4A2UA

Crp(cap) from myco. tuberculosis, with camp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
224
structure length
224
Chain Sequence
MDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE TRANSCRIPTIONAL REGULATORY PROTEIN (PROBABLY CRP/ F
publication title A New Crystal Form of Crp from M. Tuberculosis and Conformational Effects of Crystal Packing
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 58
structure length 224
sequence length 224
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4a2uA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4a2uA01
1O3QA 3N4MA 2PQ8A 5BPXA 4U0YA 2DAOA 1WSUA 2Z2SB 5CVJA 4S05A 1CAXA 5HLIA 2EWNA 2COMA 3JTHA 1AOYA 4N9IA 3AAFA 3ELNA 3C1DA 5HDKA 4YG2F 3UKNA 4NB5A 3IRRA 4OLLA 3SZTA 1SFUA 2WTEA 5TJJA 2LKPA 4P9GA 2BGCA 2W24A 1O4TA 4XLPF 1G3WA 2DCTA 3MQ0A 3NKTA 1ZZ9A 1T6SA 3NJZA 2J5PA 2FMYA 3TNPB 4PZJA 1YLLA 2GWRA 4KA4A 2HR3A 4HZFA 3IL2A 1FP2A 2DW4A 1LRHA 1IN5A 3WTYC 4OMZA 2I45A 4QLCU 3F8BA 2XLGA 1T98A 2BE5F 2QLZA 2L3DA 5D8LB 1PMIA 3HT2A 5FO5A 1J75A 4KMUX 5D5WB 1ZG1A 1ZN2A 2ZXJA 1IZ1A 4HBLA 3CJXA 1XGNA 4KU8A 3FX3A 4ESBA 2MNGA 3QACA 4WXHA 5D4RA 1FI2A 4F8AA 4G9YA 1LKNA 2CO5A 4RGRA 3CL1A 2ZJ2A 2HS5A 4RGUA 3FHZA 2D1VA 2M45A 1CAXB 5I0UA 2EA4A 3RPUA 2HYGD 3S7EA 3KGZA 1J3QA 3W6KB 3KP3A 2LF7A 3VEPA 1ZREA 4OIPF 2EV5A 3BCWA 1U5TA 1ZZ7A 2LF8A 2K02A 4HF0A 5K5RA 2PN6A 5FLXZ 5E8IA 2B8MA 4KU7A 4CDGA 2XAHA 5BOXA 2PAEA 1P4XA 6PAXA 2BYVE 1TTYA 3DP7A 4CICA 2HFHA 2ELHA 4EWDA 3PVBB 1V4RA 4ZU5A 3GF2A 4IHTA 3CUQC 2UZKA 3OCPA 2STTA 4I0BA 1ZZ6A 3QU3A 1KYWA 4RB0A 3WG9A 5J7MA 1ZZCA 3FZVA 2M5WA 4Q4ZF 2D5FA 5AIQA 3CO6C 1YFHA 2IXKA 2UY8A 3WTUC 5BY5A 4A6DA 2DFIA 2MC3A 2V79A 3U0ZA 1DDNA 3T1BA 4OIRF 2PFBA 1ZRCA 4KYWA 3KP7A 4G7ZF 4P55A 3E6CC 3K1NA 1LVAA 1UHMA 4I3PA 4ZH4F 1L3JA 2HJIA 4LA3A 2M87A 2IC1A 4UBGA 3FF5A 2XAGA 2RC4A 3EYIA 3ZPLA 1QBJA 4HA8A 3KLOA 3NL1A 5D1IA 5ERIA 4MTDA 4LLOA 1RIOH 2ESNA 4LFUA 1FYKA 1G3SA 4WXCA 2QDRA 4ZYEA 1JE8A 4KIBA 1GQHA 2V1XA 2B9UA 2FRHA 2IP2A 4I0AA 2Q0OA 2MHFA 3P9IA 5FB2A 1R36A 1ZHFA 3RI4A 3KZYA 5DUIA 3JZVA 2M8EA 1TQPA 1CGPA 5FD6A 1VP6A 2HYFA 3PFIA 1UCRA 3LSTA 3G3ZA 3VFZA 4HX8A 2XHKA 1QO0D 1UIJA 2C0ZA 2FBHA 2BNMA 3EDPA 2O3FA 1PP8F 3ZQ7A 3E5QA 1FOKA 2ZNZA 3M7GA 4UV9A 3WTTC 2W84A 4KN7X 5DCMA 4XBFA 3V7RA 2P5KA 1YQAA 3HRUA 5DV5A 1Q1HA 2GXGA 2OZUA 5HS7A 3I0TA 1USTA 1S3JA 4ORFA 4Q0QA 4M71A 2ZBKA 4QM9A 3SHFA 2PLYA 1D3YA 3MFKA 3WW3A 4HF1A 1OYIA 1RGSA 4JTNA 3EJKA 2IVMA 1FBUA 2P6SA 2KXLA 4F7ZA 3HTUA 4M9XA 4RB3C 1HQCA 1HSTA 4ZZLA 4QM8A 4ZU4A 4L18B 3ES1A 2Y48A 2Z9OA 2Q1ZB 4WCGA 2QVSB 4S04A 4QXKA 3L2HA 2XGXA 5DEQA 2A68F 4Q5SF 2V9VA 4KICA 2Z99A 1J59A 3USSA 1B9NA 5LHIA 2UY9A 4HAMA 1NE4A 1Z6TA 3M70A 5KHJA 2YSRA 1BOAA 2ZKLA 2EV0A 4YFNF 2IW5A 1ZLJA 3EETA 4PGGA 2GC3A 1CF7B 2WWYA 1Y3TA 4XFCA 4WZCA 3WTSC 4U7DA 1ULYA 1ZRFA 4Y15A 1HKTA 4RB1A 2EAAA 3C7JA 4LK0F 1TLHB 3LFKA 1YS6A 3T8TA 5FD5A 1KQ0A 1IN4A 1QQIA 3RDIA 4EJOA 3K1MA 4ASNA 3K1PA 3GBFA 5BPDA 2LDUA 1YUDA 4XF1A 2IXHA 1DUXC 1J3PA 4E2GA 5KHIA 2IA2A 4I02A 2ISYA 5JHUA 2MH9A 5FLXK 4EMSA 3GO5A 2BNOA 2DU9A 1Q43A 1H9TA 2GIVA 3VOEA 3OGJA 4YFXF 2VODA 3T8RA 5LGUA 3WE3A 2OQGA 1QGPA 5BMZA 1HBXG 4G6DA 3GYHX 5LLQA 2YR2A 5IT9Z 5CVRA 3H1YA 4N9HA 3GX4X 1HSJA 4XF9A 1MDMA 5I8SA 1HW5A 2L01A 5J8CA 3IKTA 2F4PA 3R60A 3SFZA 5D5UB 1H9GA 3R0AA 5CADA 3RKYA 4XF3A 4AVCA 3TOAA 3I54A 5FFXA 1O3TA 2D2WA 2K4JA 3LA7A 5FQ0A 3LQRA 2IXLA 2E7XA 2L54A 1XD7A 5E18F 2DK8A 3DPTA 4MX3A 2DBBA 2EFQA 5DD8A 2JSCA 4LEJA 3BWGA 1X82A 1XMKA 4A0XA 5J8FA 2YU3A 2CAVA 2PMHA 1Z91A 2HGCA 3C18A 4D7SA 2IA1A 5FGMA 4EWEA 3M3IA 1MKMA 3C3WA 4CYDA 4G8XA 4O6JA 2H27A 2DQLA 2ESHA 1O5UA 3CTAA 4QGMA 5EEGA 3QP5A 2ISZA 4B29A 5E1XA 4IEOA 4PIYA 3HT1A 1W4MA 1OFNA 5JR3A 4MQVA 4P9FA 1QXJA 1D8JA 4FHTA 1ZH5A 5EZWA 3S2WA 3HQXA 4G94A 4XFIA 4YNIA 1YYVA 1FX7A 1JHFA 4CO8A 3T0YA 2EFWA 3CUOA 3NQOA 5J6XA 4AD9A 4A0YA 1SQ4A 2HKXA 4HN0A 2K7LA 2GA1A 5CVUA 3ABTA 4HV5A 3WODF 1UFMA 1D8KA 1LDJA 5LBQA 3D82A 3MWMA 4EM0B 3OOPA 1YW7A 2PEXA 1SFEA 3DL3A 1SD7A 3BY6A 4NHJA 3O3KA 2DLLA 4ZZDA 1IXSB 5I8TA 2XAJA 4UV8A 3K0LA 2CQKA 2CGPA 2VONA 2VBYA 1F5TA 2P17A 5KK1A 2HTSA 4ZU7A 1S7AA 1SD5A 1FNNA 1MD0A 3HRSA 3QU6A 4TV7A 3CF6E 2O8QA 4PJYA 1BC7C 1X7NA 3GEZA 4MHGA 1L3LA 1CAWA 2WFPA 4UNOA 3RKXA 2BBYA 4RGSA 1OMIA 1ZRDA 2RN7A 1W5TA 1Q3EA 2FE3A 2DPDA 2V1UA 5ICFA 1O3RA 4G7OF 3FMQA 3OF1A 3TNQA 1IRGA 3EQLF 4HOBA 3O14A 2EFNA 1ZVFA 4GYIA 2ZO4A 4Z82A 4H0EA 2RDPA 4IEPA 3GZ6A 2XL9A 2ZFWA 4BYYA 5F1RA 4M6XA 1OR7A 3L7WA 4FX4A 2RKHA 5ICCA 4JV4A 4KFCA 2G7HA 1I6XA 1XRUA 2RGVA 3FXUA 2OAZA 1B9MA 1FXZA 2P4WA 1S7OA 3EHKA 4LULA 2R7FA 4LG0A 3BALA 1X3UA 4Q47A 1ZNPA 3WTZA 2FNAA 1FP1D 1LJ9A 3WTWC 5L3BA 4LB6B 3S7IA 1RI7A 3RJPA 5E8GA 1IPKA 2G7UA 3DKWA 4J1WA 1QPMA 1FPQA 3M8EA 3SXWA 4QX5A 1ZRRA 4UXAA 4BXUA 4M73A 1IXRC 2CV6A 1Q5OA 4PIXA 4Z2YA 5IT9K 4CHUA 3CLOA 3H50A 3H1MA 3IWFA 2UXXA 3KSCA 1CAVA 2OD5A 3CO7C 5JSOA 4AVAA 3ZMVA 2ETHA 4CGZA 4HX7A 2XL7A 3COAC 4WWCA 3NW4A 4HLXA 2EK5A 3F21A 2O6GE 1J58A 3J81Z 1WI9A 4B09A 2GH2A 5E17F 4KUMA 4Y13A 4GCVA 2IA0A 3NEUA 1Y9QA 4UVAA 3TKYA 3LOIA 2GA2A 3OD0A 1ZZ8A 