4A3BG

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3bG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3bG01
1TWFH 3KLWA 4KHPL 4A3JG 2NVQH 1C9OA 5FLMG 4JI8L 1FJGQ 3A5UA 1M90C 1K0RA 1MKHA 4JI4L 1L1OC 4NXNQ 1NY4A 1GVPA 1HZAA 3GTKH 1NJIC 1Z47A 2CWAA 5LMUQ 3T1HL 1HNZL 1X9NA 2E2JH 1YZ6A 5GQOA 1X55A 5C4JH 5GROA 3STBC 1QZGA 5IP9H 2KENA 3EIVA 3AEVA 1YHQA 2H5XA 1HR0L 3GTOH 3GDEA 2K14A 1QUQA 1YHAA 4LFAQ 4DV1Q 1IBLQ 4IFDJ 1N32L 2IHFA 5EAYA 1KXLA 4QL5A 1Y1VH 1PH4A 4BY7G 3F8TA 2JA7H 1PH8A 4A3CH 4X65Q 4BBRH 4H02A 2L15A 4HIDA 4A4IA 4C2MH 4JI5Q 4A3MH 1J5EL 1VQLA 4IPGA 3KF6A 3G4SA 3CAMA 1L1OB 3CD6A 2ALYB 4IPDA 4HJAA 4BBSG 4LW1A 1UE5A 1GKHA 3M4PA 5IP7G 2R7DA 2I0QA 4GKKL 5E7NA 3EN2A 3HOUH 3D0FA 3J80c 4TVAB 3RZOH 4DV6Q 1FJGL 1U5KA 3K0XA 1CSPA 4NXNL 3E9HA 3CCSA 3A74A 2OWOA 3S15H 2UXCQ 3AFQA 2ZJPA 1BKBA 1AE3A 3PV0A 5LMUL 1TWCH 1HZ9A 3L0OA 4APVA 3PSIA 3A0JA 4IPCA 2R92G 5IYCH 3J81i 5C4XH 3W5OA 1VQ7A 1WI5A 4XTCS 4LUZA 4YHHQ 4BY1H 2PQAA 4GKKQ 1MJCA 3OW2A 2CFMA 1GM5A 3S17H 2JQOA 2N78A 4DV1L 1IBLL 4LFAL 4KI0A 1CKOA 3S24A 1XPOA 2B29A 4JG2A 1EYGA 2UXBQ 3G48A 2IT1A 1PH9A 3MXNB 3CCRA 3KYHC 5C3EG 5IT9c 4X65L 1I50H 2OCEA 2ZTEA 1A8VA 3L7ZC 1Q86C 1S40A 4JI5L 1MJEA 3S1NH 1LYLA 1E1OA 1Q1BA 3MEFA 2ES2A 4LWCA 2A19A 3KDFB 4A3DG 3RLFA 4IFDI 3PO2G 3H3VI 1YEZA 4DV5Q 1ASYA 3CC2A 3CMAA 3HOYH 4TQUS 1YNXA 4DV6L 1BBWA 2N49A 1EOVA 4HIKA 2UXCL 2R93H 4NXMQ 3JAMi 4R4OA 2N8NA 3HOXG 1H95A 2F52A 3AQQA 4NB3A 3F2DA 3PIOA 3I56A 1O7IA 4A3IG 3AFPA 5C44G 4JI4Q 3GTQH 1BVSA 1WJJA 2CKZB 1SRUA 5C0XG 4LF9Q 3G6EA 2Z6KA 1V43A 1EFWA 1JJCB 4YCVA 5ELNA 3TS2A 4YHHL 1NBWA 1JJ2A 1MIUA 1VQIA 2AWNA 2BH2A 2PMZE 3HOVH 1XNRQ 5FJ8H 3AYHB 4DR4Q 1EQQA 4UP8A 2UXBL 2K5VA 4DV2Q 4DR2Q 4OWTB 4B3MQ 1X3FA 5IP9G 3J80i 2B63H 3GD7A 4P71A 4RMFA 4GLXA 4C3HH 4GNXA 1QZHA 2RF4A 1ASZA 4A3DH 2F4VQ 4R4IA 3PO2H 3GTJH 4YWKA 1T9HA 3NEMA 1VQPA 4KLKA 3S2DH 4JBJA 1WFQA 3BJUA 4AIMA 2HIXA 1UEBA 2IHEA 3EBEA 2JA7G 4A3CG 2KCMA 1C0AA 2WP8J 4A3FH 4BBRG 4GN4B 4DV5L 2RCNA 4OO1G 1AH9A 1HZBA 4O2DA 2JA6H 4BA2I 1CUKA 3PGZA 4A3MG 4HJ7A 2UXDQ 1E3PA 1UE6A 5M5YH 2MO0A 3RN5A 2ATWA 1S3OA 3UDFA 4NXML 3H15A 2D0PA 2YV5A 4MZ9A 4A3GH 1AE2A 2LXKA 2OQ0A 2NVXH 3K7AH 2F3IA 2R7ZH 2VY3A 2JA5H 3BZCA 1X3EA 4JI6Q 4IO9A 1VQMA 4DR7Q 3UE1A 4QGUA 1YITA 5DLQE 3VDYA 4LF9L 4LNQA 3HOUG 4EQ5A 2UU9Q 4IJHA 4YWMA 2HQLA 1UE7A 3CCJA 4ALPA 4R4CA 1B8AA 4DV0Q 4PMWA 5IY0A 3S1MH 2K52A 2AMCB 2NN6I 1FL0A 4PG3A 1VS0A 4X64Q 1SE8A 3KFUA 1JMCA 4DR4L 2I5LX 5IYCG 1IBMQ 1OXUA 1BBUA 2I5MX 3KOJA 4DV2L 3KF6B 4DR2L 1PV4A 4B3ML 2Y0SE 2CQOA 5C4XG 1HNWQ 3L2PA 1TWGH 4BY1G 4DV3L 4B3RQ 4L5TA 1TXYA 2ZTCA 2XGTA 3I7FA 3PUZA 1FVIA 4JOIC 2A8VA 2F4VL 4LUOA 4GOPA 1EWIA 3UE0A 2VUMH 3U58A 3CCLA 4AQYQ 4A3LH 4JI3Q 2RHQB 3B6YA 4IPHA 3WWVA 3RZDH 1IL2A 2N3SA 2FXQA 3GTGH 2R7FA 4LUVA 1OXTA 1VQCA 3FHWA 1KAWA 3E0EA 1QVFA 1G291 4JI2Q 3Q8DA 4GKJQ 3M7NA 3U50C 2UXDL 2OQKA 1DGSA 1QVGA 1KHIA 1VQKA 2K50A 3STBD 1EIFA 4OWWB 1OXVA 4JV5Q 3RR5A 4DR7L 1G6PA 4JI6L 1VQ6A 4LF7Q 2UUAQ 2I5HA 2VZAA 3I4MH 3HOYG 4K0KQ 2UU9L 2ID0A 1CKMA 3LGJA 3CP0A 5M3MH 1XMQQ 1Q82C 4JYAQ 4DV0L 1VQJA 2R93G 2Z6KC 2VQFQ 3S16H 2UUCQ 4HIOA 4X64L 1YJ9A 1TWHH 5BR8Q 2AWOA 4Y7NH 2WFWA 5C0XJ 3CCVA 1IBML 4A3KH 1CKNB 1N33Q 1UE1A 3I55A 4LF4Q 1HNWL 4A76A 4O0AA 3W1GA 2IY5B 4B3RL 1WCMG 1PYBA 4GS3A 4GN3B 1L1OA 2C35B 3U4ZA 4JC0A 5JEAG 2KCTA 3UDIA 1Q81C 1HR0W 4POFA 3HOVG 1HJPA 5FJ8G 1N36Q 1KRSA 5GAGC 4AQYL 3PIPA 4GNXC 4JI3L 4DPGA 1PH2A 3E9IA 1B7YB 2B63G 1L2FA 1D7QA 1YHBA 2AKWB 3CC7A 3CF5A 4GLVB 1HH2P 3G71A 2AHOB 4JI2L 4GKJL 3PUYA 4LFBQ 2OTJA 2QA4A 3TEHB 3PF5A 4UP7A 5M5XH 2IX1A 1VQGA 5AJ3L 4LF6Q 1HNXQ 1A62A 4DUYQ 4DK6C 1JE5A 1N34Q 1K9MC 3DLLA 4OWXB 1FGUA 1I5FA 1C7YA 4DAYB 4A3FG 4JV5L 2JA9A 4LF7L 1TWAH 4JBKA 2UUAL 2A1AA 5IE8A 2JA6G 4A93H 1VQ5A 3GTPH 4K0KL 2E2IH 1XMQL 3RNUA 4JYAL 2VQFL 1NMFA 1RL2A 2YTVA 2UUCL 4A3GG 2VNUD 3IRBA 5BR8L 1WCMH 4X6AH 1VQ4A 2R7ZG 4GNXB 2JA5G 3ULJA 1VCIA 2BH8A 3M9BA 4HJ5A 4A3EH 1N33L 2DUDA 3RLOA 3F2CA 1LTLA 4X66Q 3T1YQ 4LF4L 3HKZG 3H0GH 4DR5Q 1Q46A 2YU9H 2V1CC 1OTCA 3KJOA 3TQYA 4YCWA 4DR6Q 2YYZA 2E5LQ 3FKIH 1S72A 4DV3Q 1N36L 2VW9A 1K73C 4IOCA 1SR3A 1PH1A 1PH5A 3H3VH 2GVAA 4A3BH 2HT1A 4GOPC 5FLXc 2GVBA 1E22A 1KQSA 3HKZE 3S2HH 3ER0A 2CWPA 4UP9A 2MQHA 5C0XI 3W1BA 4R4QA 4FDBA 2JK8A 5LMNW 3U4VA 1PH7A 3PO3H 4LFBL 4POGA 3K81C 2E2HH 2VUMG 1Q8KA 4LF6L 4A3LG 1HNXL 4DUYL 1N34L 4DR3Q 3ICEA 5IYBH 2WB1E 4OXPA 3SGIA 4YY3Q 2B3GA 2JJQA 2PI2A 3NENA 3CCMA 4R1JA 4BXXH 1X65A 3NELA 3M3YH 3HKSA 3TS0A 4L5QA 3UDXA 2WAQE 1QUQB 2LXJA 2Y0SG 3DM3A 3J81c 4JBMA 1JJGA 1EQRA 2R6GA 2D0OA 3F2BA 4DUZQ 4IJLA 4DV4Q 1YJNA 2Q2HA 3I4NH 4WJ4A 3I4OA 2MFIA 4PZ6A 2RHSB 3M4QA 1PH3A 4L5SA 3HOWH 2EXDA 3PUVA 3CCEA 4GOPB 3I4MG 4X66L 2E8GA 3T1YL 4QY7A 1EUJA 4P72A 2Q2UA 4OONA 5M3MG 4DR5L 1JB7A 5ELOA 1YBYA 1PFSA 1OXXK 1VQ9A 4DR6L 1XJVA 1SROA 2E5LL 1KRTA 4DR1Q 4JI1Q 4C3JH 3GTMH 2EIFA 2JEBI 1IBKQ 1VQDA 2HHHQ 5GAEC 3CMEA 4A3KG 1Q7YC 5JJIA 2PI2E 4KHZA 2BA1A 4X62Q 4OO1I 1W3SA 1E1TA 1Y1WH 1IBKL 4HJ8A 1PA6A 5JEAJ 1VQEA 4JCVE 3KF8B 3ZJYC 1LUZA 1VQFA 2MO1A 2ZM6Q 1KIXA 4L5RC 4DNIA 5IYDH 1I94Q 3ULLA 5M3FH 1J6QA 4DR3L 2K5NA 1KL9A 1KC8C 1Q1EA 2ZTDA 5H1SE 1PYSB 4YY3L 2HIVA 5AJ3Q 1YI2A 2DGYA 3JAMc 1QVCA 4B3SQ 1K83H 2NVYH 3JC66 2KBNA 5JJKA 2PQAB 2GN5A 4LFCQ 4P74A 3GO5A 5LMNQ 1LM0A 3CCQA 3D31A 3CC4A 2ASBA 3PCOB 5IWAQ 4DUZL 3HOZH 1P8LA 3BZKA 4DV4L 2JA8H 3F1ZA 1U0LA 1XMOQ 2K5HA 4B3TQ 4A3JH 4LF5Q 4JI0Q 4A93G 1PVOA 5FLMH 3K80C 3OYYA 2K75A 4RG1A 4DK3C 2QEXA 1R9TH 2VL6A 2BA0A 1XNQQ 4ME3A 1X6OA 4DR1L 4UY8C 4MTNA 4JI1L 4AH6A 4UPAA 1K8GA 1GO3E 4A3EG 2HHHL 2PNHA 4JI7Q 3ULPA 4C3IH 1X56A 4X62L 4HJ9A 2CCZA 2JEAI 1K3RA 3H0GG 3K7UC 1CSQA 4OX9Q 1EIYB 3FKIG 1K8AC 4JBWA 2JE6I 4MNOA 2ZM6L 3OTOQ 1XPUA 3CQZH 4IFDG 2ZJRA 2OTLA 1I94L 3TREA 1UWVA 2VQEQ 4BY7H 4LF8Q 4A3BG 3RLNA 3K8AA 4J15A 3KJPA 3PUWA 1I6HH 2IX0A 4B3SL 4XIGS 1L0WA 2NZHA 3CCUA 2UUBQ 3PO3G 3M4OH 1V9PA 3PUXA 4JOIA 4LFCL 2NZOA 5LMNL 4PZ8A 3CW2C 1X54A 3PF4A 4YCUA 3CPWA 4BBSH 2EQSA 5IYBG 3BU2A 1VQAA 4QJFA 5IWAL 1IXRA 1CKNA 1OXSC 5IP7H 1Y14B 5J3BA 1XMOL 4B3TL 4BXXG 4LF5L 4JI0L 1V1QA 1JT8A 1NTGA 3J7ZC 1RIPA 2ZJQA 1SN8A 3M85A 3CXCA 1VQNA 5K36G 1GD7A 1KD1C 4HIMA 4P73A 4DV7Q 2XTIA 1B70B 5HGQA 1XNQL 4Y52H 3J7A5 3NBHB 1D8LA 1NE3A 3I4NG 2R92H 3RN2A 1XNRL 4KHPQ 3HOWG 4JI7L 1M1KC 2QGQA 4IOAA 4JI8Q 1PHJA 2MNAA 3KDFA 1YJWA 1WOCA 3S14H 2D62A 5JJLA 1IZ6A 2Z0SA 3HFZB 2WB1G 2KHJA 4GLAC 1W2BA 4YWLA 2Q2TA 4OX9L 1A63A 3T1HQ 3OTOL 3I2ZA 1NMGA 1SLJA 1SFOH 4DAMA 1P16A 1XTDA 3FP9A 1HNZQ 2VQEL 2KHIA 3A5ZB 1WYDA 1Z9FA 1I3QH 4AYBG 4LF8L 5C3EH 1HZCA 2WAQG 1N9WA 4A75A 1N8RC 1Y1WG 5M5WH 1HR0Q 2K4KA 3J81j 2UUBL 3CPFA 1SMXA 1Q12A 3GTLH 3ERSX 1G51A 1IYJB 1YVCA 4BA1I 1VQBA 2VS1A 1N32Q 5IYDG 1YIJA 2NVTH 5M3FG 1A0IA 2Q2IA 5HY6A 5GADC 5GAHC 1VQHA 1VQ8A 4AYBE 2YTYA 4QIWE 1VQOA 4GN5A 3UDGA 1XPRA 1Y1VG 4EX5A 1E7ZA 2LSSA 3S1QH 2NN6G 4DKAC 1J5EQ 4P75A 4QQBX 4NPSA 3S1RH 4PZ7A 4DV7L 3TRZA 1X3GA 1PH6A 1E24A 3HOXH 4R4TA 4WJ3M 2YTXA 3HOZG 4A3IH 2JA8G 5C44H
chains in the Genus database with same CATH superfamily
1HTLD 4UCSA 1TWFH 5FLXW 2RDFA 5M5XB 4QW8A 2G9HD 1IBLH 4JI8L 4APMA 2A6HC 4JI4L 4NXNQ 2JEFA 3GILA 4N8FA 3I70A 5DQHA 4X65H 2NTTA 2E2JH 4A93B 5C4JH 1I7LA 4MV4A 1H9RA 2X6LA 4JI5H 3V4SA 3STBC 4C3IG 2XWJB 1SYEA 1HR0L 3GDEA 3OMCA 1N32L 1FNUA 4QL5A 3M9MB 1STYA 2QF7A 5DLFA 2YU9B 1B9MA 3KLRA 4HIDA 3H09A 3S14B 3G4SA 3CAMA 3QFFA 1JWUD 5CV7A 4A2BA 4BBSG 2VQFH 1KNAA 1SNPA 4YHHH 3BYYB 5IP7G 2R7DA 3OSOA 3J81E 5E7NA 3CVZA 2FPIB 2CW0C 3RZOH 5C3XA 2D5DA 1FJGL 1CSPA 3BG5A 3E9HA 1PTOD 3S15H 2EYPA 5FK9C 1AE3A 5KIXA 3MAQA 3QWNA 4YR3A 5IIFA 3WDNA 2RCFA 4APVA 2ICIA 1F77A 3A0JA 4IPCA 4F7XA 1A3UA 1SNDA 2BQ3A 1G8ZD 3W5OA 4RKBA 1DD2A 1WI5A 1JDBB 3RAXA 2NB0A 4XTCS 2UVUA 1M4VA 4IUUA 2Q8RE 4IQZA 3OW2A 3X3MA 3WOEA 1GM5A 4LFAL 2N78A 4DV1L 3HOWB 3UFXB 1S9FA 1XPOA 1CKOA 4JG2A 1NCVA 2PBZA 3M4YA 2ENBA 3TDQA 5DG7A 1GHKA 2OCEA 5HURA 2NVQB 1S5DD 1Y8NB 4L63B 1A8VA 3L7ZC 1Q86C 3MWDA 5KFFA 1BO0A 1CA5A 2ZJTA 4XX0B 1QOHA 1MJEA 5ELBA 4AYBB 2PMZA 3GTKB 1AW7A 3MEFA 1EZ8A 4I7AA 2UVRA 3PO2G 2FFKB 3A7LA 4ZQIA 3CC2A 4ECTA 5JH7F 5M3FB 2N49A 5A2QE 5KFZA 2R93H 4DV2H 5LYJF 3HOXG 4R8IA 2GPSA 2NVYB 4DV3H 3PIOA 3AFPA 4FS2A 5LL6b 1BVSA 3SXHA 3I72A 4PDBA 3G6EA 3DMUA 1M6VA 1NBWA 1IBKH 4C2MB 3HOZB 1VQIA 5IT9W 1LT6D 1CZWA 1VDZA 1SCUB 2R8JA 1EQQA 5KFYA 4NMZA 4UP8A 3MXUA 1R9TB 2UXBL 4DR2Q 3TP7A 1GUWA 5IP9G 5D1OA 3ITPA 4P71A 4RMFA 4GLXA 3GTGA 3KBGA 2RF4A 5D3DA 4F88A 2FKLA 2AQ3B 3NSWA 4XYLB 4UDUC 4ZCKA 4KLKA 5CV8A 4JBJA 2G5DA 3VR3A 4AIMA 1TWCB 2R7NA 3D8GA 5KFCA 3J81L 2PW7A 3RGXA 4BBRG 2BQRA 2RCNA 2Y0SA 4BA2I 2J9GA 1CUKA 2RKSA 4HCEA 4I7ZC 2UXDQ 2IW3A 1VF5C 5I2YA 3RN5A 1IBMH 1LTSD 1S3OA 4NXML 1EY7A 2B2WC 1IHZA 4O3QA 5EPJA 1JORA 4MZ9A 4RNOA 4OO1G 2JA5H 3BZCA 1SNOA 1VQMA 1KJ8A 4LF9L 3HOUG 3CRKC 2UU9Q 2HQLA 4AQYH 4R4CA 5IY0A 1LTID 2YYAA 1CQVA 2L4NA 4E6IA 1PK8A 1SE8A 2L12A 2FHTA 3TN2A 5KFEA 4DR4L 3A8IE 4RGTA 1FGBD 5C4HA 2I5LX 4DNTB 4YJ3F 3KF6B 4B3ML 2EYFA 1HNWQ 4BY1G 2IP4A 4C5BA 3I7FA 3PUZA 1CT1D 4O3PA 2A74C 3FMCA 4ED0A 2VA2A 4KMUC 2F0SA 2F4VL 4H7BA 1W6JA 1H9KA 4IPHA 3OHXC 3RZDH 1L0XB 1IL2A 1YNNC 2FXQA 4DAPA 3GTGH 5I9OA 4O4LF 1VQCA 4DL6A 5ELCA 1ET6A 1SFOB 2IX3A 3VA7A 3M7NA 3U50C 5BR8H 3NTKA 5A2QL 4K2LA 4JW0A 1WTPA 1N33H 4RAYA 3T56B 3STBD 5KNCA 2F0JA 1B1ZA 2DLNA 1RJTA 3W2DA 2W71A 3I4LA 2UUAQ 2B63B 2TSSA 2VZAA 3I4MH 3HOYG 4K0KQ 1E2VA 4MV1A 1WCMA 4KD4A 2EYLA 4C3HB 1XMQQ 2V59A 3LWUA 4PMCA 4DV0L 3RMHA 2VQFQ 4MA5A 1I4GA 3H0GA 3OPOA 4RB0A 3FKIA 