 1KU7A 4EM2A 4XLCA 4HF0A 2BPA2 1I3HA 4D6SA 5J4VA 3RZLA 5IT6A 3QOPA 3DEWA 3AFKA 2IAIA 1UXZA 1ZZCA 2Z16A 4YIIA 4Y33A 4FISA 2VL8A 3TBIA 2PHRA 2PQSA 2L4MA 2E7TA 3ZXFA 3G73A 4PFPA 3G71I 1ULEA 4UI9L 1U8RA 3W6VA 4OQ8A 4WVMB 3ZN4A 2JSCA 2R0FA 5A33A 3ACFA 4I99C 3PHMA 2IWGB 2KJCA 3S2HJ 4RB1A 4D7TA 1U0JA 4MEXF 3D8CA 5J1UA 1VIWB 4U36A 3NQHA 3WCRA 4PBOA 4U87A 4N8MA 4A3GJ 4GXOA 3ZRGA 4DOUA 1Z7UA 3GCWA 3KHCA 2UY8A 4Q47A 2FBEA 3PMSA 1POV1 3O5SA 4AHYA 1PO11 5FQ0A 1C8M1 1GUUA 3VDCA 3AG2H 3JW4A 4EN0A 2VZOA 1H2LA 4M3CF 5K5RA 4C2UA 1JT6A 3GZTB 1T6SA 5HNHA 2VN2A 5I0DA 5LEJA 3ASOH 2XF6A 3HRMA 2P5LC 4RFT0 4WXCA 3HB9A 1NG0A 4M4RA 1JU3A 4YFNF 4CU7A 2Y6FA 2DVAA 3TBDA 1ZAOA 3W6KB 4LJHA 5KAIC 4IO9F 3OV8A 3RSNA 1Z3XA 3HVDA 5JR2A 3POYA 3V7CA 2IBDA 4IDZA 3BKZA 3W2WA 1DG6A 2O6GE 5ILUA 3ES4A 3RGBA 4K3UA 1QHHD 5FY9A 2RE9A 1RHI1 4KNYA 2XL9A 2DI3A 1UO9A 1RUC1 2BUKA 5AFEA 5ABJB 3UGGA 3K6GA 3IKTA 1L7RA 1R093 3WCSA 1J7KA 3I58A 5ABJC 5KAFC 1DU6A 2DW4A 4OCTA 5HCHA 5KXDA 2DPUA 2X85A 4UHTA 1IW7F 5D4SA 4JBAA 4KU7A 3BR6A 4BNCA 4XAAA 3FIWA 5FLHA 4LPLA 1VQLI 4BLJA 3I56I 4PCQA 1QH6A 4OI2A 2C9AA 4BQNA 5FMBA 4QIWN 3L1PA 3U21A 1D0HA 2ZA9A 2OZUA 3ZOIA 1QEXA 2WYFA 1JOBA 4PBPA 3QPHA 5FJHA 1ETQA 1R49A 3B93A 1N75A 4FCYA 3JU9A 3WF4A 1RI7A 1JI6A 4KQ7A 1XE8A 2XJSA 2R063 3L2YA 1ALYA 4XJ8A 3GFMA 2E63A 3JD73 1HN0A 3WDUA 3PL8A 5FPAA 5B1AH 1K42A 4I30A 4UW3A 4BEHA 2XPUA 4RD7A 1GKBA 5JLVA 5ACA2 2RHPA 4L97A 4XMIA 2GP5A 4CCLA 3RS6A 4BQ4A 4XJAA 2HWB3 4JC1A 2ZGQA 2QZ3A 4Y4RA 2DPDA 2ZJ2A 4YZ4A 4NVPA 2I5UA 4MYEA 4RAYA 4RGUA 2TCTA 3CDHA 4JP0A 5FZMA 2OQRA 3DWLE 3VD4A 1A78A 2TDXA 2W57A 4A3BJ 4AW7A 2XVCA 3LD8A 2HWE2 4P9YA 3NKGA 1ETOA 2WYSA 1ND3B 3SCFA 4KGQA 1RUOA 5EZWA 1I1GA 5HVQC 1YHFA 3RCOA 4KI5M 2IGMA 1BI3A 