4A2UA

Crp(cap) from myco. tuberculosis, with camp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
224
structure length
224
Chain Sequence
MDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A New Crystal Form of Crp from M. Tuberculosis and Conformational Effects of Crystal Packing
rcsb
molecule keywords PROBABLE TRANSCRIPTIONAL REGULATORY PROTEIN (PROBABLY CRP/ F
molecule tags Transcription
source organism Mycobacterium tuberculosis
total genus 58
structure length 224
sequence length 224
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4a2uA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4a2uA01
5H20A 3TKYA 1T39A 3LQRA 3NRVA 2BNMA 4HSLA 3SCGA 3U2RA 4IJAA 3F6OA 2GC2A 3HSEA 1P92A 3TDZC 5HDGA 1IUYA 3SQNA 4I3PA 5LLQA 4KL1A 1EY2A 1S29A 1P4AA 1UIKA 3ZDSA 3I54A 4I0BA 1YQAA 1J3PA 3TQNA 3BU7A 3BJ6A 4O9EA 4RB3C 4LG0B 4KWKA 4DQ2A 1G6NA 4RB1A 2XIGA 3P9KA 3HIFA 1MKMA 2XL9A 2FA5A 2IW5A 2UYAA 4HVOA 2JTVA 4LFUA 1LRHA 3MWMA 2HEOA 3PQKA 3FM3A 4HF0A 2GC1A 3HT2A 3M8FA 2QBYB 2MH9A 3SHFA 1HW2A 1EPZA 4GCVA 1U8RA 4QM9A 2IXJA 1Y0UA 4EM2A 4AIHA 4IEZA 3QP6A 5FD5A 3J81Z 2CQKA 3T1BA 4LGWA 2UYBA 4LD5A 2ATFA 2A3SA 3KLOA 2L54A 2MNGA 5JSRA 2AXLA 2H0VA 2FBKA 1HSJA 5J8CA 3T8TA 2VXZA 4HN1A 5C6CA 4Q4ZF 2M87A 3COAC 1J1LA 3FMRA 3NW4A 3GVAA 2IJLA 4OFGA 2Z2SB 4AQ2A 4BXUA 3T8RA 3WW2A 2MLGA 4A6EA 1D8KA 3F21A 4ZYHA 2BYVE 4CZZA 1XDUA 5CVUA 4HVRA 1NE4A 4R52A 4RS8A 1H1MA 1LVAA 4M73A 3IBMA 1FSEA 3CDHA 1OYYA 3GF2A 4LA3A 5H6QA 1CF7B 2KIFA 1G3TA 2OYZA 3DN7A 4YARA 2F5EA 2D1VA 4JTNA 3HT1A 1W4MA 4MTEA 2A6EF 4HLTA 2FE3A 3D5LA 5JCTA 4L9JA 3MZHA 5I0SA 1H9TA 3C18A 3H3ZA 2DW4A 1LDDA 1SFXA 4HVQA 4LLLA 2O8XA 1TQPA 1NXMA 2OZUA 1YFXA 2V1XA 3EDPA 2IXIA 1IPJA 1UHMA 2QQBA 3E5XA 4Z82A 2GA1A 2FQ3A 1TW2A 1QXRA 2BNOA 5F6FA 3ABTA 2F4PA 4HV5A 1IXCA 1ZREA 4ZZDA 1ULYA 3HOTA 2ISZA 2NNNA 5T3NA 5HDKA 1ZRCA 3DL3A 5DDGA 1V70A 3MCZA 1GQHA 1T6SA 4ENKA 5L3EA 1S6LA 2O1QA 3FZ3A 3M3IA 1F1ZA 4PZJA 4CYDA 1KQ8A 2MC3A 1HXDA 2J5PA 2EV5A 3RNSA 3CTAA 4OMZA 5J6XA 4ENNA 3B73A 4WBBA 2P7VB 5FO5A 4HQEA 1WGPA 5D6FA 4A12A 4FBFA 2Q2EA 1FYKA 1RIOH 2XUBA 2ETEA 5E17F 5IT9Z 1W7PA 2VBYA 1T2KA 1B59A 2K4JA 3C3WA 1I27A 2HYGD 4ZYEA 1ZHFA 5DD4A 4CO8A 1L3JA 3KEOA 5E16A 2XAGA 1DGRA 1PUEE 2E1NA 4KWJA 3EETA 1TQ5A 1P2FA 3GUDA 3O2PE 5IT9K 2DU9A 5C8WA 4ENJA 2L01A 2ZMEB 1D3YA 3D0SA 1IRGA 3P9CA 4HV6A 3I59B 1LB2A 3VB2A 2V1DA 1BN5A 1O5UA 2XLAA 1RNLA 1U78A 4QM8A 4ZU4A 4XETA 4PIXA 5FQ0A 2QQ9A 1NYWA 2PJPA 1KYWA 1XB4A 4ORFA 2PQ8A 4MEYF 2K4BA 2EV6A 4UVAA 2HGCA 4IETA 4LLGF 2LDUA 1OR7A 3V8LA 4Q5SF 3QU3A 1FY7A 4EQQA 2ZO4A 1YLFA 1FP1D 2FRHA 4RAYA 4QLCU 2IPQX 5DV5A 4FAGA 3UKVA 3EBRA 1Q3EA 2XROA 3T5XA 3KZYA 4RGSA 4ONUA 3MEXA 2KRFA 2EK5A 2ZJ2A 1HKTA 1OKRA 3FFQA 3H8UA 1QO0D 3AAFA 2HWVA 1WLTA 5EEGA 1DP7P 1YTYA 3MPBA 1ON1A 2A68F 2W85A 2FEZA 4JVAA 4HBNA 1F5TA 2VE8A 4KDPA 4M71A 2D45A 3LAGA 1ZZ6A 3NSTA 2C6YA 1FYLA 4RB2C 3L2HA 3P7NA 2KIUA 4LB6B 2K0GA 4Q0VA 1IF1A 4L18B 3U10A 5FLHA 1BM9A 2EFNA 1YFHA 1H1IA 4P55A 2M8EA 3E6CC 1UD1A 1J75A 1JUHA 3GZ5A 4M9XA 3ZMVA 5HLGA 2FMYA 2C0ZA 5I0TA 2OZ6A 4LJZF 3RPUA 4EWDA 5JHUA 1NE6A 3D82A 3WGIA 1QWRA 5CU1A 5FCCA 3WW3A 2WV0A 2ZXJA 4E2QA 1XMKA 1CAVB 1UFMA 2F2EA 1IAWA 1SMTA 1EH8A 4KIFA 1OYWA 3W6JB 4RGRA 1S3JA 2R7FA 4YFNF 3KZZA 2GC0A 2G9WA 3FHIB 4M74A 4IEXA 2DLLA 1SFUA 4E2SA 2H6BA 3F22A 3FF5A 2DAOA 3WU1B 3FWEA 4EJVA 4IHSA 4IRIA 2QUFA 5CLSA 1ZZCA 5K1YA 3BWGA 2PHLA 1QY4A 3DQVC 3CL1A 1KU7A 4J1WA 4R1HA 1ODDA 3TNPB 1R1VA 2V09A 1EYBA 1R00A 3WTUC 2MH2A 2ET7A 2QZ8A 3L00A 4AIJA 5KK1A 4GXOA 3HRTA 2QM3A 1WQ2A 2HQNA 5CADA 2PEXA 2BE5F 4OINF 2E7WA 1MJBA 2A6HF 1YWKA 2OAZA 2DK5A 4OIOF 4OMYA 4EGYA 6PAXA 5D5VB 2QENA 4DINB 3H7YA 4U88A 1CAUB 3WW4A 1OPCA 1DPRA 4HX8A 2PLYA 3PLQA 5DCMA 2H6CA 4KU8A 2J5OA 2HKOA 1TTYA 3BP8A 5AVPA 1O3QA 2F5FA 5FFZA 1OD5A 1MGTA 2BGCA 3NEUA 3KP6A 3WU0A 3DPLC 3QACA 3GO5A 2R7DA 4Q0UA 2ZKLA 2RNJA 1HSTA 4NHJA 3WTSC 1DGWA 3MDPA 2EA4A 3ZQ7A 2VT3A 4AVCA 2W57A 5KBFA 4I2OA 2LF7A 2BBYA 4YRDA 4I02A 3CUQB 4EMSA 4E2GA 2OA2A 1S7OA 2HOEA 3L2CA 3KP3A 2RVCA 4Q0PA 4G8XA 3GBFA 2O61A 4WZCA 3VHRA 1ZLJA 2IRFG 3V7RA 4U7DA 2A61A 2GAUA 1ZNPA 3R61A 5H6RA 4ZZLA 3RYKA 1WSUA 2ESNA 3H9AA 4YG2F 3H1WA 4M6XA 3F23A 4A5MA 3RYRA 5LRSA 2IT0A 2CO5A 4IEUA 3EYIA 2BEOA 1SFNA 4MQ9F 3F8MA 2COMA 4KMFA 1HW5A 3ZP5A 1YIOA 1O7FA 4IEWA 2V1UA 1JGSA 1PDNC 2FF4A 3UKTA 4NQWA 1KA8A 2UY8A 5EZWA 2PTMA 2Y48A 1ZG5A 2LKPA 1Z05A 2OU2A 4FHTA 2VPVA 1UPIA 4LMYA 4L11A 1S8NA 1Z1DA 4L0YB 1XN7A 4WX9A 2K02A 3GYDA 1X7NA 1U5TB 1G3WA 1K79A 2FNPA 1U2WA 2VE9A 4MV2A 4QGMA 4MEXF 3HYIA 1X8MA 1O3RA 3IDCB 3I71A 4R79A 4XF4A 4XFGA 3QP5A 3U11A 2XAQA 4XF9A 4Y15A 5AONA 3I7DA 3RI4A 5BS6A 1T0FA 4A0YA 2GZWA 5ILSA 1B9MA 2Y75A 1CAXB 3S7IA 2ELHA 4YFXF 3LFKA 4P9GA 1TBXA 2EA7A 5J48A 4Q0QA 5LHIA 5TJJA 5FD6A 4EJUA 4BYYA 3ES4A 4HN0A 1R5GA 3BPVA 1YS6A 1YHFA 5DUKA 4P5OA 5D5UB 1QZYA 4MGRA 1Z6RA 4U7BA 2Z33A 1WI9A 4WXCA 4PGHA 4B29A 4ON0A 1YYVA 1QBJA 3PVBB 2EV0A 1T38A 3ZN0A 1ONVA 5KHGA 1XGMA 1KU9A 1LNWA 3LZZA 3LQQA 2XL7A 5K8SA 1BI0A 4IVNA 1I5ZA 3K69A 2PMHA 4Y17A 2VC1A 2B5HA 3R0AA 3C7JA 3S0MA 2XKPA 4PGGA 1XRUA 4BHPA 