1I27A 3KCCA 1U3EM 3FJSA 1R1UA 2MLGA 1J7KA 1FBSA 1GHCA 5J3UA 4PCQA 5I8YA 3L09A 3Q9VA 4EROA 2CWEA 3H7JA 4XETA 4EJVA 4MQ9F 4IESA 5BV6A 1YHFA 3VB2A 2VN2A 4EM2A 2YX7A 3I5UA 1O7FA 5K5QA 1SFXA 1UCXA 3N97A 4LG0B 3V7CA 1KQ8A 1BI1A 4R79A 1JXSA 1P6RA 1VJ2A 2A6HF 3H3ZA 3WGHA 5FLIA 1NXMA 3V7SA 4OMYA 1IRFA 4R8HA 4JVAA 5LEJA 4IHSA 4XFGA 1DZTA 4MEXF 4MGRA 2FQ3A 5HDGA 3I59A 1S8NA 5HS9A 1BM9A 3M8FA 1NZCA 2OA4A 2P5LC 4AQ6A 3HHGA 2DQRA 2ETEA 2D5HA 1KU3A 2A69F 5AIPA 4IEXA 2E1NA 3IIAA 1X8EA 1PM7A 2PQQA 5HI0A 4GO1A 2ET1A 3U11A 2Q0AA 2CW0F 1BC8C 4P5OA 3F8FA 1XCBA 3D0SA 5BPIA 3U2RA 1R22A 3LA2A 4X6RB 2NNNA 1K6OA 2M30A 4WXDA 1ZARA 2F5EA 3RKWA 5DUKA 3WU1B 4G7HF 5L3CA 1I1GA 2VT3A 3SQNA 5LHGA 3I64A 3G7DA 2OBPA 1Z1DA 1SD4A 3P7NA 2CAUA 3SMHA 1U5TB 3IDCB 1QXRA 1J2XA 3HOSA 3TGNA 4RAYA 5I0RA 1J5YA 4BHCA 4XSXF 3B02A 1RUOA 2PBIA 4IRIA 4AVPA 5BXXA 2BV6A 3LWFA 1Z9CA 2A6EF 1J9IA 3RNSA 4META 3H9AA 3FM3A 3I59B 5CJ9A 1YFUA 1CAUA 4KWJA 1IPJA 4J1XA 3RIRA 4MUVA 4JQFA 3R6SA 3ES4A 5L3GA 3GFMA 2VT2A 1XSXA 1MZBA 3V8KA 1R00A 2GC2A 4HMZA 4B8XA 4A12A 2E1CA 5C8WA 4D7TA 2KIMA 1OYWA 1FWZA 2Y0MA 4UUVA 2PAKA 4IEVA 3BP8A 5I0SA 2BEOA 3KLNA 4FAGA 5AONA 1W7PA 3FMRA 2JPCA 3GFJA 4IERA 2AS5F 4U0VA 3TDUC 5LGNA 4MZUA 2H94A 2EFOA 1T0FA 3QPTA 1LR5A 4RGXA 3WGGA 4E2SA 1HW2A 3H7YA 3J80K 4I98B 1SEFA 3QPHA 1HXDA 2MD5A 2XROA 2XLFA 5T3NA 2XIGA 3C3VA 3WGIA 1KGSA 4E70A 4I01A 4MGKE 3ELKA 1D5VA 5H6QA 3ZMTA 4AXOA 5JR7B 2A5YB 4QGNA 4I7HA 2VBWA 5KBFA 2L02A 5I91A 4YIFA 4PGHA 4IXAA 4HLTA 2MA3A 2HWVA 3PQJA 4GULA 4O3MA 2W25A 3HSRA 3I58A 5JVTA 2PTMA 1FSHA 4HSLA 2KJBA 1BIAA 2VPVA 1WKMA 3J81K 3LA3A 4GGGA 3FE5A 4BQAA 1BBYA 4IF4A 1U78A 3LZZA 4Q0UA 3SHRA 2XUBA 4OINF 5DCMB 4WK8F 5D4SA 4MGIE 2GAUA 3IKVA 5LHHA 4MEYF 2OQRA 2EVXA 3GLXA 4O9EA 4U7BA 2KIFA 2XAQA 2UYBA 4KNYA 2TDXA 3WTXC 4ONUA 3BDDA 3BJAA 4LLGF 4ON0A 2HQNA 4K2EA 5DCFA 2JPBA 4EJWA 1X8MA 3RYKA 3HSEA 1ZYRF 4QGLA 1ZLKA 5CVVA 4I2OA 3L9FA 1XSVA 1TQ5A 5EEHA 5DDGA 3PLQA 4IEYA 1B4AA 2VECA 4X6QB 4KWKA 4A5MA 1P2FA 4OOIA 1IF1A 2FXAA 1DPRA 5E16A 1IW7F 1G3TA 5K5OA 3MDPA 2D1HA 5JCTA 1YFWA 5H20A 1KA8A 1G3YA 1W5SA 1U5TC 2RQPA 3ST7A 4EVIA 3KP6A 1FZPB 1RNLA 2QUFA 4WX9A 5E1WA 4XLNF 2R7DA 2IXIA 3EBRA 3V8LA 5DD4A 2HZTA 2PAMA 2A3SA 2K27A 1YLFA 2PYTA 4EWAA 3NVCA 3IWZA 4XF4A 3HRMA 4LUKA 2V6CA 4M6YA 4XFAA 1LEBA 1O3SA 2DT5A 3BU7A 1EH6A 5F6FA 2W57A 3MAJA 2MH2A 2NS0A 3F8CA 3R4KA 1V3FA 4HBNA 3SCHA 1J3RA 1U12A 3V4GA 4HVQA 4BHPA 1IUYA 2HEOA 3CLPA 3GFLA 3TDZC 1PUEE 2Z5UA 3CUQA 2UYAA 2QYOA 3E6MA 2M1BA 4M74A 1ZZBA 1ZGAA 1OD5A 2K86A 2VXZA 4ENMA 2FQPA 1TW2A 1YIOA 4HVOA 1H0MA 1GQGA 2GZWA 2GXBA 1RC6A 3O6BB 1FY7A 3F72A 1UIKA 1PP7U 1BIBA 4LLNA 2DPUA 1UD1A 2H0VA 2VE8A 3SCGA 1E2XA 1HW1A 1AWCA 1UW8A 5J48A 2FBIA 1I1SA 3BZ6A 3FXQA 5FCCA 3V8JA 5A2QZ 1DPUA 1MDMB 3PNAA 1BJAA 1MJBA 1LQ1A 2OA2A 4ZYHA 3HUGA 1H1IA 3EYYA 3M9AA 3TO9A 5BUVA 3LAPA 2YPRA 1VTNC 3MYXA 5FQ0B 5FFZA 2Z69A 1A04A 2F5DA 1IN6A 3ML6A 3H1WA 5L3DA 2GQQA 4R52A 3JSOA 1U8RA 3B73A 3JAMZ 1FC3A 3RZZA 3K2ZA 2QM3A 3BROA 3F3XA 3GUDA 1QWRA 3TO7A 1S6LA 2O1QA 1XDSA 1ODDA 3SXYA 3ECOA 1GXPA 2QVOA 1XN7A 2FNPA 1FYLA 2L4MA 3DF8A 2RVCA 2KRFA 4U0WA 4FX0A 5I0TA 1QY4A 1G6NA 1QNTA 4NVPA 2EFPA 2B0LA 2O8XA 1B1BA 1H1MA 3VODA 1LNWA 4RD7A 3D0JA 4KL1A 4E2QA 2VE9A 4XRFA 2IRFG 1SMTA 2P7VB 3GVAA 1SMYF 4HDUA 4LLLA 3OTFA 4HVRA 2GU9A 4M72A 1FT9A 2PG4A 2H6CA 2K9ZA 1LB2A 3JTGA 2P6TA 3K9TA 3MZHA 3SCFA 4AIHA 2VBXA 3J7AO 4R1HA 1WLTA 3I7DA 4RB2C 1WA4A 4FAHA 5D6FA 4AVBA 3KFWX 3KP5A 3P9KA 2Z3YA 1HKQA 2ZCWA 5CYVA 4LA2A 3ZN0A 4MH0E 2PJPA 1IXCA 1XCVA 3PQKA 2Q30A 4PDKA 2IT0A 4XF0A 3BB6A 1IAWA 1B59A 3ERED 3FHIB 1K78A 2CG4A 4L9VA 4U88A 4RAZA 4Q0VA 1FLIA 4NQWA 3TOBA 2C6YA 2R3SA 4EV0A 2STWA 3WTVC 4KMFA 4L5JA 4L2NA 1F9NA 4OIQF 2VBZA 2CYYA 4K8FA 1Z6RA 3J80Z 3FZ3A 2LNBA 2H09A 1KYZA 4HDVA 2D40A 1T38A 1YW9A 4KN4X 4EGZA 4WBBA 4Z07A 1R1VA 1K7AA 4ESFA 4ZYDA 3BPVA 4MGYE 1UB9A 3ZN1A 2PMUA 1J0RA 2V09A 1CAWB 4XEZA 2Q2EA 1L0OC 5ICGA 4YYOA 2EJRA 3DPLC 1OKRA 2LSOA 3WW1A 1WWXA 2FMLA 3D5LA 3E6BA 5FPZA 4H7LA 1EY2A 4IEWA 2CFXA 3CDHA 1QZYA 1MJ9A 2EA2A 4UBHA 1C0WA 2NAZA 1BI2A 2P7CB 5L3FA 1JUHA 3ZDSA 5LRRA 1ZG5A 3IBMA 1OI6A 3M1EA 1O57A 5HS8A 1KU9A 2FA5A 2D93A 3IDBB 4L11A 4P9UA 3HYIA 1R58A 4L5IA 4UXNA 3ACLA 2MLKA 1K78B 1VR3A 4HSJA 2F2EA 3F22A 1R1TA 3I4PA 2XKPA 3ULQB 5I93A 3LWCA 2ACJA 1ZGJA 2IXCA 5KHHA 1ZAOA 2Y0OA 3ZMSA 2FF4A 1GVJA 3CEWA 1BN5A 3O2PE 2KKOA 5FPXA 4M9ZA 4LUMA 2PA7A 1WGPA 1XB4A 3NSTA 1RL3A 5A2QK 3ROUA 3MCZA 2WV0A 3ABUA 3ECHA 3EQEA 4ENKA 1CAVB 1XGOA 1UHWA 4QMAA 4LB5A 3KE2A 1HKSA 4EJTA 1JHHA 2ZMEA 3MEXA 3Q5FA 4Q0SA 4YFKF 1NYWA 4IRHA 1Y0UA 2UWMA 3ISPA 3HOTA 3FM5A 4Y17A 4I09A 2OU2A 4ZYGA 1IN8A 2OZ6A 1ZG3A 2EB7A 2P8TA 3RYPA 5ICEA 5CU1A 3H92A 3EO6A 4ETSA 4MV2A 3JAMK 4M9SA 3VHRA 3KP2A 2QQ9A 4D0PA 3F8MA 4ESJA 3BJ6A 1EP0A 2A61A 4IRGA 3IRQA 2ATFA 3H3UA 2NNYA 1KU7A 2JRTA 1TQMA 1EV7A 4MTEA 3HIFA 1R5GA 1DGRA 1MJAA 2DTRA 5HVQC 1QZZA 5D5XB 2HQRA 4L0ZB 2AXLA 1XE7A 2D45A 1P92A 1SD6A 4KDPA 3R0JA 3F6VA 4HN1A 4HLYA 3GFIA 3TQNA 3NRVA 2GC1A 3KP4A 1KQ9A 1LDKB 2QENA 4BH9A 2O0YA 1YS7A 1K79A 1U6GA 3DXJF 5EFUA 1CF7A 3S0MA 1ZX5A 4JTOA 2RV8A 