3U4SA 4M73A 5FUNA 4AYBA 2DA2A 1CQ9A 4DBRA 1YEWA 3KYDB 1SLAA 4ATFA 3FX3A 2YSRA 1O3TA 5FK8A 3LEKA 4Z6YA 5LATA 4K20A 4IE0A 1REPC 1ACIA 3A02A 3AK0A 2JG9A 4KN4X 3WTWC 1S0EA 5LBCA 3AKQA 4LBNA 1IHMA 1EYBA 1C0WA 4LK1F 1SLIA 1COV2 1FMVA 4WZCA 4I98B 3K1MA 4GD4A 1XNBA 1O6UA 3ST7A 2KPMA 4YG3A 2JJ6A 3J7NA 2R6QA 1N3QA 5CYYA 2EICA 4JKMA 2BV6A 1BQPA 4KYWA 3P6BA 1FATA 1KFUL 5CPRB 3AL0B 3POSA 2RS33 5CLSA 1XMKA 4GYGA 2ZPXA 5E8GA 2HWVA 2ID4A 4JHTA 1Y9QA 2VH9A 4ES9A 1TMF1 1WPKA 4U7DA 5E88A 3DQVC 4BL0B 3DYOA 3N7JA 2DCKA 2C1FA 3BG3A 4BQAA 4E8CA 5FKKA 1E5RA 3ENRA 4UT5A 4W1UA 5E1XA 5DTDA 2OC6A 4CEYA 2V1NA 2UY9A 1YQ2A 1SAUA 3I59A 5L3EA 1D4M2 1J3RA 1UAIA 2FQ4A 1PGL2 9ANTA 4Y15A 5KHKA 5J98B 1HA8A 2N8GA 1D1AA 1XE7A 5JDBA 1QWRA 4OHVA 1UIKA 2D1HA 4TLFA 2BW8A 3KD4A 3ECHA 4M74A 2ZGRA 3C7OA 3EQEA 3LEIA 4PJYA 3A0BC 3SEEA 1S3JA 1I27A 1I6HJ 3QLQA 2XAQA 3TOAA 1KJRA 3GM8A 5CNAA 2JRMA 3ILFA 4NHLA 1XSRA 2DU0A 1UJ8A 2R5YB 5FO7B 3CJTB 4L11A 3QODA 4PIXA 1MDMA 3MKLA 2HYKA 3QQAA 3VDDB 1D5YA 4KWUA 4F52A 5A7WB 1WLTA 3VDDC 4N9HA 4DZPA 4WV8A 3ZR6A 3H92A 4LO7A 4H14A 1NLQA 1SHWB 1T08B 4O3MA 4EN8B 1R5ID 4H55A 1ST8A 3ZXGA 4BQ2A 3SYTA 3WV6A 2QQIA 1KQ9A 2O1QA 1EUUA 2H6BA 1WWXA 4DY5A 1T95A 2XUMA 1N3OA 3V4GA 3GZ5A 1XNAA 2GM4A 3SEPA 1YW8A 2CV2A 1W39A 3VBOB 2R071 1WI9A 4Q1PA 1VBA1 3VBOC 2FXAA 2XAJA 4G94A 4XUTA 1W4MA 4UV9A 4UFHA 2JN6A 3RTRA 3NWKA 2WS93 1REEA 4M6XA 2G9ZA 4AVAA 3UV9A 1W36D 4C1XA 1BOAA 3WNOA 2PMZN 1W0NA 4IHWA 1SLTA 2PFWA 1KRIA 4N4NB 1UU4A 1KS4A 1TWGJ 3CCRI 1W2OA 2ORXA 1W5SA 1EUTA 3C7GA 3BYWA 4HAMA 1IPJA 3WHCA 4N7UA 5F64A 1FEXA 3NNMA 4IGPA 3OSFA 2UURA 2OPKA 4FPKA 1J0RA 2R7RA 4HLXA 3T0YA 1Q43A 5JI9A 2PI0A 3GCMA 1YO5C 1YIFA 4LJZF 4I3PA 1PM7A 3U14A 2OU2A 5IVVA 2ZHNA 4M3CE 2HEVF 1BCXA 1BEV3 