1FSHA 1REPC 4G7ZF 5FLXZ 3QPHA 3U9GA 1O4TA 4IRGA 2EFQA 5D4SA 2H27A 1YW8A 3KETA 2OA4A 4G6QA 4G9YA 1ZG3A 1XCVA 3J81K 4CHUA 4HLXA 5ED4A 3REOA 5KVRA 1GQGA 3QOPA 3T0YA 5D8LB 1UCXA 4A0XA 4UUVA 3KP2A 2UZKA 1O3SA 1HKSA 5TRDA 3GZ6A 5FLXK 3K9TA 3W6KB 1IN7A 5DUIA 2ZMEA 2HJIA 4OIRF 2PHDA 2YX4A 3I64A 2FBIA 2IA1A 1VP6A 4MH0E 2HFHA 5LHHA 3HRSA 4HOBA 2X0LA 1RZ4A 4N9IA 4Q47A 2STTA 1Y9QA 5I0UA 2NNYA 4OLLA 2DO7A 3BROA 2DK8A 4ZU5A 2QNKA 4AD9A 1D5VA 2EJRA 2QWWA 1ON2A 4XF1A 3WG9A 3BZ6A 2Q30A 5E20A 3VFZA 4NB5A 3WTVC 1O3TA 2CWEA 1U3EM 5LHGA 4ZU7A 3OCPA 2Y0MA 1BIAA 1QZZA 2B8MA 2ET1A 5BY5A 2MPFA 1IN5A 2HQRA 4EWEA 2K86A 2P6TA 3EYYA 2D5HA 3MAJA 1BBYA 4BHCA 4X6RB 5LGNA 2MA3A 3GFLA 4PIYA 1CX4A 2IXCA 1TW3A 2XAFA 1FZPB 5L3BA 1BOAA 4A2UA 1ZG1A 4M9SA 4UXAA 1TNTA 4BH9A 3EQEA 3BOQA 3IWFA 2Z9OA 3M9AA 1IN4A 2XVCA 5DYMA 1DDNA 1J9IA 4LUKA 2DPDA 4H7LA 2Z69A 4QGNA 3JSOA 2XLGA 1FWZA 3O3KA 4KYWA 5D6EA 4UXNA 1MJAA 1R22A 5A2QZ 1MDMA 1IN8A 2JRTA 5FGMA 5E1XA 3ZN1A 3DP7A 1RL3A 3LA2A 3G73A 3J80Z 2IC1A 3M1EA 3IRQA 1ZH5A 3GEZA 4OU0A 2O0YA 4OOIA 5LEJA 3H3UA 3ABUA 3NKTA 4XBFA 3WODF 1S7AA 1CAWA 4HA8A 1DZRA 1B9NA 5A2QK 2HS5A 4XLPF 3K1NA 3GW2A 1OMIA 3TDUC 2XAJA 3CUOA 3J80K 3BPZA 2O03A 4A0ZA 3MZYA 3DF8A 1JHHA 4UV8A 3IDBB 1BIBA 4I7HA 2ZCWA 2OQGA 3E5QA 4IERA 4LLOA 4ZH4F 3I5UA 2QLZA 1J2XA 4HZFA 4LK1F 3WTYC 1UIJA 1KU2A 5ILVA 3VOEA 5D5WB 2B0LA 2KIMA 5HLIA 4A6DA 3ECHA 1YG2A 4S05A 1WKMA 1ZZ9A 4LLNA 5LGUA 1FOKA 4M72A 3CF6E 1UW8A 5HI0A 2XHKA 2OPKA 1EH6A 1YLLA 4JTOA 4HW0A 3B02A 5CVIA 4RB0A 3FXQA 3OV8A 3RYPA 1LKNA 2Q0AA 1SQ4A 3LA3A 3HTUA 3ZMZA 5CVJA 3H1YA 1EP0A 3KFWX 4MQVA 3ES1A 1K6OA 1VJ2A 4AVAA 4BQAA 3G3ZA 3SFZA 1F9NA 3I4PA 3G7DA 2PAMA 3BALA 1STZA 3BPXA 1KGSA 1USSA 3WE3A 4AWXB 4MZUA 4E70A 1RGSA 5JI6A 1W7PB 4ASNA 2PA7A 1SD7A 3H50A 1NZCA 4IEOA 3BJOA 3EHKA 1GXQA 2VODA 2ZNZA 4HYEA 2O3FA 1QPMA 2N7GA 2XLFA 3LWCA 2LF8A 5CVVA 2NS0A 4IPAA 3FE5A 2DT5A 3JSPA 2VECA 3E6MA 4ESFA 5EFUA 2CFXA 2RC4A 4PDKA 1HQCA 5KHKA 2LSOA 3HRUA 4MGYE 4XF3A 5LGTA 3EJKA 3E6BA 1NHAA 4YNIA 2RQPA 1PP8F 3OOPA 4S04A 4QMAA 4KA4A 3JZVA 2NYXA 4XLNF 2WC2A 3I58A 3QU6A 2XV4S 1FBSA 4KIGA 5FQ0B 4B8XA 2CV6A 2STWA 1DPUA 4EJWA 1K78A 1O5LA 2L02A 2ISYA 2VT2A 4L9VA 5ICGA 1RUNA 4G7OF 5F1RA 1W5SA 5BPDA 3PQJA 1D8JA 4F8AA 3HHGA 3KSCA 1P4WA 4U0VA 3ZMUA 2E1CA 1TNSA 4LEJA 1RC6A 3R6SA 4JK1X 2Z5UA 4OIPF 2VBWA 2MHFA 4AQ6A 5LRRA 3WTXC 2M5WA 4IEQA 4QWQA 3BDDA 1V3FA 2D2WA 3ROUA 1AOYA 3RKXA 2V79A 3KMHA 1WWXA 3BY6A 4ENMA 2EFPA 3SXWA 1LDKB 1ZN2A 3FXRA 3F8NA 1Z9CA 3OD0A 1TQMA 2E9QA 1I6XA 3R60A 3KE2A 3R4KA 4DNCA 3RIRA 3EO6A 2Q8KA 2I45A 3V7CA 4HF1A 4AXOA 1C0WA 5I0RA 4HX7A 1HW1A 2PYTA 2P8TA 5BUVA 2W84A 2PMUA 1YW7A 1J0RA 3FMQA 1ZRRA 1BC8C 2H94A 4BIFA 4KMUX 1LQ1A 1GXPA 2DQRA 2GQQA 4LG0A 1KU3A 5JAXA 2O6GE 1GHCA 5ICFA 1I1GA 4TV7A 1XGOA 2LNBA 2V9VA 1HBXG 4UV9A 3K1MA 3K1PA 4K2EA 1Q43A 2FQPA 2WFPA 2W24A 5K5RA 4L9NA 3S7EA 5AIQA 3LSTA 4XFCA 2PG4A 3IHUA 4HF2A 2QBYA 2PN6A 2CGPA 2Q4SA 1LR5A 2ZBKA 1BC7C 5FFXA 3U1DA 1XE8A 1FC3A 3FM5A 4QXKA 5LEKA 3KP4A 1FLIA 4KNYA 1XGSA 4KIBA 4XFIA 4HDUA 4MX3A 3GXOA 4FAHA 1R58A 2HTJA 5HLHA 1TQIA 3BCWA 3JAMZ 1I1SA 2IXLA 1SFEA 3I53A 1U12A 3DEUA 5ICEA 3ETQA 1EV7A 1F4KA 2PFWA 3GFIA 2VBXA 3JTGA 5FLIA 2QVOA 3KCCA 1IN6A 2YSRA 5JVTA 1CF7A 4D0PA 5BV6A 3TO7A 3JAMK 3ERED 2UY9A 1FBQA 1QQIA 1P4XA 4JBAA 5DD8A 4XSZF 4LK0F 5JR3A 3WTZA 3HOSA 1MJ9A 2EWNA 1R7JA 5L3DA 2QJVA 3L7WA 3OF1A 3KEQA 5DEQA 3IL2A 3WE2A 5AIPA 3NL1A 1Q1HA 5ILUA 2ETHA 1IXSB 4YYOA 2RDPA 2L4MA 4Q0SA 1WRJA 4G94A 4M6YA 1E17A 2XASA 5IT3A 2P5VA 4AVPA 2CAVA 1SD5A 2DPUA 2Q0OA 4EWAA 4RGUA 4WK8F 4I01A 4G6DA 3MFKA 5I8SA 4U0YA 1O57A 1T98A 2Z3YA 3RKYA 3IC7A 2OBPA 1OFNA 3DKWA 2MLKA 1ZARA 4XFBA 1FPQA 1GVJA 5L3FA 4Q48A 5K5QA 4ESJA 4HQMA 3H7JA 3CO6C 4WF2A 1SD6A 5DCFA 4HLYA 4QX5A 2EB7A 2X4HA 3ZPLA 3BJAA 3NQOA 1H0MA 2UXNA 1FT9A 1HKQA 1PP7U 4N0BA 1YFWA 1ZYRF 1B6AA 4MGZE 5FB2A 3ST7A 2K9ZA 4PCQA 1J59A 1VR3A 3Q9SA 1RI7A 2UWMA 4GGGA 3SZTA 1ZZ7A 2JPBA 2YPRA 4HX4A 2CSOA 5F64A 4K8FA 4WXDA 2Z99A 4IEYA 3LWFA 3GWZA 5BMZA 4XFHA 1RTVA 1XDSA 2CW0F 2D40A 4UVBA 3ISPA 5L3CA 2B9UA 4KT5C 2CYYA 2YR2A 3F8BA 1KQ0A 3HHHA 4LULA 4IEPA 4XF0A 3ELKA 4XEZA 4GYIA 3ZMSA 1XE7A 2EFWA 4UBGA 3CJNA 1ZAOA 1LEAA 4JQFA 1UHWA 1Z6TA 4WWCA 4G7HF 1W5TA 3CLPA 2JZYA 3I59A 2M30A 2P4WA 2OD5A 3LOIA 2BV6A 4I09A 1B4AA 3CUQC 4J1XA 1MD0A 1DUXC 2DQLA 4P9FA 2YX7A 5FDBA 1JE8A 2Y0OA 5J8FA 2A07F 4LB5A 3ULQB 1YW9A 2CAUA 3ZMDA 1YFUA 3M70A 2R3SA 1LJ9A 4KUMA 1IRFA 2IA2A 2IXKA 3BB6A 1V4RA 2E7XA 2K27A 1FP2A 3V7SA 4EM0B 2G7HA 4LTAA 3FZVA 2GC3A 3UKNA 1JHFA 4Y13A 1J3RA 2FSWA 4M9ZA 4OIQF 2VQAA 5BOXA 5BXXA 3E6DA 3SXYA 2GA2A 1KQ9A 2DFIA 1FBUA 5JFRA 3WTTC 2D5FA 5BPIA 2PFBA 2HKXA 4XFAA 1X8EA 1BI2A 2CG4A 2DTRA 1IW7F 3C1DA 2DBBA 1LEBA 4NVPA 3TGNA 1ZRDA 3PNAA 2EA2A 2FMLA 3I0TA 4CICA 2KKOA 4MUVA 2ZFWA 4P96A 4ESBA 4IEVA 1PMIA 3Q9VA 1U5TC 2WWYA 2GU9A 4CXFA 1P6RA 4HMZA 1YFYA 4H0EA 2PI0A 1J3QA 5E1WA 5E8IA 1R1UA 3RJPA 3DXJF 4PJYA 3SHRA 2VN2A 3DV8A 1J58A 4YSFA 4AIKA 4FX4A 1JXSA 1ZRFA 1YS7A 3JW4A 4BAYA 3P9IA 5KHJA 4MGIE 1XGNA 4WVZA 1CAVA 2FNAA 4X6QB 2XAHA 3TOBA 1J7KA 1O7LA 3IRRA 4YFKF 3H92A 3MYXA 2VC0A 2HTSA 