4KK7A 1E4FT 4ED2A 1DV2A 1E0BA 4O3OA 4LF6H 1JOOA 4O0AA 4DUYH 1CQFA 4B3RL 4F4WA 2VPQA 4ED6A 3OSPA 4J0MA 2C35B 2HDLA 3U4ZA 5JEAG 5C44B 3UDIA 1STEA 1TWFB 3Q22A 1Q81C 1C8CA 1HR0W 3GTJA 5FKAC 1B3AA 2K01A 5EJWA 4JI3L 3E9IA 5I6WA 1HXYD 2CW0D 4EQNA 2NVXB 2AUJD 1G2TA 3T51B 1YHBA 3N43B 1LTBD 4JI2L 4GKJL 2CW8A 4LFBQ 3RF2A 4J9PA 2OTJA 2CVRA 3TEHB 3PF5A 3BDLA 1HNXQ 1N34Q 4EBDA 1PZID 3MXPA 3K5OA 4FNFA 3V6HA 5CYUA 3NP8A 4ECVA 2JA9A 2YRXA 4LF7L 4K8JA 3FPPA 5KGUA 3PZPA 1DYQA 4JYAL 5KFIA 1JB3A 1NAPA 1RL2A 2UUCL 1K8OA 4A3GG 1KJIA 1EWHA 1WCMH 2F0KA 1VCIA 3M9BA 3OHBA 4L8JA 4LF4L 3UQ8A 2NTSA 3H0GH 3GTMA 1F2ZA 3VMMA 2JXMB 4YCWA 3FKIH 1U4PA 2WAQA 2RA4A 1N36L 4DV3Q 3RZOB 2EYHA 4IFDH 3QIAA 3H3VH 3T5JA 4GOPC 3S15B 5FLXc 2GVBA 2QDLA 4OL7A 3NBHA 3KHRA 2W9CA 1IBKQ 2MQHA 3W1BA 4DUZH 4Q0YA 1BXRA 4POGA 2VUMG 1SJHD 3R8BA 2B2VA 2FMCA 3S16B 2F0UA 4DR3Q 5IYBH 4LMYA 3N6RA 3SGIA 5E3FA 4GKKH 4A3KB 3CCMA 5EWEA 5J2UF 4BXXH 4M8AA 3HKSA 1F2MA 4HR7A 4EYHB 5F9LA 3RBDA 4X62H 2LXJA 1JJGA 2DIKA 5KG6A 4CJ0B 4Q44A 1WD0A 5I9PA 3DEOA 4PZ6A 2O4XA 1PH3A 5KRUA 4GOPB 4X66L 1G6ZA 4P72A 2R61A 3H6MA 4DR5L 2F0TA 2K03A 2YW2A 4DR6L 3MR3A 1JR0D 1KRTA 5F2DA 2OEOA 1CM9A 3A8JE 3GTMH 4EEQA 3RB0A 2C22A 1VQDA 4RHRA 5FO8B 3DWPA 5GAEC 2HHHQ 1KBLA 2FLPA 4LFCH 2R93B 1U9RA 3MWMA 4OO1I 4WRDA 3CQZA 4ECYA 5JEAJ 1VQEA 4JCVE 1AN8A 1WTVA 1E4EA 3ZJYC 5I47A 3SK8A 1KIXA 3GIPA 4L5RC 1XX8A 5EBDA 4DNIA 3X3NA 3QOJA 2KECA 2K5NA 2V9WA 1Q1EA 2HIVA 3J81W 3JAMc 4XQJA 4ABNA 2YZGA 3TQTA 2OH2A 2BQUA 3MFIA 3O13A 2ZDHA 4JI7H 2CQAA 1ULZA 4CHTB 3EROA 1RJQA 4OX9H 2W8LA 5ELEA 4ZUJA 5AFWA 4RNMA 4A3JH 4LF5Q 2X0SA 1PVOA 2ATLA 3SVMA 2YU9A 4RG1A 1DIKA 1XDNA 2BA0A 1XNQQ 2C00A 1AFPA 4DR1L 4JI1L 4UPAA 4A3EG 5KFBA 2VOBA 2QILA 2CCZA 2C2EA 2ZXOA 3MR2A 3M3YB 4F4ZA 4O2BF 5C5MA 2JA5B 3QG1A 2DWCA 1DCZA 3OTOQ 2ZM6L 3CQZH 2ZJRA 2OTLA 4XQQA 2CW7A 5KT7A 4A3BG 3G8CA 3P20A 2XGPA 3RLNA 4J15A 4O4HF 4DV5H 2M2LA 1TS4A 2DY7A 1V9PA 3EJIA 3PUXA 1LTGD 4JOIA 3N41B 5EKLA 2WB1B 1KC7A 2YZMA 3PF4A 3CPWA 1QWYA 1VKZA 2EQSA 3BU2A 5IWAL 1HHVA 1Y14B 1RDPD 4HQ6A 4TQRA 1XMOL 1F9PA 3LP8A 3C0FB 3J7ZC 1ML0D 2R7MA 1Y1WB 5IYZF 4J9OA 1QE6A 4UCOA 2EY6A 4Y52H 2WV6D 1D8LA 5KYLA 1NE3A 5KEEA 3I4NG 4AYBA 4Q5VA 3GTKA 4MV9A 4YR2A 1YJWA 3S14H 1IZ6A 3IAYA 2KHJA 2Z4HA 4YWLA 2JP1A 5FPOA 3Q8PB 4RKLA 1TS2A 4KTAA 4TV8F 3FP9A 4DAVA 1DXMA 2VQEL 2KHIA 3A5ZB 4FYDA 1WYDA 2R84A 3SHLA 1BR9A 3OIPA 4RB1A 4IZOA 3ZYYX 1B33N 2JEIA 3CPFA 3GTLH 2LS01 1STNA 3V05A 1TY0A 3KHHA 1YVCA 4BA1I 2VS1A 1CQIB 1YIJA 1A0IA 4C2MA 1VQHA 4X3UA 3DF7A 1X3PA 3BQ1A 1VQOA 3R5XA 2NU6B 1ET9A 5FD6A 1E7ZA 1R9TA 2RDHA 2L55A 1DM0B 2PW5A 1J5EQ 2K1BA 1KLGD 3CKIB 4ZLTF 3TRZA 5IGBA 1EUDB 3AB9A 4GKKQ 4KHPL 2HCIA 3GP7A 2NVQH 3TIIA 5FLMG 3FMAA 4CKEA 1TWCA 3K5IA 3Q8RB 3H3VC 1M90C 3M4OB 3D6CA 5CORA 1NJIC 3GTKH 2JEGA 4WJWA 5LMUQ 3T1HL 1HNZL 1X9NA 4LK1C 2DPIA 4BBSB 1X55A 2HDMA 4CBVA 2C2DA 2W6QA 2L11A 2KENA 1PXUA 4RNNA 2H5XA 1E2ZA 5KT5A 5K2MA 1B9NA 1S5FD 1QUQA 1JOQA 2IHFA 5EAYA 1KXLA 4BY7G 3H0GB 2JA7H 1UAPA 3FKIB 3P1HA 2KSWA 4M9UA 2B2UA 4YAJB 4A4IA 4C2MH 1CHPD 1YNJC 3KF6A 4IPGA 3CD6A 4R8UA 2V4QA 3G6VA 1IKMA 2OT2A 4M7EA 2K7VA 3FPUB 3FRPB 4X3TA 1SJED 1BQQT 1SEIA 3D0FA 3J80c 2EJMA 1RHPA 4TVAB 4DV6Q 4QWBA 4ODGA 3KF8A 4IUVA 2W7OA 3PV0A 4TV9F 1S0OA 4XYQA 1TWCH 3L0OA 3S9WA 3PSIA 2R92G 3RV4A 5IYCH 1KJ9A 5EGTA 1HQMC 4QF4A 3ETJA 3J81i 4LUZA 2PQAA 1T5XD 4C1NI 2RBMA 2CH4W 2CFMA 4HN7A 2B63A 1IBLL 4MV8A 4KKUA 2W6MA 4ECQA 1EYGA 1QG7A 1I4PA 4WORA 1PH9A 1SE3A 2IT1A 3GIIA 5C3EG 3MFHA 4X65L 5JVDF 4JV1A 1S40A 4JI5L 1O7ZA 1E1OA 3NHHA 2WAQB 1D5MC 3J7AF 3NQTA 2A19A 1TWFA 2V4RA 3VYSA 4DV5Q 3T16A 1ILQA 3BJYA 2NVXA 1SMYD 2UXCL 4DR2H 2N8NA 1DOLA 1H95A 3AQQA 1Y1VB 4A3IG 5KFDA 3T5KA 2WINB 3GTQH 3EVQA 1TS5A 3J80E 2CKZB 5C0XG 2Z4IA 1J8IA 1PLFA 4BBRB 2HCCA 4YHHL 5D14A 5KYIA 2EVBA 2PMZE 3IKJA 1ZYRC 4A3JB 2QDBA 3AYHB 2GLTA 5EKKA 2WACA 3BDCA 2UXDH 4LAAA 1LLRD 1SYGA 1X3FA 2B63H 1UUPA 3HOUB 2F03A 3KAJA 4H0LC 4C3HH 4HNTA 2EY1A 1QZHA 1S5BD 1ASZA 1ZHSA 2KEEA 4BS9A 4YWKA 1VQPA 5KG5A 3S2DH 1XTCD 3BJUA 1WTRA 5D65A 5JVH3 3EBEA 1S10A 2UU9H 2EYOA 4G7ZC 4A3CG 4IR1A 2KCMA 3DEPA 4A3FH 4YAKB 1EY8A 4O2DA 2O5IC 3PGZA 3D4RA 4A3MG 4HJ7A 4DU9A 1E3PA 1UE6A 2ATWA 3D4WA 5KFXA 1E4EB 3H15A 1M7JA 1HNWH 3MHBA 1VAJA 4EFBA 1EYAA 2OQ0A 2NVXH 4DR7Q 4JI6Q 1M8AA 4LNQA 5KX5F 4EQ5A 5DGBA 1WTXA 4ALPA 5CV9A 5EDWA 3JZIA 2HVSA 2EY2A 2K52A 4PG3A 3S1NB 4X64Q 5BPHA 4EFEA 1JMCA 3H4DA 1OXUA 1BBUA 4DV2L 3KOJA 5C4XG 2LMCB 2Y0SE 3L2PA 4DV3L 1RK5A 3E0JA 4JOIC 3HOYB 3LNNA 4RA8A 4IZ8A 2F0OA 1EWIA 4GOPA 2OLSA 3UE0A 3U58A 1RYSA 3CCLA 3MFYA 4K8IA 4FO2A 4A3LH 1JIHA 2HGSA 3B6YA 5JUMA 4K0KH 1LT3D 2N3SA 2JSOA 1K8MA 2R7FA 3VR5A 1XMQH 1B44D 1V8QA 1KAWA 3E0EA 2F1MA 5LL6S 2R82A 2IBKA 2OQKA 2R93A 3I73A 1EOTA 5JVLA 3V96A 5KFTA 1KHIA 4F87A 3I3CA 1Q3LA 5DG9A 3KAKA 1KEEA 2F0EA 4MAMA 3GTLB 3RR5A 3HGBA 3J80L 2P5ZX 4OIJA 2QK4A 3NK9A 5KFAA 1SNMA 3KK7A 5M3MH 1Q82C 1WTOA 3GV7B 5KFJA 4A3DB 2Z6KC 3S16H 4J9NA 1T5EA 3NQIA 4NP5A 2RDIA 5DG8A 1V1OA 5IGEA 2AWOA 4Y7NH 5C0XJ 1IBML 3PN1A 3G6XA 4A3KH 1N56A 4LFBH 1J9OA 3V6JA 2VPSA 1YNJD 3IFDA 1SE4A 1HNXH 1N34H 5CR3A 1WCMG 3A7AB 5DM73 4GS3A 1L1OA 5M5YB 1I4RA 4POFA 5JQWA 1HJPA 5FJ8G 3OW7A 4DA2A 4F50A 2GPWA 1L2ZA 4AQYL 1EHIA 2J6UA 3PVXA 2SNMA 1EEID 1L2FA 1CI3M 1SYBA 5EBCA 3QOLA 5EQ0A 1HH2P 3CF5A 5JVG3 2YL2A 2AHOB 2R8KA 4CDCC 4UCTA 4U6PA 3T13A 1D2BA 4DV7H 3DHQA 1JX4A 4DK6C 4MHEA 3DLLA 4ZI7F 2JA5A 3CHBD 4JV5L 1I5FA 3D4DA 1STGA 5C1OA 1F9RA 2JA6G 5J2TF 1HQRD 1TWGB 4L6TB 4RU9A 5CBAE 4UHVA 2JA7B 3RNUA 1S97A 4ED3A 1SNCA 1RD9D 1SYCA 4DXGA 1KTKA 2YTVA 3IRBA 3OWFA 5BR8L 2R7ZG 2WB1A 2I8CA 1FNVA 4HJ5A 2XN9C 1N33L 1BJTA 1TA8A 4NW2A 3T1YQ 1AUXA 1Q46A 2DNCA 1JLLB 4DF7A 3ORRA 4RZRA 4DR3H 3TQYA 3SK4A 2YYZA 3TMEA 2E5LQ 1NR4A 4KKSA 4TSSA 3GIMA 1CHQD 3H94A 1Y1WA 4IOCA 1SR3A 1PH5A 4L1KA 2A5HA 3R23A 5KFSA 2LKVA 3NPPA 3N8DA 3VR4A 4EYIB 2B2UC 4CKBA 1KQSA 3JRWA 5LMNW 2CWPA 5L1LA 5C0XI 3I90A 5CV6A 3PO3H 1GXDC 2JK8A 5C8YF 3GV5B 2J7ZA 2PZUA 1Q8KA 4LF6L 4DUYL 2WTFA 2UUAH 2AU0A 3Q2OA 2E76C 4YY3Q 2B3GA 4KD3A 4R1JA 3IFTA 4B9XA 1F2YA 2VB2X 5EPLA 3M3YH 1GSOA 1FJGH 1ZYRD 2KCNA 5K36H 2HHHH 1C48A 2KCCA 2WAQE 1QUQB 3DM3A 1LTTD 3F2BA 2R3ZA 4DV4Q 1IKLA 3J7AV 1SYXB 2RHSB 4PQXA 1DOMA 4H44C 2E8GA 4QY7A 4RFBA 1EY9A 3M7GA 4UFZA 1JB7A 3MA2B 5E4XA 4C5CA 1YBYA 1PFSA 1OXXK 4R8UB 3BDOA 1SROA 3NUCA 1EWCA 1UC9A 4YR0A 2A68D 2FK2A 4EGVA 5JJIA 2YCHA 2DJGC 5KFNA 5I6YA 1HUNA 3VA5A 1HFNA 4R9WA 1TWAB 1E1TA 1W3SA 2XCLA 1Y1WH 2VA3A 2RSOA 2XRSD 4MV7A 3GTQB 3KF8B 2HVRA 1VQFA 4U673 2F0LA 3GIKA 4FXKC 2F0NA 2NUCA 5IYDH 1Z2NX 1A2TA 2D2CC 2B39A 1I94Q 1JKJB 4PWQA 4KN4C 3L9AX 3PR5B 3MR5A 5L1IA 4UCUA 1PYSB 2WKDA 5AJ3Q 1YI2A 2F0WA 4WD3A 4KJNA 1WR2A 1XNQH 1QVCA 4K5VA 1K83H 4B3SQ 2KBNA 5JJKA 3SI8A 2PQAB 2GN5A 2PVPA 3A54A 5JJZA 5LMNQ 1A3VA 2M05A 3CC4A 1AZQA 2ASBA 4DL3A 2JYOA 3K59A 4DUZL 2JA8H 3NBIA 1U0LA 3FDSA 4FP5D 4B3TQ 2IWHA 4A93G 3S2DB 5M9OA 3OTOH 3T5HA 1XWEA 4DK3C 1Y8OB 1OO9B 1RKNA 4A3FB 3MWEA 4ME6A 2E2HB 5KFWA 1MZBA 4MTNA 4FVMA 3DXJC 4AH6A 2RDJA 1GO3E 4FXDA 4C3IH 1X56A 4X62L 1ENFA 4HJ9A 2N88A 5KFRA 2EDGA 3V4ZA 1EIYB 1CTMA 4MNOA 2J4XA 3RGZA 3HKZB 3OSNA 1I6UA 2OXPA 4LF8Q 3I4NB 1I6HH 2RGVA 4ID6A 4EBCA 2UUBQ 3M4OH 3C1EA 5A35A 4LFCL 2R8IA 1CZGA 4C56C 4IRDA 3R3OA 3HZXA 4BBSH 1FKAH 1VQAA 4QJFA 1CKNA 3SR1A 5IP7H 1WSCA 4GC7A 2E74C 2X69A 1FD7D 4JI0L 1RIPA 2R7KA 3CXCA 1XXGA 1HNZH 4K2KA 1KD1C 4P73A 4DV7Q 2XTIA 1UEAB 1B70B 2MGSA 3J7A5 1ESFA 3WO0A 4OHJA 1EYZA 4RAZA 2WKCA 3T5LA 3RN2A 1LTRD 1XNRL 3HOWG 4JI7L 3DWAA 2O2LD 2QGQA 1NUCA 4JI8Q 2D62A 5JJLA 2Z0SA 2Z9HA 4Q8FA 2J6TA 4V0BA 4OX9L 3PIP3 4IHJF 4XYMB 4DAMA 4C3JG 4K6LA 1KDCA 3LX0A 5M3MB 4AYBG 4DAYA 1J5EH 4HMJA 1N9WA 2E2DC 1Y1VA 4JV2A 5DAUA 1HR0Q 2EJGC 4ECWA 1AUVA 1Q12A 3OHAA 4Y7NB 1G51A 1Z2OX 1IYJB 1W96A 2FK3A 1N32Q 1JDEA 2IMWP 2NVTH 5M3FG 5GADC 2ALZA 5GAHC 5IGDA 4AYBE 5KNDA 3PQIA 5DEHA 4GN5A 1Q90A 5DLGA 3K5NA 3F8NA 5LMUH 4IURA 2LSSA 2NN6G 1DONA 3EPGA 1QNKA 5IGFA 3P7JA 5FO9B 1Y69U 1X3GA 3HOXH 1BDOA 3HOZG 1G91A 3JSNA 3RB4A 2WIIB 3KLWA 3KLSA 3ONAB 5IGGA 1FJGQ 3HBLA 1L1OC 4BWGB 1GVPA 1PFBA 4XXEA 2F0PA 2CWAA 2A6ED 4HEDA 4OGQC 2ZXPA 2F0GA 4YIJA 1TIID 2B8GA 4ED7A 5GROA 4WBNF 4DK1A 3GV6A 1V51A 1QZGA 2BR0A 5IP9H 1ESRA 3EIVA 5FLXE 4GKJH 5EWFA 1YHAA 1KNEA 4LFAQ 4DV1Q 1BNZA 1Y1VH 1PDQA 4PNYA 1PH4A 5KFVA 4DV6H 3E3XA 1W6KA 1PH8A 2R92B 4FF3A 4BBRH 4H02A 4K5WA 1D6EC 3I91A 2R8HA 2L15A 1BUVT 5CAEB 1L1OB 1BBXC 3RAQA 2A73B 2VR1A 2ZT9C 1HA5A 1B53A 4LW1A 4LJZC 3PO3B 1UE5A 3M4PA 3OMGA 3U9OA 1H9JA 4RWSC 1QCBD 1I3QB 4K6DA 5EPKA 4DFAA 4OO1H 5KG7A 1VMPA 3HOUH 3Q1KA 1EYDA 2KQ3A 3K0XA 4NXNL 4JVZA 3A74A 2OWOA 3Q24A 4LH7A 1QILA 3AFQA 1GUNA 1BKBA 4QWCA 2SEBD 1N36H 1HZ9A 2RQXA 1B2TA 1B50A 2DZDA 4S3SA 1GGOA 5FD5A 1SMYC 1GSHA 2TMPA 1JXLA 4BY1H 3GTLA 3URYA 4MTDA 1MJCA 1EFID 2JQOA 3R2IA 1AEXA 4KI0A 3S24A 4JUZA 2B29A 3A8KE 2W70A 2UXBQ 3FVQA 2HD3A 3G48A 3CCRA 3FDTA 5IT9c 5A2QW 4YJ2F 4RAUC 1NR2A 2ZTEA 3BVMA 2XCPA 3G6YA 5L37A 3HEJA 3JAME 4G7HC 3S1NH 1Q1BA 2NZ1D 2ES2A 4CDEC 4TUYF 3RLFA 4DXFA 4CKCA 1ASYA 3CMAA 3HOYH 4TQUS 3M4IA 1SDFA 1EOVA 4R7RA 4RGMA 3SK5A 4NXMQ 5KNBA 4R4OA 4HSPA 3VYUA 4QWAA 1K83B 3F2DA 5C44G 1ZKOA 1WJJA 1IOVA 2KHSA 1PX2A 2RGRA 1SRUA 4LF9Q 2NUAB 2Z6KA 1V43A 1K0SA 4KN7C 1JQYD 1JJCB 1EL0A 5ELNA 3TS2A 1JJ2A 5FLXL 3MFGA 2JA8B 2AWNA 2BH2A 3HOVH 5JEAH 4B08A 4XYOA 4DL2A 1TWGA 3N40P 4DR4Q 2QCPX 2JA7A 2K5VA 1VBHA 4RUAA 2V4DA 4B3MQ 1S5ED 4KHVA 3J80i 3VPCA 2PNRC 2VUMA 2LFNA 1VMCA 3EQLC 4ZRZA 5ELFA 4A3DH 3RD4A 5EKIA 1WTWA 2F4VQ 4DR7H 