3F6VA 5FFXA 3HQUA 5LY1A 2WL1A 5JZGA 5TISC 4LQRA 4AWDA 2K5CA 2DK5A 4IXAA 3FN9A 1YHQI 2WFPA 2ZX0A 3O2PE 3JSOA 4QQ2A 5LWBA 3HOBA 3RZKA 3JAMZ 1X1AA 4LB6B 5I8YA 4KT5C 3K48A 3M70A 1RMU1 1KYWA 5M3MJ 2RREA 4GB33 3H36A 4EGZA 1H9WA 3CLOA 3K4DA 4ASNA 5HV4A 4DYRA 2IVJA 1RIOH 4GWMA 2ZXQA 2WY7Q 4YW4A 1IF1A 4XVHA 1AF9A 3CHXA 1AR61 4NJ4A 2FDIA 2IPQX 3OYNA 3GTOJ 4II3A 3CO7C 1AR83 1IN4A 1F43A 2F4PA 3LDRA 4LHNA 4UOJA 3ZQFA 1C5HA 1BR4A 4ZDOA 4DINB 2M34A 1EV13 2P6TA 5BMZA 1MIJA 4XURA 1OYYA 3RWKX 1DGRM 2E7QA 1LE8B 1I9RA 1TT5B 5ANQA 3L2QA 1H2MA 2IXLA 5JXGA 3VBFB 2CW0F 4I02A 2ZNZA 4BISA 3M8LA 2GNTA 3VBFC 3ZMTA 1IZ1A 4FQ4A 4P96A 4AQ2A 1WD3A 4P9GA 2QGUA 1G3YA 3H1CA 3H0DA 2R32A 1PHMA 5EDNA 4YIRX 4XDPA 3V0AB 1WLWA 4XCAA 3OBRA 3K9TA 4Y52J 2QYOA 2ZEYA 2RS51 3GDBA 1HC8A 4CZZA 4V2VA 4MADA 5LZ6A 1BBT1 1YQAA 3AKZA 4KMUX 1GZTA 1RJ8A 1VALA 4W6XA 1UMIA 2DYRH 2DT7B 3TP3A 4XOGA 1L7QA 5A32A 3BOQA 4IQ4A 1AXYA 5D4RA 4NHXA 4AR2A 1QDOA 5IVEA 2OPWA 3AXEA 3LWFA 4CDGA 1T98A 2W82A 3LAPA 2E32A 2M87A 2A7AA 5C4JJ 3ZKUA 3RQ4A 4IVNA 4A4AA 5CJ9A 5I0SA 1LRHA 3HDDA 2C26A 3E7LA 3OCPA 2STWA 2IVIB 3LEGA 2EA7A 5C3SA 1BA5A 2R7SA 2L9NA 4XF3A 3HG9A 3GHNA 2WAAA 3GNEA 3BTJA 1A6QA 1QXRA 4XBQA 5JCTA 4YFZA 3VD3A 3CCSI 4Z07A 1ZRDA 1N78A 2Y8KA 1YJWI 5F32A 3OL4A 2ZCWA 1CZTA 2EAKA 1HBXG 3ZYGA 4ZONA 2WO3A 1LOCA 3NW4A 1IRGA 3I7DA 3A0NA 1HN1A 2CNAA 2HOEA 1ZGWA 2DCYA 5HODA 1ZZ9A 3MFAA 1NXD1 2R7OA 1WD4A 2Q8EA 2LK2A 5D5WB 4EN9B 5DMYA 3HPHA 2Y48A 2F4IA 1NE4A 3NJYA 1CX4A 5FYBA 4IW3A 4CCDA 2B4KA 3ZYIB 2WNUC 4M01A 4B1MA 3KV9A 3EUAA 4COWA 1Y9MA 5J96B 5EGOA 3N3HA 5AC93 1XTAA 1B9NA 1F4HA 4XXPA 3ZMNA 2OIIA 4FAHA 2XJPA 4FOVA 3CUOA 4EM0B 4YG6A 5H9RA 2ZGOA 1AYM1 4AQSA 3IPVB 2R7UA 4KNCA 3P9CA 1YX3A 4Q5SF 2OCCH 4B3AA 5FY1A 4YFWA 