3WW4A 2ZKZA 1NHAA 4BAYA 5KHKA 3KETA 3BOQA 4XFFA 4BIFA 3I71A 3DV8A 4IJAA 2ZMEB 2DI3A 5HDNA 4OFGA 4KIGA 1FYMA 2FOKA 2HKOA 4OU0A 2Q4SA 3DQVC 5E20A 3WU0A 2VQAA 1XE8A 1GXQA 4DINB 2FBKA 1SAXA 1R23A 4KT5C 5D8KB 1TBXA 4HQMA 4UVBA 1ONVA 4LJZF 3JW4A 4GXOA 3QAHA 2EA7A 3F8NA 4WF2A 2XVCA 3HSFA 1YG2A 3L2CA 4TLFA 1I5ZA 1WQ2A 2GC0A 5ILUA 5DYMA 1T2KA 4IEZA 2DK5A 3P9CA 5C6CA 5K8SA 1TNSA 1BI0A 1E17A 2OZJA 4YRDA 1CX4A 5AVPA 4Q48A 4A2UA 4XFHA 1DP7P 5D6EA 2JT1A 2NRAC 1YWKA 3WE2A 2JZYA 2HDCA 3BJOA 4AWXB 3E6DA 3MPBA 3HTSB 3U1DA 1LDDA 2IXJA 5JSPA 2XLAA 2X0LA 3FFQA 1U2WA 4KWLA 1CAUB 3UKVA 1EH7A 1J1LA 1F1ZA 3FXRA 4HX4A 3KEQA 2X4HA 1B6AA 1ON1A 2FSWA 4DNCA 1P4WA 4CZZA 3BPZA 1XGSA 2XASA 2V1DA 4JK1X 4BHBA 3GWZA 4Q29A 4ENJA 1TNTA 2HOEA 2QWWA 1Z7UA 5BS6A 4FT8A 4JBAA 4L9JA 4HV6A 3UKTA 3E5XA 5ILVA 3RTRA 5FLJA 5LEKA 4IETA 1DGWA 5D5VB 5BQTA 1W7PB 1OYYA 2FEZA 3H8UA 1XGMA 1FSEA 2O03A 2VOPA 5LGTA 1OPCA 1XDUA 2YX4A 3JSPA 3GZ5A 5ED4A 4AIKA 4FBFA 2QQAA 1WRJA 4AQ2A 4KIFA 2QNKA 1XMAA 2QQBA 4UHTA 2Q8KA 4Q0PA 2VC0A 2PHDA 5KHGA 5JSRA 2XRNA 3IC7A 3MZYA 3FWEA 3LAGA 4XSZF 3K69A 1REPC 4IPAA 4P96A 3QRFF 1YO5C 2K4BA 1S29A 2OPKA 3QOPA 4ENNA 4A6EA 3E5UA 1YFXA 2H6BA 5L3EA 5E1RA 2O61A 5HLHA 2MPFA 3TO6A 2VC1A 2OYZA 4A5NA 3DFGA 5H6RA 3KGLA 2RNJA 4LTAA 1DZRA 3QP6A 5KVRA 4WVZA 1IN7A 5CVIA 1USSA 1SFNA 1STZA 2DO7A 1YFYA 3KEOA 3KMHA 4O9GA 5JFRA 1O7LA 4IEQA 2ET7A 4LGWA 1TQIA 4UVCA 2W85A 4GYGA 4LD5A 2K0GA 5TRDA 2MBFA 3FMSA 4A0ZA 3W6JB 1G4DA 3U10A 5HOOA 1XSDA 2EV6A 1YTYA 1P4AA 2KIUA 4G6QA 3OV8A 5CLSA 2B5HA 4BNCA 2UXNA 2QJVA 4N0BA 4HW0A 1LEAA 1BI3A 1KU2A 3BPXA 4LK1F 2VOOA 3LAJA 4XFBA 3GW2A 3REOA 3Q9SA 3HRTA 5FLHA 2QBYA 3HHHA 2NYXA 5IT3A 2JTVA 3L00A 4L9TA 1R7JA 5JAXA 2F5FA 3IHUA 4OIOF 4L0YB 4IVNA 1FBQA 3EUHA 4HYEA 4YSFA 2FU4A 1T39A 4HF2A 3I53A 4YARA 4RS8A 2IPQX 4QWQA 4CXFA 1RZ4A 4LMYA 5FDBA 4MNUA 3E3VA 4MGZE 2P5VA 3GXOA 3T5XA 3F23A 2BNNA 3G73A 4L9NA 4O5VA 5ILSA 3ETQA 1W7PD 2XKOA 2KJCA 4PIZA 4AIJA 4DQ2A 3ZP5A 2E9QA 2XAFA 1PDNC 3DN7A 3RPQA 3ZMUA 5LRSA 2PFWA 1EH8A 2F5CA 3CO2A 4IEUA 3CUQB 2PI0A 5HLGA 4EGYA 2XV4S 1ON2A 1Z05A 3E97A 3ZMDA 3SZPA 2PHLA 1O5LA 3LQQA 3U9GA 1YW8A 5K1YA 4EM1A 1EYBA 3ZMZA 2E7WA 1RUNA 2QZ8A 2QCSB 2A07F 2G9WA 1UPIA 3WW2A 5E1ZB 2ADUA 3R61A 2Y75A 1EPZA 2ZNYA 3F6OA 1NE6A 2N7GA 5JI6A 2WC2A 3GYDA 3CJNA 2Z33A 5F64A 2J5OA 2IJLA 4EQQA 3RYRA 1V70A 4YIIA 1RTVA 1JGSA 2HTJA 3DEUA 1R5HA 1TW3A 1F4KA 2L4AA 1MGTA 4HQEA 4EJUA 2CSOA 2QBYB 3KZZA
chains in the Genus database with same CATH superfamily
1O3QA 2PQ8A 3HUGB 3S1RJ 1UX7A 2K5CA 4YW4A 5BPXA 2CRGA 4U0YA 4Z2WA 4S05A 4GKYA 5HLIA 3ENRA 1AOYA 2E1OA 3L2QA 5IJRA 4M00A 3VZNA 4NB5A 1ND2B 5L9BA 1QOSA 4XRSA 4JHZA 4JKMA 2EF6A 3G4SI 3KD4A 1G3WA 2VMDA 3JRGA 2WS92 4DYCA 5JIUA 4QD2A 4LG3A 2QE3A 4PZJA 1YLLA 5K0UB 4KA4A 2HR3A 4LOTA 1FP2A 1AX2A 2ZHMA 2DA5A 2ARXA 3WTYC 4XBQA 3RVHA 1SBEA 1FOXA 4IZZA 5FY8A 2WY7Q 4BK5A 4UUSB 3HWJA 2CTVA 1QJX3 1IZ1A 1OCCH 1A36A 4HBLA 3A0NA 3CJXA 5ANNA 4ESBA 1NQJA 2HPIA 1CQ9A 3QACA 5D4RA 4ZXKA 2X51A 4A7ZA 5FZ7A 4P00B 1UELB 3CL1A 3VBSB 3GDBA 1NCRC 2HS5A 4RGUA 3H36A 2HZDA 4XHXA 2D1VA 3HM5A 3CCUI 5I0UA 3A23A 5CB7A 2FDFA 3JRFA 3S7EA 1J3QA 3DCQA 1BHGA 2OPWA 3W6KB 1PX4A 4BLJA 4CEWA 1NX9A 4OIPF 5KC5A 2AQFA 5A7NA 1EA3A 2XB5A 4AFMA 1RUJ2 1DQ6A 4CZSA 2ZXIA 1S5LC 3VYSB 2PAEA 4MHRA 2W1QA 1AVBA 4CICA 4FQZA 5T5LA 4XVHA 1V4RA 3GF2A 3CUQC 2E32A 1NLRA 3OCPA 3S3NA 2STTA 1LFPA 4I0BA 2DFCA 1PNFA 2KR2A 2AQEA 5H9SA 3B3QE 2B9VA 3OYFA 4AI0A 3AG1H 3WG9A 3JBG3 1OVPA 2M5WA 3CJRB 3CO6C 5CFCC 3BOPA 2UY8A 1WJEA 3NAPA 4G7ZF 4P55A 4W6XA 3E6CC 3BT9A 4N53B 1VQKI 3H3LA 3DU5A 3HPNA 3CMYA 1UHMA 3RSJA 4LA3A 2M87A 4UBGA 4LOCA 3FF5A 3WSOA 4M6VA 1JBCA 1S2EA 2XPWA 1YI7A 1MS3A 4LLOA 3FISA 2CHHA 1FYKA 1G3SA 3ZN6B 2QDRA 4CXWA 1JE8A 3OYMA 4CCDA 1GQHA 3IB3A 5GZDA 2DTWA 2IP2A 4I0AA 5DDJ2 3P9IA 3N9OA 1W04A 1ND2C 4S0HB 4PFOA 4QB1A 4BQOA 1R36A 3RI4A 2M0MA 4BE3A 4BJ6C 2OCCH 5FD6A 4FCAA 3LSTA 2J22A 1C1FA 2HYJA 4E7IA 3VD5A 5K0UC 2VOTA 3R4SA 2W95A 1VBE1 3M7GA 2DYSH 4Q8LA 3VSLA 2GH8A 1GWKA 4UFMA 2AXTC 4UY8I 5DCMA 5FZ8A 1H2MA 2P5KA 3HRUA 3HKZA 5FLMJ 4KG8A 3AZYA 1OCTC 5LCWL 1FIAA 1USTA 4XURA 1RUI1 1W6MB 3CQOA 4P9LA 4IHWA 3MKZA 1RESA 3BQZA 3HKZN 3WW3A 1RGSA 4QWNA 1OF4A 5E8AA 4D7MA 3HVDA 2QQMA 4PCRA 3ES1A 4YVWB 2QVSB 4S04A 3L2HA 1K4SA 3VSKA 2RS31 2Q8EA 4QKNA 3O8GA 1H2KA 4C0BA 2EZHA 5LHIA 4A69C 3AMQA 2DOEA 1YQCA 1RIRA 5KHJA 2EIBA 2YSRA 2ZKLA 2W5FA 4PGGA 2BBVA 2NVXJ 1VQ8I 1T6GC 1W2OA 3RG0A 3WTSC 4U7DA 1ULYA 1ZRFA 4ZDOA 2CY6A 5A3LA 2VI6A 2LS6A 2EAAA 1NCQB 1S72I 4YGCA 2LMDA 4DZGA 1UY2A 2H0BA 3LFKA 1YS6A 3T8TA 5LA0A 2F4MB 3AXDA 1RMU1 1AHDP 5B2GB 1QQIA 3RJRA 1O6UA 4UWDA 4ASNA 3K1PA 2LDUA 4I76A 5JXHA 1J3PA 4E2GA 4N53C 1XNKA 2IA2A 1WZXA 2BP6A 1QDOA 4EMSA 3LFIA 4DRVA 2GIVA 3VOEA 1R71A 2YC4A 1YE9A 1YITI 4OHVA 3T8RA 5C33A 2W3JA 3P5BA 2DMQA 5G04L 1GP5A 5LLQA 1NKGA 2YR2A 3RKQA 1GWMA 2VM9A 1MDMA 2L01A 3VD4A 5J8CA 3HOBA 3NWTA 3IKTA 3R60A 2FX0A 3I49A 1AR71 2KRCA 3I54A 1O3TA 3BZCA 4QQLA 2D2WA 1J09A 4GJYA 2DBBA 3BVCA 4CA9A 5FFOC 1ULDA 3ZXGA 2EFQA 4Y26A 4XJ8A 1W8HA 1F35A 1XMKA 4A0XA 2CAVA 1Y1VJ 4AIDA 4KQ7A 4D7SA 