3NEMA 5KFKA 4C3IB 4JI6H 1WFQA 4J9MA 2HIXA 1UEBA 2W9AA 2NU7B 3I12A 4PMBA 4FBUA 1A6XA 3H91A 5FOBB 2KUMA 5D1PA 3RBEA 3BQ0A 5C4XB 4X64H 4I50F 3SDZA 3MR6A 1KLUD 3BA9A 3U9TA 4FU0A 5M5YH 1E2WA 3S17B 2CHBD 3K3PA 2L0CA 4PV1C 3OUZA 4A3GH 1I6HB 1AE2A 3TQ1A 2LXKA 5KFHA 3L4JA 3TSSA 3G7LA 1RYRA 5DLQE 1LO5D 2I80A 3ORQA 2FPPB 2VUGA 4O4IF 5EZYF 4YWMA 3CCJA 1UE7A 1M0TA 3OUUA 1B8AA 4DV0Q 4PMWA 3PW0A 2AMCB 2NN6I 1FL0A 1V1PA 4DR2L 3CRLC 1PV4A 3E5NA 2CQOA 1BCPF 1TWGH 2K32A 4B3RQ 1BOSA 2XGTA 3KBXA 4ECSA 1FVIA 3GQBA 3ND9A 4MN3A 5C3WA 3JAML 4FF1A 1SNQA 2VQDA 2XSCA 3NTIA 2A69C 2HQEA 2VUMH 4KV6A 5J39A 4JI3Q 3OOCA 4CDDC 1G6PA 2C9OA 3AU7A 4LUVA 5IWAH 3FHWA 3MWYW 1QVFA 1G291 1KAAA 4JI2Q 3Q8DA 2ZDGA 4GKJQ 4Z9CB 3RFCA 3KHLA 1I6VC 1ZEQX 4ZK9B 1EU3A 2UXDL 2ASJA 1DGSA 1QVGA 1TQOA 1TWAA 3BABA 3GTPA 2E2IA 5LHY1 3A56A 3GTQA 4YBZB 4LF5H 5F9NA 4ZKBB 4LF7Q 3WOFA 4QWDA 4NKLA 2UU9L 2NVTB 2ID0A 1CKMA 2SDFA 1TVXA 3LGJA 3K57A 1RK6A 1LABA 4JYAQ 2R93G 1VQJA 3PO2B 1TU2B 3BVGA 2UUCQ 4HIOA 5CV4A 2MUYA 5DGAA 1T94A 2VQEH 3CCVA 2UVWA 2WFWA 1CKNB 3C2PA 2R7LA 3E5SA 5E4WC 1UE1A 4LF4Q 1HNWL 3HOXB 4A76A 1BCPC 2GA4B 3KTMA 3ERQA 4JC0A 2KCTA 4J6HA 1RTNA 4EG0A 1N36Q 5KT4A 1KRSA 5GAGC 2R86A 5IOCA 4GNXC 4DPGA 1PH2A 2UVVA 4EGJA 1ILPA 1B7YB 3NTHA 1EY5A 2AQ2B 3PMFA 1D7QA 4QIWB 2AKWB 3CC7A 2E2HA 4GLVB 2RVLA 3PUYA 4J1MA 5J22A 1PRTF 4QUFA 2QA4A 3KLSX 3WNZA 3Q23A 2B2YC 4HAEA 5ELDA 5AJ3L 1A62A 3GLKA 3T1YH 4YP3A 4OWXB 1JE4A 3OIQA 4DAYB 5CA1F 2E5LH 1TWAH 4JBKA 2UUAL 2A1AA 4ILWA 4K5XA 2FJZA 3HKZA 1HPCA 3GTPH 4K0KL 2E2IH 3R93A 1BCPB 2PQEA 1XMQL 1BGWA 3QB3A 2VQFL 4O3NA 4IWXA 3T1HH 4IUQA 4X6AH 4N9PA 3HOVG 1VQ4A 1EIHA 3MXNA 1H9SA 3ULJA 4GNXB 2JA5G 5HV6A 2BH8A 1LT4D 4A3EH 4Q45A 3F2CA 1LTLA 3TP6A 4X66Q 3HRZC 4FBTA 1U4MA 3K6OA 4DR5Q 1CS0A 3K58A 5LP6F 2V1CC 1OTCA 4ETSA 4EQOA 4DR6Q 4YY3H 2AQ1B 3GIJA 1S72A 2EE1A 2Z8LA 2VW9A 4RGOS 3RJ0A 1PH1A 2HUGA 5JOBA 1I7NA 2GVAA 3W3AA 4FF4A 5JAVA 4A3BH 2WE6A 1JWSD 5LL6X 4R4QA 3U4VA 4LFBL 4DV4H 1PRTC 1RTOA 2W9BA 2E2HH 2A68C 3WO1A 2N55A 1HNXL 1N34L 5DQIA 4BY1B 2WB1E 4OXPA 2B8FA 2PI2A 2JJQA 3KXYT 3NENA 4RZQA 4KJOA 1X65A 3NELA 3Q8QB 4L5QA 1TY2A 2CQYA 2QW7A 3PIO3 3GV8B 2Y0SG 3J81c 4QCLA 2NYZD 1HCZA 2K05A 2R6GA 2D0OA 3EYYA 4IJLA 1YJNA 1DJRD 3I4NH 4WJ4A 1EU4A 4Y8VB 2MFIA 3IL8A 4U68A 3M4QA 3HP3A 1XYIA 4L5SA 2EXDA 3PUVA 5BN4A 3I4MG 3RV3A 1F9SA 4CJ1B 1EUJA 4LSXA 1I94H 3TP5A 3VYTA 2SOBA 1JC7A 5JPMC 4Q0FA 1VQ9A 1XJVA 1PRTB 3L3OC 2B2TA 1HRJA 1IL8A 1GHJA 3SK6A 1KDAA 4JI1Q 4DR1Q 4B3SH 2EIFA 2JEBI 3CMEA 2F0HA 1LACA 1Q7YC 1B6RA 4KHZA 2BA1A 5EWGA 5LMNH 1IBKL 1KJJA 4HJ8A 1STHA 1V4YA 4DL7A 4DGZA 1SBBB 2MPMA 4G57A 2ZM6Q 4B3TH 1U4LA 4IUNA 2M00A 3M9NB 4DR3L 1KC8C 4I4TF 2ZTDA 5H1SE 3HOVB 4HSVA 3R5FA 1GUGA 1GUOA 2HJWA 4CC5A 1EZ1A 4Q43A 4IAJA 4P74A 4CC6A 2W6NA 2UXCH 3GO5A 2RDGA 3EA6A 1I4HA 4ZOLF 1EUCB 1BXTA 5IWAQ 1GJXA 2EJFC 2XNAC 3F1ZA 4F4XA 2FMAA 3KALA 1EQTA 3GV3A 1XMOQ 5FLMH 3DWQA 4CJ2C 3S2HB 3OYYA 2K75A 1S5CD 2QEXA 2A69D 2R92A 1IOWA 4LF8H 5KKNB 2PZTA 2VL6A 2MP1A 1GYFA 2L1BA 1O7LA 2UUBH 2HHHL 2LY7A 3ULPA 4ZAIA 4DK0A 1SAPA 2RSNA 3TP8A 3H0GG 1PFMA 4A3GB 3K7UC 4IWYA 4RH6A 1Z6HA 1CSQA 1I3QA 3QZ8A 2JN4A 3FKIG 4JBWA 2JE6I 3JAMW 1DZ1A 2XGQA 1XPUA 4ECXA 1T3NA 4IFDG 2VQEQ 4BY7H 2AQ4A 2KJXA 1FR3A 1QNUA 4F4YA 1WH2A 3KJPA 4ZUIA 1AH9A 5K5PA 3NWTA 4XIGS 2NZHA 1L0WA 4WFN3 3CCUA 4IRCA 2W6OA 3R5HA 2F3VA 5D3IB 2NZOA 3N44B 4PZ8A 3K5HA 1X54A 3T4AC 2EYJA 2KVMA 4JI8H 5IYBG 2YS6A 4JI4H 4C3JB 3CU7A 5CMDA 4O1NA 2DN8A 1BCPD 4RGNA 4JV0A 1D1KA 1D5XC 4BXXG 5TSSA 4LF5L 2VUMB 1NTGA 4LMQD 1U4RA 4C5AA 1B04A 1GD7A 4DL5A 5G3LF 5HGQA 1XNQL 1C3OA 4J9QA 1HR0H 2R92H 4KHPQ 3HXLA 1MHWC 4ED1A 5CGKA 1M1KC 3VPDA 1PHJA 1GSAA 1N32H 2O03A 1WOCA 3Q6SA 5CV5A 4IUTA 2FLNA 4F8MA 2FK1A 4A2AA 1A63A 3Q8SB 3T1HQ 3OTOL 3I2ZA 1NMGA 1SLJA 1HNZQ 3QO2A 1XTDA 3GIQA 3GTOA 1Z9FA 1I3QH 3QR8A 5C3EH 1HZCA 2WAQG 1N8RC 1K83A 5M5WH 2K4KA 1SSOA 5EOYA 1SMXA 2A6EC 2F4IA 3ERSX 2C2RA 3JSLA 4DLKA 1EY0A 1V1PB 4U7CA 1KJQA 5E1FA 3RB3A 4QIWE 3UDGA 1XPRA 1Y1VG 5DM63 4G7OC 4QUCA 3S1QH 5KFPA 1AZPA 2BCOA 4NPSA 3S1RH 4PZ7A 3C46A 1PH6A 1E24A 4R4TA 4UCRA 2YTXA 3RB6A 4KY6A 4A3IH 1EY4A 2J6SA 2W6ZA 5BPFA 4DL4A 5C0XH 4A3JG 4LFAH 1C9OA 4DV1H 4Q8EA 1PRTD 3A5UA 1K0RA 1MKHA 2AGPA 3EFXD 1NY4A 1I4XA 1HZAA 1STBA 1Z47A 1DV1A 1YZ6A 5GQOA 2YRWA 3GTPB 2E2IB 3VR6A 2R87A 3GQCA 4KY5A 2WDTA 4RB3C 1S0NA 3RTXA 3RUZA 3AEVA 2K5DA 1YHQA 3GTOH 1IYUA 3KHGA 2K14A 5KFMA 4A3EB 5D8DA 1I50A 4OIKA 1IBLQ 3K5LA 4IFDJ 4ME5A 4TKOB 3F8TA 1AP0A 4A3CH 1RJPA 4JV5H 2IJ0A 4X65Q 1TKWB 1A9XA 5KFLA 1KABA 1NSNS 1LT5D 4JI5Q 4A3MH 1J5EL 1VQLA 4XT1B 5LOVF 2ASLA 1IW7C 2ALYB 1CFMA 4IPDA 2A6HD 4RHSA 4A3BB 4ED8A 4HJAA 2F0IA 3QJYA 2K6AA 1F2LA 1GKHA 2I0QA 4GKKL 3EN2A 1TT2A 4QWEA 3F2UA 2FB9A 1U5KA 3CCSA 5L9XA 2IL8A 2UXCQ 4XT3B 2UXBH 2ZJPA 1HUMA 3ETHA 5LMUL 4ECRA 2H1EA 2W8KA 4IN3A 1VQ7A 1SEBD 5C4XH 2BDOA 4JK1C 3NE5B 4YHHQ 3RUPA 4MTEA 5KG3A 1D1IA 3S17H 5FO7B 1I4QA 2XIGA 3SE7A 1ZHQA 2I46A 3VR2A 3MXNB 1H9SB 3KYHC 1TAEA 4NXMH 1I50H 2KEDA 1CE8A 2FE3A 3BAAA 5CC4A 2I07B 4XZ3B 2QEJC 1MD2D 4G3IA 1LYLA 2F0FA 4KY7A 1ONLA 1C4QA 3J80W 4LF9H 4GC6A 2JA6A 1ZETA 3C1FA 2E2JB 4LWCA 3KDFB 3LMLA 5L1JA 5C4JB 4A3DG 4IFDI 4DNRB 3H3VI 4EVOA 1YEZA 5BMVF 2K5QA 5CA0F 1ENAA 4QB4A 1YNXA 4DV6L 4DR4H 1BBWA 2R7ZA 3DUZA 1QJOA 4HIKA 4QIWA 4B9WA 3JAMi 2B2TC 2XRQD 2W9BB 4B3MH 2F52A 4NB3A 4UAIA 4JI4Q 3I56A 3N42B 1O7IA 2R6FA 2F4VH 1ENCA 1F9QA 1EFWA 5GONF 3FEWX 4YCVA 2WYOA 1S0MA 3BA8A 1MIUA 5C5JA 2Z1CA 4MV6A 2BOSA 2M9VA 3TIGA 4HNUA 3PW7A 5FJ8H 2K5WA 2DPJA 2XC9A 3HB9A 4DV2Q 4E4TA 4OWTB 4OELB 2FLLA 5KG0A 3GD7A 1A2UA 1HFGA 4GNXA 5C6AA 4R4IA 3PO2H 3GTJH 1T9HA 4MTKA 4ZHQF 1B4OA 1K1QA 2F3WA 4IUPA 2IHEA 5JPNC 2JA7G 2ASDA 1E4GT 3IN5A 5COYA 1C0AA 4DV0H 4DN4M 2KOLA 2FMMA 2B2YA 2WP8J 1Y8PB 4GN4B 4I65A 4DV5L 1B6SA 3R2TA 1HZBA 4X3KA 4O42A 5T1IA 2JA6H 3TINA 4HNVA 1Q8IA 1PTOH 4BY7B 2HVQA 3I8ZA 1O75A 2MO0A 3UDFA 4I7HA 2D0PA 2YV5A 2DNEA 1T36A 2R85A 2XVSA 3IG0A 4B3RH 3PW5A 1SE2A 5HBRB 3K7AH 2F3IA 3TZUA 2VY3A 2R7ZH 1X3EA 4KKTA 4IO9A 3OWEB 3HG9A 3UE1A 4QGUA 1YITA 3J7AK 3VDYA 1TWHA 4IJHA 4XDXA 4JI3H 3PW2A 5LA6F 1MSHA 3S1MH 2ZXRA 3NXWA 4V190 1VS0A 2PPBC 2X6GA 3KFUA 3L4KA 4JI2H 3NWSA 1ZXTA 2DJFC 5IYCG 1X32A 1IBMQ 1RCVD 2I5MX 3TZDA 4CDFC 5KT6A 3T53B 4ZYSA 4L5TA 1TXYA 2ZTCA 2A8VA 3SE0A 1R4PB 1PYWD 5G3LD 4LUOA 1EZ6A 1II3A 4LF7H 4AQYQ 4ULLA 2RHQB 2XWBB 3WWVA 2YS7A 1X3QA 1OXTA 4JYAH 1GUTA 2O5JC 1AN7A 2UUCH 4JI0H 1PZJD 1O78A 1PZKD 2MCTA 2DY8A 5C3EB 1VQKA 4TRDA 3P75A 1EEFD 2K50A 3MC0B 4LF4H 1EIFA 4OWWB 5M5WB 1C30A 5J1ZA 1OXVA 4JV5Q 4DR7L 4JI6L 1VQ6A 2D9UA 1XNRH 2I5HA 2CH4A 3CP0A 5IODA 1KDBA 5C5LA 3BS1A 3H40A 4X64L 1YJ9A 1TWHH 5BR8Q 4O3SA 3S1QB 4YB8B 5L1KA 3S1RB 1N33Q 4ECZA 2CZGA 2PMZB 1YNND 1TR5A 3I55A 2PCFB 2IY5B 3W1GA 1IW7D 4EBEA 1PYBA 4A3IB 4GN3B 3MXGA 1TS3A 2C5CA 4TQSA 3PIPA 2EXZA 2E75C 4HTHA 2FINB 4R8NA 2B63G 2K33A 3G71A 1JOKA 1L0YB 5NUCA 4C3HG 2J0TD 4HCSA 3K3VA 5CB4F 3PW4A 4UP7A 5M5XH 2IX1A 1VQGA 4LF6Q 3V2TA 4DUYQ 2AGOA 4X66H 1JE5A 1K9MC 5KG1A 1CK1A 4DR5H 3GTOB 2XIWA 4IR9A 1FGUA 1C7YA 1NNXA 3BZDB 3G6JB 4A3FG 4RB2C 4DR6H 4X3SA 5T14A 5BN5A 2K04A 5IE8A 1HTPA 3BYTB 4A93H 1VQ5A 2XD4A 2NWGA 3BVZA 3ND8A 2BE5C 4J9RA 1NMFA 2VNUD 1LV9A 5D1OB 1FYCA 4A3MB 3RZDB 3GTGB 5T1GA 5I2XA 4J8QA 2PO4A 4EQPA 2DUDA 3RLOA 1S03G 4K14A 3HKZG 5KFQA 1ZQ7A 3MVVA 2YU9H 3J7YW 2NU9B 3KJOA 1MGSA 4RCNA 1PMRA 1K1SA 2Y0SB 1K73C 4CGYB 4YQWA 2SNSA 5KG4A 2HT1A 3V6KA 1E22A 3S2HH 3HKZE 2V5AA 3ER0A 4UP9A 3I4MB 1PH7A 4H13C 4FDBA 5IT9E 2SCUB 3K81C 1PTOF 2FPGB 4A3LG 2NVYA 1JWMD 4IALA 2Z6BA 3ICEA 3Q0AA 1MSGA 2EYMA 3GIDA 4EGQA 4ZKCB 1FNWA 1WTHA 4RCOA 2EPBA 4DR1H 3TS0A 4HYKA 4JI1H 4NDXA 2VB3X 1WD1A 3UDXA 2PZWA 4NXNH 3KUPA 1DOKA 4I55F 1R4QB 4JBMA 1I50B 1EY6A 1EQRA 3N52A 4DUZQ 1SYDA 5C4ZA 2Q2HA 4O3RA 3I4OA 3HOWH 3CCEA 4QMGA 2ZM6H 3T1YL 1GLVA 3NGDA 2XCAA 1MBYA 2Q2UA 4OONA 5M3MG 2C28A 1S68A 1M0WA 5ELOA 4C1NK 2V58A 4MIUA 1VF7A 1EIGA 4N8X1 2E5LL 5KFGA 3K0YA 4J9LA 1D5ZC 4C3JH 2I87A 4GZYC 4A3KG 1ICWA 2PI2E 4X62Q 4LH6A 2G9DA 1Z7TA 2IPKD 3N6XA 3QZ7A 1K28A 1PA6A 4JPBW 1K3BC 2EZVA 2NU8B 1LUZA 2MO1A 1XMOH 1PTOC 1JICA 1MI2A 3ULLA 4XQNA 1J6QA 1GOZA 5M3FH 1KL9A 1WCMB 4J9SA 5KG2A 3UI2A 4YY3L 2DGYA 2W7PA 2NVYH 3JC66 4P2CB 3MEHA 5I4DA 2H4OA 2NN6H 4LFCQ 1STAA 3M9OB 5H80A 3C3LA 1LM0A 3CCQA 3D31A 3RIZA 1PFNA 3PCOB 3HOZH 1P8LA 3BZKA 4DV4L 1CQJB 3MTSA 2K5HA 3GTJB 4JI0Q 2AUKA 3K80C 1LTAD 2W6PA 1R9TH 5ISRA 1JCKB 2ICEC 3VPBA 2ZDQA 1EQVA 5KFUA 4ME3A 1X6OA 2B2WA 2JA6B 3A55A 4N9TA 4UY8C 3HS0C 1PTOB 2KA7A 1K8GA 1XNRQ 3E6ZX 2PNHA 4JI7Q 4ECUA 2JEAI 1K3RA 1RODA 1SFOA 4M1UB 5IT9L 4OX9Q 3K7AB 2R7ZB 2EOTA 1K8AC 2OF1A 1A15A 1I94L 3TREA 1UWVA 1W93A 1VBGA 3MZ5A 2F0QA 2Q8IB 3S1MB 1G2SA 3K8AA 4FS1A 5KT3A 2B2VC 4O2AF 1S4ZA 1QB5D 2IX0A 3PUWA 4B3SL 3PO3G 1SYFA 2YZNA 4RUCA 2VXWA 1B3QA 3LWEA 1EYCA 5LMNL 4FXGC 2W57A 3CW2C 5KT2A 4KHPH 4YCUA 3VYRA 3EPIA 5LXTF 3GTMB 3PR4A 1IXRA 1OXSC 3LWBA 1N48A 5KFOA 5J3BA 4B3TL 2IA6A 5BN3A 2MJ8A 1V1QA 1ICFB 2NBFA 1JT8A 2L9HA 1OWTA 4MA0A 2ZJQA 1SN8A 5IGCA 1A3TA 2F0DA 2L5TA 3M85A 1VQNA 5K36G 4HIMA 1SXTA 2MHVA 3NBHB 2W9CB 3D6WA 1HA6A 3JRXA 1UC8A 1UNSA 3MJFA 4FM9A 1BF4A 2R8GA 4IOAA 3BQ2A 1IYVA 2MNAA 3KDFA 3HFZB 1H9MA 4GLAC 2WB1G 3SEBA 1W2BA 1UNNC 3H20A 2Q8TA 2Q2TA 5C1PA 1WVLA 4NLGA 4OEMB 3K5MA 4EEYA 4HMIA 5DNFA 3BG3A 4UCVA 1SFOH 1P16A 2FJ2A 4G4KA 2JEJA 1RJRA 4LF8L 2BDNA 2PN1A 4HR7B 4A75A 2AGQA 1BNCA 1Y1WG 3H4BA 2BE5D 1TWHB 4ZQ3A 2QKIC 3U9SA 3J81j 2UUBL 1GUSA 4IRKA 1CA6A 5FPRA 1VQBA 5IYDG 3AMUA 1WTQA 4BWSC 2Q2IA 5DQGA 5HY6A 5CBEE 1VQ8A 1O7YA 2PYKA 4J9KA 2YTYA 3DM1A 5HGTA 4EX5A 2EY5A 2F0VA 3TBIB 4DKAC 2QYZA 4P75A 1O80A 4QQBX 2P0AA 1RF2D 4LSAA 4QW9A 3D3RA 4DV7L 2FP4B 2K28A 4WJ3M 4MV3A 1Z2PX 3CQZB 2F0MA 4FF2A 2JA8G 5C44H