1A04A 1J5YA 3QAHA 2RV8A 2W25A 3DPTA 5KHIA 3WW1A 4BNCA 1BI1A 2V6CA 5I8TA 1R1TA 4XRFA 5E8GA 4QGLA 4IXAA 2RGVA 2KXLA 1Z7UA 4ZYGA 3IIAA 3ML6A 3H1MA 2QYOA 4UBHA 3FJSA 1L0OC 1G4DA 4Q29A 1H9GA 3JTHA 3KGLA 4TLFA 2XKOA 5FPXA 1G3YA 2IA0A 2ADUA 3QRFF 5K5OA 2JT1A 4CDGA 3VODA 3USSA 3N4MA 3S2WA 5HS9A 5J7MA 3SZPA 4N9HA 1YO5C 2VOPA 3Q5FA 2ACJA 3J7AO 5ERIA 4O5VA 4B09A 2IVMA 2GXGA 2YU3A 2XRNA 3F6VA 3KGZA 2P6SA 1AWCA 2EVXA 3HSRA 3LAJA 4O6JA 3GFMA 1R36A 3O6BB 2M45A 3F8FA 3V4GA 2PQQA 2A5YB 3M8EA 3F72A 1L3LA 1OYIA 2FU4A 4RAZA 2PAKA 5E18F 3HRMA 5FPZA 3SCFA 2P5KA 1PM7A 2NRAC 2HR3A 1CAUA 1XMAA 2DI3A 1K7AA 4KWLA 4IF4A 2ESHA 3HUGA 2QDRA 1XSDA 1ZGJA 3N97A 4BHBA 3FX3A 3C3VA 3CEWA 3TO9A 1CGPA 5CVRA 2GH2A 4PIZA 2M1BA 5BPXA 2F5CA 2H09A 4KFCA 2G7UA 1MDMB 5D4RA 3K2ZA 1ZZ8A 4L5IA 1QNTA 5KHHA 3IKTA 3D0JA 2JSCA 5FLJA 1USTA 3WGHA 1XSVA 3ACLA 1VTNC 4L9TA 2HZTA 2GIVA 1FXZA 4F7ZA 4IESA 1YUDA 1ZZBA 1LDJA 2IXHA 2ZKZA 2IP2A 3CUQA 2DCTA 1Z91A 3L09A 4AVBA 2RKHA 3TO6A 1CAWB 4EROA 2GWRA 1ZLKA 3ELNA 4RD7A 3HSFA 2OQRA 3R0JA 3GX4X 2PBIA 3WTWC 1X3UA 1EH7A 2MD5A 2QVSB 1RUOA 4EM1A 3WGGA 5BQTA 4HDVA 4XFFA 2HYFA 1ZX5A 3VEPA 2F5DA 4D7TA 4I98B 1UB9A 5E1RA 1IXRC 3CO2A 4WXHA 5EEHA 5HVQC 3RTRA 2VBZA 4GYGA 5HDNA 4UVCA 2P17A 3LAPA 4XSXF 4WCGA 2FOKA 2NAZA 1FX7A 3RKWA 3KP5A 3V8KA 1Q5OA 1ZVFA 4HAMA 2TDXA 3OGJA 4I0AA 5CJ9A 3E5UA 3QPTA 1FYMA 1Y3TA 5ICCA 4P9UA 5LBQA 3SCHA 1DZTA 4KICA 3RDIA 1QXJA 1U6GA 4LA2A 4GULA 3K0LA 3M7GA 1QGPA 4EV0A 4GO1A 2L4AA 1U5TA 3TOAA 4MHGA 2Q1ZB 4KN7X 4R8HA 3CJXA 2O8QA 4FT8A 5D5XB 4D7SA 1WA4A 4IRHA 1R23A 4A5NA 1XSXA 2KJCA 5HS7A 4EVIA 2FXAA 2L3DA 2MBFA 3GLXA 4U0WA 4IHTA 5D8KB 1G3SA 1E2XA 1ZGAA 3E97A 5HOOA 3MQ0A 4UHTA 3F8CA 3FHZA 4ZYDA 4KU7A 1CAXA 5CYVA 4MGKE 2P5LC 5L3GA 2PAEA 4CGZA 3IKVA 1BJAA 1FI2A 3O14A 1IPKA 4HSJA 2D93A 4ETSA 4EGZA 4YIIA 4LUMA 2KJBA 4O3MA 5E1ZB 3RZZA 4KN4X 1R5HA 2QCSB 5D1IA 4O9GA 3TNQA 3L9FA 3ECOA 4JV4A 1UCRA 1BI3A 1KYZA 2OZJA 3NVCA 2GXBA 1X82A 3KP7A 3FXUA 2VOOA 4HBLA 1SD4A 4YIFA 3U0ZA 5JSOA 3GFJA 4EJTA 3CO7C 3OTFA 3KLNA 1OI6A 5JR7B 2RN7A 5I91A 3HQXA 1K78B 5I93A 1XCBA 4META 3F3XA 5HS8A 2A69F 4L5JA 4Z07A 2QQAA 4L0ZB 1XD7A 1SEFA 5JSPA 2UXXA 4RGXA 3SMHA 3DFGA 1TLHB 2XGXA 3GYHX 2K7LA 4UNOA 5J3UA 1W7PD 3RPQA 1SAXA 2FBHA 3EQLF 2WTEA 3V8JA 1FNNA 4MNUA 3ZMTA 2ZNYA 4MTDA 2D1HA 3PFIA 2EFOA 4EJOA 4L2NA 2JPCA 5I8YA 3NJZA 3IWZA 2HDCA 4FX0A 1MZBA 4Z2YA 3HTSB 3E3VA 2AS5F 2P7CB 1SMYF 2BNNA 3FMSA 2EAAA 5DCMB 3EUHA 1IZ1A 3CLOA 2VONA 3LA7A 1B1BA
chains in the Genus database with same CATH superfamily
2VKEA 5H20A 1RUI1 4GB32 1FPN1 4NPRA 1AL23 4XUNA 5HDGA 2J1VA 4KL1A 1S29A 5K4LA 1OR7C 3UR3C 3HM5A 2P1BA 2ERFA 3TQNA 3BU7A 2JSPA 4O9EA 5IFPA 4RB3C 2P3KA 4J25A 5LA2A 4DQ2A 1GBGA 4GALA 3C2HA 2CW7A 3EUAA 4XW3A 5LASA 2JTVA 4LK6A 5KCMA 4AQSA 3AKQA 1TWCJ 4HF0A 2GC1A 2A3WA 5B66C 2QBYB 5ISLA 1HW2A 1G8XA 5FUPA 4Y1YA 4Q1RA 3ZXKA 4S2HA 2WKKA 3AP4A 3P5BA 3LB9A 2H0BA 3CCMI 2XB6C 4LD5A 3KS7A 2ATFA 2A3SA 2RREA 2XUMA 1RC9A 4A3JJ 2MNGA 2H0VA 2FBKA 1HSJA 5J8CA 1GLHA 2X5IB 1GV2A 3VZNA 2E5ZA 2O7OA 4Q4W3 3COAC 1J1LA 3FMRA 1DHKB 4OUEA 2IJLA 1DQ2A 4AQ2A 5FIXA 3ETPA 2MLGA 3S6PA 1W8TA 5JOYA 2D7FA 1XDUA 2YC4A 4M73A 1IG0A 1FSEA 1QVUA 1OYYA 2KQRA 2ZGLA 4M3DA 3GF2A 1HIXA 2DBIA 2KIFA 3CKHA 2RR11 1IDYA 1Z0HA 1G3TA 3LPGA 3HKZN 3DN7A 4YARA 4XCBA 2F5EA 4LO8A 4UW4A 2RS32 2ZGTA 4MTEA 3DPRA 3S2DJ 4N43A 2E51A 3D5LA 5JCTA 1FOWA 2DBNA 5I0SA 3FXJA 4QPIB 3OMYA 1MQTC 1LDDA 2WO2A 3BU0A 2O8XA 1TQPA 1WMFA 2D6KA 1M1EB 1D7PM 2HXOA 5FP8A 5IVEA 4HK9A 5KWRA 1JZ8A 2M0MA 2QQBA 2F6CA 1VBD1 3I2IA 2BNOA 2HQ5A 3NWTA 2J1TA 3A4UA 2F4PA 4YELA 3VBSB 2BERA 5KAIC 1V6NA 2YYOA 3K48A 4ARYA 2W5FA 1SHWB 1HLVA 4BBSJ 5HDKA 5CG8A 1UMHA 3WT3A 5JXHA 3UL2A 2O8OA 2R061 2VJ4A 2YBPA 4LKEA 3OYAA 5F9TA 1F1ZA 3GDBA 3LIGA 1KQ8A 1LHNA 3G6JB 5T54A 1VQKI 3CTAA 2Y2ZA 1UN1A 3DYMA 3B73A 2XF7A 5LFAA 2M7BA 2Q2EA 1FYKA 2WYFA 4PF1A 1K45A 2XG3A 4MG2A 3MF9A 2C26A 2DUPA 1T2KA 4FTSA 1OQ1A 2K4JA 3C3WA 5DM6F 2VBPA 4QHOA 4WZFA 3WF1A 5DZEA 4D69A 4EN0A 1L3JA 1WPKA 5FZ9A 1UL9A 2E26A 2GN7A 1J84A 3PVOA 4DUVA 1HXS1 2P3YA 4XLFA 4IDZA 3EETA 4LE3A 3O2PE 5IT9K 3FLTA 4CA9A 2L01A 1W9TA 1AL22 4GD4A 1XNAA 1O5UA 3ZIXA 3SKVA 2MC4A 3ALQA 3GM8A 2YS9A 4L5EA 3OBRA 4ORFA 3SDGA 1BMV1 3PUBA 2RAEA 3TP3A 1W2UA 3N3HA 4LLGF 5FMBA 1B8IB 2LDUA 1PHMA 5DUWA 3I8TA 3OGRA 2WDBA 3QU3A 1C28A 2WWUA 3MLKA 2ZS6B 3VKOA 2FRHA 1SBDA 4FAGA 3TEYA 2UUZA 1OQDA 1WLDA 2J1SA 2XUEA 4OVEA 3AZXA 3T5XA 2Q8EA 2KRFA 1QO0D 4XLAA 3ABLH 5ERLA 1DP7P 3BR6A 1YTYA 4EYUA 3VBOC 3VDDB 4BXFA 2XVKA 4JVAA 2O9LA 5TSWA 3VSKA 4FXGB 4Q4W2 1HCRA 3HBKA 3RVHA 3VV1A 1YJNI 4RB2C 4NRMA 1DLCA 4LBKA 4KH9A 4LB6B 2AYHA 4AC0A 1LHUA 1QKQA 2F4LA 5HV4A 2CRGA 5CYYA 1UZWA 4EE2A 5C70A 2P3JA 1H0BA 3WNOA 1ZBA1 5DN2A 1L7LA 1UD1A 2JD9A 1JUHA 1DG6A 2C0ZA 5I0TA 2X6XA 4XORA 1FOD3 2QA4I 1NE6A 2OCCH 1QWRA 5CU1A 3WW3A 2BZDA 1PO13 2RDNA 4QU1A 2DTWA 1XMKA 1IAWA 1SMTA 2A1XA 4KIFA 3Q0UA 1V6JA 3L2RA 5A7PA 2LD5A 1GZ9A 2R7FA 5B5EC 3RQIA 3Q8CA 2VD7A 4E4HA 2D6LX 3M1HA 2VOWA 4LPLA 3I3BA 2D97A 4EJVA 2R7RA 3JXSA 4IRIA 5FYYA 5A3TA 1ZM1A 5KHDA 2XGDA 4B43A 3RZKA 1O91A 1ZZCA 5JWPA 5K1YA 