1MKMA 2E33A 1D1BA 5DABA 2P1BA 4C3JJ 4QPQA 1VF9A 4G8XA 4XIDA 2DVFA 4G9SB 2FCTA 4XDQA 2ISZA 1Z3YA 2JA8J 3V0BB 2ADDA 1W4MA 1OFNA 5JR3A 4P9FA 2ZGTA 4FFHA 2W68A 1D8JA 4XMAA 2VZ3A 1YQ2A 2JDYA 1TZOA 3UGGA 4YNIA 3HZJA 1ENQA 1BMV1 3J8F2 3ZM8A 1BL0A 1SLIA 3ZDVA 2W1WA 2B7YA 1F43A 4AD9A 1SQ4A 2HKXA 2XB0X 5DZGA 4HN0A 1QJX1 4XE9A 4E4DX 3ACIA 5FOJB 1AU7A 3WODF 4HV5A 1UFMA 1D8KA 1N78A 3SH4A 1LDJA 5LBQA 4EM0B 3OOPA 1HDDC 3LL7A 1SFEA 1IJWC 1UNBA 4HEA2 1WH5A 4Z1VA 3DF0A 1IXSB 5I8TA 5KAFC 5A3OA 3K0LA 1YIJI 2VONA 1W8ZA 4Q4V3 3ZXDA 2VBYA 5KK1A 2PXJA 3KEYA 2VVEA 1K6YA 3BIWE 4BU2A 3LSIA 2J1TA 3JD72 1HF0A 3CF6E 1BC7C 2R042 4DW6A 3GEZA 3HN3A 3IH3A 3RKXA 2QKMB 2H8WA 2PLV1 2RN7A 2R6QA 1W5TA 4LO6B 1ETWA 4W97A 2V1UA 4FOWA 2YB7A 4PLOA 3JUUA 4CEYB 3HG9A 5FZHA 1UMZA 4FASD 4HOBA 4UUTA 2QA4I 3SLIA 4IOAF 4Y52J 1D1CA 3CZUA 4FPLA 1W28A 5F1RA 2OUHA 5AVAA 5BYNA 1OR7A 1GV9A 5JOXA 1UZZA 5ICCA 1I6XA 3OG2A 2XUMA 3VDDB 5M5XJ 2OAZA 3OYEA 1S7OA 2BHZA 3GBWA 2HOAA 1FP1D 1LJ9A 4MLOA 1KXGA 4P1WA 3Q8BA 5E8GA 1QPMA 1H4HA 3SXWA 4QX5A 1GLHA 3GTOJ 2GN3A 4AI3A 2ZEZA 3GZTB 4M73A 1IXRC 5J4VA 1TZLA 3GTKJ 2CV6A 1VQ5I 5IT9K 2JD4A 3IWFA 2UXXA 1OURA 1N3PA 3VN4A 3AL6A 2YC2A 3CO7C 3IH2A 4IHXA 3POIA 3UNPA 2IEKA 3ZMVA 2ME6A 5FP9A 4E27A 3PUAA 2R0HA 3S16J 4XC9A 5E17F 2VZPA 2YFUA 1W6NA 2GMEA 4LO8A 2BVLA 1BEV1 2RS12 2IA0A 3NEUA 2XHNA 3TKYA 4AVZA 3GHNA 3LOIA 2WAFA 4UW6A 5C70A 1X4PA 3I4NJ 1U3EM 4CCKA 2VAUA 3WZ1A 2I5UA 3WQ0A 5C8CC 5J3UA 2KP6A 5I8YA 4N4OB 5F0HA 2CWEA 4AI8A 2B42B 5HNFA 3A4UA 2YX7A 1F36A 1QOOA 4C8DA 2RS32 1AR92 3V7CA 1KQ8A 1RYYA 1JXSA 5DAVA 4BMBA 3BPSA 2ZGSA 5CZKA 3BTXA 5F08A 1DZTA 5AC93 5HXVA 2WWJA 4X0GA 3I59A 1MQTC 1W6QB 1X50A 1X1CA 1I5PA 2A6TA 2E5ZA 1F31A 5HS9A 4QQPA 4RMNA 4W1UA 2WDBA 4IEXA 2K3PA 2X1DA 1WMFA 4ASLA 1O59A 3UKGA 2PMZA 1RHI3 1PM7A 4Q4W3 3IP4B 2AACA 5HI0A 4GO1A 1V5EA 2Q0AA 2CW0F 3GXUA 3VZJA 4E7KA 1ENXA 2YUSA 3JRBA 3ZFGA 3IDAA 3DEEA 2EIKH 1I3AA 1P8JA 1R22A 4NIHA 3C7HA 4X6RB 3HL2A 4COUA 4N43B 2PMZN 4H3WA 2RG4A 2M30A 1ZBE3 4WXDA 1RMU2 5DUKA 4SLIA 5FJKA 4YVSA 1U9OA 4LIUA 2ARCA 3OGSA 3DPRC 4R9DA 2CH0A 3C7OA 4CU9A 2PX9A 3E1SA 4IV3A 4GALA 4K8RB 4CU7A 3RZKA 3P7NA 2RR11 4NIAA 4DXSA 5JXJA 4XSXF 4QQOA 4XUPA 4Q1PA 1Y8RB 4RLQA 1O4YA 1L7RA 1RUOA 2DCJA 4FFFA 2IBDA 2PBIA 3PUFA 1OKOA 4QPYA 4AVPA 2A6EF 1J9IA 5FLVA 3AJZA 4META 4RDUA 5GLZA 3FM3A 1V6KA 3C2GA 1C8M1 3RIRA 3AM2A 1XS9A 1GUUA 4LHLA 5L3GA 4O65A 1W5CC 4ZKTB 2LKSA 1MZBA 2GLOA 3S6PA 3J7HA 4HMZA 4B8XA 4A12A 1JU4A 1Z7S2 2E1CA 5C8WA 2FCVA 1ENRA 5CA6A 2ID4A 2BEOA 1CN1A 1W7PA 5LD2C 2H1KA 2ID3A 1DHKB 5LGNA 3OPZA 3H0DA 2KHMA 2MEV2 1LR5A 4RGXA 4XRMA 2YU1A 5D8AA 3J80K 3QPHA 1K5MB 4AOCA 1N1TA 1KGSA 1ODMA 4I01A 3ELKA 5IT6A 1D5VA 1WMXA 2WAAA 4Q5OA 1ZYBA 5GZGA 5I91A 4YIFA 1IO2A 4HLTA 1GZTA 3HSRA 3I58A 5E3OA 5M3MJ 2XSDC 1RR8C 4HSLA 4Y20B 1RUH2 4I6ZA 1BIAA 4CDUB 3MIBA 4MO7A 3CJIA 4GQ7A 1OLQA 2DTYA 1X3ZB 1E0EA 4Q0UA 2XUBA 4OINF 1L7LA 5EHDA 4EZ4A 4M3CE 2VCMA 2OX0A 2X8KA 2GAUA 4QX1A 3QH7A 2CU5A 2ZSIB 3QWLA 2KIFA 5B1AH 1MVEA 2UYBA 5IAVA 2VMFA 1VBA3 3CCQI 1LOGA 1B8IA 4IGQA 1XPXA 4PJMA 2NM1A 4S2FA 1PMHX 5DAXA 4A93J 4N43C 4LKFA 1XSVA 1PIV2 4AI1A 5EEHA 4FCYA 1MH4A 2KPMA 4A5MA 5E16A 1IW7F 1LJ7A 5JCTA 3OR2C 2CNAA 5FKOA 2Y8KA 1TMF1 2AYHA 1W5SA 1ETOA 2RQPA 5H9RA 3BLYA 3WHCA 4EWAA 1YLFA 2PYTA 3IWZA 4XF4A 1BQPA 1LEBA 3VGIA 2LBFA 3ZR8X 2LY9A 5C8CA 1D0ZA 1O3SA 2DT5A 1EH6A 2DFHA 2HWC2 3MAJA 2NS0A 1BBT2 3R4KA 1FMD3 3UETA 1V3FA 2K40A 4AI2A 2R1BA 2V72A 3V4GA 2HEOA 1W2TA 2LG4A 3Q9OA 5FR3A 3F0CA 1OOPA 1FMWA 4M74A 1ZGAA 3MBWA 3OS1A 4CUGA 4M3CB 3GTPJ 2VXZA 3MI8A 3X29B 3NO8A 2WNOA 3ABZA 3JCIA 3S1MJ 5IK5A 2GXAA 3FXLA 1RC6A 1U5ZA 3GM8A 2M4KA 3J7NA 1BIBA 2UURA 1ODNA 2NYYA 1E2XA 2C6SA 1UW8A 4FXGB 4GZ9A 1AZDA 5A80A 4FXKB 3FBNB 5A2QZ 1DPUA 4NAMA 1QRYA 1MJBA 3ZXKA 5KCMA 5FKKA 4NWWA 4V2VA 1OLTA 3EYYA 1K5MC 1HXS2 3HQRA 3SH5A 1S0EA 2BOIA 2YPRA 2DU1A 3WX5A 1VTNC 5FQ0B 4JAAA 2F5DA 4QHOA 3MFCA 2LREA 3NNGA 3H1WA 1ACIA 5F5QA 1I50J 3D3AA 2YFZA 4AEMA 1FC3A 3RZZA 3GUDA 5LA1A 3PSFA 1FYUA 5F1JA 1E3HA 2ZJQF 1S6LA 3EB7A 1XDSA 3K10A 1QHDA 1RUG3 3ECOA 4CDUC 4YWAA 2RVCA 4U0WA 2XBO3 1G6NA 5J47A 5C4WA 4NVPA 5ABJA 1OLME 3D8CA 5L9VA 3VODA 3W20A 4BIOA 2ZXHA 3U4SA 4MFEA 3D0JA 2RDSA 5CNAA 3U37A 5IUQA 2H6CA 2OCEA 4RLFA 4UFJA 4ISQA 2QKDA 1F2NA 2EICA 4AIHA 5FYHA 4A3LJ 2Z5WA 1WLTA 1RUC1 1ULFA 1BW5A 1W8FA 4JKKA 3I7DA 2XPVA 3VBHB 4FAHA 4CDXA 4LT5A 3KFWX 3KP5A 3A4CA 1HKQA 4P9YA 2XRLA 4LA2A 1W1WE 1TVGA 3HEIA 5FZ9A 3AMMA 1XCVA 4Q27A 3PQKA 5A7QA 2IT0A 2ZGLA 3BB6A 1IAWA 1OCZH 2F6BA 3THDA 5FYUA 2FQ4A 1ZBE1 4Q0VA 4NQWA 4DFSA 2RR12 4EV0A 5C3QA 4L5JA 3ZN5A 4OHXA 5CISA 5EDNA 1YI2I 1QJU2 1R4MB 4AGGA 2V9KA 4A3MJ 1NLQA 2CQQA 3LEGA 3M3QA 3I4IA 4WM7B 4ESFA 3ZN1A 1RVF1 1CAWB 5FXVA 2IUWA 1IUFA 1PZ7A 5LBFA 4ATEA 1ND3B 2VZVA 1WCDJ 4QPOA 4NHYA 1EAH1 3E6BA 5FPZA 4H7LA 5CG8A 3BGAA 4IEWA 3CDHA 1POV1 2BY3A 3ALQA 4GA9A 4A3CJ 2M2EA 4XJZA 3ZDSA 3N36A 2C26A 2NPIA 5CPRB 1ZG5A 2E6VA 4IOCF 1JTYA 1O57A 3OYHA 1ASJ2 4AFAA 2FA5A 2RS51 4Y22A 5APAA 4Q4Y2 4P9UA 4BJTA 1R58A 3BTCA 4UB6C 2WBMA 3WP4A 1K78B 1UAIA 2QQKA 2YG0A 2P3KA 2CU7A 1RUE2 1VR3A 4HSJA 