chains in the Genus database with same CATH topology
1TWFH 3KLWA 4KHPL 4A3JG 2NVQH 1C9OA 5FLMG 4JI8L 1FJGQ 3A5UA 1M90C 1K0RA 1MKHA 4JI4L 1L1OC 4NXNQ 1NY4A 1GVPA 1HZAA 3GTKH 1NJIC 1Z47A 2CWAA 5LMUQ 3T1HL 1HNZL 1X9NA 2E2JH 1YZ6A 5GQOA 1X55A 5C4JH 5GROA 3STBC 1QZGA 5IP9H 2KENA 3EIVA 3AEVA 1YHQA 2H5XA 1HR0L 3GTOH 3GDEA 2K14A 1QUQA 1YHAA 4LFAQ 4DV1Q 1IBLQ 4IFDJ 1N32L 2IHFA 5EAYA 1KXLA 4QL5A 1Y1VH 1PH4A 4BY7G 3F8TA 2JA7H 1PH8A 4A3CH 4X65Q 4BBRH 4H02A 2L15A 4HIDA 4A4IA 4C2MH 4JI5Q 4A3MH 1J5EL 1VQLA 4IPGA 3KF6A 3G4SA 3CAMA 1L1OB 3CD6A 2ALYB 4IPDA 4HJAA 4BBSG 4LW1A 1UE5A 1GKHA 3M4PA 5IP7G 2R7DA 2I0QA 4GKKL 5E7NA 3EN2A 3HOUH 3D0FA 3J80c 4TVAB 3RZOH 4DV6Q 1FJGL 1U5KA 3K0XA 1CSPA 4NXNL 3E9HA 3CCSA 3A74A 2OWOA 3S15H 2UXCQ 3AFQA 2ZJPA 1BKBA 1AE3A 3PV0A 5LMUL 1TWCH 1HZ9A 3L0OA 4APVA 3PSIA 3A0JA 4IPCA 2R92G 5IYCH 3J81i 5C4XH 3W5OA 1VQ7A 1WI5A 4XTCS 4LUZA 4YHHQ 4BY1H 2PQAA 4GKKQ 1MJCA 3OW2A 2CFMA 1GM5A 3S17H 2JQOA 2N78A 4DV1L 1IBLL 4LFAL 4KI0A 1CKOA 3S24A 1XPOA 2B29A 4JG2A 1EYGA 2UXBQ 3G48A 2IT1A 1PH9A 3MXNB 3CCRA 3KYHC 5C3EG 5IT9c 4X65L 1I50H 2OCEA 2ZTEA 1A8VA 3L7ZC 1Q86C 1S40A 4JI5L 1MJEA 3S1NH 1LYLA 1E1OA 1Q1BA 3MEFA 2ES2A 4LWCA 2A19A 3KDFB 4A3DG 3RLFA 4IFDI 3PO2G 3H3VI 1YEZA 4DV5Q 1ASYA 3CC2A 3CMAA 3HOYH 4TQUS 1YNXA 4DV6L 1BBWA 2N49A 1EOVA 4HIKA 2UXCL 2R93H 4NXMQ 3JAMi 4R4OA 2N8NA 3HOXG 1H95A 2F52A 3AQQA 4NB3A 3F2DA 3PIOA 3I56A 1O7IA 4A3IG 3AFPA 5C44G 4JI4Q 3GTQH 1BVSA 1WJJA 2CKZB 1SRUA 5C0XG 4LF9Q 3G6EA 2Z6KA 1V43A 1EFWA 1JJCB 4YCVA 5ELNA 3TS2A 4YHHL 1NBWA 1JJ2A 1MIUA 1VQIA 2AWNA 2BH2A 2PMZE 3HOVH 1XNRQ 5FJ8H 3AYHB 4DR4Q 1EQQA 4UP8A 2UXBL 2K5VA 4DV2Q 4DR2Q 4OWTB 4B3MQ 1X3FA 5IP9G 3J80i 2B63H 3GD7A 4P71A 4RMFA 4GLXA 4C3HH 4GNXA 1QZHA 2RF4A 1ASZA 4A3DH 2F4VQ 4R4IA 3PO2H 3GTJH 4YWKA 1T9HA 3NEMA 1VQPA 4KLKA 3S2DH 4JBJA 1WFQA 3BJUA 4AIMA 2HIXA 1UEBA 2IHEA 3EBEA 2JA7G 4A3CG 2KCMA 1C0AA 2WP8J 4A3FH 4BBRG 4GN4B 4DV5L 2RCNA 4OO1G 1AH9A 1HZBA 4O2DA 2JA6H 4BA2I 1CUKA 3PGZA 4A3MG 4HJ7A 2UXDQ 1E3PA 1UE6A 5M5YH 2MO0A 3RN5A 2ATWA 1S3OA 3UDFA 4NXML 3H15A 2D0PA 2YV5A 4MZ9A 4A3GH 1AE2A 2LXKA 2OQ0A 2NVXH 3K7AH 2F3IA 2R7ZH 2VY3A 2JA5H 3BZCA 1X3EA 4JI6Q 4IO9A 1VQMA 4DR7Q 3UE1A 4QGUA 1YITA 5DLQE 3VDYA 4LF9L 4LNQA 3HOUG 4EQ5A 2UU9Q 4IJHA 4YWMA 2HQLA 1UE7A 3CCJA 4ALPA 4R4CA 1B8AA 4DV0Q 4PMWA 5IY0A 3S1MH 2K52A 2AMCB 2NN6I 1FL0A 4PG3A 1VS0A 4X64Q 1SE8A 3KFUA 1JMCA 4DR4L 2I5LX 5IYCG 1IBMQ 1OXUA 1BBUA 2I5MX 3KOJA 4DV2L 3KF6B 4DR2L 1PV4A 4B3ML 2Y0SE 2CQOA 5C4XG 1HNWQ 3L2PA 1TWGH 4BY1G 4DV3L 4B3RQ 4L5TA 1TXYA 2ZTCA 2XGTA 3I7FA 3PUZA 1FVIA 4JOIC 2A8VA 2F4VL 4LUOA 4GOPA 1EWIA 3UE0A 2VUMH 3U58A 3CCLA 4AQYQ 4A3LH 4JI3Q 2RHQB 3B6YA 4IPHA 3WWVA 3RZDH 1IL2A 2N3SA 2FXQA 3GTGH 2R7FA 4LUVA 1OXTA 1VQCA 3FHWA 1KAWA 3E0EA 1QVFA 1G291 4JI2Q 3Q8DA 4GKJQ 3M7NA 3U50C 2UXDL 2OQKA 1DGSA 1QVGA 1KHIA 1VQKA 2K50A 3STBD 1EIFA 4OWWB 1OXVA 4JV5Q 3RR5A 4DR7L 1G6PA 4JI6L 1VQ6A 4LF7Q 2UUAQ 2I5HA 2VZAA 3I4MH 3HOYG 4K0KQ 2UU9L 2ID0A 1CKMA 3LGJA 3CP0A 5M3MH 1XMQQ 1Q82C 4JYAQ 4DV0L 1VQJA 2R93G 2Z6KC 2VQFQ 3S16H 2UUCQ 4HIOA 4X64L 1YJ9A 1TWHH 5BR8Q 2AWOA 4Y7NH 2WFWA 5C0XJ 3CCVA 1IBML 4A3KH 1CKNB 1N33Q 1UE1A 3I55A 4LF4Q 1HNWL 4A76A 4O0AA 3W1GA 2IY5B 4B3RL 1WCMG 1PYBA 4GS3A 4GN3B 1L1OA 2C35B 3U4ZA 4JC0A 5JEAG 2KCTA 3UDIA 1Q81C 1HR0W 4POFA 3HOVG 1HJPA 5FJ8G 1N36Q 1KRSA 5GAGC 4AQYL 3PIPA 4GNXC 4JI3L 4DPGA 1PH2A 3E9IA 1B7YB 2B63G 1L2FA 1D7QA 1YHBA 2AKWB 3CC7A 3CF5A 4GLVB 1HH2P 3G71A 2AHOB 4JI2L 4GKJL 3PUYA 4LFBQ 2OTJA 2QA4A 3TEHB 3PF5A 4UP7A 5M5XH 2IX1A 1VQGA 5AJ3L 4LF6Q 1HNXQ 1A62A 4DUYQ 4DK6C 1JE5A 1N34Q 1K9MC 3DLLA 4OWXB 1FGUA 1I5FA 1C7YA 4DAYB 4A3FG 4JV5L 2JA9A 4LF7L 1TWAH 4JBKA 2UUAL 2A1AA 5IE8A 2JA6G 4A93H 1VQ5A 3GTPH 4K0KL 2E2IH 1XMQL 3RNUA 4JYAL 2VQFL 1NMFA 1RL2A 2YTVA 2UUCL 4A3GG 2VNUD 3IRBA 5BR8L 1WCMH 4X6AH 1VQ4A 2R7ZG 4GNXB 2JA5G 3ULJA 1VCIA 2BH8A 3M9BA 4HJ5A 4A3EH 1N33L 2DUDA 3RLOA 3F2CA 1LTLA 4X66Q 3T1YQ 4LF4L 3HKZG 3H0GH 4DR5Q 1Q46A 2YU9H 2V1CC 1OTCA 3KJOA 3TQYA 4YCWA 4DR6Q 2YYZA 2E5LQ 3FKIH 1S72A 4DV3Q 1N36L 2VW9A 1K73C 4IOCA 1SR3A 1PH1A 1PH5A 3H3VH 2GVAA 4A3BH 2HT1A 4GOPC 5FLXc 2GVBA 1E22A 1KQSA 3HKZE 3S2HH 3ER0A 2CWPA 4UP9A 2MQHA 5C0XI 3W1BA 4R4QA 4FDBA 2JK8A 5LMNW 3U4VA 1PH7A 3PO3H 4LFBL 4POGA 3K81C 2E2HH 2VUMG 1Q8KA 4LF6L 4A3LG 1HNXL 4DUYL 1N34L 4DR3Q 3ICEA 5IYBH 2WB1E 4OXPA 3SGIA 4YY3Q 2B3GA 2JJQA 2PI2A 3NENA 3CCMA 4R1JA 4BXXH 1X65A 3NELA 3M3YH 3HKSA 3TS0A 4L5QA 3UDXA 2WAQE 1QUQB 2LXJA 2Y0SG 3DM3A 3J81c 4JBMA 1JJGA 1EQRA 2R6GA 2D0OA 3F2BA 4DUZQ 4IJLA 4DV4Q 1YJNA 2Q2HA 3I4NH 4WJ4A 3I4OA 2MFIA 4PZ6A 2RHSB 3M4QA 1PH3A 4L5SA 3HOWH 2EXDA 3PUVA 3CCEA 4GOPB 3I4MG 4X66L 2E8GA 3T1YL 4QY7A 1EUJA 4P72A 2Q2UA 4OONA 5M3MG 4DR5L 1JB7A 5ELOA 1YBYA 1PFSA 1OXXK 1VQ9A 4DR6L 1XJVA 1SROA 2E5LL 1KRTA 4DR1Q 4JI1Q 4C3JH 3GTMH 2EIFA 2JEBI 1IBKQ 1VQDA 2HHHQ 5GAEC 3CMEA 4A3KG 1Q7YC 5JJIA 2PI2E 4KHZA 2BA1A 4X62Q 4OO1I 1W3SA 1E1TA 1Y1WH 1IBKL 4HJ8A 1PA6A 5JEAJ 1VQEA 4JCVE 3KF8B 3ZJYC 1LUZA 1VQFA 2MO1A 2ZM6Q 1KIXA 4L5RC 4DNIA 5IYDH 1I94Q 3ULLA 5M3FH 1J6QA 4DR3L 2K5NA 1KL9A 1KC8C 1Q1EA 2ZTDA 5H1SE 1PYSB 4YY3L 2HIVA 5AJ3Q 1YI2A 2DGYA 3JAMc 1QVCA 4B3SQ 1K83H 2NVYH 3JC66 2KBNA 5JJKA 2PQAB 2GN5A 4LFCQ 4P74A 3GO5A 5LMNQ 1LM0A 3CCQA 3D31A 3CC4A 2ASBA 3PCOB 5IWAQ 4DUZL 3HOZH 1P8LA 3BZKA 4DV4L 2JA8H 3F1ZA 1U0LA 1XMOQ 2K5HA 4B3TQ 4A3JH 4LF5Q 4JI0Q 4A93G 1PVOA 5FLMH 3K80C 3OYYA 2K75A 4RG1A 4DK3C 2QEXA 1R9TH 2VL6A 2BA0A 1XNQQ 4ME3A 1X6OA 4DR1L 4UY8C 4MTNA 4JI1L 4AH6A 4UPAA 1K8GA 1GO3E 4A3EG 2HHHL 2PNHA 4JI7Q 3ULPA 4C3IH 1X56A 4X62L 4HJ9A 2CCZA 2JEAI 1K3RA 3H0GG 3K7UC 1CSQA 4OX9Q 1EIYB 3FKIG 1K8AC 4JBWA 2JE6I 4MNOA 2ZM6L 3OTOQ 1XPUA 3CQZH 4IFDG 2ZJRA 2OTLA 1I94L 3TREA 1UWVA 2VQEQ 4BY7H 4LF8Q 4A3BG 3RLNA 3K8AA 4J15A 3KJPA 3PUWA 1I6HH 2IX0A 4B3SL 4XIGS 1L0WA 2NZHA 3CCUA 2UUBQ 3PO3G 3M4OH 1V9PA 3PUXA 4JOIA 4LFCL 2NZOA 5LMNL 4PZ8A 3CW2C 1X54A 3PF4A 4YCUA 3CPWA 4BBSH 2EQSA 5IYBG 3BU2A 1VQAA 4QJFA 5IWAL 1IXRA 1CKNA 1OXSC 5IP7H 1Y14B 5J3BA 1XMOL 4B3TL 4BXXG 4LF5L 4JI0L 1V1QA 1JT8A 1NTGA 3J7ZC 1RIPA 2ZJQA 1SN8A 3M85A 3CXCA 1VQNA 5K36G 1GD7A 1KD1C 4HIMA 4P73A 4DV7Q 2XTIA 1B70B 5HGQA 1XNQL 4Y52H 3J7A5 3NBHB 1D8LA 1NE3A 3I4NG 2R92H 3RN2A 1XNRL 4KHPQ 3HOWG 4JI7L 1M1KC 2QGQA 4IOAA 4JI8Q 1PHJA 2MNAA 3KDFA 1YJWA 1WOCA 3S14H 2D62A 5JJLA 1IZ6A 2Z0SA 3HFZB 2WB1G 2KHJA 4GLAC 1W2BA 4YWLA 2Q2TA 4OX9L 1A63A 3T1HQ 3OTOL 3I2ZA 1NMGA 1SLJA 1SFOH 4DAMA 1P16A 1XTDA 3FP9A 1HNZQ 2VQEL 2KHIA 3A5ZB 1WYDA 1Z9FA 1I3QH 4AYBG 4LF8L 5C3EH 1HZCA 2WAQG 1N9WA 4A75A 1N8RC 1Y1WG 5M5WH 1HR0Q 2K4KA 3J81j 2UUBL 3CPFA 1SMXA 1Q12A 3GTLH 3ERSX 1G51A 1IYJB 1YVCA 4BA1I 1VQBA 2VS1A 1N32Q 5IYDG 1YIJA 2NVTH 5M3FG 1A0IA 2Q2IA 5HY6A 5GADC 5GAHC 1VQHA 1VQ8A 4AYBE 2YTYA 4QIWE 1VQOA 4GN5A 3UDGA 1XPRA 1Y1VG 4EX5A 1E7ZA 2LSSA 3S1QH 2NN6G 4DKAC 1J5EQ 4P75A 4QQBX 4NPSA 3S1RH 4PZ7A 4DV7L 3TRZA 1X3GA 1PH6A 1E24A 3HOXH 4R4TA 4WJ3M 2YTXA 3HOZG 4A3IH 2JA8G 5C44H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWF H;  3KLW A;  4KHP L;  4A3J G;  2NVQ H;  1C9O A;  5FLM G;  4JI8 L;  1FJG Q;  3A5U A;  1M90 C;  1K0R A;  1MKH A;  4JI4 L;  1L1O C;  4NXN Q;  1NY4 A;  1GVP A;  1HZA A;  3GTK H;  1NJI C;  1Z47 A;  2CWA A;  5LMU Q;  3T1H L;  1HNZ L;  1X9N A;  2E2J H;  1YZ6 A;  5GQO A;  1X55 A;  5C4J H;  5GRO A;  3STB C;  1QZG A;  5IP9 H;  2KEN A;  3EIV A;  3AEV A;  1YHQ A;  2H5X A;  1HR0 L;  3GTO H;  3GDE A;  2K14 A;  1QUQ A;  1YHA A;  4LFA Q;  4DV1 Q;  1IBL Q;  4IFD J;  1N32 L;  2IHF A;  5EAY A;  1KXL A;  4QL5 A;  1Y1V H;  1PH4 A;  4BY7 G;  3F8T A;  2JA7 H;  1PH8 A;  4A3C H;  4X65 Q;  4BBR H;  4H02 A;  2L15 A;  4HID A;  4A4I A;  4C2M H;  4JI5 Q;  4A3M H;  1J5E L;  1VQL A;  4IPG A;  3KF6 A;  3G4S A;  3CAM A;  1L1O B;  3CD6 A;  2ALY B;  4IPD A;  4HJA A;  4BBS G;  4LW1 A;  1UE5 A;  1GKH A;  3M4P A;  5IP7 G;  2R7D A;  2I0Q A;  4GKK L;  5E7N A;  3EN2 A;  3HOU H;  3D0F A;  3J80 c;  4TVA B;  3RZO H;  4DV6 Q;  1FJG L;  1U5K A;  3K0X A;  1CSP A;  4NXN L;  3E9H A;  3CCS A;  3A74 A;  2OWO A;  3S15 H;  2UXC Q;  3AFQ A;  2ZJP A;  1BKB A;  1AE3 A;  3PV0 A;  5LMU L;  1TWC H;  1HZ9 A;  3L0O A;  4APV A;  3PSI A;  3A0J A;  4IPC A;  2R92 G;  5IYC H;  3J81 i;  5C4X H;  3W5O A;  1VQ7 A;  1WI5 A;  4XTC S;  4LUZ A;  4YHH Q;  4BY1 H;  2PQA A;  4GKK Q;  1MJC A;  3OW2 A;  2CFM A;  1GM5 A;  3S17 H;  2JQO A;  2N78 A;  4DV1 L;  1IBL L;  4LFA L;  4KI0 A;  1CKO A;  3S24 A;  1XPO A;  2B29 A;  4JG2 A;  1EYG A;  2UXB Q;  3G48 A;  2IT1 A;  1PH9 A;  3MXN B;  3CCR A;  3KYH C;  5C3E G;  5IT9 c;  4X65 L;  1I50 H;  2OCE A;  2ZTE A;  1A8V A;  3L7Z C;  1Q86 C;  1S40 A;  4JI5 L;  1MJE A;  3S1N H;  1LYL A;  1E1O A;  1Q1B A;  3MEF A;  2ES2 A;  4LWC A;  2A19 A;  3KDF B;  4A3D G;  3RLF A;  4IFD I;  3PO2 G;  3H3V I;  1YEZ A;  4DV5 Q;  1ASY A;  3CC2 A;  3CMA A;  3HOY H;  4TQU S;  1YNX A;  4DV6 L;  1BBW A;  2N49 A;  1EOV A;  4HIK A;  2UXC L;  2R93 H;  4NXM Q;  3JAM i;  4R4O A;  2N8N A;  3HOX G;  1H95 A;  2F52 A;  3AQQ A;  4NB3 A;  3F2D A;  3PIO A;  3I56 A;  1O7I A;  4A3I G;  3AFP A;  5C44 G;  4JI4 Q;  3GTQ H;  1BVS A;  1WJJ A;  2CKZ B;  1SRU A;  5C0X G;  4LF9 Q;  3G6E A;  2Z6K A;  1V43 A;  1EFW A;  1JJC B;  4YCV A;  5ELN A;  3TS2 A;  4YHH L;  1NBW A;  1JJ2 A;  1MIU A;  1VQI A;  2AWN A;  2BH2 A;  2PMZ E;  