1QY4A 3L2WA 1UYPA 3DQVC 2V5DA 4FQ4A 4H3WA 5CISA 2YC2A 4RQPB 2RS13 2MH2A 1JTYA 5KK1A 4GXOA 3ZFEB 3HRTA 4JKMA 3JRIA 3GNEA 5T52A 1WQ2A 2HQNA 2DTYA 1T33A 2BE5F 4V2VA 4K3UA 3CDZB 4HG2A 4XDQA 1Y8RB 1DQ1A 1WW7A 4OUMA 5E3NA 2OAZA 2DK5A 3OYHA 5D5VB 5F8PA 2ZMEC 5JZGC 3KHCA 3N7KA 3WW4A 1DPRA 1RUJ1 4KU8A 3U21A 1RUE1 1E5SA 5AVPA 1TTYA 2I5UA 4E7SA 5FYIA 3HG9A 2DOAA 1O3QA 2F5FA 2Q5TA 5FFZA 1OD5A 1MGTA 1OQEA 2WQ8A 3AKZA 3QACA 2JDZA 3A03A 2ZKLA 1HSTA 1OLRA 4NHJA 2LTPA 2WS91 2BPA2 4RGGA 2Y69H 2VO5A 1W39A 3S1RJ 3N9MA 4YFWA 2VTXJ 2LF7A 3T08A 2A5WA 4BJ6C 1GNZA 3V42A 2ZZQA 3KP3A 4YW5A 1TNFA 4Q0PA 5CFCB 3LEGA 3HD8B 4LMFA 2YU2A 1JU3A 3ZQHA 2IRFG 3CDIA 1KDMA 4WVMA 5T5PA 1VF9A 1GZTA 1QHDA 4YG3A 1SLLA 5H6RA 4N7IA 1OA3A 1AX2A 4M6XA 5DAVA 1W6PB 2AR6A 4M3EA 1B35C 1H2MA 1SFNA 4MQ9F 4XM3A 2ZBJA 5IVCA 4CTEA 1VQ6I 3TEXA 1YCIA 1CPMA 3ZFGC 3FHAA 3UKTA 3ZYRA 4YZ5A 2UY8A 5FKMA 1CN1A 3WNMA 2VQ0A 4JX5A 2FDHA 2UURA 1IPSA 1UX7A 1VQ8I 4OI0A 5FYTA 1PX4A 1XNBA 1WI3A 5HNHA 1DFQA 4AEDA 3JRDA 2BTVC 2QQPA 3NARA 5JMCA 1S8NA 3BTYA 4WX9A 4DFSA 2GM4A 1U5TB 4BCUA 1OKOA 1FOD2 5EQUA 3QPSA 2FNPA 4QGMA 3O12A 1X8MA 5CFDA 4XBNA 3I71A 3ESWB 1Z7LA 1XJAA 4URAA 2XAQA 1K4SA 5LK5A 4XF9A 4F55A 2G9GA 4XIKA 5AONA 5FYHA 1PUFA 4JQTA 5J4YA 5BS6A 4NIHA 4A0YA 1BQPA 1M4WA 2A6WA 3I2DA 1B9MA 1US2A 4CEWA 2MD0A 4N4OB 1D4M1 4LKSA 2G4IA 5F3EA 3ES4A 1V6MA 3LSKA 5A7OA 1G59A 3BUCA 1YHFA 5DUKA 1FEXA 5D5UB 2DVFA 4AFMA 3ORJA 1EUUA 2Z33A 3DEEA 2VMCA 1K61A 5DMYA 1ASJ3 1QBJA 3AL5A 3K46A 5F2WA 3G6EI 1ONVA 5KHGA 4UI9L 2KDZA 1S2EA 1COV3 1KU9A 3LQQA 2RS12 2XL7A 5K8SA 5FFOC 4IL7A 5FZBA 4B8EA 4AHWA 2KL4A 1REPC 1RMU3 3U9GA 1ALYA 3CF5F 2EFQA 4A3LJ 4AF9A 1YW8A 3KETA 4G9YA 2FQ4A 3J81K 4CCCA 1X1BA 3CZ6A 4B1MA 5CNAA 3ZN5A 1MBGA 5ED4A 2WAEA 1W6QA 2VNRA 2K2SA 4UUVA 3T4HB 2VMGA 1YYNA 1GZWA 2WA3A 2JDHA 4E7KA 4OQ8A 4IE7A 4XKCA 1VP6A 3S15J 4IL6C 4CDWA 2DYSH 5FK7A 4Q47A 4CU8A 3U75A 1UQXA 3SEQA 2GMEA 4E7ZA 5I0UA 2NNYA 5EEAA 1CQTA 1VBB2 1REFA 4R4XA 1OCRH 3NO8A 4ZU5A 1V9U1 5C9AC 5JVVA 2WINB 4B4CA 2XJQA 2WAQN 2EIEA 1AKHA 4LXLA 2EXHA 1G7YA 1HQNA 4NB5A 4X0GA 1O3TA 2NVTJ 1A36A 5LHGA 3OCPA 2Y0MA 1BIAA 4KGQA 1PK6A 1VMFA 2IS6A 4Y4RA 2PELA 4KI5M 4JKLA 4F52A 4GH4A 2BP6A 1BOAA 1ZG1A 2WUHA 3JB4C 3BCBA 1F31A 4DO0A 4E7HA 4QSHA 3S2HJ 3KF5A 4UXAA 3EQEA 3WUDA 4LITA 1JYIA 3N05A 4RLFA 4HSRA 2Z69A 1A6QA 3FK6A 1TME3 2WNVA 2VQGA 2WSUA 4II2A 2DFCA 1NQDA 4YM1A 4AAPA 2JENA 2ZX1A 3CP2A 3OUJA 1V54H 1X4PA 5A2QZ 4BE0A 3LA2A 1CPNA 4A3FJ 1CVNA 1EAH3 1PO23 3OBAA 1OFSA 4XJ8A 4NE9A 3IRQA 1ZH5A 2WNOA 2DA4A 3ILRA 2G9ZA 3TAYA 3H3UA 3ZXAC 3NKTA 1CAWA 1S7AA 3C2BA 2HS5A 4XLPF 1IOAA 5EPAA 3AK0A 2XAJA 1C1FA 1A5JA 1OA4A 2QSHX 4ET7A 5G04L 3J80K 3JD73 3BPZA 3OOUA 4COVA 4UV8A 5BNGA 4I7HA 1E0EA 3C7GA 2YY1A 4XLEA 3I5UA 1RUC3 4IGOA 1SC7A 3DPRB 4N43B 3BYWA 3EB7A 3R4SA 5L7OA 4CH7A 4ZTFA 2B0LA 2KIMA 1TT5B 2ECCA 5HLIA 1LKXA 3ZSLA 5A33B 5C4JJ 2DCZA 1FOKA 1ND3B 4M6VA 1C8M1 5GAEJ 2DV9A 3BOPA 3ZFFA 3FXQA 4OQ9A 2CDOA 4CE8A 3OV8A 3T2PA 5J36A 5C44J 3RYPA 2Q0AA 1SZBA 2K40A 4M3GA 2DCJA 3AKRA 3ZOIA 1RMU2 1I39A 1K6OA 4HNVA 2XRLA 4XIDA 5ACA3 2W46A 3G3ZA 3SFZA 4FPCA 5C71A 3SZGA 3I4PA 3F0CA 4OHXA 3Q9OA 3HPNA 4DB5A 3BPXA 1T2XA 1POV3 4AWXB 1DGWX 4MZUA 4E70A 2Q2EB 4RA2A 4S2DA 2FCTA 2AEYA 1SD7A 1UU4A 2DDUA 4Y5TA 1NZCA 3PJRA 4IEOA 3EHKA 4YIRX 1GXQA 3RZLA 2O3FA 1FTZA 1SFKA 4NHLA 5GZGA 3BR5A 2XC7A 3JSPA 2VECA 1MMGA 5F7UA 3ZSKA 4XUTA 4BUPA 3VBSC 2CFXA 2CTVA 4RN5A 2ID6A 1HQCA 3PDQA 5KHKA 2LSOA 3QD6A 4XF3A 2VU9A 2HWE3 2ZXIA 2JE9A 5GLTA 2RQPA 1PP8F 1ENXA 1AR63 1JMUB 4QMAA 3H3LA 5FZ7A 4E9KA 1DGRN 4KIGA 3KV5A 4B8XA 2YGLA 3ZXLA 4EJWA 1N1YA 4RSUA 1NY72 1O5LA 2XVLA 5FR3A 3FLRA 5IHRA 2VT2A 2COBA 4YVWA 4B3AA 1EKEA 5DTDA 5BPDA 2AZ5A 3PQJA 3ZLIA 3FXOA 5J1XA 1WMEA 1QH6A 3HHGA 4U0VA 2E1CA 4PJNA 4LEJA 3T0DA 1UY3A 3R6SA 4BLIA 4JK1X 5DAXA 3NWKA 5EZGA 2VB6A 1TME2 5LRRA 3WTXC 1MVQA 1IHMA 5FKCA 4BEHA 1XC5A 3O5SA 2V79A 3KMHA 1YQ8A 5JI9A 4XUPA 2EFPA 5L36A 1LDKB 3FXRA 4LBLA 4Y20A 1EAH2 1PO22 3F8NA 4ITVA 1IKQA 3HUGB 1YQ2A 4QXBA 1I6XA 5FKBA 3RIRA 2QQIA 1GZCA 4GZ9A 1TL8A 2LS6A 4QXCA 4BJTA 1N78A 2PYTA 1FNYA 2P8TA 2V4AA 3BTCA 1YW7A 1AR91 3JD72 3K4NA 2NVYJ 2EXIA 3VD7A 2H94A 1PGL2 2WADA 4DZGA 1W36D 4DXZA 3A22A 4LG0A 1KU3A 5FY0A 2DA1A 1QQP3 5ICFA 2PX9A 1XGOA 1HBXG 3K1MA 3K1PA 5GAHJ 1Q56A 2M4KA 5GZDA 4HF2A 1DP3A 4XXPA 1Z7S1 4CP0A 4FCYA 1BBT1 3K7AJ 4XZUG 1LR5A 2J1AA 3ABZA 5FPBA 4AEJA 4BY7J 5KXBA 3VDDC 1ORKA 3IH2A 3JUUA 1FC3A 3FM5A 4G6TB 4HSTA 4CCOA 5LEKA 2ZA9A 3KP4A 1OD3A 5HNFA 2ZMLA 3D3AA 1OVPA 2RMU3 3K2AA 2HWB1 4XFIA 3WHTA 3S32A 1SACA 3NRUA 4LO5B 3DEMA 4AZZA 4H7MA 2E1MB 4HPQA 4RS5A 2FHRA 3BCWA 3R4UA 2ZX2A 4NAOA 1BHGA 5ACA2 3I49A 2BOIA 1E3PA 3KZIC 2D6MA 1FMVA 2KPMA 3BQYA 2YDEA 1EV7A 3GFIA 5F5CA 5FLIA 1V5FA 3KCCA 1IN6A 1BZWA 4M3BA 4V2FA 4FQGA 1WH5A 5E3MA 3OWTA 4U36A 1WFXA 2CV2A 4AGGA 3TO7A 1MEC3 1R091 2QEXI 1FBQA 4GJYA 1P4XA 2M0CA 4XSZF 1VBE3 3V0AA 2DU1A 2QJVA 3TEZA 3L7WA 1ETKA 3KEQA 3AZVA 5AIPA 1TWGJ 3RCOA 1IXSB 3CNAA 4YYOA 3HOUJ 1WRJA 3DPUA 3HC7A 3B5LB 2DFEA 2GOXB 4GIQA 1R71A 1AVBA 1SD5A 2DPUA 1AR62 2DVBA 1OHFA 4I01A 2L2OA 3IT8A 4G6DA 5I8SA 3TP0A 