3HD8B 3VB9A 2H1LA 5HLIA 5F37A 2IT0A 2VKHA 4AYBN 4META 1IXRC 2PAMA 4IV1A 1W6NA 3PNYA 5E17F 5J48A 2YGLA 5A3UA 2CAVA 1AVBA 2J1RA 1QJX2 1HRV1 3WP3A 4H2AA 4XJWA 2E26A 1PIV1 3EUHC 5EPAA 5DXDA 3NJZA 4WM7B 2PBIA 3CJIA 2GXBA 3WXPA 2VNVA 3O7OA 4WM7C 4OULA 5JFRA 3GZ6A 4ZYAA 3K75B 1X9TA 1OPOA 4RB3C 3JCUC 1JBCA 1ND2B 1XJAA 4ZDPA 1ND2C 1HXS2 5ILSA 3GJBA 1YQ5A 2DTZA 1VQ8I 2YC0A 1R1TA 2WSVA 1HQLA 3VEPA 2XIGA 3EYYA 2PELA 4IL6C 1Q56A 2CH0A 4BMBA 5IVCA 4I3GA 4LFUA 4YW2A 2CG4A 3T0BA 1U6GA 3WHUA 3GO5A 4K8RB 3N35A 3K70D 4PK4A 2YBPA 2KA3A 2V5DA 1XOYA 3HEFA 3ZLIA 3GW2A 5F0HA 2ZMLA 1NA1B 2D5VA 1US2A 3MIHA 2WLPA 1BR2A 2XAGA 2WNEA 3P9KA 4CEWA 1L3LA 2PEXA 3FXQA 2R0QC 2ZGNA 1CWPA 4P9JA 3H8XA 4RS5C 2ECCA 2P37A 1VLNA 3GTPJ 3FZ3A 1DQ2A 4AVPA 4FE4A 3URFA 5EF6A 4RGXA 3VV1A 1XPXA 1WFXA 1W0TA 1PVC2 4D8MA 1OCRH 4A69C 3K4KA 2VTXA 3A22A 5A2QZ 1PZ8A 2WY8Q 2QUOA 3TL4X 3F8NA 3G1MA 3KZZA 3B6AA 1UY0A 2L7MP 2M3AA 1S0DA 4QKDA 4XCBA 4OHZA 5BNQA 4FXKB 1W8TA 4BK4A 1TT0A 2OZ6A 5DAVA 3FK7A 3HTUA 4HMZA 1CZVA 1QJY3 5GLZA 1HDDC 4LLNA 4CDUB 2XOMA 1W0OA 2WKKA 1YFWA 4FHTA 2IJLA 5GAHJ 4AVBA 3MLJA 4NRQA 2LBFB 2CUJA 2VXZA 2GDFA 5JPMB 1UY2A 5APAA 1DF0A 5JIUA 3JRDA 3ECOA 2F48A 5J7MA 1TE1B 2CS3A 3KETA 1XCBA 2ZABA 1F9NA 1QMJA 4KDPA 1W03A 3W6JB 2NN8A 2IVMA 2KFDA 5FZHA 3BG7A 3UNGC 2LS6A 1LU1A 3I4NJ 2RM21 2XGXA 4K7JA 4ARYA 3VBHB 4A5MA 3JR9A 5C3QA 3VBHC 1RZ4A 5GTHC 4QPQA 3ACHA 4C3IJ 5HDKA 4XJZA 3ZPOA 3PUSA 3ONQA 3H3UA 1RUE3 1WQ2A 5FRNA 3THPA 3D5LA 4R8HA 3KF5A 4P5HA 3Q8FA 3F8FA 1C5IA 4MEYF 1SACA 1WCMJ 1YX5A 5EXOA 5ACA3 4B47A 1YS6A 3CKHA 3GZEA 3VOEA 4NDLA 3BN6A 4YGCA 3WF2A 4BB3A 4G6DA 5FP3A 3UJOA 4CPBA 5E8AA 1VBE1 3ZQCA 1OKOA 2A71A 4M00A 2ZTNA 4X6QB 2UWCA 5FOBB 2HWE3 4IHVA 5F04A 2HOAA 4URTA 4CSWA 3NARA 