3HOV H;  1XNR Q;  5FJ8 H;  3AYH B;  4DR4 Q;  1EQQ A;  4UP8 A;  2UXB L;  2K5V A;  4DV2 Q;  4DR2 Q;  4OWT B;  4B3M Q;  1X3F A;  5IP9 G;  3J80 i;  2B63 H;  3GD7 A;  4P71 A;  4RMF A;  4GLX A;  4C3H H;  4GNX A;  1QZH A;  2RF4 A;  1ASZ A;  4A3D H;  2F4V Q;  4R4I A;  3PO2 H;  3GTJ H;  4YWK A;  1T9H A;  3NEM A;  1VQP A;  4KLK A;  3S2D H;  4JBJ A;  1WFQ A;  3BJU A;  4AIM A;  2HIX A;  1UEB A;  2IHE A;  3EBE A;  2JA7 G;  4A3C G;  2KCM A;  1C0A A;  2WP8 J;  4A3F H;  4BBR G;  4GN4 B;  4DV5 L;  2RCN A;  4OO1 G;  1AH9 A;  1HZB A;  4O2D A;  2JA6 H;  4BA2 I;  1CUK A;  3PGZ A;  4A3M G;  4HJ7 A;  2UXD Q;  1E3P A;  1UE6 A;  5M5Y H;  2MO0 A;  3RN5 A;  2ATW A;  1S3O A;  3UDF A;  4NXM L;  3H15 A;  2D0P A;  2YV5 A;  4MZ9 A;  4A3G H;  1AE2 A;  2LXK A;  2OQ0 A;  2NVX H;  3K7A H;  2F3I A;  2R7Z H;  2VY3 A;  2JA5 H;  3BZC A;  1X3E A;  4JI6 Q;  4IO9 A;  1VQM A;  4DR7 Q;  3UE1 A;  4QGU A;  1YIT A;  5DLQ E;  3VDY A;  4LF9 L;  4LNQ A;  3HOU G;  4EQ5 A;  2UU9 Q;  4IJH A;  4YWM A;  2HQL A;  1UE7 A;  3CCJ A;  4ALP A;  4R4C A;  1B8A A;  4DV0 Q;  4PMW A;  5IY0 A;  3S1M H;  2K52 A;  2AMC B;  2NN6 I;  1FL0 A;  4PG3 A;  1VS0 A;  4X64 Q;  1SE8 A;  3KFU A;  1JMC A;  4DR4 L;  2I5L X;  5IYC G;  1IBM Q;  1OXU A;  1BBU A;  2I5M X;  3KOJ A;  4DV2 L;  3KF6 B;  4DR2 L;  1PV4 A;  4B3M L;  2Y0S E;  2CQO A;  5C4X G;  1HNW Q;  3L2P A;  1TWG H;  4BY1 G;  4DV3 L;  4B3R Q;  4L5T A;  1TXY A;  2ZTC A;  2XGT A;  3I7F A;  3PUZ A;  1FVI A;  4JOI C;  2A8V A;  2F4V L;  4LUO A;  4GOP A;  1EWI A;  3UE0 A;  2VUM H;  3U58 A;  3CCL A;  4AQY Q;  4A3L H;  4JI3 Q;  2RHQ B;  3B6Y A;  4IPH A;  3WWV A;  3RZD H;  1IL2 A;  2N3S A;  2FXQ A;  3GTG H;  2R7F A;  4LUV A;  1OXT A;  1VQC A;  3FHW A;  1KAW A;  3E0E A;  1QVF A;  1G29 1;  4JI2 Q;  3Q8D A;  4GKJ Q;  3M7N A;  3U50 C;  2UXD L;  2OQK A;  1DGS A;  1QVG A;  1KHI A;  1VQK A;  2K50 A;  3STB D;  1EIF A;  4OWW B;  1OXV A;  4JV5 Q;  3RR5 A;  4DR7 L;  1G6P A;  4JI6 L;  1VQ6 A;  4LF7 Q;  2UUA Q;  2I5H A;  2VZA A;  3I4M H;  3HOY G;  4K0K Q;  2UU9 L;  2ID0 A;  1CKM A;  3LGJ A;  3CP0 A;  5M3M H;  1XMQ Q;  1Q82 C;  4JYA Q;  4DV0 L;  1VQJ A;  2R93 G;  2Z6K C;  2VQF Q;  3S16 H;  2UUC Q;  4HIO A;  4X64 L;  1YJ9 A;  1TWH H;  5BR8 Q;  2AWO A;  4Y7N H;  2WFW A;  5C0X J;  3CCV A;  1IBM L;  4A3K H;  1CKN B;  1N33 Q;  1UE1 A;  3I55 A;  4LF4 Q;  1HNW L;  4A76 A;  4O0A A;  3W1G A;  2IY5 B;  4B3R L;  1WCM G;  1PYB A;  4GS3 A;  4GN3 B;  1L1O A;  2C35 B;  3U4Z A;  4JC0 A;  5JEA G;  2KCT A;  3UDI A;  1Q81 C;  1HR0 W;  4POF A;  3HOV G;  1HJP A;  5FJ8 G;  1N36 Q;  1KRS A;  5GAG C;  4AQY L;  3PIP A;  4GNX C;  4JI3 L;  4DPG A;  1PH2 A;  3E9I A;  1B7Y B;  2B63 G;  1L2F A;  1D7Q A;  1YHB A;  2AKW B;  3CC7 A;  3CF5 A;  4GLV B;  1HH2 P;  3G71 A;  2AHO B;  4JI2 L;  4GKJ L;  3PUY A;  4LFB Q;  2OTJ A;  2QA4 A;  3TEH B;  3PF5 A;  4UP7 A;  5M5X H;  2IX1 A;  1VQG A;  5AJ3 L;  4LF6 Q;  1HNX Q;  1A62 A;  4DUY Q;  4DK6 C;  1JE5 A;  1N34 Q;  1K9M C;  3DLL A;  4OWX B;  1FGU A;  1I5F A;  1C7Y A;  4DAY B;  4A3F G;  4JV5 L;  2JA9 A;  4LF7 L;  1TWA H;  4JBK A;  2UUA L;  2A1A A;  5IE8 A;  2JA6 G;  4A93 H;  1VQ5 A;  3GTP H;  4K0K L;  2E2I H;  1XMQ L;  3RNU A;  4JYA L;  2VQF L;  1NMF A;  1RL2 A;  2YTV A;  2UUC L;  4A3G G;  2VNU D;  3IRB A;  5BR8 L;  1WCM H;  4X6A H;  1VQ4 A;  2R7Z G;  4GNX B;  2JA5 G;  3ULJ A;  1VCI A;  2BH8 A;  3M9B A;  4HJ5 A;  4A3E H;  1N33 L;  2DUD A;  3RLO A;  3F2C A;  1LTL A;  4X66 Q;  3T1Y Q;  4LF4 L;  3HKZ G;  3H0G H;  4DR5 Q;  1Q46 A;  2YU9 H;  2V1C C;  1OTC A;  3KJO A;  3TQY A;  4YCW A;  4DR6 Q;  2YYZ A;  2E5L Q;  3FKI H;  1S72 A;  4DV3 Q;  1N36 L;  2VW9 A;  1K73 C;  4IOC A;  1SR3 A;  1PH1 A;  1PH5 A;  3H3V H;  2GVA A;  4A3B H;  2HT1 A;  4GOP C;  5FLX c;  2GVB A;  1E22 A;  1KQS A;  3HKZ E;  3S2H H;  3ER0 A;  2CWP A;  4UP9 A;  2MQH A;  5C0X I;  3W1B A;  4R4Q A;  4FDB A;  2JK8 A;  5LMN W;  3U4V A;  1PH7 A;  3PO3 H;  4LFB L;  4POG A;  3K81 C;  2E2H H;  2VUM G;  1Q8K A;  4LF6 L;  4A3L G;  1HNX L;  4DUY L;  1N34 L;  4DR3 Q;  3ICE A;  5IYB H;  2WB1 E;  4OXP A;  3SGI A;  4YY3 Q;  2B3G A;  2JJQ A;  2PI2 A;  3NEN A;  3CCM A;  4R1J A;  4BXX H;  1X65 A;  3NEL A;  3M3Y H;  3HKS A;  3TS0 A;  4L5Q A;  3UDX A;  2WAQ E;  1QUQ B;  2LXJ A;  2Y0S G;  3DM3 A;  3J81 c;  4JBM A;  1JJG A;  1EQR A;  2R6G A;  2D0O A;  3F2B A;  4DUZ Q;  4IJL A;  4DV4 Q;  1YJN A;  2Q2H A;  3I4N H;  4WJ4 A;  3I4O A;  2MFI A;  4PZ6 A;  2RHS B;  3M4Q A;  1PH3 A;  4L5S A;  3HOW H;  2EXD A;  3PUV A;  3CCE A;  4GOP B;  3I4M G;  4X66 L;  2E8G A;  3T1Y L;  4QY7 A;  1EUJ A;  4P72 A;  2Q2U A;  4OON A;  5M3M G;  4DR5 L;  1JB7 A;  5ELO A;  1YBY A;  1PFS A;  1OXX K;  1VQ9 A;  4DR6 L;  1XJV A;  1SRO A;  2E5L L;  1KRT A;  4DR1 Q;  4JI1 Q;  4C3J H;  3GTM H;  2EIF A;  2JEB I;  1IBK Q;  1VQD A;  2HHH Q;  5GAE C;  3CME A;  4A3K G;  1Q7Y C;  5JJI A;  2PI2 E;  4KHZ A;  2BA1 A;  4X62 Q;  4OO1 I;  1W3S A;  1E1T A;  1Y1W H;  1IBK L;  4HJ8 A;  1PA6 A;  5JEA J;  1VQE A;  4JCV E;  3KF8 B;  3ZJY C;  1LUZ A;  1VQF A;  2MO1 A;  2ZM6 Q;  1KIX A;  4L5R C;  4DNI A;  5IYD H;  1I94 Q;  3ULL A;  5M3F H;  1J6Q A;  4DR3 L;  2K5N A;  1KL9 A;  1KC8 C;  1Q1E A;  2ZTD A;  5H1S E;  1PYS B;  4YY3 L;  2HIV A;  5AJ3 Q;  1YI2 A;  2DGY A;  3JAM c;  1QVC A;  4B3S Q;  1K83 H;  2NVY H;  3JC6 6;  2KBN A;  5JJK A;  2PQA B;  2GN5 A;  4LFC Q;  4P74 A;  3GO5 A;  5LMN Q;  1LM0 A;  3CCQ A;  3D31 A;  3CC4 A;  2ASB A;  3PCO B;  5IWA Q;  4DUZ L;  3HOZ H;  1P8L A;  3BZK A;  4DV4 L;  2JA8 H;  3F1Z A;  1U0L A;  1XMO Q;  2K5H A;  4B3T Q;  4A3J H;  4LF5 Q;  4JI0 Q;  4A93 G;  1PVO A;  5FLM H;  3K80 C;  3OYY A;  2K75 A;  4RG1 A;  4DK3 C;  2QEX A;  1R9T H;  2VL6 A;  2BA0 A;  1XNQ Q;  4ME3 A;  1X6O A;  4DR1 L;  4UY8 C;  4MTN A;  4JI1 L;  4AH6 A;  4UPA A;  1K8G A;  1GO3 E;  4A3E G;  2HHH L;  2PNH A;  4JI7 Q;  3ULP A;  4C3I H;  1X56 A;  4X62 L;  4HJ9 A;  2CCZ A;  2JEA I;  1K3R A;  3H0G G;  3K7U C;  1CSQ A;  4OX9 Q;  1EIY B;  3FKI G;  1K8A C;  4JBW A;  2JE6 I;  4MNO A;  2ZM6 L;  3OTO Q;  1XPU A;  3CQZ H;  4IFD G;  2ZJR A;  2OTL A;  1I94 L;  3TRE A;  1UWV A;  2VQE Q;  4BY7 H;  4LF8 Q;  4A3B G;  3RLN A;  3K8A A;  4J15 A;  3KJP A;  3PUW A;  1I6H H;  2IX0 A;  4B3S L;  4XIG S;  1L0W A;  2NZH A;  3CCU A;  2UUB Q;  3PO3 G;  3M4O H;  1V9P A;  3PUX A;  4JOI A;  4LFC L;  2NZO A;  5LMN L;  4PZ8 A;  3CW2 C;  1X54 A;  3PF4 A;  4YCU A;  3CPW A;  4BBS H;  2EQS A;  5IYB G;  3BU2 A;  1VQA A;  4QJF A;  5IWA L;  1IXR A;  1CKN A;  1OXS C;  5IP7 H;  1Y14 B;  5J3B A;  1XMO L;  4B3T L;  4BXX G;  4LF5 L;  4JI0 L;  1V1Q A;  1JT8 A;  1NTG A;  3J7Z C;  1RIP A;  2ZJQ A;  1SN8 A;  3M85 A;  3CXC A;  1VQN A;  5K36 G;  1GD7 A;  1KD1 C;  4HIM A;  4P73 A;  4DV7 Q;  2XTI A;  1B70 B;  5HGQ A;  1XNQ L;  4Y52 H;  3J7A 5;  3NBH B;  1D8L A;  1NE3 A;  3I4N G;  2R92 H;  3RN2 A;  1XNR L;  4KHP Q;  3HOW G;  4JI7 L;  1M1K C;  2QGQ A;  4IOA A;  4JI8 Q;  1PHJ A;  2MNA A;  3KDF A;  1YJW A;  1WOC A;  3S14 H;  2D62 A;  5JJL A;  1IZ6 A;  2Z0S A;  3HFZ B;  2WB1 G;  2KHJ A;  4GLA C;  1W2B A;  4YWL A;  2Q2T A;  4OX9 L;  1A63 A;  3T1H Q;  3OTO L;  3I2Z A;  1NMG A;  1SLJ A;  1SFO H;  4DAM A;  1P16 A;  1XTD A;  3FP9 A;  1HNZ Q;  2VQE L;  2KHI A;  3A5Z B;  1WYD A;  1Z9F A;  1I3Q H;  4AYB G;  4LF8 L;  5C3E H;  1HZC A;  2WAQ G;  1N9W A;  4A75 A;  1N8R C;  1Y1W G;  5M5W H;  1HR0 Q;  2K4K A;  3J81 j;  2UUB L;  3CPF A;  1SMX A;  1Q12 A;  3GTL H;  3ERS X;  1G51 A;  1IYJ B;  1YVC A;  4BA1 I;  1VQB A;  2VS1 A;  1N32 Q;  5IYD G;  1YIJ A;  2NVT H;  5M3F G;  1A0I A;  2Q2I A;  5HY6 A;  5GAD C;  5GAH C;  1VQH A;  1VQ8 A;  4AYB E;  2YTY A;  4QIW E;  1VQO A;  4GN5 A;  3UDG A;  1XPR A;  1Y1V G;  4EX5 A;  1E7Z A;  2LSS A;  3S1Q H;  2NN6 G;  4DKA C;  1J5E Q;  4P75 A;  4QQB X;  4NPS A;  3S1R H;  4PZ7 A;  4DV7 L;  3TRZ A;  1X3G A;  1PH6 A;  1E24 A;  3HOX H;  4R4T A;  4WJ3 M;  2YTX A;  3HOZ G;  4A3I H;  2JA8 G;  5C44 H; 
#chains in the Genus database with same CATH topology
 1HTL D;  4UCS A;  1TWF H;  5FLX W;  2RDF A;  5M5X B;  4QW8 A;  2G9H D;  1IBL H;  4JI8 L;  4APM A;  2A6H C;  4JI4 L;  4NXN Q;  2JEF A;  3GIL A;  4N8F A;  3I70 A;  5DQH A;  4X65 H;  2NTT A;  2E2J H;  4A93 B;  5C4J H;  1I7L A;  4MV4 A;  1H9R A;  2X6L A;  4JI5 H;  3V4S A;  3STB C;  4C3I G;  2XWJ B;  1SYE A;  1HR0 L;  3GDE A;  3OMC A;  1N32 L;  1FNU A;  4QL5 A;  3M9M B;  1STY A;  2QF7 A;  5DLF A;  2YU9 B;  1B9M A;  3KLR A;  4HID A;  3H09 A;  3S14 B;  3G4S A;  3CAM A;  3QFF A;  1JWU D;  5CV7 A;  4A2B A;  4BBS G;  2VQF H;  1KNA A;  1SNP A;  4YHH H;  3BYY B;  5IP7 G;  2R7D A;  3OSO A;  3J81 E;  5E7N A;  3CVZ A;  2FPI B;  2CW0 C;  3RZO H;  5C3X A;  2D5D A;  1FJG L;  1CSP A;  3BG5 A;  3E9H A;  1PTO D;  3S15 H;  2EYP A;  5FK9 C;  1AE3 A;  5KIX A;  3MAQ A;  3QWN A;  4YR3 A;  5IIF A;  3WDN A;  2RCF A;  4APV A;  2ICI A;  1F77 A;  3A0J A;  4IPC A;  4F7X A;  1A3U A;  1SND A;  2BQ3 A;  1G8Z D;  3W5O A;  4RKB A;  1DD2 A;  1WI5 A;  1JDB B;  3RAX A;  2NB0 A;  4XTC S;  2UVU A;  1M4V A;  4IUU A;  2Q8R E;  4IQZ A;  3OW2 A;  3X3M A;  3WOE A;  1GM5 A;  4LFA L;  2N78 A;  4DV1 L;  3HOW B;  3UFX B;  1S9F A;  1XPO A;  1CKO A;  4JG2 A;  1NCV A;  2PBZ A;  3M4Y A;  2ENB A;  3TDQ A;  5DG7 A;  1GHK A;  2OCE A;  5HUR A;  2NVQ B;  1S5D D;  1Y8N B;  4L63 B;  1A8V A;  3L7Z C;  1Q86 C;  3MWD A;  5KFF A;  1BO0 A;  1CA5 A;  2ZJT A;  4XX0 B;  1QOH A;  1MJE A;  5ELB A;  4AYB B;  2PMZ A;  3GTK