3BTXA 1Q8OA 3RKYA 4B48A 3DKWA 4AIDA 4XFBA 3SNMA 3CO6C 5L9BA 4HLYA 3UGGA 4GXLA 4OUSA 3ZFEC 3BJAA 1QHGA 1P8JA 2LP0A 1Y4WA 2UXNA 3N9NA 3NJXA 3KQRA 1PP7U 1MNEA 1JYNA 2WN3A 4MADA 4OULA 2X09A 2D6NA 1J59A 1VR3A 3GHNA 4WVMB 3SH5A 4GGGA 1ZZ7A 2R042 2JPBA 1CESA 4NIGA 1VFCA 1HB1A 5FOJB 1AR81 2W52A 3ZX7A 3LWFA 5BMZA 4QX3A 1TWFJ 5L3CA 2B9UA 2M8GX 3O1RA 4KT5C 5EWSA 2CYYA 1KQ0A 1JZ4A 4PBPA 3PUAA 1NA1C 4YGCA 1BVP1 1S5LC 1TMF1 3CJNA 5JOWA 4ZC3A 4JQFA 4WWCA 4G7HF 2JZYA 2J22A 2QFEA 3I59A 4IE0A 4BWOA 2MEV2 2BV6A 1LVKA 3OYJA 4J1XA 4AEDB 5FDBA 1WW4A 2Y0OA 2CWSA 3J7YJ 4ZZ8A 3POFA 3CJIA 5CFCC 2CAUA 9ANTA 1YFUA 2CW8A 3M70A 1LJ9A 2B9SA 2VCAA 2IA2A 2IXKA 1QQP2 2RHPA 5CFDB 5DG2A 3KQ4B 4AEKA 2VNVA 2Y6LA 1S0BA 4BDYA 4CU6A 2HXIA 3WF2A 1QZEA 4OIQF 3Q0WA 5FMOL 1Q8VA 4CEWB 4K21A 4C3IJ 3AYDA 3GZNB 3WTTC 2D5FA 2RMU2 3K4KA 1GP6A 1X8EA 2EBIA 4GAZA 3DECA 1JKPC 2BY0A 3C1DA 1ZRDA 1S0DA 4JOMA 3A21A 1AZDA 4L92A 2KKOA 3WNXA 4MUVA 4P96A 1HRV3 5J40A 2IWGB 4BQ5A 1NZIA 1U5TC 2WWYA 2YROA 4RHV3 3UGHA 1VBA3 3MIHA 1P6RA 2HU9A 1YFYA 1S7EA 4H0EA 3LOBA 5E8IA 1O6UA 3JR9A 1R1UA 4PJYA 1MEC2 4XKWA 4OHYA 1VBE2 3W2VA 2PLV1 4AIKA 4AFDA 1ZRFA 1CJPA 3JW4A 1DLLA 2ZAHA 3I2FA 2EH3A 3P9IA 2TBVA 3B01A 3HQRA 5KHJA 5FBZA 4G12A 1W6QB 4L99A 4Y1XA 2XAHA 2BDRA 1O7LA 3IRRA 4YFKF 3MYXA 1A04A 4C3JJ 2WA0A 4BXXJ 1LOEA 1OH4A 4CVUA 4IV3A 4PFOA 3NJVA 1HN0A 5L73A 5I8TA 4GMP3 5DUXA 4CDWB 2IGNA 1W6MA 4FFIA 5C8CA 2KXLA 4ZYGA 4LQRA 1WJDA 2QUOA 3H1MA 4GWJA 3SFIA 3H0OA 4COUA 2JG8A 4Q29A 1HDKA 3JTHA 3KGLA 2KLOA 1BOBA 1JKOC 3QRFF 2EQRA 3S2WA 3SZPA 1X9TA 2IFWA 2ACJA 1RUG1 3BC8A 1W0NA 4CDXA 4PDWC 3HGYA 1RRJA 3ON7A 1DZQA 1PK6B 3ZYJB 1PX3A 4IXLA 3V4GA 2OUJA 2W95A 5JLXA 4IZZA 3F72A 4AVSA 4GH4B 2HBTA 3VZJA 1ACIA 3LSMA 4RGKA 2VL4A 2FU4A 4HT1T 3KV4A 4P9WA 1GNYA 3MZ8A 4B47A 1PM7A 1S0FA 2HR3A 1XMAA 1UNBA 4DNYA 1XSDA 3ZR5A 2HLEA 5DDJ3 3N97A 2WNVB 1S0JA 3FX3A 3C3VA 3TO9A 3J4UH 4GWMA 3H8XA 1ZR2A 5CVRA 4PIZA 2M1BA 2QQJA 2H09A 5IT6A 5D4RA 3TN93 1WCQA 1QNTA 1GQPA 5FLJA 2GH8A 2AO9A 1Y0NA 1DGLA 3D4KA 4YFZA 3OYIA 4AEMA 1GFF2 4XE9A 5FV3A 3ACLA 4UF0A 5T5OA 4F7ZA 3ASIA 4LIVA 3PURA 2DOEA 2IP2A 3CUQA 4YEJA 1CAWB 4ITCA 3WDXA 4DY5A 4XHBA 2Y8KA 2ZJCA 4BZ4A 3NNJA 3HSFA 4ISRA 4PFPA 2OQRA 3RKQA 3GX4X 2K9NA 3GTJJ 4JZRA 1RUOA 4NN0A 3H3VK 4P9XA 4NMIA 4XFFA 1VAKA 1FMD2 4IX7A 3GZTB 4IKFA 3BZCA 3UJQA 5E1RA 1IXRC 2V7FA 2ARXA 5KC5A 4MHUA 3MIFA 5K0UA 4QKDA 5EEHA 5HVQC 2W1SA 4GYGA 2C24A 2NQYA 4K6BA 3D1NI 2DCEA 4HRIA 3S3MA 3EMRA 5A6YA 3LEIA 2P34A 1D1CA 5FKLA 3V8KA 1Q5OA 3J7AY 2BHZA 4P02B 2TNFA 1HRV2 5C3SA 4RHV2 5ICCA 3ZFFB 1VBA2 3SCHA 3SJMA 4KICA 3HOZJ 2ILMA 2OUMA 1U6GA 2VW2A 2WT2A 5HCHA 1LU2A 5FYSA 4GO1A 3O0VA 2ZMNA 4WM7C 2OVUA 1YX3A 3DF0A 2Y6KA 1WJFA 4R8HA 3MEPA 2E60A 3RI8A 4D7SA 1W9YA 1DQ6A 2YFZA 3LDRA 3DPRC 2FXAA 2OT7A 4N43C 4CEYA 1UX6A 1PZ8A 5D8KB 4CCLA 3E97A 1RVF1 2VUCA 5K9YA 4Z2AA 3JRFA 3FHZA 4KU7A 5CYVA 2P5LC 1AUYA 5CKTA 3AMPA 1BJAA 1PNGA 4ZXKA 4W6XA 2CQXA 2QQNA 4YIIA 1XS9A 1IG7A 3OL3A 4KN4X 4A3IJ 1R5HA 4K9SA 2YGMA 3JCUC 1K12A 3IB3A 3RGBA 4O9GA 3TNQA 4JV4A 4K20A 1KYZA 4H4KC 3UKGA 3FXUA 3PO2J 4HBLA 2ZEWA 1SD4A 5L19A 4YIFA 3U0ZA 1K6YA 4EJTA 3OPZA 2R1BA 3OTFA 4MO7A 4AYBN 3HXLA 1QU0A 4L5JA 1MW7A 2B4KA 4Z8BA 5EIYB 1XD7A 4RGAA 3WCSA 2X10A 1TLHB 3FC0A 3WSOA 1V0AA 3GYHX 2R16A 4O65A 4E8CA 1ULPA 1DIWA 4YGBA 4B4RA 2WTEA 3V8JA 3PU3A 3AMHA 2JDNA 3ZMTA 4LG3A 2BHYA 1VQNI 1K5JA 3ZR6A 4XQFA 2EFOA 3POIA 4BEHB 4L2NA 5G05L 3W59A 4FX0A 4IQPA 4BOWA 1MS0A 2I74A 2CV1A 2JB8A 2VMEA 2WNUA 4Y20B 3E3VA 1SMYF 4NNJA 1RUH1 2DU0A 2ELKA 1G86A 2WWJA 1UG2A 3LA7A 1B1BA 1GWKA 4G4FA 5GLVA 3LQRA 3PUSA 1R4MB 4U87A 2BNMA 1E3OC 3C7FA 2GP5A 2GC2A 3TDZC 4RBOA 1U5ZA 1MVEA 2Z42A 5LLQA 1LGNA 4LNVA 2LROA 1MH3A 3UNPA 3MW4A 1JYVA 4Z6YA 1XU1A 2O8KA 4LG0B 1OSGA 1HLCA 1QOSA 2VPRA 4RB1A 2XIGA 2R7SA 1JS9A 3J7NA 4YPJA 2UYAA 1GP4A 4HVOA 1F4HA 4YGDA 3KB5A 1G9AA 1RUF2 1H2KA 3M8FA 3GJAA 3SHFA 1EPZA 4GCVA 1D1AA 3AVSA 4QM9A 4OI4A 4AIHA 1D1BA 3Q3SA 1SCSA 5FYZA 3J81Z 2VXRA 3GZUC 5LA0A 4O61A 2Z16A 1U5IA 3O7OA 2L54A 4DXTA 5JSRA 2AXLA 2FD5A 1UZ0A 4RS5B 1QJX3 2DFFA 2VXZA 5A70A 4LOTA 3NW4A 1N3QA 2V9KA 4K40A 5SV5A 5J1RA 3F21A 4B3NA 4HVRA 5LD2C 4R52A 1H1MA 1TEIA 4IE6A 3T2QA 3CDHA 3PJQA 5EYXA 4LA3A 1EV13 4IGPA 4JGZA 3I4NJ 3BVCA 1W05A 3LFIA 4JTNA 1ETOA 1W4MA 3V0AB 4OHWA 2A6EF 1MZ5A 4HLTA 3HOXJ 3TEWA 1UPSA 4L9JA 3H3ZA 2VPLA 2DW4A 1A8DA 2R32A 2ADDA 2DMUA 2RDRA 4A6SA 2CV0A 3POJA 2IXIA 4ZHNA 1RB8G 3FBNB 1UHMA 3OEBA 4YW2A 2VBBA 2E1MC 2GA1A 3B69A 5J4VA 5F6FA 3NV2A 4YW4A 1BVVA 1WZXA 2HWD1 5IVYA 4ES9A 2W1UA 5BNNA 2VCBA 1ZREA 3I55I 1F8VA 5GKAC 3VD5A 5T3NA 1YC61 4LBMA 5JXJA 1V70A 3VPRA 5L3EA 3FZ3A 3RZJA 1I3HA 1ENHA 5FJKA 2M3AA 2GMPA 2MC3A 2P2KA 5DUUA 2VIXA 2XJRA 1LGCA 3MKZA 3RNSA 4PLNA 2OTLI 4M3FA 5J37A 2P7VB 1V6IA 2DA6A 5FO5A 4HQEA 1WGPA 5D6FA 3HBLA 1W9SA 1N75A 5F5QA 3RFRA 1RIOH 1W7PA 4XRMA 2VBYA 2X51A 1RUI3 1FPN3 3ZN6A 3NWSA 2Y0SA 4XR6A 1B59A 3GF6A 5FXZA 1I50J 4IGQA 1R49A 1I27A 3PO3J 1UZZA 5DD4A 2LK2A 4DYQA 3VKMA 2RV9A 2XAGA 1YI2I 1PUEE 2FZ2A 2E1NA 4C1XA 1TQ5A 4LBQB 2DU9A 4IHWA 2TCTA 1AYM1 2WRAA 3S5AA 1D3YA 3WDUA 3I59B 4WVVA 1LB2A 5F5IA 2V1DA 