4WWCA 4AVZA 1CIYA 2E19A 3H7JA 2NS8A 3KP5A 3U4XA 1OCPA 1XQNA 2XVKA 1MS5A 1JTYA 2OT7A 1NZCA 4BJ5C 4S05A 3H8OA 1ZRIA 5BNNB 2E7AA 2D6PA 5D2AA 4QSHA 3TN92 2ZEZA 5JLXA 5BNNC 3RMXA 1J9IA 4B43A 4EE2A 2PQ8A 3CUQA 5FY7A 1Z21A 1TZLA 4GH4A 4FTBA 3K3OA 2A6WA 1AL23 2J1TA 1G9CA 1V6MA 2BWAA 1JYXA 1DUXC 3S93A 4B09A 2LKSA 4IZZA 3MN2A 1F4AA 4MGSA 4UY8I 5FBJA 2GAUA 3IDEA 4ENMA 3CJNA 2X1DA 1PGW1 2OA4A 1WI3A 2YR2A 1X58A 2VT3A 5A1FA 1G8WA 2CSGA 4O9EA 1DPUA 2VJ5A 2BNNA 2C6SA 3P1IA 5IOYA 5CQEA 1KD7A 4BUPA 3ZIWA 2ZJQF 4YVWB 3D1NI 2A6TA 2X1CA 2ISZA 4YVWC 5C4WB 2GOMA 4IX7A 5C4WC 1GLHA 3J7YJ 4QHBA 3I2HA 1RVF3 2FHRA 2MNGA 2FNPA 2Y33A 1NLRA 2MEV2 2VJXA 3FBMA 3JBG2 3AP7A 4YNIA 4BQYA 5B3SH 2RS12 4FPCA 5IK4A 3MPBA 1IC8A 4F8AA 2PMUA 2PMWB 4HDUA 1RUH1 3SH3A 3CESA 4ISRA 5IATA 5FJ8J 2Y0SN 1MR5A 2GA2A 4CZSA 4XRSG 1K61A 2ZJRF 2P7VB 1OOPB 2YXSA 2VQGA 1OOPC 1TNFA 2WAFA 2CYYA 4DZGA 3DTEA 2VUCA 1RPWA 1LJ9A 3B00A 2MABA 4ZZ8A 5KHIA 2WZEA 1ZHFA 4QDRA 1WWYA 5CAZA 2RKHA 5A3TA 4NMIA 4HBLA 2K4BA 1F9KA 5FPZA 3H8RA 4XKBA 1HB2A 2XAHA 5I8SA 5F0CA 1LODA 2J1UA 3CMMA 4COUA 3LOCA 2WO2A 3SHFA 4M4PA 1WJEA 3FFQA 5KR7A 3HUGB 3RQIA 1WGXA 2VBDA 2NMNA 2A5YB 3IT8A 3GXOA 3D0JA 1D0GA 2ZHKA 4X6RB 2BXZA 3VKFC 2VO5A 2IFRA 2IS4A 3T09A 2JE9A 2W1OA 5JOYA 3MIGA 2VB6A 3VKOA 3U2RA 1T2KA 4JHZA 5J1RA 2ZGSA 4UFKA 4NB5A 2ZGKA 5CVIA 1OJLA 1H4GA 3AZWA 2LTNA 3OYCA 2NVYJ 4MSVA 4Q0SA 3BP8A 4A6EA 2FUG2 4WVMA 1X36A 2VKEA 1TWFJ 5K7PA 4L99A 5EYXA 1H4HA 4ETSA 3KP4A 2GC1A 1P9QC 2Y0OA 4XBLA 3OD4A 2R7WA 3BC8A 1NKGA 1XG1A 1Q8OA 1GFF2 1V6NA 5FCCA 2DT6A 2VJIA 4QM9A 3I2GA 1KEXA 2D40A 2D98A 4YARA 3CC4I 4AEDB 2QBXA 3SCHA 4AEDC 4BXXJ 3LOIA 2QBYB 4PLMA 4I6ZA 3ZR5A 2W7NA 4C3HJ 1OCOH 5IW0A 2AYHA 3POFA 5HCFA 3ZGKA 1OHFA 5C71A 1AYN1 1DQUA 3BCBA 