B;  1AW7 A;  3MEF A;  1EZ8 A;  4I7A A;  2UVR A;  3PO2 G;  2FFK B;  3A7L A;  4ZQI A;  3CC2 A;  4ECT A;  5JH7 F;  5M3F B;  2N49 A;  5A2Q E;  5KFZ A;  2R93 H;  4DV2 H;  5LYJ F;  3HOX G;  4R8I A;  2GPS A;  2NVY B;  4DV3 H;  3PIO A;  3AFP A;  4FS2 A;  5LL6 b;  1BVS A;  3SXH A;  3I72 A;  4PDB A;  3G6E A;  3DMU A;  1M6V A;  1NBW A;  1IBK H;  4C2M B;  3HOZ B;  1VQI A;  5IT9 W;  1LT6 D;  1CZW A;  1VDZ A;  1SCU B;  2R8J A;  1EQQ A;  5KFY A;  4NMZ A;  4UP8 A;  3MXU A;  1R9T B;  2UXB L;  4DR2 Q;  3TP7 A;  1GUW A;  5IP9 G;  5D1O A;  3ITP A;  4P71 A;  4RMF A;  4GLX A;  3GTG A;  3KBG A;  2RF4 A;  5D3D A;  4F88 A;  2FKL A;  2AQ3 B;  3NSW A;  4XYL B;  4UDU C;  4ZCK A;  4KLK A;  5CV8 A;  4JBJ A;  2G5D A;  3VR3 A;  4AIM A;  1TWC B;  2R7N A;  3D8G A;  5KFC A;  3J81 L;  2PW7 A;  3RGX A;  4BBR G;  2BQR A;  2RCN A;  2Y0S A;  4BA2 I;  2J9G A;  1CUK A;  2RKS A;  4HCE A;  4I7Z C;  2UXD Q;  2IW3 A;  1VF5 C;  5I2Y A;  3RN5 A;  1IBM H;  1LTS D;  1S3O A;  4NXM L;  1EY7 A;  2B2W C;  1IHZ A;  4O3Q A;  5EPJ A;  1JOR A;  4MZ9 A;  4RNO A;  4OO1 G;  2JA5 H;  3BZC A;  1SNO A;  1VQM A;  1KJ8 A;  4LF9 L;  3HOU G;  3CRK C;  2UU9 Q;  2HQL A;  4AQY H;  4R4C A;  5IY0 A;  1LTI D;  2YYA A;  1CQV A;  2L4N A;  4E6I A;  1PK8 A;  1SE8 A;  2L12 A;  2FHT A;  3TN2 A;  5KFE A;  4DR4 L;  3A8I E;  4RGT A;  1FGB D;  5C4H A;  2I5L X;  4DNT B;  4YJ3 F;  3KF6 B;  4B3M L;  2EYF A;  1HNW Q;  4BY1 G;  2IP4 A;  4C5B A;  3I7F A;  3PUZ A;  1CT1 D;  4O3P A;  2A74 C;  3FMC A;  4ED0 A;  2VA2 A;  4KMU C;  2F0S A;  2F4V L;  4H7B A;  1W6J A;  1H9K A;  4IPH A;  3OHX C;  3RZD H;  1L0X B;  1IL2 A;  1YNN C;  2FXQ A;  4DAP A;  3GTG H;  5I9O A;  4O4L F;  1VQC A;  4DL6 A;  5ELC A;  1ET6 A;  1SFO B;  2IX3 A;  3VA7 A;  3M7N A;  3U50 C;  5BR8 H;  3NTK A;  5A2Q L;  4K2L A;  4JW0 A;  1WTP A;  1N33 H;  4RAY A;  3T56 B;  3STB D;  5KNC A;  2F0J A;  1B1Z A;  2DLN A;  1RJT A;  3W2D A;  2W71 A;  3I4L A;  2UUA Q;  2B63 B;  2TSS A;  2VZA A;  3I4M H;  3HOY G;  4K0K Q;  1E2V A;  4MV1 A;  1WCM A;  4KD4 A;  2EYL A;  4C3H B;  1XMQ Q;  2V59 A;  3LWU A;  4PMC A;  4DV0 L;  3RMH A;  2VQF Q;  4MA5 A;  1I4G A;  3H0G A;  3OPO A;  4RB0 A;  3FKI A;  4KK7 A;  1E4F T;  4ED2 A;  1DV2 A;  1E0B A;  4O3O A;  4LF6 H;  1JOO A;  4O0A A;  4DUY H;  1CQF A;  4B3R L;  4F4W A;  2VPQ A;  4ED6 A;  3OSP A;  4J0M A;  2C35 B;  2HDL A;  3U4Z A;  5JEA G;  5C44 B;  3UDI A;  1STE A;  1TWF B;  3Q22 A;  1Q81 C;  1C8C A;  1HR0 W;  3GTJ A;  5FKA C;  1B3A A;  2K01 A;  5EJW A;  4JI3 L;  3E9I A;  5I6W A;  1HXY D;  2CW0 D;  4EQN A;  2NVX B;  2AUJ D;  1G2T A;  3T51 B;  1YHB A;  3N43 B;  1LTB D;  4JI2 L;  4GKJ L;  2CW8 A;  4LFB Q;  3RF2 A;  4J9P A;  2OTJ A;  2CVR A;  3TEH B;  3PF5 A;  3BDL A;  1HNX Q;  1N34 Q;  4EBD A;  1PZI D;  3MXP A;  3K5O A;  4FNF A;  3V6H A;  5CYU A;  3NP8 A;  4ECV A;  2JA9 A;  2YRX A;  4LF7 L;  4K8J A;  3FPP A;  5KGU A;  3PZP A;  1DYQ A;  4JYA L;  5KFI A;  1JB3 A;  1NAP A;  1RL2 A;  2UUC L;  1K8O A;  4A3G G;  1KJI A;  1EWH A;  1WCM H;  2F0K A;  1VCI A;  3M9B A;  3OHB A;  4L8J A;  4LF4 L;  3UQ8 A;  2NTS A;  3H0G H;  3GTM A;  1F2Z A;  3VMM A;  2JXM B;  4YCW A;  3FKI H;  1U4P A;  2WAQ A;  2RA4 A;  1N36 L;  4DV3 Q;  3RZO B;  2EYH A;  4IFD H;  3QIA A;  3H3V H;  3T5J A;  4GOP C;  3S15 B;  5FLX c;  2GVB A;  2QDL A;  4OL7 A;  3NBH A;  3KHR A;  2W9C A;  1IBK Q;  2MQH A;  3W1B A;  4DUZ H;  4Q0Y A;  1BXR A;  4POG A;  2VUM G;  1SJH D;  3R8B A;  2B2V A;  2FMC A;  3S16 B;  2F0U A;  4DR3 Q;  5IYB H;  4LMY A;  3N6R A;  3SGI A;  5E3F A;  4GKK H;  4A3K B;  3CCM A;  5EWE A;  5J2U F;  4BXX H;  4M8A A;  3HKS A;  1F2M A;  4HR7 A;  4EYH B;  5F9L A;  3RBD A;  4X62 H;  2LXJ A;  1JJG A;  2DIK A;  5KG6 A;  4CJ0 B;  4Q44 A;  1WD0 A;  5I9P A;  3DEO A;  4PZ6 A;  2O4X A;  1PH3 A;  5KRU A;  4GOP B;  4X66 L;  1G6Z A;  4P72 A;  2R61 A;  3H6M A;  4DR5 L;  2F0T A;  2K03 A;  2YW2 A;  4DR6 L;  3MR3 A;  1JR0 D;  1KRT A;  5F2D A;  2OEO A;  1CM9 A;  3A8J E;  3GTM H;  4EEQ A;  3RB0 A;  2C22 A;  1VQD A;  4RHR A;  5FO8 B;  3DWP A;  5GAE C;  2HHH Q;  1KBL A;  2FLP A;  4LFC H;  2R93 B;  1U9R A;  3MWM A;  4OO1 I;  4WRD A;  3CQZ A;  4ECY A;  5JEA J;  1VQE A;  4JCV E;  1AN8 A;  1WTV A;  1E4E A;  3ZJY C;  5I47 A;  3SK8 A;  1KIX A;  3GIP A;  4L5R C;  1XX8 A;  5EBD A;  4DNI A;  3X3N A;  3QOJ A;  2KEC A;  2K5N A;  2V9W A;  1Q1E A;  2HIV A;  3J81 W;  3JAM c;  4XQJ A;  4ABN A;  2YZG A;  3TQT A;  2OH2 A;  2BQU A;  3MFI A;  3O13 A;  2ZDH A;  4JI7 H;  2CQA A;  1ULZ A;  4CHT B;  3ERO A;  1RJQ A;  4OX9 H;  2W8L A;  5ELE A;  4ZUJ A;  5AFW A;  4RNM A;  4A3J H;  4LF5 Q;  2X0S A;  1PVO A;  2ATL A;  3SVM A;  2YU9 A;  4RG1 A;  1DIK A;  1XDN A;  2BA0 A;  1XNQ Q;  2C00 A;  1AFP A;  4DR1 L;  4JI1 L;  4UPA A;  4A3E G;  5KFB A;  2VOB A;  2QIL A;  2CCZ A;  2C2E A;  2ZXO A;  3MR2 A;  3M3Y B;  4F4Z A;  4O2B F;  5C5M A;  2JA5 B;  3QG1 A;  2DWC A;  1DCZ A;  3OTO Q;  2ZM6 L;  3CQZ H;  2ZJR A;  2OTL A;  4XQQ A;  2CW7 A;  5KT7 A;  4A3B G;  3G8C A;  3P20 A;  2XGP A;  3RLN A;  4J15 A;  4O4H F;  4DV5 H;  2M2L A;  1TS4 A;  2DY7 A;  1V9P A;  3EJI A;  3PUX A;  1LTG D;  4JOI A;  3N41 B;  5EKL A;  2WB1 B;  1KC7 A;  2YZM A;  3PF4 A;  3CPW A;  1QWY A;  1VKZ A;  2EQS A;  3BU2 A;  5IWA L;  1HHV A;  1Y14 B;  1RDP D;  4HQ6 A;  4TQR A;  1XMO L;  1F9P A;  3LP8 A;  3C0F B;  3J7Z C;  1ML0 D;  2R7M A;  1Y1W B;  5IYZ F;  4J9O A;  1QE6 A;  4UCO A;  2EY6 A;  4Y52 H;  2WV6 D;  1D8L A;  5KYL A;  1NE3 A;  5KEE A;  3I4N G;  4AYB A;  4Q5V A;  3GTK A;  4MV9 A;  4YR2 A;  1YJW A;  3S14 H;  1IZ6 A;  3IAY A;  2KHJ A;  2Z4H A;  4YWL A;  2JP1 A;  5FPO A;  3Q8P B;  4RKL A;  1TS2 A;  4KTA A;  4TV8 F;  3FP9 A;  4DAV A;  1DXM A;  2VQE L;  2KHI A;  3A5Z B;  4FYD A;  1WYD A;  2R84 A;  3SHL A;  1BR9 A;  3OIP A;  4RB1 A;  4IZO A;  3ZYY X;  1B33 N;  2JEI A;  3CPF A;  3GTL H;  2LS0 1;  1STN A;  3V05 A;  1TY0 A;  3KHH A;  1YVC A;  4BA1 I;  2VS1 A;  1CQI B;  1YIJ A;  1A0I A;  4C2M A;  1VQH A;  4X3U A;  3DF7 A;  1X3P A;  3BQ1 A;  1VQO A;  3R5X A;  2NU6 B;  1ET9 A;  5FD6 A;  1E7Z A;  1R9T A;  2RDH A;  2L55 A;  1DM0 B;  2PW5 A;  1J5E Q;  2K1B A;  1KLG D;  3CKI B;  4ZLT F;  3TRZ A;  5IGB A;  1EUD B;  3AB9 A;  4GKK Q;  4KHP L;  2HCI A;  3GP7 A;  2NVQ H;  3TII A;  5FLM G;  3FMA A;  4CKE A;  1TWC A;  3K5I A;  3Q8R B;  3H3V C;  1M90 C;  3M4O B;  3D6C A;  5COR A;  1NJI C;  3GTK H;  2JEG A;  4WJW A;  5LMU Q;  3T1H L;  1HNZ L;  1X9N A;  4LK1 C;  2DPI A;  4BBS B;  1X55 A;  2HDM A;  4CBV A;  2C2D A;  2W6Q A;  2L11 A;  2KEN A;  1PXU A;  4RNN A;  2H5X A;  1E2Z A;  5KT5 A;  5K2M A;  1B9N A;  1S5F D;  1QUQ A;  1JOQ A;  2IHF A;  5EAY A;  1KXL A;  4BY7 G;  3H0G B;  2JA7 H;  1UAP A;  3FKI B;  3P1H A;  2KSW A;  4M9U A;  2B2U A;  4YAJ B;  4A4I A;  4C2M H;  1CHP D;  1YNJ C;  3KF6 A;  4IPG A;  3CD6 A;  4R8U A;  2V4Q A;  3G6V A;  1IKM A;  2OT2 A;  4M7E A;  2K7V A;  3FPU B;  3FRP B;  4X3T A;  1SJE D;  1BQQ T;  1SEI A;  3D0F A;  3J80 c;  2EJM A;  1RHP A;  4TVA B;  4DV6 Q;  4QWB A;  4ODG A;  3KF8 A;  4IUV A;  2W7O A;  3PV0 A;  4TV9 F;  1S0O A;  4XYQ A;  1TWC H;  3L0O A;  3S9W A;  3PSI A;  2R92 G;  3RV4 A;  5IYC H;  1KJ9 A;  5EGT A;  1HQM C;  4QF4 A;  3ETJ A;  3J81 i;  4LUZ A;  2PQA A;  1T5X D;  4C1N I;  2RBM A;  2CH4 W;  2CFM A;  4HN7 A;  2B63 A;  1IBL L;  4MV8 A;  4KKU A;  2W6M A;  4ECQ A;  1EYG A;  1QG7 A;  1I4P A;  4WOR A;  1PH9 A;  1SE3 A;  2IT1 A;  3GII A;  5C3E G;  3MFH A;  4X65 L;  5JVD F;  4JV1 A;  1S40 A;  4JI5 L;  1O7Z A;  1E1O A;  3NHH A;  2WAQ B;  1D5M C;  3J7A F;  3NQT A;  2A19 A;  1TWF A;  2V4R A;  3VYS A;  4DV5 Q;  3T16 A;  1ILQ A;  3BJY A;  2NVX A;  1SMY D;  2UXC L;  4DR2 H;  2N8N A;  1DOL A;  1H95 A;  3AQQ A;  1Y1V B;  4A3I G;  5KFD A;  3T5K A;  2WIN B;  3GTQ H;  3EVQ A;  1TS5 A;  3J80 E;  2CKZ B;  5C0X G;  2Z4I A;  1J8I A;  1PLF A;  4BBR B;  2HCC A;  4YHH L;  5D14 A;  5KYI A;  2EVB A;  2PMZ E;  3IKJ A;  1ZYR C;  4A3J B;  2QDB A;  3AYH B;  2GLT A;  5EKK A;  2WAC A;  3BDC A;  2UXD H;  4LAA A;  1LLR D;  1SYG A;  1X3F A;  2B63 H;  1UUP A;  3HOU B;  2F03 A;  3KAJ A;  4H0L C;  4C3H H;  4HNT A;  2EY1 A;  1QZH A;  1S5B D;  1ASZ A;  1ZHS A;  2KEE A;  4BS9 A;  4YWK A;  1VQP A;  5KG5 A;  3S2D H;  1XTC D;  3BJU A;  1WTR A;  5D65 A;  5JVH 3;  3EBE A;  1S10 A;  2UU9 H;  2EYO A;  4G7Z C;  4A3C G;  4IR1 A;  2KCM A;  3DEP A;  4A3F H;  4YAK B;  1EY8 A;  4O2D A;  2O5I C;  3PGZ A;  3D4R A;  4A3M G;  4HJ7 A;  4DU9 A;  1E3P A;  1UE6 A;  2ATW A;  3D4W A;  5KFX A;  1E4E B;  3H15 A;  1M7J A;  1HNW H;  3MHB A;  1VAJ A;  4EFB A;  1EYA A;  2OQ0 A;  2NVX H;  4DR7 Q;  4JI6 Q;  1M8A A;  4LNQ A;  5KX5 F;  4EQ5 A;  5DGB A;  1WTX A;  4ALP A;  5CV9 A;  5EDW A;  3JZI A;  2HVS A;  2EY2 A;  2K52 A;  4PG3 A;  3S1N B;  4X64 Q;  5BPH A;  4EFE A;  1JMC A;  3H4D A;  1OXU A;  1BBU A;  4DV2 L;  3KOJ A;  5C4X G;  2LMC B;  2Y0S E;  3L2P A;  4DV3 L;  1RK5 A;  3E0J A;  4JOI C;  3HOY B;  3LNN A;  4RA8 A;  4IZ8 A;  2F0O A;  1EWI A;  4GOP A;  2OLS A;  3UE0 A;  3U58 A;  1RYS A;  3CCL A;  3MFY A;  4K8I A;  4FO2 A;  4A3L H;  1JIH A;  2HGS A;  3B6Y A;  5JUM A;  4K0K H;  1LT3 D;  2N3S A;  2JSO A;  1K8M A;  2R7F A;  3VR5 A;  1XMQ H;  1B44 D;  1V8Q A;  1KAW A;  3E0E A;  2F1M A;  5LL6 S;  2R82 A;  2IBK A;  2OQK A;  2R93 A;  3I73 A;  1EOT A;  5JVL A;  3V96 A;  5KFT A;  1KHI A;  4F87 A;  3I3C A;  1Q3L A;  5DG9 A;  3KAK A;  1KEE A;  2F0E A;  4MAM A;  3GTL B;  3RR5 A;  3HGB A;  3J80 L;  