3IH4A 4A3EJ 4D3WA 4QM8A 4XETA 2OX0A 4PIXA 4A7YA 1NYWA 3AZYA 2Y6HA 1KYWA 3CJIB 5FZ8A 2PQ8A 3POSA 4MEYF 4B7EA 2K4BA 3CJQB 3AKSA 3CDLA 4LT5A 5FOBB 2EF6A 1LFUP 4Q5SF 2DWRA 1GP5A 2AUYA 4YW1A 1YLFA 3WG1A 3R4DB 2FUG2 3TB0A 2VW0A 3P5JA 3I4MJ 3K2OA 4RAYA 2C9AA 2X8KA 5DV5A 3EBRA 5A7NA 1Q3EA 2XROA 3K4DA 3M4OJ 1WLCA 2LBFA 3A02A 3ZKUA 2AHQA 2LRDA 2DURA 1PZ7A 1UELB 3LQCA 1HKTA 3FFQA 3H8UA 5IVJA 3AAFA 5A80A 2O14A 3WP4A 2IAIA 1TP4A 2HVSA 2RR13 2RVAA 2L7KA 3MPBA 1ON1A 3G1LA 3H36A 1PMHX 2L9RA 2W85A 2FEZA 1QJX2 3RZDJ 4HBNA 2IBDA 2VE8A 4KDPA 1UU6A 3ACGA 2D45A 4BQWA 3NSTA 2C6YA 4AEDC 3SLIA 3Q0VA 3JB8A 3SH4A 4BM8A 3THCA 3PVNA 4Q0VA 4FE4A 4L18B 3U10A 5KXCA 1BM9A 1YFHA 1H1IA 3USUA 5CFDC 4P55A 1RUD2 1VBD3 1EV12 1NLQA 3E6CC 1X1AA 4CU7A 1J75A 3GZ5A 2M2EA 4M9XA 2FMYA 4KT6A 3RZOJ 1HB4A 1X1PA 3RPUA 2KRHA 1EF4A 3J8F1 1UXZA 3JRCA 1AR71 3JREA 1BXHA 2HYKA 5E8AA 2ZXJA 2R063 2DCYA 4HKWA 2F2EA 3MKWB 1RITA 1EH8A 2JVHA 3W6JB 1S3JA 3W3CA 1N1TA 2D5VA 2Y34A 4FFFA 5IP6A 2HWF1 2DLLA 1Z21A 4E2SA 1KZHA 3F22A 2DAOA 2J1RA 5C8CB 3N9LA 1KGYA 3NV1A 1ONAA 1N77A 5CLSA 4ZTJA 3MW3A 2JG8B 3BWGA 4XRSG 2PHLA 1AYN2 2TEPA 3CMAI 4LBOA 2A6TA 5HBAA 4XOPA 3HGGA 2VE1A 2ARAA 1ODDA 1HXS3 4NHYA 2WLQA 1R1VA 1EYBA 5JOZA 3WTUC 4GFBA 4AIJA 5B1BH 2QM3A 4MGTA 3QYEA 5FBJA 1RUI2 5CADA 2PEXA 1FPN2 3KHBA 4RDUA 3AMNA 1SVLA 2E7WA 3T09A 1MJBA 1NG6A 1R64A 5GLZA 2L7FP 2H8RA 5LWBA 4OMYA 3IDAA 4EGYA 4DINB 4U88A 4IE5A 1OPCA 2VOVA 2CUEA 4B44A 2RS51 4CDWC 4M3CF 2JQ7A 2DXIA 2JDPA 4Q1PA 3BP8A 4QDQA 2VZOA 1XTAA 1H4GA 2BGCA 4PLMA 3H8RA 3DPLC 3X29B 4GDFA 2WFF2 4ZKTB 4DZPA 2RNJA 4UFMA 4X8NA 1BL0A 4XUOA 3ABKH 2A5ZA 2VT3A 2ZJRF 5IVBA 2W57A 4BK4A 4CPBD 2IFRA 3LCPA 4FCAA 5FPUA 2WB1A 4YRDA 2QSFX 3CUQB 3N7LA 4GKXA 3OD4A 5DG1A 4E2GA 2OA2A 1OA2A 4XJAA 1PK6C 3GTLJ 5CZKA 3ECQA 2RVCA 1PM4A 4Q4Y2 2LKSA 2O61A 3K51A 4GH4C 1DP0A 4WZCA 5FK8A 2C4XA 1JXNA 5C3PA 5SV8A 1NXD1 3DYPA 4U7DA 5FY9A 3W58A 5DZGA 2GAUA 1GUUA 3R61A 4F83A 2CS3A 3KVAA 1YHQI 2DJNA 1EPWA 3RG0A 3H9AA 4YG2F 3WF4A 3IN9A 4HXCA 3F23A 5K0UB 1ZBA3 3KM5A 5LRSA 3MHZA 2RR12 1MSEC 2BXZA 2I2SA 1U8BA 1HW5A 2X5IA 4Q4X1 3IUOA 1A35A 2V1UA 1VE0A 3HNMA 3CIHA 4PK4A 2D3PA 1KA8A 5EZWA 2V73A 3A0NA 1LEMA 5A3LA 2LKPA 1Y43B 1HB2A 1FOXA 4FHTA 2OU2A 1UPIA 1R082 4LMYA 1AL0G 1Z1DA 3WDWA 3BIEA 1G3WA 4KG8A 3UGFA 4DBRA 5J3LA 1C3HA 3IDCB 5FP3A 1BK1A 3B00A 4XF4A 2WT1A 2R062 1ODNA 3QP5A 1WBLA 4BB3A 5IOZA 4CEYB 1X1DA 4NOTA 4Y15A 5L7OC 2QQLA 2XVGA 1BR2A 5A3NA 4LHNA 1IO2A 2Y75A 5LB6A 4PQ9A 4YFXF 1LGBA 4YLZA 1TBXA 2EA7A 3RZGA 2ZABA 1D0XA 5TJJA 5FD6A 4BYYA 5F1JA 1R5GA 1YS6A 4P5OA 1BW5A 4QQ2A 4NRPA 3ZFFC 1QZYA 1Z6RA 2VOTA 4WXCA 2X9DA 4B29A 4XJ9A 1YYVA 3PVBB 4CDUA 3GALA 2V4JC 1HXS2 4QDRA 2W3JA 3LZZA 1QJY1 4AR2A 1BI0A 3U37A 4IVNA 3DBHB 1RUE3 4Q26A 3K69A 4CP9A 2VC1A 2B5HA 2YV8A 3R0AA 3C7JA 3AL0B 2XKPA 3BQZA 1IS5A 4G7ZF 2K9QA 4YW3A 1ZRIA 1BR1A 3O1PA 3FHQA 4GJZA 2WS93 4G6QA 1ZG3A 1BMV2 5FUNA 4HLXA 1XSRA 3REOA 5KVRA 3POGA 4FPJA 1I6HJ 4DRVA 5D8LB 3OYDA 1UCXA 1ZBE2 3RMXA 1N25A 1DGRM 1HKSA 2BW8A 5TRDA 4AOCA 3A2KA 1OPMA 2KA3A 4OIRF 2XJPA 3IIIA 1DU0A 4MH0E 2HFHA 1WBFA 1O8PA 2WNUB 5FZMA 1N1SA 4N9IA 1I3QJ 5E79C 2R5ZA 2BQPA 3MKLA 5IUQA 3BROA 3A1YA 4B3XA 1LPQA 3WINE 3KF3A 2NN8A 1XMXA 2LUWA 4AD9A 1TVGA 1D5VA 1B8IA 2QWWA 4QD2A 4YVWC 4ZS2A 2JA8J 3WG3A 2Y38A 2XPJA 3WTVC 2KRCA 3BKZA 1RHI2 3S57A 1QZZA 3R05A 5BY5A 2ADEA 4XAEA 2VXJA 4EWEA 2P6TA 2D5HA 2UWAA 4X6RB 5LGNA 2MA3A 3GFLA 4DEQA 3V65A 1CX4A 2IXCA 1V6KA 2XAFA 1ZBA2 5L3BA 4A2UA 3L9JT 4AI2A 3IWFA 2JMWA 1J9IA 3M9AA 1IN4A 5DYMA 4LUKA 2DPDA 4H7LA 3RSJA 1PNFA 2HEVF 2NP0A 1S9HA 1URXA 3DYOA 2KP6A 5FJ8J 2VOXA 1MJAA 1PJRA 2CQNA 4Z2WA 2WO3A 2QKMB 2BWAA 3OBTA 2Q8OA 3ZN1A 3I2HA 3G73A 3PUFA 2IC1A 4V1PA 1D4M3 2P5BA 5FZ0A 4RM2A 1W8HA 2CHHA 1UYXA 1WGXA 4XYXA 1X36A 1BKZA 4HA8A 1B9NA 5A2QK 3TDUC 4S0HB 4E7LA 2IVIB 1H6XA 2EIKH 1TE1B 1N1VA 3Q8BA 2O03A 1W06A 4QQLA 3MZYA 3DF8A 3OGSA 4JGZB 3O1OA 2F4OB 2W68A 1H9WA 4ZH4F 3OYKA 3JRAA 2QLZA 3QYFA 1UZYA 3L2VA 2OQ7A 4WM8A 5FY5A 1KU2A 3MFAA 5LA1A 1XNTA 5AFEA 1LCLA 3VOEA 3VBHA 2IUWA 3S17J 4I76A 3PL0A 4AFAA 3I2JA 4S05A 2JN6A 3FKJA 2RDQA 4LLNA 1QIQA 4BBRJ 4H2AA 3ZXSA 1UW8A 5HI0A 4YRVA 4DBQA 4YM3A 4LOCA 1LHVA 3N7JA 1J83A 3SKJE 4RS5C 1JHJA 1YLLA 1UJ8A 3ZR8X 3T0AA 4V2GA 4BJ5C 4HW0A 1VBB1 5BNNB 3B02A 4RQPA 1RUE2 1RXGA 5CVIA 2ZXHA 2C9KA 2ZGPA 1RJ7A 1SQ4A 3HTUA 2JA2A 3P3PA 1WW6A 3H1YA 3TW7A 5EGOA 1EP0A 4NO4A 3C2UA 2HI3A 4AVAA 1K42A 4PQQA 3EXUA 2HOSA 2WS92 1D4VB 2RM21 3RRDA 2ZAAA 5T55A 1XU2A 2M34A 2BGPA 1STZA 2GXAA 1USSA 4Y4YA 1V9U3 1RJ8A 1JT0A 1F5FA 2JDAA 5JI6A 1W7PB 4ASNA 2PA7A 2QE3A 3ZN6B 4KJZA 1A8MA 2ZGUA 3H50A 5E6HA 2BVBA 2P37A 4PCRA 4ANJA 2ZMKA 2VODA 2LF8A 1SDDB 1QU3A 5CVVA 2NS0A 2MABA 1SBEA 1W8NA 2DT5A 4ESFA 1UYYA 3HOWJ 3NKGA 3A0BC 2ECBA 2RC4A 5A1LA 2RJKA 1ZYBA 3HRUA 4XN0A 4MGYE 1MNMC 2WZR1 1GDTA 3T2TA 3AFGA 1DYOA 3OOPA 3IV5A 4S04A 4KA4A 5A3WA 4XLNF 3I58A 1VIWB 3H0DA 3QU6A 2XV4S 4D9JA 2P6HA 2QBXA 3WP3A 5C3OA 3NAUA 1NTCA 2E7TA 1VQLI 2L02A 1RUNA 3RZHA 2CQ7A 3CMGA 4NIDA 3JRHA 4YVSA 1D8JA 4F8AA 1W1WE 3KSCA 1P4WA 3ZMUA 3OSDA 2BVLA 1W6PA 4CDQA 3DXTA 3OYCA 4IV1A 3GCXA 4OIPF 