1T6BX 2F2EA 3F22A 4NHXA 4EQVA 4NC8A 2YY1A 2VKVA 3LWCA 2ACJA 4RHV3 3O1RA 1OLRA 1VQ9I 2R0FA 3I97A 3N7LA 5KHHA 2VOVA 2OW4A 2Y0OA 3T2TA 5A3PA 3ZMSA 1HB3A 1GDTA 1XNCA 4QT6A 3GTGJ 5FPXA 4DXRA 4M9ZA 2Y9ZA 2PHXA 4LUMA 5IVBA 1WGPA 3K4ZA 5GJ6A 1R1A2 1JW6A 2YC0A 1Z0XA 5KWRA 1HKSA 2VXJA 4DZPA 4EJTA 4BBSJ 2OV7A 4FTHA 4ZS3A 1JHHA 3RRDA 1Y0UA 5I0DA 5FZ1A 2WNUA 4QDSA 2SBAA 3M8LA 4HG6B 4QX0A 4I09A 4ZYGA 1IN8A 2OZ6A 3SJMA 2B46X 2Y6FA 1CWPA 2X05A 1ZG3A 4DOUA 5ICEA 1QQP3 4ETSA 1WGXA 3JAMK 1VBC2 1A6IA 1DU3D 5FYBA 4D0PA 3O1OA 4X8PA 1TC3C 4B3NA 1UHSA 3F8MA 1C5HA 1W6OB 5IK4A 3PURA 2NNYA 5EYXA 5CKNA 2HWD2 1EV7A 3MW2A 4QDRA 5C3SA 3K70C 1DGRA 2P34A 1MJAA 3POBA 2CGNA 4IO9F 2WZ8A 2VQGA 1XE7A 1IGNA 1CESA 2UU8A 3F6VA 1DGRN 3NWSA 3WV6A 3POYA 1R49A 1CPMA 1AYN3 2R0QC 5FZ6A 1WJBA 1D2SA 2M3AA 1YS7A 5A1LA 3HR9A 3FXKA 1ZX5A 1JKOC 1IV8A 2RV8A 4WM7C 1E3PA 3VBRB 3WW4A 4LBNA 3WNLA 1NHAA 1VBB1 3BOQA 4XFFA 1QMJA 4IJAA 3T3YA 1W0PA 1XE0A 1UG2A 4OFGA 4KIGA 4XUTA 1ND3C 5KC6A 2Q4SA 3WU0A 2DBIA 1TNRA 4Q1RA 1XE8A 3MV11 3HBLA 1NG0A 1CJPA 4DINB 4QPIA 3FFZA 1SAXA 1TBXA 2BUKA 2COBA 4UVBA 2R7OA 4LJZF 1MR5A 3CLQA 2EA7A 3F8NA 1LOFC 3ILNA 1MMSA 1I5ZA 2GC0A 5DYMA 3DYPA 2DVDA 4IEZA 2RV9A 1FNYA 1BI0A 2DDBA 2RDQA 1CX4A 5C4JJ 1IGOA 4XFHA 3DKXA 1W0TA 4MSVA 4JC1A 2VQHA 1DP7P 2HDCA 3BJOA 4AWXB 5KNLA 1MS9A 4E7ZA 2ZTNA 2J42A 1OFSA 2IXJA 2R072 4D7NA 4FP2A 1GANA 1EH7A 3ZXLA 2LC2A 4HX4A 3KEQA 5IOYA 4N4NB 1N1YA 5A6XA 1B6AA 1ON1A 1P4WA 1IKPA 4CZZA 3G1OA 4P9WA 3KWVA 1JTZX 5HV0A 2XASA 2Z42A 4N90A 3SKVA 4ENJA 5G05L 2WZR3 4KJZA 3AK0A 3UKTA 3E5XA 5ILVA 3H8UA 2FEZA 3H9GA 1FSEA 2OC6A 3A2KA 2YX4A 1XU1A 3JSPA 4PI0A 1JZ8A 3MMYB 2QNKA 5GZCA 5FZ3A 2YMZA 2Q8KA 3WP6A 4AEDB 5DG1A 2VC0A 4J01A 3GCXA 4NIGA 3JR9A 2VR4A 1JZ4A 1VRH2 5A6ZA 4JRAA 3LAGA 2WFF1 1REPC 4UT5A 3ZQCA 5JZGB 3ILRA 1S29A 3N35A 5FMOL 4OUSA 3E5UA 1LGCA 4YW5A 4Y4RA 1T08B 1A34A 5HLHA 3VDXA 1UQXA 2VC1A 2NLRA 4ZC3A 2OYZA 2KFDA 5DAQA 3KGLA 5KVRA 1UY3A 3ZYPA 1SFNA 1OUXA 1STZA 3CCVI 5FY5A 4O9GA 4UAPA 5JFRA 1POQA 3PTYA 3M07A 1O7LA 1H8TA 1Y4WA 1W3VA 4PFPA 2WNVB 1OPOA 3NJXA 4LD5A 1SBDA 4QPGA 5GLVA 3VBRC 2IGMA 1PO22 4OAZA 1LODA 1VQ7I 5HOOA 5K7ZA 1XSDA 3UESA 4XMIA 5FPVA 2E60A 4G6QA 1JYXA 2DA1A 4J19A 4BNCA 2BW3A 4AHWA 1JKQC 1BI3A 3BPXA 4LK1F 3SDGA 1W36D 1QKQA 3H9QA 4XFBA 2LVSA 1RKWA 1W6PB 2RE9A 3QCWA 3REOA 3Q9SA 1JT6A 1YXWA 2Y0SN 3HHHA 2YBSA 4BISA 5IT3A 2F5FA 1QNWA 1EAH2 4L0YB 2VU9A 3BTZA 3EUHA 4HF2A 3I53A 4RS8A 2JENA 3IAQA 4KH9A 5CFDC 5BNQA 5FDBA 1AR83 4E6KG 3F2ZA 1GYKA 4AF9A 3GXOA 3F23A 3TEXA 3AYEA 5ILSA 1FX5A 4XICA 3A0BC 4PIZA 5FYIA 2HWF1 3VUOA 2XAFA 2ZZQA 1Y6IA 1KDKA 4M4PA 3BC8A 5LRSA 4XCAA 1EH8A 1VAMA 5EXOA 4IEUA 5HLGA 4EGYA 4K7JA 3ZXSA 2XV4S 1Z05A 3E97A 5JI7A 3ZMDA 3SZPA 4NE9A 1W2AX 3W58A 1ETQA 1UZVA 1O5LA 2VOKA 4UYBA 5A1FA 3HOYJ 3GZNB 1DZQA 5EZGA 1UPIA 4RHV1 5E1ZB 4AFBA 4YZ1A 2JKXA 2Y75A 3F6OA 1NE6A 2N7GA 3S15J 3CJNA 5IVVA 5F64A 2XWJB 1FJLA 2J5OA 2IGNA 1NOVA 3L9JT 4UUSA 2R062 2Y6KA 1JGSA 5FRNA 1TW3A 1F4KA 4ZJZA 4AQSA 2QBYB 2QUOA 3N4MA 4XBLA 2UWBA 2M0CA 2DCYA 5F6KA 3AG3H 1DQ2A 3VBSA 4Q2FA 4LBQD 2XJTA 4C1WA 1U5IA 1OCPA 1HRI3 1XYOA 2Z2SB 3NV3A 2Q8DA 5JZGC 2XF6A 1SLLA 4XTMA 5FZOB 3JTHA 4N9IA 4LKSA 1G86A 5HDKA 1KJRA 4YG2F 1B35C 3UKNA 3IRRA 3I2IA 1AR63 5FZGA 4A3DJ 2LKPA 4P9GA 1BR2A 1H2LA 4GH4B 3ZMNA 4XLPF 3I55I 5FZDA 5DPNA 4D1QA 2IAIA 3NKTA 2EIDA 4NRPA 1WD4A 3TL4X 2WNVC 2ZGMA 2Y2ZA 3OL4A 1ETYA 1AUYA 2GWRA 1ZELA 3K4BA 4KWUA 3IL2A 3FLRA 4DYQA 1AL23 1LRHA 2ES3A 2I45A 3LDRA 4KI5M 1X1BA 2BE5F 2VZQA 1ZR2A 5F6LB 2DMPA 2UV1A 1SVMA 3PL0A 5FO5A 1J75A 3ZYIB 3PM1A 4KMUX 1DIWA 2JDMA 4YW6A 4F91B 1LULA 4ZTFA 3CMMA 1GZCA 3C2UA 4Y4YA 5FWEA 1YJLA 1HQLA 5FYMA 3S14J 1FI2A 4F8AA 5FJ8J 1BCXA 3VV1A 3TMOA 2WRAA 5GKAC 3S30A 5FTTC 2ZJ2A 3ZO0B 3FHZA 1W0OA 1GV5A 1DCSA 3UGHA 3AP9A 2HYGD 1WMEA 3KP3A 3CZ6A 1AYM1 4JRLA 4XOGA 4BQ3A 4JGYA 2L9NA 3VKOA 4LKDA 3GCMA 5K5RA 3JU9A 3CC7I 4CDGA 1PUFA 1CX1A 1P4XA 6PAXA 2BYVE 1DP0A 4RFRB 2FDHA 3DP7A 5TSWA 4EWDA 5IYBJ 1FV3A 4ZU5A 4LJHA 5E3LA 2P5BA 3C7GA 1PMJX 5GAHJ 3EXUA 1SLTA 5FZAA 3GZUC 2CW8A 5FUPA 4XIOA 3HPHA 4RB0A 1ZZCA 1TME2 3FZVA 4NC7A 5AIQA 3K77A 2RJKA 3WTUC 2GOXB 3BTAA 5BY5A 2E35A 2DFIA 3AKPA 3T1BA 1V6LA 3EMRA 2ZOEB 1TWGJ 5T5PA 3VD3A 1LVAA 4OULA 4I3PA 3WQBA 1L3JA 2IC1A 5FMOS 2XAGA 4RQPC 2RC4A 1WFXA 5FK8A 3FMGA 2KDZA 4LLFA 1X3WB 3ZXJA 1CZVA 4MTDA 1GNYA 4YVWA 3TYJA 3GCWA 4ZYEA 3GHMA 2B9UA 4M4RA 2MHFA 3SEZA 5LBCA 3VZOA 2WFF2 1D4M2 4BLIA 1OJLA 3VYUB 2HWB1 1ONAA 1IRZA 3H35A 3KZYA 1G7YA 1CGPA 5FY9A 2BY0A 3ZFFB 4GH4C 3NQHA 4UOJA 1VP6A 5J37A 3PFIA 1UCRA 4RR3C 3DECA 3WHTA 3VFZA 3AZXA 1LOAA 2JIGA 2ZZJA 2HLEA 2C0ZA 3KVAA 4DUWA 5KXCA 3EDPA 3E5QA 2JEMA 4V1PA 2ZNZA 4FPJA 4TYSA 4LBMA 4UV9A 2W52A 3WTTC 1NCQA 2HOTA 3V56A 2VUJA 4K6BA 4B8EA 4XBFA 4W6YA 3SEQA 3G1LA 3HBZA 4CA0A 1YQAA 4XN3A 4LK6A 3H5AA 2XDVA 4A3KJ 4AC0A 4NC6A 4ORFA 1WVRA 2VE1A 4R9BA 3SHFA 3MFKA 3C2HA 2WO3A 4D6RA 4HF1A 3I8TA 2KXLA 4A3FJ 3HTUA 4RB3C 5IHRA 4ZZLA 4QM8A 1UY4A 4INDA 5H9PA 2Z9OA 4IUGA 3VBFA 3ZGKA 3OUHA 3MW4A 4YRVA 4KICA 4PSWA 3PMEA 4F3QA 1J59A 3USSA 2W1OA 4HPQA 2A71A 2C4XA 1JODA 3IMNA 2ZXWH 3I2HA 