5KC5A 1QZYA 3GYDA 1Z78A 1C1LA 3I3DA 4V2WA 2KZVA 2R7EB 4Q27A 2W5FA 4WM8B 2XJTA 4QQHA 4GMP0 4BS9A 3IB3A 3IL2A 4WM8C 2MLKA 4XKVA 1IGNA 4A0YA 4L9TA 1UY4A 5BNGA 3VHNA 2WAOA 3PVOA 1X2NA 2M30A 4IOAF 2AH2A 4LLOA 3W2AA 4BXUA 4JKLA 3WG9A 5GKAC 4OZOA 5LA1A 1FOYA 5HLTA 3GCXA 5DS9A 5DABA 2DBNA 3J7LA 5ABJA 4UUVA 3BJOA 2L9VA 1V5EA 2F5VA 4BY7J 2X6OA 1GZCA 4LUKA 3LA2A 4HN1A 3AG4H 5IYBJ 2HWF3 1WW7A 3BG9A 3ZYFA 2DMNA 2YHJA 2HYFA 3HHGA 1XC6A 3VZNA 1USSA 1OF3A 2L02A 3HYIA 2ME0A 2YB7A 2XAFA 3SZTA 1IN5A 5FZ1A 2ARAA 4P00B 3FM3A 1PO12 1NG6A 3O3KA 1FIAA 2F5FA 2CW8A 2E60A 1C8M2 4CVUA 3GZUC 3MCZA 4OIQF 4I76A 3AKSA 3RZDJ 3KEOA 2GIVA 3WTUC 4N53C 5CVRA 1ZLKA 4M3DA 1YIOA 1GWKA 3PU3A 3GMEA 2VMDA 2EQRA 2JA5J 3HM5A 1O3QA 1REDA 3LDBA 4A7KA 5F2WA 1CZSA 4KWKA 2JDNA 2DVFA 4PI2A 3SCGA 4IHTA 4I09A 3Q0UA 3USUB 3BG5A 2JMWA 3PFIA 4LOCA 1H8TC 4OHWA 2EB7A 1JW6A 1V00A 1RUJ1 1NQDA 1IN7A 4OHXA 3VZLA 1RHI2 4N43B 2VZRA 1JODA 3QP5A 1KS5A 2WZR1 3VKMA 1VRBA 4LBKA 3HOSA 3WOGA 4B7EA 3E1F1 1GHCA 5BOXA 3LSIA 2JD9A 4Q48A 4DOZA 3BQZA 3GXUA 1YS7A 2WT2A 2A3YA 1S2BA 3RDIA 1W6PB 1BZWA 3ZN5A 3WTZA 3BPZA 5DYMA 2PJPA 4L9BA 5C44J 3MLLA 1P92A 2DOFA 4ARXA 3PUIA 1YQ6A 2W3JA 4Y13A 4HK8A 5JAXA 1MNMC 1LJ7A 3J8F1 1WKMA 1BJAA 3DU5A 1XSXA 4W6YA 2MSYA 1WMXA 2Q8DA 2AENA 2RR13 4Z2YA 1BK1A 5GTIC 1CONA 2KLOA 5FZAA 2BFUS 1MVEA 2NMOA 5T3NA 3IH3A 5FPLA 2P0WA 3ZMDA 1W06A 2VONA 4XHBA 3RNSA 4HSJA 1YNAA 2X09A 5FYIA 3AVRA 4TSVA 2LFBA 2HWD3 4HX4A 2WUHA 4CXFA 2I8DA 1MBGA 1HRI1 4F93B 2BY1A 4XILA 2P1BA 3U75A 1LESA 4L5EA 4D94A 4NC8A 1H6YA 3BR1A 1VE0A 1UAAA 5B2GB 4NHMA 2DXIA 2Y6JA 5DV5A 3BTYA 2MC3A 2ME6A 4R9CA 2BZDA 1S2EA 3HR9A 2PHTA 4I2OA 1H8AC 1LOEA 2A6VA 1WZ2A 3C3VA 3DLAA 1RC9A 2RMU2 2W39A 1ITYA 3GLLA 5A80A 2VCCA 1QF3A 1SAXA 