4DZJA 3OUHA 2P0WA 2K9LA 4DMIA 4AQ6A 2LBFB 2UWBA 4DIQA 4ASKA 4FE7A 1JH5A 2SBAA 3BDDA 1V3FA 4W6YA 2D2WA 1WZ2A 3VDXA 3RKXA 4NWWA 1WWXA 3BY6A 4WV8A 4AAXA 3DTIA 5DAQA 4IHXA 1QJEA 4UUSB 2WZEA 1LFBA 2E9QA 4A44A 3R60A 4DNCA 4HF1A 1KFUL 2VY0A 3CJIC 4ASLA 3T4VA 1C0WA 5I0RA 1UXXX 3S1MJ 5EZHA 1HW1A 2VQUA 5M3MJ 3USUB 3J7MA 4FVVA 2EXKA 2PMUA 3KV9A 1C8M3 5LK7B 2VZTA 4W97A 1H1AA 3MV01 2GQQA 1PVC2 2IXSA 1W0TA 5JAXA 2O6GE 1I1GA 1OFCX 2QQKA 1YX5A 4UV9A 3MBWA 4QPWA 3AMMA 2XJUA 3VZMA 2FQPA 4PJ0C 1W2AX 5K5RA 3S7EA 3LSTA 1Y39A 2PG4A 4OI1A 3IHUA 3LE0A 3WHCA 3AYAA 4LBJA 1JOJA 3OYLA 5HLTA 1N3OA 4MXWA 2ZBKA 3W2WA 1BC7C 2JJ7A 3U1DA 3H8OA 3I97A 3KV6A 2VR4A 2I8DA 4BQ3A 1FLIA 2DMPA 4KNYA 4KIBA 1HJGA 4FQZA 4Y26A 5A32B 3FLPA 2M9HA 3GXOA 2HTJA 4CA0A 1E57A 2C5DA 1TQIA 3JAMZ 2VZSA 1X3WB 1U9OA 3HKZA 4AHYA 3I53A 3J9SA 3H42B 4M0HA 1F4KA 2VBXA 2N8GA 1HJFA 2QVOA 2LM3A 1V9U2 3VUOA 2K9SA 2HDDA 1VB4A 2XBO2 2BFUS 3FHNA 5IK5A 1NH3A 1QQIA 4UFJA 4LK0F 3WTZA 4FP2A 5LA9A 3AFHA 4IV3C 2ZHNA 5CB7A 1RPWA 3AP6A 5DEQA 1TZOA 3NL1A 5IYYA 2HQAA 4LOSA 1S2BA 4Q4V1 1E17A 5C8CC 5IT3A 2P5VA 3GBGA 4JQRA 4OHZA 2CAVA 1QRYA 2Q0OA 3U1KA 4RGUA 2W94A 2JG8C 1EUTA 4QPGC 2E35A 1STMA 2MW8A 2XB5A 2RJ2A 1OFNA 1QOTA 1FPQA 3A0KA 4ESJA 4CDXC 4PI0A 2NMNA 3AXEA 4E8DA 2XAUA 1N47A 1HKQA 3HN1A 5EYYA 1PGL1 1Y6IA 3LSHA 1B6AA 2DA5A 1W0UA 1Y8QB 4MGZE 5FB2A 3VD4A 3ONQA 2PHXA 3N9PA 4DY3A 3BCAA 4PCQA 4L0PA 4E4SA 4A3MJ 1AU7A 2HYJA 3IAS2 4K8FA 5JIUA 2Z99A 1I5PA 5A6QA 1LULA 2XWJB 1GYKA 2PQSA 3KYCB 1AR93 1SAUA 4IEYA 5J1YA 4BDVB 2PJRA 4XVHA 4CSWA 1RTVA 2CW0F 3G4SI 3ISPA 3THTA 2CUJA 1H8AC 3F8BA 3ZCOA 4CUGA 2O5RA 2A71A 3ELKA 4BACA 2V1NA 1HB3A 2EFWA 2E2JJ 1ZAOA 1OKQA 1LEAA 3B9IA 1W5TA 3U4XA 3K4BA 3WNLA 2W2IA 1AXKA 2OD5A 1Z7S3 2VJXA 1BBT3 4W65A 3CUQC 5F0FA 4AFBA 4FPLA 4P9FA 2YX7A 1C8M2 2QTWB 1JE8A 5FYVA 5LATA 1HC8A 1S0EA 3N9OA 2A07F 3ULQB 1H4HA 2XONA 1YW9A 1C4RA 1H89C 2HWB3 2R3SA 2CU5A 4QAWA 3OSGA 3TMOA 1QHHD 3JRGA 3OOXA 1UY2A 4ZY9A 2P6CA 2ZXWH 1H2LA 2G7HA 2W48A 5AFBA 5A33A 5K0UC 1T8IA 4CUBA 4NRQA 1ND3A 2WWSA 2QQMA 1GNHA 3RQ0A 5JXGA 3CJTB 3QQAA 2IS2A 1KQ9A 5IAVA 4XBQA 2ZGRA 3G1MA 1R093 4K1YA 2DTRA 4NPMA 2DBBA 3TGNA 3OUIA 4CDUB 3PNAA 4GKYA 4FOQA 4XICA 4II3A 4CICA 1QGLA 2CY6A 4JYKA 1NT0A 2GU9A 4CXFA 4CP9B 4HMZA 4UYBA 3KT1A 1Z67A 2A6XA 1K5MA 4DYRA 2HEYF 3WG7H 3RJPA 3HOYJ 2JG9A 2VN2A 3DV8A 4CEYC 2RE9A 4YZ4A 4HEA2 4FTHA 4FX4A 1JXSA 2R041 1YS7A 4EN6B 2ZGMA 3I3MA 4UB8C 4MGIE 1JBCA 4XOTA 4WVZA 3WLUA 1VBC2 2VC0A 4DEVA 3NV4A 1J5YA 4PUSA 3QAHA 2W25A 4XILA 4AHZA 1LHWA 3L2YA 3I4IA 4Z92B 4UW6A 2V6CA 3WDTA 5E8GA 2BZTA 5AVAA 1VB2A 5IAXA 3LNQA 4JAAA 1XOYA 1WVRA 2R5ZB 2ORZA 1AR83 1FX5A 2MEV1 4UBHA 4CYCA 1L0OC 5FUIA 3AL0C 4A4AA 1C5HA 2GDFA 1WW5A 5JLVA 1G3YA 2IA0A 2ADUA 3Q8FA 4CDGA 3VODA 3URFA 5HS9A 5C4WA 2ENRA 2JJ6A 4N9HA 1YO5C 2VOPA 5J7MA 5ERIA 4TTGA 2IVMA 3B3QE 3OBZA 1TMF3 3CCRI 2P6SA 2X05A 3VBRA 2OF7A 2EVXA 3LAJA 4XKBA 1RINA 3GFMA 2GP3A 2JA7J 2VBDA 1R36A 3OR1C 2E36A 2WJSA 2FJ1A 2R1DA 1W3XA 2R7VA 1AR92 1KQRA 3TEDA 3BTJA 4RAZA 2X1DA 1NUKA 5FPZA 2DUQA 5H9PA 3CESA 1K7AA 3ZSEA 4IF4A 3C8XA 3P3NA 3HUGA 1GUIA 2QDRA 2WNUC 1KEXA 1ZGJA 5IPAA 3CEWA 5FWEA 5M5WJ 1CGPA 3LSJA 1Z7S2 2BOJA 1BBT2 5DAPA 4E27A 3HOBA 3AYEA 3IKTA 3SH3A 3PVEA 1USTA 3WGHA 4IO9F 4JDOA 1BK0A 1XSVA 4XXAA 4YW7A 1VTNC 4L9TA 2HZTA 2GIVA 5GTHC 2DT7B 2HWB2 5C3QA 2DUOA 1XBFA 1ETYA 2ZC2A 1T0FC 1Z91A 3L09A 3POYA 5FZAA 2GWRA 3VZLA 3BR1A 1AX0A 2WT0A 4NPLA 3N7MA 1VRBA 4JDMA 2PBIA 1JTXA 1IGOA 4EZ4A 3OSFA 1RESA 4XURA 2LVSA 3K4ZA 2AQEA 3WUCA 4HDVA 4BE1A 2HYFA 5JPNB 4DPNA 2F5DA 4WM8B 1IQAA 3T30A 4D7TA 5F3IA 1UB9A 4A93J 2X1EA 3VBHB 2EALA 2DODA 5HDNA 4A3BJ 3ZRGA 4UVCA 4XRSA 2P17A 1HQWA 2XPWA 5EG0A 3LAPA 4K8RB 2PLV3 4WCGA 4HOOA 2FOKA 1IGNA 3VKLA 3RKWA 3KP5A 2FDGA 1LHOA 1OCTC 4I0AA 2C1FA 1FYMA 1PGSA 1VQ4I 2DT6A 5LBQA 5FP9A 4LA2A 1W9WA 3K0LA 3M7GA 3JQWA 5EGOB 1QGPA 4DRRA 2L4AA 1Y1VJ 3UJOA 2Q1ZB 4MHGA 1GOFA 4PT6A 2X6YA 4KN7X 2JIJA 3CJXA 4JGZC 4FT8A 3OB8A 5D5XB 4I30A 5KR7A 1R23A 2ZGSA 1XSXA 1WD4A 5HS7A 1ULGA 2XQXA 1JJ6C 2L3DA 4U0WA 5M5XJ 3OYEA 2KD7A 2BVMA 3WCRA 1E2XA 1ZGAA 3MQ0A 4UHTA 4P08A 4A69C 3PHMA 4ZYDA 1CAXA 1F5JA 4CGZA 1U5YA 3O14A 2LG4A 1IPKA 3J7ZI 1JODA 2ZEZA 3ZXFA 1SEUA 5BNNC 2KJBA 1RETA 3RZZA 5FXWA 2DA3A 2VUAA 1SLIA 3D8CA 4QT6A 3L9FA 3ECOA 3NQHA 4A3DJ 4FOWA 1L7RA 2R30A 4RFT0 2AREA 3GCMA 1TMF2 4QHZA 5JR7B 5I91A 2VOKA 5FY8A 5I93A 4META 5HS8A 2E2IJ 3DU6A 3FISA 2PMZN 4D5FA 1LESA 4YVSB 2XMLA 3SMHA 5CKNA 4XTMA 3OY9A 2XOMA 5L9RA 5FKOA 4LO4B 2XGXA 3A0HC 4CDQB 1BEV1 3PSFA 4IV1B 2K7LA 1FMD1 2NS7A 5EF6A 1Q8SA 1RIRA 5JIAA 3RPQA 2FBHA 1R5ID 1YIJI 4M4PA 4V2WA 5JI7A 1YRZA 4MTDA 2JE7A 2D1HA 3MD2A 1LOGA 2VKDA 4HK8A 2WAQA 2O0OA 2DN0A 1G9FA 3NJZA 3IWZA 2HDCA 1YQ6A 3JBG1 4NDLA 4CRQA 4Z2YA 3BZKA 3QODA 4UFIA 2WR9A 4JCKA 4QHBA 3D5SC 5DCMB 4CCDA 4AVZA 1UU5A 5B1AH 5IOYA 4MIMA 1T39A 2KISA 2ZX0A 1PO12 4HSLA 4IJAA 4UT5A 3F6OA 1P92A 1VRH1 1MBHA 2DVGA 1GSLA 2LW8A 4EN9B 4I3PA 3EPZA 1S4CA 2IGKA 1UIKA 4WVWA 1LEDA 2ZGQA 4JX0A 3C7EA 1LTEA 4FOVA 3RMYA 2UWCA 3PNVA 4KWKA 1JI6A 1GOHA 3LFMA 3VBUA 1G6NA 5FP4A 4AE2A 3P9KA 2HOTA 1MBEA 3HIFA 2XL9A 