2UY9A 3BCAA 1NE4A 4LE3A 2KQRA 1Z6TA 1BOAA 1V54H 4QXHA 1ZLJA 5LK5A 2ELJA 4A3BJ 2WWYA 4L8QA 1YNAA 1E57A 4AHZA 4A3ZA 5F5CA 2G4IA 1V9U2 1I1EA 1W9TA 4Y15A 4RAFA 2CGOA 2B4KA 4RB1A 4CDWA 2LK2A 1QH6A 2IS6A 1EUUA 4PJLA 3FXJA 5FD5A 4BQNA 4FFIA 3ACHA 2KZGA 3P3NA 4D8MA 3GBFA 3OOXA 1DG6A 1YUDA 2IXHA 5FP3A 2XAUA 4QU2A 1M06G 5JHUA 2VPLA 3OUJA 3GO5A 3WG3A 2DU9A 4BOWA 1H9TA 2WS93 3OGJA 2CWSA 1IV6A 1LNSA 3WE3A 1QGPA 5BMZA 2AUYA 5FYYA 5IAXA 2XF7A 2C24A 5IT9Z 1WJCA 5CVRA 5I8SA 5C9AB 5L7OB 1HLVA 2Y6HA 5D5UB 3R0AA 3WCRA 5BNOA 5CADA 3HOWJ 1A8DA 2N8GA 1A5JA 1JYIA 4K1ZA 3ZVXA 3TOAA 4AM3A 3AYDA 1U8BA 1HRV2 2K4JA 2DFFA 2QQ8A 3LA7A 3B9IA 3LQRA 2WAQN 2IXLA 2L54A 2L7ZA 2WJSA 3G1MA 2P2KA 5E18F 3FBYA 1CVNA 3ZFFC 2AC1A 3FLPA 4URTA 1S55A 3O1SA 5L9RA 1Z7LA 3IAPA 1PK6B 1VRBA 3DUIA 5J96B 3C18A 5FGMA 2R5ZB 2ZMEC 4KT6A 2XMLA 1T2XA 3C3WA 4NWVA 2VJ5A 1XNBA 2H27A 4UW3A 1O5UA 3AP7A 5EEGA 3MLKA 1HN1A 2WUHA 4IEOA 4NAOA 3HT1A 1SCSA 2VNVA 2QCOA 3PNYA 4RS5C 4FHTA 1ZH5A 3ACGA 1YJWI 3I3QA 4CEYA 3M3CA 4IXLA 5A3NA 4V2WA 3GTMJ 2DCKA 1FX7A 1JHFA 1A6CA 1RUD3 2VCCA 4CO8A 2B9SA 3BI3A 4Q4X1 1W05A 3CUOA 3M3YJ 2LR8A 4RQPA 1SFKA 1HQNA 2A1XA 5JHFA 4UW5A 4XORA 3JRHA 1WHUA 4I3GA 3AFHA 4IGOA 3VDDA 4XKBA 2R49A 2PEXA 3BIEA 3K3NA 5FP7A 2P3YA 5IY5H 1DF0A 1PVC1 4E7SA 1F5TA 2P17A 3NRUA 2HTSA 4ZU7A 1DGWY 1SD5A 4TTGA 2ZS6B 4OI4A 1R9TJ 4A3IJ 3QU6A 1UXZA 3BR1A 3RZOJ 4PJYA 2OUMA 4IL6C 3DWLE 5EJCA 1DGLA 5FPBA 4MHGA 2EZKA 2SLIA 3IAM2 1V5GA 1I39A 1OMIA 2DPDA 2K9LA 2X48A 5ICFA 3S93A 3IM0A 2KA3A 3O1UA 4B4PA 1X2MA 3TNQA 1R1ZA 3LB9A 1OFCX 3APBA 3O0XA 3MV01 2DF7A 3T0BA 4GYIA 3H8RA 4LITA 2ZO4A 4H0EA 5TISC 2RDPA 5CKMA 4IEPA 5C9AC 3GZ6A 4COZA 1JZ3A 3T2QA 4HPKA 1DQ4A 2RHPA 3L7WA 3MGUA 2I8DA 3OYWB 2RKHA 4JV4A 1EV13 4KFCA 2G7HA 3WUDA 3OYBA 2RGVA 5FZ0A 1LVKA 1FXZA 1VI0A 1BR1A 2P4WA 3LOCA 1DYOA 4LULA 3ZQHA 2R7FA 4YFZA 1ZNPA 3ZFEB 4OI1A 3DBLB 1FMVA 1LPQA 5A7SA 2HWB2 3WG7H 3ESWB 2VJJA 1OXCA 5AFBA 2EIMH 5GADJ 3DKWA 4J1WA 3JRIA 3M8EA 1KGYA 1PK6C 1W6QA 4OZOA 3K2OA 3WY6A 1CPNA 4BXUA 2VKDA 3N3HA 1KDMA 4FVVA 4PIXA 4E4HA 3RCOA 4CHUA 3T1LA 2BDRA 5BNPB 3H1MA 2UWCA 3USUB 2LTPA 1YJNI 3KSCA 5E89A 1CAVA 4IL7A 2OD5A 2JA6J 2DMUA 4D0QA 2A5WA 3SEEA 4AVAA 2LH9A 4Y33A 3SFIA 2XL7A 3OYJA 4WWCA 2EQRA 5FXZA 5AFEA 2O6GE 1J58A 1WI9A 4XJAA 4NJ4A 4GCVA 1N1VA 1UKGA 3ZYBA 1QOTA 2BXZA 3TN91 1C4RA 1GNZA 5CKQA 2GA2A 1ZZ8A 1LEDA 1HDPA 4II3A 1R1UA 1K12A 3K6GA 1J7KA 1REDA 3KCYA 4PCQA 2HXIA 3P5JA 5CYYA 1MMGA 1MBEA 4XW3A 3BCBA 4EJVA 3I2KA 4EM2A 5FO7B 5K5QA 3AL5A 5ISLA 1UCXA 2NOGA 2LP0A 2F17A 5GP9A 4GMP0 1SBFA 4OMYA 1IRFA 3KT1A 3DYOA 5LEJA 2YDEA 4MGRA 2FQ3A 3WD5A 5HDGA 3PIGA 5H2FC 2BVVA 2VOXA 3HOXJ 2OA4A 2P5LC 1V5FA 2DQRA 5F3CA 2VW1A 2D5HA 1LENA 4AW7A 5JOZA 5CEHA 1JUSA 2X6XA 1GV2A 5HODA 1MMNA 1BC8C 4LO4B 3QODA 1VFCA 3F8FA 1H30A 2XSJC 2GP3A 4Y1ZA 5IYDJ 1XCBA 3D0SA 2YXSA 2L5QA 4Q4V2 2E5NA 2NNNA 3KB5A 2WB1A 4EYUA 2F5EA 1J84A 3RWNA 1X1AA 1QHGA 3VD7A 3KIOA 1I1GA 3CIHA 5JXGA 4CDQB 3WNPA 3LCPA 1WMDA 4EN8B 2OBPA 2WB1N 2K9NA 3IDCB 2FJ1A 4N7IA 4GWIA 2IWGB 2WKKA 1JZ7A 1J1TA 3W3CA 4WM8C 2EAKA 5JDBA 4H7MA 4KITB 1TEIA 3B02A 1R092 4IRIA 3OBRA 4AK3A 3ZFEC 2BV6A 1Z9CA 5C5TA 4BBRJ 1IZ3A 4BQ4A 4RM2A 1OQEA 2IXSA 2OTJI 4J1XA 4MUVA 5J1UA 3OR1C 3GFMA 3INAA 1XSXA 4Y24A 3V8KA 4EN6B 1R00A 3IMMA 3NAPB 2GC2A 5BNPC 2G19A 1QVUA 1UX6A 1U0JA 4D7TA 2KIMA 1RRJA 2VJIA 2Y0MA 4UUVA 1Q8SA 4L9BA 4OWRB 3I2JA 5BNNC 2L2OA 5EJZB 3WDUA 3KLNA 3AYAA 3GJBA 3FMRA 2GMMA 3GFJA 1WLCA 1ZKGA 2QGUA 4U0VA 3FKJA 4G3YC 4MZUA 3ZSEA 2Z1DA 5DUXA 4N7UA 5SV5A 3OYAA 2X85A 4PDWB 3WGGA 1VMHA 1MSFC 2E51A 2WABA 4XNFA 3GTJJ 3DTIA 1GP4A 3RS6A 1YEWA 4NNJA 2TRTA 2XROA 2XIGA 3WGIA 1V6IA 4FETA 1MBFA 4DY5A 4E70A 1RUJ1 1HA8A 4R9CA 5H6QA 3MICA 3ZMTA 3OGGA 4CXXA 5FPUA 1XJAA 2A5YB 4QGNA 2P6CA 3ABLH 2D3SA 2QQVA 4PGHA 1U0AA 1XSQA 2ZKNA 3WF4A 5DUVA 1Z67A 4G4FA 5JVTA 1DGWX 3OB8A 2PTMA 1FSHA 2NP0A 2VC9A 3W9AA 2KJBA 1D0HA 3M3EA 3CP2A 2KM2A 1IQDC 4ITCA 3LA3A 1UOJA 3RI8A 2NVYJ 1BBYA 5J09A 3LZZA 3RPUD 3NJVA 2JIJA 4HXCA 5DCMB 1WCKA 2YU9J 4LBQA 4MEYF 2OQRA 4M3CA 2VQLA 2CS3A 2K9MA 3FXOA 4U7BA 1QF3A 3CC4I 2A6ZA 2XAQA 3P3PA 5FZIA 3PHMA 3SQOA 4JGZA 4NBQA 1DU0A 3BJAA 4LLGF 1X8MA 2AGSA 5DCFA 2JPBA 3RYKA 3HSEA 3OGRA 2OJED 1ZLKA 3B94A 2E19A 4I2OA 4DXTA 1TQ5A 2E31A 3PO2J 3IDEA 3NWKA 4IEYA 1IKQA 5M3FJ 4E8CA 4CXYA 2HQ5A 1LU2A 3POJA 2NN8A 2FXAA 3J7ZI 4AG4A 1G3TA 5K5OA 1AJKA 4CEWC 4FFGA 5DDJ1 1KA8A 2W1SA 1RHI2 3ST7A 4EVIA 3KP6A 1FZPB 4Q4W2 5E1WA 2R7DA 2DUOA 2IXIA 1WCQA 4BQQA 2PAMA 2DDAA 5M0TA 4NO4A 5GAEJ 2V6CA 4D5CA 1APNA 4M6YA 3LDKA 4XFAA 4NR1A 1PYVA 3F8CA 3UL2A 2HI3A 3SCHA 1J3RA 4IQJA 1IDYA 4JX6A 2RS13 4BHPA 1IUYA 1X33A 1RUI3 4YEJA 4A42A 2UYAA 1MIJA 3DXTA 5KR7A 2WO2A 3T4VA 3ZR6A 3NAPC 1SEUA 3ZIXA 1H0MA 2Y33A 4JX5A 1US2A 2GXBA 5D2AA 1GZWA 2DOFA 1OBNA 4BL0B 3F72A 2RS33 1UIKA 3K3OA 2VE8A 3SCGA 2YUEA 4FOVA 4QDQA 4A6SA 3FK6A 2VBPA 1I1SA 5J48A 1GMMA 3FXQA 4ZYAA 1UMIA 2R32A 5JR2A 1MDMB 3VBHA 2WQ4A 3S8PA 4XABA 2IZWA 4OCTA 2JWPA 3CCEI 2OA2A 3IH4A 5FREA 1VQPI 1PGL2 3I56I 1X1PA 1SLCA 1NCRB 5BUVA 3M9AA 4HG2A 1QNYA 5F5IA 2DXIA 3LAPA 1VLNA 5FO8B 2YPDA 4O61A 2Z69A 2VXDA 