2P5Z X;  4OIJ A;  2QK4 A;  3NK9 A;  5KFA A;  1SNM A;  3KK7 A;  5M3M H;  1Q82 C;  1WTO A;  3GV7 B;  5KFJ A;  4A3D B;  2Z6K C;  3S16 H;  4J9N A;  1T5E A;  3NQI A;  4NP5 A;  2RDI A;  5DG8 A;  1V1O A;  5IGE A;  2AWO A;  4Y7N H;  5C0X J;  1IBM L;  3PN1 A;  3G6X A;  4A3K H;  1N56 A;  4LFB H;  1J9O A;  3V6J A;  2VPS A;  1YNJ D;  3IFD A;  1SE4 A;  1HNX H;  1N34 H;  5CR3 A;  1WCM G;  3A7A B;  5DM7 3;  4GS3 A;  1L1O A;  5M5Y B;  1I4R A;  4POF A;  5JQW A;  1HJP A;  5FJ8 G;  3OW7 A;  4DA2 A;  4F50 A;  2GPW A;  1L2Z A;  4AQY L;  1EHI A;  2J6U A;  3PVX A;  2SNM A;  1EEI D;  1L2F A;  1CI3 M;  1SYB A;  5EBC A;  3QOL A;  5EQ0 A;  1HH2 P;  3CF5 A;  5JVG 3;  2YL2 A;  2AHO B;  2R8K A;  4CDC C;  4UCT A;  4U6P A;  3T13 A;  1D2B A;  4DV7 H;  3DHQ A;  1JX4 A;  4DK6 C;  4MHE A;  3DLL A;  4ZI7 F;  2JA5 A;  3CHB D;  4JV5 L;  1I5F A;  3D4D A;  1STG A;  5C1O A;  1F9R A;  2JA6 G;  5J2T F;  1HQR D;  1TWG B;  4L6T B;  4RU9 A;  5CBA E;  4UHV A;  2JA7 B;  3RNU A;  1S97 A;  4ED3 A;  1SNC A;  1RD9 D;  1SYC A;  4DXG A;  1KTK A;  2YTV A;  3IRB A;  3OWF A;  5BR8 L;  2R7Z G;  2WB1 A;  2I8C A;  1FNV A;  4HJ5 A;  2XN9 C;  1N33 L;  1BJT A;  1TA8 A;  4NW2 A;  3T1Y Q;  1AUX A;  1Q46 A;  2DNC A;  1JLL B;  4DF7 A;  3ORR A;  4RZR A;  4DR3 H;  3TQY A;  3SK4 A;  2YYZ A;  3TME A;  2E5L Q;  1NR4 A;  4KKS A;  4TSS A;  3GIM A;  1CHQ D;  3H94 A;  1Y1W A;  4IOC A;  1SR3 A;  1PH5 A;  4L1K A;  2A5H A;  3R23 A;  5KFS A;  2LKV A;  3NPP A;  3N8D A;  3VR4 A;  4EYI B;  2B2U C;  4CKB A;  1KQS A;  3JRW A;  5LMN W;  2CWP A;  5L1L A;  5C0X I;  3I90 A;  5CV6 A;  3PO3 H;  1GXD C;  2JK8 A;  5C8Y F;  3GV5 B;  2J7Z A;  2PZU A;  1Q8K A;  4LF6 L;  4DUY L;  2WTF A;  2UUA H;  2AU0 A;  3Q2O A;  2E76 C;  4YY3 Q;  2B3G A;  4KD3 A;  4R1J A;  3IFT A;  4B9X A;  1F2Y A;  2VB2 X;  5EPL A;  3M3Y H;  1GSO A;  1FJG H;  1ZYR D;  2KCN A;  5K36 H;  2HHH H;  1C48 A;  2KCC A;  2WAQ E;  1QUQ B;  3DM3 A;  1LTT D;  3F2B A;  2R3Z A;  4DV4 Q;  1IKL A;  3J7A V;  1SYX B;  2RHS B;  4PQX A;  1DOM A;  4H44 C;  2E8G A;  4QY7 A;  4RFB A;  1EY9 A;  3M7G A;  4UFZ A;  1JB7 A;  3MA2 B;  5E4X A;  4C5C A;  1YBY A;  1PFS A;  1OXX K;  4R8U B;  3BDO A;  1SRO A;  3NUC A;  1EWC A;  1UC9 A;  4YR0 A;  2A68 D;  2FK2 A;  4EGV A;  5JJI A;  2YCH A;  2DJG C;  5KFN A;  5I6Y A;  1HUN A;  3VA5 A;  1HFN A;  4R9W A;  1TWA B;  1E1T A;  1W3S A;  2XCL A;  1Y1W H;  2VA3 A;  2RSO A;  2XRS D;  4MV7 A;  3GTQ B;  3KF8 B;  2HVR A;  1VQF A;  4U67 3;  2F0L A;  3GIK A;  4FXK C;  2F0N A;  2NUC A;  5IYD H;  1Z2N X;  1A2T A;  2D2C C;  2B39 A;  1I94 Q;  1JKJ B;  4PWQ A;  4KN4 C;  3L9A X;  3PR5 B;  3MR5 A;  5L1I A;  4UCU A;  1PYS B;  2WKD A;  5AJ3 Q;  1YI2 A;  2F0W A;  4WD3 A;  4KJN A;  1WR2 A;  1XNQ H;  1QVC A;  4K5V A;  1K83 H;  4B3S Q;  2KBN A;  5JJK A;  3SI8 A;  2PQA B;  2GN5 A;  2PVP A;  3A54 A;  5JJZ A;  5LMN Q;  1A3V A;  2M05 A;  3CC4 A;  1AZQ A;  2ASB A;  4DL3 A;  2JYO A;  3K59 A;  4DUZ L;  2JA8 H;  3NBI A;  1U0L A;  3FDS A;  4FP5 D;  4B3T Q;  2IWH A;  4A93 G;  3S2D B;  5M9O A;  3OTO H;  3T5H A;  1XWE A;  4DK3 C;  1Y8O B;  1OO9 B;  1RKN A;  4A3F B;  3MWE A;  4ME6 A;  2E2H B;  5KFW A;  1MZB A;  4MTN A;  4FVM A;  3DXJ C;  4AH6 A;  2RDJ A;  1GO3 E;  4FXD A;  4C3I H;  1X56 A;  4X62 L;  1ENF A;  4HJ9 A;  2N88 A;  5KFR A;  2EDG A;  3V4Z A;  1EIY B;  1CTM A;  4MNO A;  2J4X A;  3RGZ A;  3HKZ B;  3OSN A;  1I6U A;  2OXP A;  4LF8 Q;  3I4N B;  1I6H H;  2RGV A;  4ID6 A;  4EBC A;  2UUB Q;  3M4O H;  3C1E A;  5A35 A;  4LFC L;  2R8I A;  1CZG A;  4C56 C;  4IRD A;  3R3O A;  3HZX A;  4BBS H;  1FKA H;  1VQA A;  4QJF A;  1CKN A;  3SR1 A;  5IP7 H;  1WSC A;  4GC7 A;  2E74 C;  2X69 A;  1FD7 D;  4JI0 L;  1RIP A;  2R7K A;  3CXC A;  1XXG A;  1HNZ H;  4K2K A;  1KD1 C;  4P73 A;  4DV7 Q;  2XTI A;  1UEA B;  1B70 B;  2MGS A;  3J7A 5;  1ESF A;  3WO0 A;  4OHJ A;  1EYZ A;  4RAZ A;  2WKC A;  3T5L A;  3RN2 A;  1LTR D;  1XNR L;  3HOW G;  4JI7 L;  3DWA A;  2O2L D;  2QGQ A;  1NUC A;  4JI8 Q;  2D62 A;  5JJL A;  2Z0S A;  2Z9H A;  4Q8F A;  2J6T A;  4V0B A;  4OX9 L;  3PIP 3;  4IHJ F;  4XYM B;  4DAM A;  4C3J G;  4K6L A;  1KDC A;  3LX0 A;  5M3M B;  4AYB G;  4DAY A;  1J5E H;  4HMJ A;  1N9W A;  2E2D C;  1Y1V A;  4JV2 A;  5DAU A;  1HR0 Q;  2EJG C;  4ECW A;  1AUV A;  1Q12 A;  3OHA A;  4Y7N B;  1G51 A;  1Z2O X;  1IYJ B;  1W96 A;  2FK3 A;  1N32 Q;  1JDE A;  2IMW P;  2NVT H;  5M3F G;  5GAD C;  2ALZ A;  5GAH C;  5IGD A;  4AYB E;  5KND A;  3PQI A;  5DEH A;  4GN5 A;  1Q90 A;  5DLG A;  3K5N A;  3F8N A;  5LMU H;  4IUR A;  2LSS A;  2NN6 G;  1DON A;  3EPG A;  1QNK A;  5IGF A;  3P7J A;  5FO9 B;  1Y69 U;  1X3G A;  3HOX H;  1BDO A;  3HOZ G;  1G91 A;  3JSN A;  3RB4 A;  2WII B;  3KLW A;  3KLS A;  3ONA B;  5IGG A;  1FJG Q;  3HBL A;  1L1O C;  4BWG B;  1GVP A;  1PFB A;  4XXE A;  2F0P A;  2CWA A;  2A6E D;  4HED A;  4OGQ C;  2ZXP A;  2F0G A;  4YIJ A;  1TII D;  2B8G A;  4ED7 A;  5GRO A;  4WBN F;  4DK1 A;  3GV6 A;  1V51 A;  1QZG A;  2BR0 A;  5IP9 H;  1ESR A;  3EIV A;  5FLX E;  4GKJ H;  5EWF A;  1YHA A;  1KNE A;  4LFA Q;  4DV1 Q;  1BNZ A;  1Y1V H;  1PDQ A;  4PNY A;  1PH4 A;  5KFV A;  4DV6 H;  3E3X A;  1W6K A;  1PH8 A;  2R92 B;  4FF3 A;  4BBR H;  4H02 A;  4K5W A;  1D6E C;  3I91 A;  2R8H A;  2L15 A;  1BUV T;  5CAE B;  1L1O B;  1BBX C;  3RAQ A;  2A73 B;  2VR1 A;  2ZT9 C;  1HA5 A;  1B53 A;  4LW1 A;  4LJZ C;  3PO3 B;  1UE5 A;  3M4P A;  3OMG A;  3U9O A;  1H9J A;  4RWS C;  1QCB D;  1I3Q B;  4K6D A;  5EPK A;  4DFA A;  4OO1 H;  5KG7 A;  1VMP A;  3HOU H;  3Q1K A;  1EYD A;  2KQ3 A;  3K0X A;  4NXN L;  4JVZ A;  3A74 A;  2OWO A;  3Q24 A;  4LH7 A;  1QIL A;  3AFQ A;  1GUN A;  1BKB A;  4QWC A;  2SEB D;  1N36 H;  1HZ9 A;  2RQX A;  1B2T A;  1B50 A;  2DZD A;  4S3S A;  1GGO A;  5FD5 A;  1SMY C;  1GSH A;  2TMP A;  1JXL A;  4BY1 H;  3GTL A;  3URY A;  4MTD A;  1MJC A;  1EFI D;  2JQO A;  3R2I A;  1AEX A;  4KI0 A;  3S24 A;  4JUZ A;  2B29 A;  3A8K E;  2W70 A;  2UXB Q;  3FVQ A;  2HD3 A;  3G48 A;  3CCR A;  3FDT A;  5IT9 c;  5A2Q W;  4YJ2 F;  4RAU C;  1NR2 A;  2ZTE A;  3BVM A;  2XCP A;  3G6Y A;  5L37 A;  3HEJ A;  3JAM E;  4G7H C;  3S1N H;  1Q1B A;  2NZ1 D;  2ES2 A;  4CDE C;  4TUY F;  3RLF A;  4DXF A;  4CKC A;  1ASY A;  3CMA A;  3HOY H;  4TQU S;  3M4I A;  1SDF A;  1EOV A;  4R7R A;  4RGM A;  3SK5 A;  4NXM Q;  5KNB A;  4R4O A;  4HSP A;  3VYU A;  4QWA A;  1K83 B;  3F2D A;  5C44 G;  1ZKO A;  1WJJ A;  1IOV A;  2KHS A;  1PX2 A;  2RGR A;  1SRU A;  4LF9 Q;  2NUA B;  2Z6K A;  1V43 A;  1K0S A;  4KN7 C;  1JQY D;  1JJC B;  1EL0 A;  5ELN A;  3TS2 A;  1JJ2 A;  5FLX L;  3MFG A;  2JA8 B;  2AWN A;  2BH2 A;  3HOV H;  5JEA H;  4B08 A;  4XYO A;  4DL2 A;  1TWG A;  3N40 P;  4DR4 Q;  2QCP X;  2JA7 A;  2K5V A;  1VBH A;  4RUA A;  2V4D A;  4B3M Q;  1S5E D;  4KHV A;  3J80 i;  3VPC A;  2PNR C;  2VUM A;  2LFN A;  1VMC A;  3EQL C;  4ZRZ A;  5ELF A;  4A3D H;  3RD4 A;  5EKI A;  1WTW A;  2F4V Q;  4DR7 H;  3NEM A;  5KFK A;  4C3I B;  4JI6 H;  1WFQ A;  4J9M A;  2HIX A;  1UEB A;  2W9A A;  2NU7 B;  3I12 A;  4PMB A;  4FBU A;  1A6X A;  3H91 A;  5FOB B;  2KUM A;  5D1P A;  3RBE A;  3BQ0 A;  5C4X B;  4X64 H;  4I50 F;  3SDZ A;  3MR6 A;  1KLU D;  3BA9 A;  3U9T A;  4FU0 A;  5M5Y H;  1E2W A;  3S17 B;  2CHB D;  3K3P A;  2L0C A;  4PV1 C;  3OUZ A;  4A3G H;  1I6H B;  1AE2 A;  3TQ1 A;  2LXK A;  5KFH A;  3L4J A;  3TSS A;  3G7L A;  1RYR A;  5DLQ E;  1LO5 D;  2I80 A;  3ORQ A;  2FPP B;  2VUG A;  4O4I F;  5EZY F;  4YWM A;  3CCJ A;  1UE7 A;  1M0T A;  3OUU A;  1B8A A;  4DV0 Q;  4PMW A;  3PW0 A;  2AMC B;  2NN6 I;  1FL0 A;  1V1P A;  4DR2 L;  3CRL C;  1PV4 A;  3E5N A;  2CQO A;  1BCP F;  1TWG H;  2K32 A;  4B3R Q;  1BOS A;  2XGT A;  3KBX A;  4ECS A;  1FVI A;  3GQB A;  3ND9 A;  4MN3 A;  5C3W A;  3JAM L;  4FF1 A;  1SNQ A;  2VQD A;  2XSC A;  3NTI A;  2A69 C;  2HQE A;  2VUM H;  4KV6 A;  5J39 A;  4JI3 Q;  3OOC A;  4CDD C;  1G6P A;  2C9O A;  3AU7 A;  4LUV A;  5IWA H;  3FHW A;  3MWY W;  1QVF A;  1G29 1;  1KAA A;  4JI2 Q;  3Q8D A;  2ZDG A;  4GKJ Q;  4Z9C B;  3RFC A;  3KHL A;  1I6V C;  1ZEQ X;  4ZK9 B;  1EU3 A;  2UXD L;  2ASJ A;  1DGS A;  1QVG A;  1TQO A;  1TWA A;  3BAB A;  3GTP A;  2E2I A;  5LHY 1;  3A56 A;  3GTQ A;  4YBZ B;  4LF5 H;  5F9N A;  4ZKB B;  4LF7 Q;  3WOF A;  4QWD A;  4NKL A;  2UU9 L;  2NVT B;  2ID0 A;  1CKM A;  2SDF A;  1TVX A;  3LGJ A;  3K57 A;  1RK6 A;  1LAB A;  4JYA Q;  2R93 G;  1VQJ A;  3PO2 B;  1TU2 B;  3BVG A;  2UUC Q;  4HIO A;  5CV4 A;  2MUY A;  5DGA A;  1T94 A;  2VQE H;  3CCV A;  2UVW A;  2WFW A;  1CKN B;  3C2P A;  2R7L A;  3E5S A;  5E4W C;  1UE1 A;  4LF4 Q;  1HNW L;  3HOX B;  4A76 A;  1BCP C;  2GA4 B;  3KTM A;  3ERQ A;  4JC0 A;  2KCT A;  4J6H A;  1RTN A;  4EG0 A;  1N36 Q;  5KT4 A;  1KRS A;  5GAG C;  2R86 A;  5IOC A;  4GNX C;  4DPG A;  1PH2 A;  2UVV A;  4EGJ A;  1ILP A;  1B7Y B;  3NTH A;  1EY5 A;  2AQ2 B;  3PMF A;  1D7Q A;  4QIW B;  2AKW B;  3CC7 A;  2E2H A;  4GLV B;  2RVL A;  3PUY A;  4J1M A;  5J22 A;  1PRT F;  4QUF A;  2QA4 A;  3KLS X;  3WNZ A;  3Q23 A;  2B2Y C;  4HAE A;  5ELD A;  5AJ3 L;  1A62 A;  3GLK A;  3T1Y H;  4YP3 A;  4OWX B;  1JE4 A;  3OIQ A;  4DAY B;  5CA1 F;  2E5L H;  1TWA H;  4JBK A;  2UUA L;  2A1A A;  4ILW A;  4K5X A;  2FJZ A;  3HKZ A;  1HPC A;  3GTP H;  4K0K L;  2E2I H;  3R93 A;  1BCP B;  2PQE A;  1XMQ L;  1BGW A;  3QB3 A;  2VQF L;  4O3N A;  4IWX A;  3T1H H;  4IUQ A;  4X6A H;  4N9P A;  3HOV G;  1VQ4 A;  1EIH A;  3MXN A;  1H9S A;  3ULJ A;  4GNX B;  2JA5 