2IW5A 5B2GB 2VUJA 4G3YC 4E4DX 2QGUA 1LRHA 2PHFA 3MWMA 4RFRB 2HEOA 3PQKA 3LL7A 2WABA 1OCZH 2MH9A 2XF5A 4IOCF 1O4ZA 4MXWB 4YM2A 1HV1A 3F95A 1Y0UA 4EM2A 3QP6A 4ASMB 3MIDA 1YRNA 3CCJI 2EILH 4N8MA 4LGWA 2UYBA 3POWA 2FCUA 5GLUA 1RVF3 3KLOA 3VGIA 1NCQA 3KT4A 3LSPA 4NAMA 3FUOA 1OPOA 2OTJI 3OYNA 2KHMA 3T8TA 1YQCA 2CNAA 3BG9A 5C6CA 4P14A 4Q4ZF 3ZQGA 3KZ4C 2A7AA 4W50A 3T8RA 2E53A 1HRI1 3WW2A 4FPGA 2BYVE 4CZZA 2QQOA 4G9SB 2NVQJ 5CVUA 2XWBB 1NE4A 3ASOH 4RS8A 3IBMA 1LVAA 4PJLA 2J42A 5T50A 2WY7Q 5CKMA 4C2UA 3BG3A 3LEKA 5BNOA 3ZXGA 4BPZA 1LAJA 3MZHA 3C18A 5FXXA 1SFXA 4HVQA 4LLLA 3AZWA 1LOCA 3LEMA 5EJ3A 1YFXA 5F2SA 3B93A 2D98A 3E5XA 2FQ3A 1QXRA 4W4ZA 2VH9A 4HV5A 3NAPA 4ZZDA 4BQ1A 3HOTA 2R7WA 1ZRCA 3DL3A 2HZDA 2YC0A 1GQHA 4D6SA 1UY1A 1T6SA 4Y52J 2O1QA 5AC91 1JOPA 1LE8A 3M3IA 4PZJA 4CYDA 3VWBA 2EXJA 3HVDA 2R7EB 1HXDA 2J5PA 1RUH3 3LGRA 3WVJA 5J6XA 4BLJA 4ENNA 1TC3C 1G2HA 5A7WA 4V19K 4LKFA 2BY3A 2CH0A 1XG1A 4C2MJ 3GZEA 4A12A 4FBFA 2XUBA 5E17F 4INDA 2NVUB 3VDBA 2VMHA 1RUF1 3CMEI 3CLQA 2HYGD 4ZYEA 2PJRB 2JIGA 4CO8A 5E16A 1DGRA 2A73B 5GPAA 1T56A 1WCDJ 4QB2A 1VZ0A 4QPYA 4TSVA 4ENJA 1NCRA 2V72A 2ZMEB 3D0SA 1IRGA 5IVFA 5JZGB 3P9CA 5IY5H 4R9BA 4ZDLA 2BVVA 1RNLA 1U78A 4XABA 5A3MA 5FQ0A 1S1AA 2QQ9A 2PJPA 1XB4A 2X53S 2NVXJ 2EV6A 1VQ5I 2FCVA 4B1LA 2OW4A 4JRAA 3GCWA 3VHOA 4Y1VA 2LLKA 3ZPYA 4EQQA 3ZDVA 2ZO4A 5EDNA 4W1UA 5FXVA 1FP1D 1OCCH 1CQ9A 2KFDA 1KXGA 2X29A 1XX5A 5KC6A 4M3CA 3UKVA 1ASJ2 1DQUA 2L9VA 2CGNA 2X5IC 3OS1A 1H88C 1COV2 3MEXA 2DF7A 2ZJ2A 3MICA 2B45X 1AJOA 1RVF2 4D7YA 2G0EA 5A3OA 4A6OA 2JICA 2V26A 3PFYA 1F5TA 2VXDA 1JKRC 3LAGA 1ZZ6A 1MS3A 1SLAA 5FZHA 5M0TA 1H2NA 2DMTA 2R0HA 3L2HA 2XJTA 4QX1A 1XNDA 1WCKA 2K0GA 3GLLA 3ZXJA 1JTZX 1Q8QA 2Y33A 3OYWA 5FLHA 1K5MB 3H9QA 2RJLA 5FO8B 5ABJA 3LOCA 3ZFGB 4MGQA 4QPIC 2JG9B 3ZMVA 5HLGA 2HWD3 3MF6A 4X8PA 2R7TA 3S8PA 3ZQIA 1D0GA 4BK5A 4CCMA 5JHUA 4XJZA 5IK8A 4LO6B 3O0XA 5IVVA 4E2QA 1F15A 3WNPA 3MI8A 1OYWA 4FPOB 5D21A 4RGRA 3DTKA 2XGEA 4F3JA 3HJRA 4YFNF 3KZZA 2GC0A 2G9WA 3FHIB 3IMNA 4M00A 1SFUA 2VI6A 1Y1WJ 3O1UA 3WU1B 4CDUC 1NG0A 4LJHA 4BA6A 3FWEA 4JGYA 3CHXA 4IHSA 2QUFA 5HXMA 1WCUA 1JN2P 2E31A 1ENQA 1W6NA 4CYCB 2HVRA 3CL1A 1KS5A 1KU7A 1DYPA 4P5HA 1DQ0A 4XIOA 4R1HA 5C4WB 1OLMA 4P5YA 4AFCA 2QKDA 2E7AA 1R00A 5C3EJ 1CJDA 2ET7A 2QZ8A 3L00A 1AYM3 3VBRB 2GIZA 1S55A 3CZJA 2M4GA 3RJ2X 4LHKA 2E32A 1OLTA 3IMMA 1ETXA 2KM2A 1MR5A 2LRPA 2ID4A 3H7YA 4EEFG 4XDPA 1XNKA 3HEFA 3QPLA 2PLYA 4CXYA 5FZLA 2VM9A 4TYSA 3WU0A 4FFGA 4HANA 2ZSIB 1DF0A 4UUTA 4OCTA 2VMFA 1UMIA 4Q0UA 3B6CA 1SMVA 3OL4A 3WTSC 2QQ8A 1DGWA 3CC2I 4QQHA 5KBFA 4I2OA 4X1EA 5IK4A 1RUC2 3OEAA 4I02A 4EMSA 4F93B 3W6VA 1RUD1 2BJSA 1S7OA 2HOEA 3L2CA 3BG6A 1TWAJ 2FD8A 5GZEA 1YNAA 3VHRA 1ZLJA 3WV6A 3V7RA 2PHRA 2WYSA 2VW1A 1ZNPA 1UO9A 3O1VA 4ZZLA 3I2GA 1WSUA 1JOBA 3H1WA 5M3FJ 3ZQLA 2W1WA 2BEOA 2R071 1UY4A 3M7AA 3F8MA 4KMFA 1WHUA 5EG0B 2OCEA 2LFBA 5GPCA 1UAAA 1MBJA 1GLNA 3WQBA 1FOYA 1YIOA 3J8F3 4IEWA 3MW2A 1KJRA 1AR73 4NQWA 2VL8A 3VKFC 5GAGJ 1KDKA 1PVXA 2Y48A 1AYN1 4BQYA 1ZG5A 1XSQA 3LKJA 1D2SA 4DJAA 4L11A 3D5OA 4L0YB 2HWF3 1XN7A 2HWD2 3GYDA 1X7NA 3OYBA 4M3CE 2EAKA 1K79A 4HONA 3MIBA 1Z3YA 1E3HA 5CIRA 5F32A 3HYIA 4A3CJ 3KYDB 5D8AA 3W5NA 2Y64A 4R79A 5CEHA 2W1OA 3HL2A 4WM8C 2YG0A 3U11A 4DYCA 4XQ4A 3VBHC 1QJU1 2K5CA 2XQRA 5F3CA 1QDCA 2HWE2 2XB0X 3WF3A 3ZN4A 5ILSA 4NJ4A 1CAXB 3FBIB 4AI0A 1KFXL 4KG0A 4NC8A 4P9GA 3SISA 3TYJA 3W9AA 3AJZA 5LHIA 4Q0QA 1ZQ3P 3O1SA 4XQWA 4A42A 3GBWA 1KONA 1JUSA 1M06G 3RWNA 4RQPC 1APNA 4MGRA 2HEWF 3KVBA 3S16J 4PGHA 4I6ZA 2WFF1 1XQNA 3VB9A 5FTTC 2ME0A 1T38A 3ZN0A 1UKGA 1XGMA 3WOGA 1LNWA 3IAQA 2RS53 1FV3A 2LY2A 2PMHA 4FSJA 5HCFA 3PIOF 3MLLA 2QQVA 1W8ZA 1IKPA 1AYM2 2XH6A 3S0MA 4KBBA 3PUQA 2DCKA 4BHPA 5A7QA 2JDKA 1FSHA 4EJRA 2WAOA 2A6VA 1D0YA 5FLXZ 4Q4Y1 2CGOA 3PIPF 1O4TA 3ZQQA 1OBNA 1V55H 1QH7A 5DQ0A 2EZHA 1VQOI 2OA4A 4M4RA 1JUPA 2RDSA 1CX1A 4CZCA 1GQGA 3T0YA 4MHRA 4WM7A 1SANA 1MS5A 3KP2A 4LBQA 2YPDA 2UZKA 5FRAA 1T08B 3QBQA 3GZ6A 3RPUD 3LSGA 2JDMA 3W6KB 2Z79A 3SQOA 4L97A 4QDSA 4XPVA 2PHDA 2YX4A 3I64A 5J1UA 2FBIA 3S1QJ 4XAAA 4PSXA 1OLME 2ORXA 5LHHA 1YQ5A 3VYSB 2ZSHB 4HOBA 5FKNA 2X0LA 1OUXA 5DAWA 1UKRA 2STTA 1Y9QA 4Y3OA 2DO7A 5FWJA 2DK8A 1QMJA 4UFHA 2FDJA 2VUDA 5FYCA 4CPBA 1UMQA 2EJRA 5FRMA 3TWIA 1R081 1F36A 1ON2A 5A7SA 4Q4X3 5K7FA 3BZ6A 3U78A 3IP4B 2Q30A 3K4AA 4MXVA 4QKFA 2CWEA 4YVSC 1AHDP 1U3EM 4ZU7A 3MLJA 1REEA 4PF5A 2B8MA 2ET1A 4CDQC 2MPFA 2WO1A 4IV1C 1IN5A 2K86A 3EYYA 2VZQA 5IWFA 4AHXA 3PNYA 3VBUB 1BBYA 3I3DA 4PIYA 4P9YA 1ETVA 5EJCA 1TW3A 3ZYHA 1H8VA 4CCJA 2W82A 2DDBA 3ABMH 4BH9A 3CJRB 3BOQA 2FX0A 1JJ8C 1ST8A 2XVCA 4DXSA 2M7AA 3M3CA 3B6AA 3J8F2 2WY8Q 3JSOA 4QGNA 4JP0A 4LORA 1AR72 2UV1A 2E6VA 1PIV3 3MUZ1 1Z0XA 2ZOEB 4KYWA 5D6EA 1VI0A 1HF0A 1YRNB 4D1QA 4UXNA 1ZA7A 1R22A 2VULA 4PLOA 1IN8A 2JRTA 5FGMA 4XN3A 4ATFA 5E1XA 4J00A 1NCQB 2WQZC 3DP7A 1RL3A 1LFPA 1DU6A 1Y9GA 2HWF2 3MN2A 2JX9A 1E5IA 3GEZA 4RL7A 2OQ6A 2O0YA 4COYA 4OOIA 3AG2H 3KCYA 3WODF 1DZRA 1LOBA 1IQDC 1AA7A 2JUGA 4P9LA 3S30A 5CA6A 4A0ZA 1BIBA 2ZCWA 2R7UA 2OQGA 3POEA 3UT0A 4LLOA 1QJY3 1WJEA 4HZFA 4LK1F 4LO7A 1ZBE1