2MYSA 1IN6A 1IS5A 4JQRA 1RUF2 5E88A 3WINE 1WW6A 3JAMZ 3LIGA 3WG2A 3F3XA 2F6CA 3WDTA 1QWRA 1HIXA 1VAKA 4XOTA 4WM8A 5EPAA 3ZQQA 1RMU3 2DT7B 4ZDPA 2WV1A 1RXGA 1XN7A 5GPAA 1EUTA 1U5XA 3GBGA 5C4XJ 4FOYA 2ZEWA 3VLBB 1LHOA 1PNGA 3J7AY 5LW9A 3F9KA 1OH3A 3J9SA 2M9HA 4RD7A 3I2GA 4E2QA 4EZHA 4XRFA 3QH6A 2IRFG 3HOVJ 3ZYJB 2P7VB 4HDUA 2BBAA 4NHLA 1ZA7A 4M72A 1FT9A 1JH5A 5FYCA 2P6TA 5IYCJ 3SCFA 2B39A 2VBXA 1IG7A 3J7AO 2LRDA 4DJAA 5DQ0A 5DUWA 1WA4A 5SV8A 5BNNA 3P9KA 2Z3YA 3H3VK 2ZCWA 3KZIC 3O1PA 3GNEA 1OQDA 1SDWA 2VMIA 1IXCA 3CMGA 1JU3A 2Q30A 3OSGA 1MW7A 2A70A 1K78A 4GIQA 2O0OA 1BVVA 3B9CA 3CDZB 1HDKA 2A73B 1PZ9A 4RM3A 1FLIA 2CDPA 3H8OA 1YC61 4P9JA 2STWA 4ARXA 1TP4A 3VBUA 2XVGA 1S0IA 1IQAA 3FZ3A 3O1MA 2YROA 1VQMI 2LNBA 4FTEA 1YW9A 4EGZA 3QBQA 4WBBA 4Z07A 3VYTB 1O8SA 4ZYDA 1UB9A 2PMUA 1J0RA 4NROA 2ZX2A 2Q2EA 2WT2A 2V4VA 4FP3A 1WW5A 5D21A 2TUNA 4YYOA 3SKJE 2EJRA 3IUOA 3DPLC 1OKRA 2LSOA 3KQ4B 3AKZA 1WWXA 1FMD2 1ULOA 5FKNA 1QGLA 2FMLA 2IFWA 2VD7A 1EY2A 5E3MA 3AXEA 1MJ9A 3J8F1 5J1RA 3H5RA 3VZLA 3FHQA 1BI2A 5L3FA 4XLEA 3DBHB 4LBJA 4EN0A 1MACA 1OI6A 1OD3A 3D6EA 5HS8A 3X2QH 2E7AA 5A7OA 4Y5Z0 1US3A 4UXNA 1SPPB 3ACLA 2MLKA 4YW3A 3Q8CA 3I4PA 2XKPA 3ULQB 4QB6A 3VDBA 3U07A 2IXCA 1ZAOA 3MLJA 2C9AA 1S0DA 3L2WA 1GVJA 3CEWA 2L9RA 2VZSA 4FQ4A 1IC8A 3AJYA 2KKOA 4RFT0 1JYNA 2BVBA 3TEWA 5IP7J 2PLV3 2JA2A 3WP5A 3JD71 2CUZA 4CH7A 1YX5A 3DEMA 2R041 2DJIA 3OIPA 2AR6A 2R92J 3ABUA 3ECHA 2VQTA 4ENKA 1XGOA 4XUOA 1UHWA 3KE2A 3W6VA 2W39A 5C3RA 4E7HA 4HK8A 5L36A 3KVBA 4UFIA 3Q5FA 4IRHA 3ISPA 3FM5A 1LU1A 2YV8A 4D6QA 1W6NB 2EB7A 1RUG2 2HWC3 4LOSA 2Y34A 3EO6A 3VHRA 2XBO2 4IDZA 4ES8A 4JYKA 1YQ5A 1UF2C 1EP0A 4IRGA 1PVXA 3IRQA 1XBFA 2JRTA 3J4UH 4DOZA 3HIFA 2IS1A 1R5GA 1LGBA 3ZKYA 2DUPA 5FP4A 2J1VA 4Z8BA 1ZBA2 2HQRA 1P92A 1SD6A 4BJ0A 5EV7A 3ZRGA 4HLYA 3K46A 3NRVA 3KP4A 1OCOH 4MGQA 3MN2A 4BH9A 4NOTA 3UJOA 3FHAA 3ABMH 5LA2A 1K79A 2G9GA 4FPKA 2BERA 1CF7A 4JTOA 3BR5A 3ASNH 3BTYA 3WF0A 4P5YA 3I71A 1MEC2 1S1AA 1C5IA 1BEV3 2DI3A 4DIQA 1PGW2 2WT1A 3ZFGB 1D7PM 1X9PA 2FOKA 4YGEA 2HKOA 4XKVA 2JDNA 3DQVC 2VQAA 4C2UA 1LE8A 4YVSB 3VBOA 3BYWA 2RS11 4AUXA 3PJQA 5FROA 1FTZA 2FDKA 3F95A 1SANA 4AEDA 4V2GA 2WY8Q 2JVGA 2WL1A 3JW4A 4GXOA 4IV3B 3QAHA 4Q26A 2PJRA 3T2OA 4WF2A 2YS9A 4AFCA 3L2CA 3HSFA 1OR7C 5ILUA 1JOJA 4GRIA 5FY0A 2DK5A 1FOWA 1E17A 1PM4A 2OZJA 4YRDA 3MHZA 4Q48A 4A2UA 2ENRA 2NRAC 1YWKA 2NVTJ 1AR91 1M4WA 4HK9A 3E6DA 3MPBA 2V26A 3U1DA 2D6NA 2IFRA 2P3IA 4P5HA 2ZMKA 3FFQA 4M0NA 1LESA 4V2FA 1U2WA 1O91A 1J1LA 1F1ZA 2WA4A 3NARA 4LKEA 2JUCA 3WQ1A 2E53A 1H1AA 2QQPA 2V9PA 3ONQA 1JMUB 4B43A 4M3DA 5IVJA 4B47A 4XR6A 1TNTA 5BNGA 3OJBA 4BXXJ 2F4IA 2CQXA 4L9JA 4GMP1 5FLJA 5LEKA 1DGWA 5IOZA 1W7PB 1OYYA 1ENSA 1MS8A 2E2HJ 2O03A 2VOPA 2RR13 1OPCA 1SFPA 3GZ5A 4FBFA 1WRJA 2A6VA 4AQ2A 4AGRA 1N77A 4Y3OA 3E1F1 1ACCA 2PHDA 5KHGA 2NMOA 3PFYA 3FWEA 5ERLA 3KPHA 3K69A 3GLLA 2DT6A 2WN2A 4XRSG 4CE8A 2ZAHA 3A01A 1H89C 2OPKA 4CU6A 4ENNA 1YFXA 1C8M3 1UOGA 4IV1A 5F3IA 5E1RA 2Y69H 2XONA 3TO6A 3UNGC 1QQP2 3DFGA 3PUHA 5FWJA 1Q8VA 4OUMA 2NXNB 4C9YA 2D44A 3QP6A 4WVZA 3QYFA 3TWIA 4XMYA 3CJIB 2X9DA 1USSA 5JLXA 4DGWB 1RITA 2EPFA 2ET7A 4LGWA 4AAXA 4RGKA 2JSPA 2EH3A 1ASJ3 2MBFA 3U14A 3OYLA 4XM3A 3FMSA 1Z7S1 4Q4Y3 4B44A 1X4OA 1D4VB 3U10A 5KXDA 4RN5A 5LK7B 3LEKA 2KIUA 2I10A 4DEQA 3OV8A 1B8IB 1RUE3 1UN1A 4TXWA 1TWCJ 3ZFGC 1UMQA 4YZ5A 4YM0A 2LROA 4HW0A 3KHCA 1LEAA 1RETA 1C8NA 3LAJA 4KMQA 5A7WA 4NDLA 1AYN2 2MEV1 2WYSA 4YVSC 3CBNA 1MS1A 4DUVA 4LK7A 2ZBJA 2QBYA 1QPIA 4YW1A 2IVJA 4BY7J 4IV3C 4OUEA 1R7JA 5JAXA 2BWAA 3O5SA 2FU4A 2WA0A 2EINH 4YARA 5FYSA 2HVQA 4QWQA 4CVUA 1H2NA 1JOPA 4CXFA 3CF2A 5FMCA 1IHMA 2LRPA 3POFA 5FZOA 2LBFB 4EN7B 3E3VA 5C8CB 3G73A 4BJ5C 3S2HJ 2M34A 2E2IJ 3PNVA 4ANJA 4COWA 3ETQA 4BK4A 1RUH1 3AKQA 2X5IA 5F2WA 4DQ2A 2RM22 3DN7A 3ZMUA 2TNFA 3VKLA 1OOPB 1G8XA 3LQQA 1MQTB 2E7WA 2A07F 1GFF2 3OD4A 2Y26A 1DU6A 2KL4A 4COYA 5JI6A 2WC2A 4OAYA 4B1MA 2BOLA 4XBNA 2BVMA 1PIV1 1TMF3 4W50A 2HTJA 3DEUA 1KJLA 3PDQA 2ZXQA 5GM0A 3TB0A 1OPMA 2L4AA 5EG0B 4DEVA 1QXPA 5IWFA 5D8AC 3Q8EA 2MG4A 3K2AA 2RMU1 2WZR2 3OWTA 3DPRB 4JZRA 1WSUA 5GTHC 5CVJA 3LSPA 2EWNA 1ZTRA 2VL4A 2WO1A 5JVVA 1W8NA 2V6EA 3ELNA 4YELA 3WHBA 3BTIA 2HWC1 1BBT1 2ELKA 3UYJA 1LHWA 1SFUA 2WTEA 4F83A 5TJJA 2NS7A 1LFBA 3T08A 5DXDA 2W24A 3CJIC 1QHHD 1FPN1 5C4WB 2ZHNA 1SACA 1ZZ9A 1T6SA 2KLOA 3NJZA 1JKPC 4XYXA 2FMYA 4P9IA 5DTDA 1POGA 3BTJA 1WJ5A 4HZFA 4XL9A 2E26A 3CU7A 2DW4A 1IN5A 4OMZA 4QLCU 3F8BA 2XLGA 2QLZA 2JUGA 5FYZA 1B09A 1TE1B 1PMIA 3HT2A 3ERMA 5D5WB 1LAJA 1GZ9A 1ZN2A 2VJ4A 2ZXJA 3GTQJ 4CDXB 3FX3A 3NV1A 3I3LA 4WVWA 4OHWA 1GLNA 3M4FA 3LSHA 5A6QA 2L0KA 3CCRI 3L2VA 4PJNA 3TW7A 2CO5A 1BVP1 1HXS1 3E0JB 1CD3G 1E5IA 1BZWA 5IVYA 1CAXB 3T0DA 3BR3A 2EA4A 3RPUA 3AZVA 4UF0A 2LF7A 3VEPA 1ZREA 4NQWB 2EV5A 3BCWA 1U5TA 3THTA 1ZZ7A 5HCAA 2ZX4A 2LF8A 1MMDA 5IP9J 2QSGX 2FDIA 2PN6A 2B8MA 5EWSA 4KU7A 3JXSA 2XAHA 5FZEA 2FDJA 2HFHA 2ELHA 3PVBB 3G6JB 5GPCA 4IHTA 4WVMA 2VUDA 2JE9A 4MXWA 1OOPC 1T33A 1VRH3 2VO5A 4AR2A 1ZZ6A 2HEWF 5E79C 2R5YA 2W08A 3QU3A 1AR82 1KYWA 4HT1T 2CFOA 5J7MA 1RUC3 4J6GA 1SFOJ 2WINB 4Q4ZF 2D5FA 