2E2HJ 1W2NA 3S2DJ 2VE8A 2DYSH 4YW6A 3WF3A 2LKPA 5HLGA 2UWBA 5FR3A 1S55A 3JZVA 4X8NA 5LBEA 3BOWA 2DOAA 1Q8PA 3T30A 2EIKH 2V72A 3I3MA 5LD2C 2CYFA 3ABZA 3SNMA 1UYYA 2XJUA 5CG9A 3IAQA 2CDOA 3VWBA 3VYSB 3S57A 2DO7A 5C5TA 3DKQA 3JREA 2UZKA 4OI4A 4JTOA 3HZJA 3CCVI 1D8JA 2W48A 1S0IA 5A7PA 5FLMJ 2Y75A 2NVTJ 3ZQQA 1D2QA 3TAYA 1MSEC 2BNOA 2A70A 2R5YA 2ARBA 2LM3A 3NMBA 3BPSA 4XACA 1OI6A 4EZ4A 4HOBA 3N7MA 2CU7A 3VDDA 4K2EA 2VGDA 1WMEA 5A7WA 2QFEA 1XDUA 3NKTA 1PP8F 3AMQA 1AXKA 1DYPA 4CU9A 4HVOA 2VC0A 3VYUB 4QX5A 2EFOA 1OKRA 1XN7A 2ZX4A 3ZDSA 1ACCA 3U0ZA 4PSWA 1JS9A 4UB8C 2O8KA 3TEWA 3CMYA 4LR4A 3PIJA 3ZO0B 1G86A 4E7SA 3OYKA 5E79C 1YW9A 2DQRA 4HPKB 3O12A 3KIOA 3VODA 1MS4A 4YPJA 1TMF2 4AVTA 4URAA 5DUXA 3J80Z 3B3QE 3VBOA 4FQGA 1N1VA 1PVC3 1CJDA 5BY5A 1JUSA 4QTRA 5IP9J 1OQDA 5A7QA 4KU8A 2XPWA 4HDVA 1Q8VA 4OIRF 2CU5A 1TQ5A 2D5FA 1EPWA 3T5XA 1EH8A 3F8MA 1TNSA 5LK7B 4UVCA 3ABTA 1OLMA 2CRGA 5KXBA 1W1WE 3BB6A 2ESHA 4XONA 1LEMA 5JSRA 1QU0A 1G3SA 4KIBA 4FX4A 1JXSA 2EBIA 4FE7A 2HXOA 2E6VA 5C6CA 2F4MB 5C4XJ 4LLGF 2EILH 1NYWA 3MW3A 4N9IA 2ISYA 1K3IA 4XSZF 2DA7A 3LSGA 3WE3A 2JWPA 5K7ZA 1ULCA 1S29A 2EXIA 5CFCC 1MW7A 3KP2A 2HJIA 3TEXA 3WNMA 1ZR4A 5FKLA 2D7FA 3PJYA 1D0ZA 1TBXA 4QB1A 3S14J 3AKTA 5CKNA 4ENJA 4WX9A 2R7ZJ 3TW6A 1N3PA 2EPFA 2VQHA 1LDKB 4M9ZA 1ULDA 1K5JA 2WRAA 1CN1A 3DYMA 4JDOA 4YW7A 4HKLA 4R9DA 1D4M1 4B4CA 3M7AA 4E4ZA 2G9FA 5F5CA 4BHBA 3THDA 3MMYB 5EIYB 1R00A 4A3MJ 5T55A 5JVGF 4IOCF 3WF1A 1LHUA 4NWWA 5EZHA 1ZX5A 3G4SI 3EJKA 1ZRFA 2R072 2GN7A 4NRMA 3S8PA 4HONA 3S1NJ 5IK5A 1XE0A 4G7OF 4AI1A 3HJRA 3Q8AA 3GZNB 2VTFA 4OOIA 1LE8A 2DFIA 2XGCA 3PIGA 2LP0A 4BK5A 5IT3A 3BR2A 3VBFA 1CAWB 4FPHA 3TN93 2YX7A 1S72I 3MW2A 4I0BA 5FMOL 5FZEA 3FK6A 3I4MJ 4ISQA 1YO8A 3MV01 5HI0A