2DVBA 3SEPA 2JE7A 3ZXEA 4Z2AA 5B1BH 2IXKA 2BV4A 3BG5A 2ZJRF 4A6DA 2V79A 1DDNA 3BR2A 1ZRCA 4F55A 4RBOA 1REFA 3N7KA 3KP7A 3GZAA 2W82A 4LQRA 3C7FA 2CUJA 2KDOA 1YJKA 3I2FA 3K1NA 1XMXA 1NY72 4ZH4F 5LFAA 1C1LA 4DO0A 3EYIA 4HA8A 3KLOA 4Y22B 1GBGA 2ZEYA 1RJ7A 1O4XA 1HOMA 4KIBA 2V1XA 1YIFA 3OBTA 3J7YJ 4XPVA 5FB2A 2BTVC 1I9RA 4D94A 1R082 1W99A 1RVF3 3V42A 3LE0A 3TEZA 1QJU1 2R93J 5FMDA 4YPJA 1SVLA 2ID6A 3TAYA 1ZQ3P 4CCLA 3PIJA 5C4WC 2ZFUA 3CCYA 4HX8A 4CUBA 5ABJC 1NUKA 4BPZA 2XHKA 1HRI2 2ZHLA 1HX6A 1EAH3 3D5SC 2FBHA 3QOEA 5IPAA 1S2BA 4RYDA 3NAUA 2X29A 3ZQ7A 1POV3 2DCZA 2VBDA 2I07B 2DFEA 4HSTA 1SHWB 2W84A 4BGDA 4GDFA 1AR62 3ZYRA 1S7EA 3H9JA 1Q1HA 2EIEA 2OZUA 2RS53 5HS7A 2EIJH 3OEAA 3R05A 3DCFA 1S3JA 2ZACA 4Q0QA 4CDXC 5ACA2 4QM9A 4G6TB 1KFUL 2PLYA 1D3YA 2K9SA 1WA6X 1OYIA 1ASJ1 4JTNA 4NPMA 2B63J 2IVMA 2ZGKA 2P6SA 4B3XA 4M9XA 4SBVA 3QYBA 4Q4Y1 4A6OA 1HSTA 4ZU4A 4E4SA 1AL22 1ITYA 4WCGA 5LZ6A 3D4KA 4QXKA 2BW8A 1RUE1 5L7OA 1UYPA 1T95A 4M3BA 2V9VA 2IGOA 3MVPA 1NA1A 5FY1A 1ULCA 5GAGJ 2JDAA 4HAMA 3AC0A 2ICWG 3M70A 1ULGA 5CBLA 5IVEA 4C2MJ 2IW5A 4LORA 5IP6A 4HSRA 1EPWA 2GC3A 3WEZA 4AEKA 1R1A1 1UOBA 1U5YA 3I3DA 1Y3TA 1DFQA 4WZCA 4E7LA 4A45A 1G9DA 5CQEA 1HKTA 2Z4FA 2C9KA 2GNDA 4LK0F 1TLHB 2ZGPA 3PJYA 3HGYA 4A3EJ 1OQ1A 1KQ0A 4XUNA 1JZ6A 3RDIA 4M3GA 3C7EA 3K1MA 1VBC1 1RKTA 5BPDA 3WCSA 1DUXC 1OUSA 4AFDA 5KHIA 4XQFA 4I02A 2ISYA 2MH9A 5FLXK 3ETPA 4YGBA 1Q43A 1VE0A 2JB4A 2VODA 5LGUA 3WQ7A 2HWD1 3SH3A 4G6DA 2PHRA 4N9HA 1P9QC 1HSJA 4OI0A 1HW5A 4MVTA 3U4XA 3H5NA 3WR0A 2F4PA 2HYKA 3SFZA 1GOHA 1JKRC 1H9GA 4CUAA 4ATFA 5EF6A 5IFPA 1A78A 4AVCA 2DU0A 2RMU2 2JQ7A 4AQTA 2R4GA 1VBB3 2E7XA 2VULA 2RDRA 4QQHA 1XD7A 2O14A 2DK8A 3DPTA 2CJJA 2ORZA 4A3GJ 1GOGA 1K45A 3LSJA 5DD8A 5CKTA 2HYXA 2QQNA 3B69A 1YRNA 1QDCA 3AG2H 5J8FA 2YU3A 2PMHA 1LKXA 2CV2A 4IKFA 2A5ZA 3MW3A 2TBVA 2IA1A 1XNAA 1FPN2 2WN3A 1CIYA 2UUZA 2WNUC 4CYDA 4D9JA 2WZPP 1OA2A 2ESHA 4QGMA 1IS4A 4B29A 1AXKA 3OYDA 4QHZA 4PIYA 1RJ8A 3BZKA 4MQVA 3HXLA 1BR4A 4ASMB 4GAZA 1GT0C 5IVCA 5JI9A 3S2WA 4XFIA 1VQ4I 1YYVA 3I2DA 1UJ8A 1QJFA 2LLKA 4A3XA 1KQRA 4IX7A 2XJVA 3M3OA 4LNVA 4DNYA 4XOPA 3HOZJ 5JUVA 1WBFA 5J6XA 1D0GA 3DLLF 2D6KA 2A3YA 4A0YA 3W5MA 2B45X 2R071 4IQ4A 3OPTA 2K7LA 2GA1A 5CVUA 3ABTA 3DTEA 1B72B 3D82A 3VD9A 2AH2A 2CL2A 2XQXA 3BY6A 1W9FA 2WLPA 3O3KA 1N3OA 4OVEA 2DLLA 3BQYA 3VDCA 4UV8A 3DBRB 2CQKA 5FUIA 4QPGB 2DA6A 4M0HA 2W47A 1HB4A 4BACA 2BRTA 5JVGF 5GLTA 5DMYA 1F4AA 1S7AA 4Y1YA 4P02B 3HOUJ 1MD0A 3HNYM 3HRSA 1QJY1 2JJ7A 3TW6A 3B7MA 4TV7A 4BDYA 4LO5B 2FHRA 2BW3B 1F5FA 3JQWA 4C3IJ 1X7NA 5E6HA 3USUA 2WFF3 1D4M3 4UNOA 4A7YA 2HPMA 1V6NA 2BBYA 3A22A 4QPIC 2MW8A 1W0UA 2HEVF 3CDLA 3UGFA 2MSYA 1G9BA 2FE3A 1VRH1 3AX4A 1WJAA 1O3RA 4G7OF 3MKLA 1R64A 2RDNA 2A05A 1IRGA 3EQLF 4LBOA 4BQYA 3O14A 2EFNA 1ZVFA 4Z82A 2HWE1 2ZSHB 4BYYA 2X6WA 4DYRA 4M6XA 2VH9A 4QIWN 4FX4A 1LEMA 4PJ0C 2GOMA 5ANQA 1XRUA 2YHJA 4IEJA 1B9MA 3EHKA 4Q47A 4NMIA 3WTZA 2NZ9A 2P6HA 1MZEA 3S7IA 1RI7A 2CUFA 1PO21 1Y0NA 5FK7A 1VBD2 4JKLA 1FPQA 3RMXA 1IRXA 4UXAA 2VKEA 1A8MA 4FTBA 1HV1A 3HPGA 1AX0A 3D1NI 3ZOBA 1Q5OA 4UFLA 4Z2YA 3T30A 3OSFA 1W8UA 3QYEA 3AMNA 4I30A 3H8XA 3KT4A 4QHBA 3CCLI 4AYUA 3JB4C 3VKNA 4CGZA 3CKHA 2J1RA 3NW4A 4HLXA 4AZZA 1Q56A 3F21A 1FTTA 1H8VA 5C5UA 5FYVA 4B09A 2ZPXA 4R9AA 2GH2A 1T8IA 5FBZA 1JI6A 4KUMA 4Y13A 4XDOA 3RQIA 2ZGUA 3K4LA 2HWF3 3BODA 2GNTA 2JG9C 4CDQA 1I27A 2J1UA 2ZX1A 1CJDA 1HN0A 3FJSA 4AYBA 2PHWA 1V9U3 1L7QA 4HKLA 2GDFA 4MFDA 3R4UA 5J36A 1APLC 3L09A 3Q9VA 4EROA 1WLWA 4GB31 4XETA 3M7AA 4MQ9F 4IESA 4AYBN 3EUAA 1YHFA 3VB2A 2VN2A 1LUJB 2NMNA 1SFXA 5A33A 1OVSA 3LFUA 4LG0B 2W00A 3G6EI 4YG3A 4DY3A 1H8TC 3WGHA 5FLIA 1MZ6A 1NXMA 1V00A 2EALA 3V7SA 1D0YA 4R8HA 4UFKA 2OUJA 1RUD2 4QPGC 1FOD2 4XFGA 4L97A 2JG8A 4MEXF 2CV0A 4RA0A 1BM9A 3HD8B 3HHGA 4XONA 2ETEA 1KU3A 2YGLA 4MADA 3WDYA 2E1NA 3IIAA 2R061 1X9TA 4D69A 1PVEA 1A35A 2PQQA 4L92A 2C5DA 3A0HC 5DZEA 2ET1A 2J1SA 3O12A 3U11A 2HVSA 1HRV3 3V65A 2WZEA 4FI9A 2VPRA 1MS5A 5BPIA 3U2RA 1DP3A 1TT5B 2YPJA 1K6OA 1ZARA 3AL0B 4BQ1A 3RKWA 2YGMA 3WU1B 3EUHC 1JYCA 4LXLA 4I0WB 4G7HF 3CJTB 4BUPA 4IE0A 2VT3A 5FZCA 4PDWA 1ZA4A 1JYWA 1Z1DA 1SD4A 4CYCB 4XACA 4S2GA 5C44J 2CAUA 3SMHA 1GU3A 4JGYB 3HOSA 4XKWA 3TGNA 1AKHA 4RAYA 3I3BA 3N9PA 5I0RA 1J5YA 5EIYB 4BHCA 4MGSA 2HEYF 1PUFB 2J7MA 1PO12 1FEXA 2R7XA 1A3KA 3AG4H 4Y7NJ 2QZ2A 2V5DA 5HCFA 4BQWA 4CPBD 3THPA 5FP8A 3LWFA 5FPAA 1J83A 1YFUA 1CAUA 4KWJA 4JQFA 2ILMA 2DVAA 2VT2A 2XJUA 4L99A 5JMCA 4B4RA 3JRCA 1EV12 2CUEA 3GF6A 4LR4A 1VQOI 3KF3A 1FWZA 1HLCA 4IEVA 3BP8A 4ZZ5A 5I0SA 2BZTA 3OPWA 2LYCA 2XPJA 4FAGA 5AONA 1AYM3 2AS5F 3KYLA 3TDUC 2ERFA 4QQ2A 3VBSC 3ZOIA 2H94A 2EFOA 3B01A 1T0FA 1ETXA 2W1UA 3QPTA 4RA2A 2NOJB 4E2SA 3H7YA 1QJZA 3IIIA 4HKOA 5J3LA 1HXDA 1BK0A 5EEAA 4BEHB 1Z78A 3C3VA 2AZ5A 4MGKE 5CFDB 5JR7B 2XPUA 4I7HA 2WSUA 2L02A 2OIIA 3KT7A 4IXAA 2MA3A 2FBEA 1XC5A 3PQJA 4GULA 4O3MA 1RINA 3R4DB 5EJ3A 1OA4A 3LKJA 2V4AA 5FO9B 4QX7A 4H2AA 2VPVA 3N9QA 5GALA 1XXNA 2ZJCA 3J81K 2HBUA 4GGGA 3FE5A 1TME1 1VALA 4IF4A 2VL8A 4CP0A 3SHRA 4F52A 2CQNA 4ZY9A 4WK8F 1W9SA 4MGIE 4D7YA 3PO3J 3KX2A 5JPNB 4O9EA