G;  5HV6 A;  2BH8 A;  1LT4 D;  4A3E H;  4Q45 A;  3F2C A;  1LTL A;  3TP6 A;  4X66 Q;  3HRZ C;  4FBT A;  1U4M A;  3K6O A;  4DR5 Q;  1CS0 A;  3K58 A;  5LP6 F;  2V1C C;  1OTC A;  4ETS A;  4EQO A;  4DR6 Q;  4YY3 H;  2AQ1 B;  3GIJ A;  1S72 A;  2EE1 A;  2Z8L A;  2VW9 A;  4RGO S;  3RJ0 A;  1PH1 A;  2HUG A;  5JOB A;  1I7N A;  2GVA A;  3W3A A;  4FF4 A;  5JAV A;  4A3B H;  2WE6 A;  1JWS D;  5LL6 X;  4R4Q A;  3U4V A;  4LFB L;  4DV4 H;  1PRT C;  1RTO A;  2W9B A;  2E2H H;  2A68 C;  3WO1 A;  2N55 A;  1HNX L;  1N34 L;  5DQI A;  4BY1 B;  2WB1 E;  4OXP A;  2B8F A;  2PI2 A;  2JJQ A;  3KXY T;  3NEN A;  4RZQ A;  4KJO A;  1X65 A;  3NEL A;  3Q8Q B;  4L5Q A;  1TY2 A;  2CQY A;  2QW7 A;  3PIO 3;  3GV8 B;  2Y0S G;  3J81 c;  4QCL A;  2NYZ D;  1HCZ A;  2K05 A;  2R6G A;  2D0O A;  3EYY A;  4IJL A;  1YJN A;  1DJR D;  3I4N H;  4WJ4 A;  1EU4 A;  4Y8V B;  2MFI A;  3IL8 A;  4U68 A;  3M4Q A;  3HP3 A;  1XYI A;  4L5S A;  2EXD A;  3PUV A;  5BN4 A;  3I4M G;  3RV3 A;  1F9S A;  4CJ1 B;  1EUJ A;  4LSX A;  1I94 H;  3TP5 A;  3VYT A;  2SOB A;  1JC7 A;  5JPM C;  4Q0F A;  1VQ9 A;  1XJV A;  1PRT B;  3L3O C;  2B2T A;  1HRJ A;  1IL8 A;  1GHJ A;  3SK6 A;  1KDA A;  4JI1 Q;  4DR1 Q;  4B3S H;  2EIF A;  2JEB I;  3CME A;  2F0H A;  1LAC A;  1Q7Y C;  1B6R A;  4KHZ A;  2BA1 A;  5EWG A;  5LMN H;  1IBK L;  1KJJ A;  4HJ8 A;  1STH A;  1V4Y A;  4DL7 A;  4DGZ A;  1SBB B;  2MPM A;  4G57 A;  2ZM6 Q;  4B3T H;  1U4L A;  4IUN A;  2M00 A;  3M9N B;  4DR3 L;  1KC8 C;  4I4T F;  2ZTD A;  5H1S E;  3HOV B;  4HSV A;  3R5F A;  1GUG A;  1GUO A;  2HJW A;  4CC5 A;  1EZ1 A;  4Q43 A;  4IAJ A;  4P74 A;  4CC6 A;  2W6N A;  2UXC H;  3GO5 A;  2RDG A;  3EA6 A;  1I4H A;  4ZOL F;  1EUC B;  1BXT A;  5IWA Q;  1GJX A;  2EJF C;  2XNA C;  3F1Z A;  4F4X A;  2FMA A;  3KAL A;  1EQT A;  3GV3 A;  1XMO Q;  5FLM H;  3DWQ A;  4CJ2 C;  3S2H B;  3OYY A;  2K75 A;  1S5C D;  2QEX A;  2A69 D;  2R92 A;  1IOW A;  4LF8 H;  5KKN B;  2PZT A;  2VL6 A;  2MP1 A;  1GYF A;  2L1B A;  1O7L A;  2UUB H;  2HHH L;  2LY7 A;  3ULP A;  4ZAI A;  4DK0 A;  1SAP A;  2RSN A;  3TP8 A;  3H0G G;  1PFM A;  4A3G B;  3K7U C;  4IWY A;  4RH6 A;  1Z6H A;  1CSQ A;  1I3Q A;  3QZ8 A;  2JN4 A;  3FKI G;  4JBW A;  2JE6 I;  3JAM W;  1DZ1 A;  2XGQ A;  1XPU A;  4ECX A;  1T3N A;  4IFD G;  2VQE Q;  4BY7 H;  2AQ4 A;  2KJX A;  1FR3 A;  1QNU A;  4F4Y A;  1WH2 A;  3KJP A;  4ZUI A;  1AH9 A;  5K5P A;  3NWT A;  4XIG S;  2NZH A;  1L0W A;  4WFN 3;  3CCU A;  4IRC A;  2W6O A;  3R5H A;  2F3V A;  5D3I B;  2NZO A;  3N44 B;  4PZ8 A;  3K5H A;  1X54 A;  3T4A C;  2EYJ A;  2KVM A;  4JI8 H;  5IYB G;  2YS6 A;  4JI4 H;  4C3J B;  3CU7 A;  5CMD A;  4O1N A;  2DN8 A;  1BCP D;  4RGN A;  4JV0 A;  1D1K A;  1D5X C;  4BXX G;  5TSS A;  4LF5 L;  2VUM B;  1NTG A;  4LMQ D;  1U4R A;  4C5A A;  1B04 A;  1GD7 A;  4DL5 A;  5G3L F;  5HGQ A;  1XNQ L;  1C3O A;  4J9Q A;  1HR0 H;  2R92 H;  4KHP Q;  3HXL A;  1MHW C;  4ED1 A;  5CGK A;  1M1K C;  3VPD A;  1PHJ A;  1GSA A;  1N32 H;  2O03 A;  1WOC A;  3Q6S A;  5CV5 A;  4IUT A;  2FLN A;  4F8M A;  2FK1 A;  4A2A A;  1A63 A;  3Q8S B;  3T1H Q;  3OTO L;  3I2Z A;  1NMG A;  1SLJ A;  1HNZ Q;  3QO2 A;  1XTD A;  3GIQ A;  3GTO A;  1Z9F A;  1I3Q H;  3QR8 A;  5C3E H;  1HZC A;  2WAQ G;  1N8R C;  1K83 A;  5M5W H;  2K4K A;  1SSO A;  5EOY A;  1SMX A;  2A6E C;  2F4I A;  3ERS X;  2C2R A;  3JSL A;  4DLK A;  1EY0 A;  1V1P B;  4U7C A;  1KJQ A;  5E1F A;  3RB3 A;  4QIW E;  3UDG A;  1XPR A;  1Y1V G;  5DM6 3;  4G7O C;  4QUC A;  3S1Q H;  5KFP A;  1AZP A;  2BCO A;  4NPS A;  3S1R H;  4PZ7 A;  3C46 A;  1PH6 A;  1E24 A;  4R4T A;  4UCR A;  2YTX A;  3RB6 A;  4KY6 A;  4A3I H;  1EY4 A;  2J6S A;  2W6Z A;  5BPF A;  4DL4 A;  5C0X H;  4A3J G;  4LFA H;  1C9O A;  4DV1 H;  4Q8E A;  1PRT D;  3A5U A;  1K0R A;  1MKH A;  2AGP A;  3EFX D;  1NY4 A;  1I4X A;  1HZA A;  1STB A;  1Z47 A;  1DV1 A;  1YZ6 A;  5GQO A;  2YRW A;  3GTP B;  2E2I B;  3VR6 A;  2R87 A;  3GQC A;  4KY5 A;  2WDT A;  4RB3 C;  1S0N A;  3RTX A;  3RUZ A;  3AEV A;  2K5D A;  1YHQ A;  3GTO H;  1IYU A;  3KHG A;  2K14 A;  5KFM A;  4A3E B;  5D8D A;  1I50 A;  4OIK A;  1IBL Q;  3K5L A;  4IFD J;  4ME5 A;  4TKO B;  3F8T A;  1AP0 A;  4A3C H;  1RJP A;  4JV5 H;  2IJ0 A;  4X65 Q;  1TKW B;  1A9X A;  5KFL A;  1KAB A;  1NSN S;  1LT5 D;  4JI5 Q;  4A3M H;  1J5E L;  1VQL A;  4XT1 B;  5LOV F;  2ASL A;  1IW7 C;  2ALY B;  1CFM A;  4IPD A;  2A6H D;  4RHS A;  4A3B B;  4ED8 A;  4HJA A;  2F0I A;  3QJY A;  2K6A A;  1F2L A;  1GKH A;  2I0Q A;  4GKK L;  3EN2 A;  1TT2 A;  4QWE A;  3F2U A;  2FB9 A;  1U5K A;  3CCS A;  5L9X A;  2IL8 A;  2UXC Q;  4XT3 B;  2UXB H;  2ZJP A;  1HUM A;  3ETH A;  5LMU L;  4ECR A;  2H1E A;  2W8K A;  4IN3 A;  1VQ7 A;  1SEB D;  5C4X H;  2BDO A;  4JK1 C;  3NE5 B;  4YHH Q;  3RUP A;  4MTE A;  5KG3 A;  1D1I A;  3S17 H;  5FO7 B;  1I4Q A;  2XIG A;  3SE7 A;  1ZHQ A;  2I46 A;  3VR2 A;  3MXN B;  1H9S B;  3KYH C;  1TAE A;  4NXM H;  1I50 H;  2KED A;  1CE8 A;  2FE3 A;  3BAA A;  5CC4 A;  2I07 B;  4XZ3 B;  2QEJ C;  1MD2 D;  4G3I A;  1LYL A;  2F0F A;  4KY7 A;  1ONL A;  1C4Q A;  3J80 W;  4LF9 H;  4GC6 A;  2JA6 A;  1ZET A;  3C1F A;  2E2J B;  4LWC A;  3KDF B;  3LML A;  5L1J A;  5C4J B;  4A3D G;  4IFD I;  4DNR B;  3H3V I;  4EVO A;  1YEZ A;  5BMV F;  2K5Q A;  5CA0 F;  1ENA A;  4QB4 A;  1YNX A;  4DV6 L;  4DR4 H;  1BBW A;  2R7Z A;  3DUZ A;  1QJO A;  4HIK A;  4QIW A;  4B9W A;  3JAM i;  2B2T C;  2XRQ D;  2W9B B;  4B3M H;  2F52 A;  4NB3 A;  4UAI A;  4JI4 Q;  3I56 A;  3N42 B;  1O7I A;  2R6F A;  2F4V H;  1ENC A;  1F9Q A;  1EFW A;  5GON F;  3FEW X;  4YCV A;  2WYO A;  1S0M A;  3BA8 A;  1MIU A;  5C5J A;  2Z1C A;  4MV6 A;  2BOS A;  2M9V A;  3TIG A;  4HNU A;  3PW7 A;  5FJ8 H;  2K5W A;  2DPJ A;  2XC9 A;  3HB9 A;  4DV2 Q;  4E4T A;  4OWT B;  4OEL B;  2FLL A;  5KG0 A;  3GD7 A;  1A2U A;  1HFG A;  4GNX A;  5C6A A;  4R4I A;  3PO2 H;  3GTJ H;  1T9H A;  4MTK A;  4ZHQ F;  1B4O A;  1K1Q A;  2F3W A;  4IUP A;  2IHE A;  5JPN C;  2JA7 G;  2ASD A;  1E4G T;  3IN5 A;  5COY A;  1C0A A;  4DV0 H;  4DN4 M;  2KOL A;  2FMM A;  2B2Y A;  2WP8 J;  1Y8P B;  4GN4 B;  4I65 A;  4DV5 L;  1B6S A;  3R2T A;  1HZB A;  4X3K A;  4O42 A;  5T1I A;  2JA6 H;  3TIN A;  4HNV A;  1Q8I A;  1PTO H;  4BY7 B;  2HVQ A;  3I8Z A;  1O75 A;  2MO0 A;  3UDF A;  4I7H A;  2D0P A;  2YV5 A;  2DNE A;  1T36 A;  2R85 A;  2XVS A;  3IG0 A;  4B3R H;  3PW5 A;  1SE2 A;  5HBR B;  3K7A H;  2F3I A;  3TZU A;  2VY3 A;  2R7Z H;  1X3E A;  4KKT A;  4IO9 A;  3OWE B;  3HG9 A;  3UE1 A;  4QGU A;  1YIT A;  3J7A K;  3VDY A;  1TWH A;  4IJH A;  4XDX A;  4JI3 H;  3PW2 A;  5LA6 F;  1MSH A;  3S1M H;  2ZXR A;  3NXW A;  4V19 0;  1VS0 A;  2PPB C;  2X6G A;  3KFU A;  3L4K A;  4JI2 H;  3NWS A;  1ZXT A;  2DJF C;  5IYC G;  1X32 A;  1IBM Q;  1RCV D;  2I5M X;  3TZD A;  4CDF C;  5KT6 A;  3T53 B;  4ZYS A;  4L5T A;  1TXY A;  2ZTC A;  2A8V A;  3SE0 A;  1R4P B;  1PYW D;  5G3L D;  4LUO A;  1EZ6 A;  1II3 A;  4LF7 H;  4AQY Q;  4ULL A;  2RHQ B;  2XWB B;  3WWV A;  2YS7 A;  1X3Q A;  1OXT A;  4JYA H;  1GUT A;  2O5J C;  1AN7 A;  2UUC H;  4JI0 H;  1PZJ D;  1O78 A;  1PZK D;  2MCT A;  2DY8 A;  5C3E B;  1VQK A;  4TRD A;  3P75 A;  1EEF D;  2K50 A;  3MC0 B;  4LF4 H;  1EIF A;  4OWW B;  5M5W B;  1C30 A;  5J1Z A;  1OXV A;  4JV5 Q;  4DR7 L;  4JI6 L;  1VQ6 A;  2D9U A;  1XNR H;  2I5H A;  2CH4 A;  3CP0 A;  5IOD A;  1KDB A;  5C5L A;  3BS1 A;  3H40 A;  4X64 L;  1YJ9 A;  1TWH H;  5BR8 Q;  4O3S A;  3S1Q B;  4YB8 B;  5L1K A;  3S1R B;  1N33 Q;  4ECZ A;  2CZG A;  2PMZ B;  1YNN D;  1TR5 A;  3I55 A;  2PCF B;  2IY5 B;  3W1G A;  1IW7 D;  4EBE A;  1PYB A;  4A3I B;  4GN3 B;  3MXG A;  1TS3 A;  2C5C A;  4TQS A;  3PIP A;  2EXZ A;  2E75 C;  4HTH A;  2FIN B;  4R8N A;  2B63 G;  2K33 A;  3G71 A;  1JOK A;  1L0Y B;  5NUC A;  4C3H G;  2J0T D;  4HCS A;  3K3V A;  5CB4 F;  3PW4 A;  4UP7 A;  5M5X H;  2IX1 A;  1VQG A;  4LF6 Q;  3V2T A;  4DUY Q;  2AGO A;  4X66 H;  1JE5 A;  1K9M C;  5KG1 A;  1CK1 A;  4DR5 H;  3GTO B;  2XIW A;  4IR9 A;  1FGU A;  1C7Y A;  1NNX A;  3BZD B;  3G6J B;  4A3F G;  4RB2 C;  4DR6 H;  4X3S A;  5T14 A;  5BN5 A;  2K04 A;  5IE8 A;  1HTP A;  3BYT B;  4A93 H;  1VQ5 A;  2XD4 A;  2NWG A;  3BVZ A;  3ND8 A;  2BE5 C;  4J9R A;  1NMF A;  2VNU D;  1LV9 A;  5D1O B;  1FYC A;  4A3M B;  3RZD B;  3GTG B;  5T1G A;  5I2X A;  4J8Q A;  2PO4 A;  4EQP A;  2DUD A;  3RLO A;  1S03 G;  4K14 A;  3HKZ G;  5KFQ A;  1ZQ7 A;  3MVV A;  2YU9 H;  3J7Y W;  2NU9 B;  3KJO A;  1MGS A;  4RCN A;  1PMR A;  1K1S A;  2Y0S B;  1K73 C;  4CGY B;  4YQW A;  2SNS A;  5KG4 A;  2HT1 A;  3V6K A;  1E22 A;  3S2H H;  3HKZ E;  2V5A A;  3ER0 A;  4UP9 A;  3I4M B;  1PH7 A;  4H13 C;  4FDB A;  5IT9 E;  2SCU B;  3K81 C;  1PTO F;  2FPG B;  4A3L G;  2NVY A;  1JWM D;  4IAL A;  2Z6B A;  3ICE A;  3Q0A A;  1MSG A;  2EYM A;  3GID A;  4EGQ A;  4ZKC B;  1FNW A;  1WTH A;  4RCO A;  2EPB A;  4DR1 H;  3TS0 A;  4HYK A;  4JI1 H;  4NDX A;  2VB3 X;  1WD1 A;  3UDX A;  2PZW A;  4NXN H;  3KUP A;  1DOK A;  4I55 F;  1R4Q B;  4JBM A;  1I50 B;  1EY6 A;  1EQR A;  3N52 A;  4DUZ Q;  1SYD A;  5C4Z A;  2Q2H A;  4O3R A;  3I4O A;  3HOW H;  3CCE A;  4QMG A;  2ZM6 H;  3T1Y L;  1GLV A;  3NGD A;  2XCA A;  1MBY A;  2Q2U A;  4OON A;  5M3M G;  2C28 A;  1S68 A;  1M0W A;  5ELO A;  4C1N K;  2V58 A;  4MIU A;  1VF7 A;  1EIG A;  4N8X 1;  2E5L L;  5KFG A;  3K0Y A;  4J9L A;  1D5Z C;  4C3J H;  2I87 A;  4GZY C;  4A3K G;  1ICW A;  2PI2 E;  4X62 Q;  4LH6 A;  2G9D A;  1Z7T A;  2IPK D;  3N6X A;  3QZ7 A;  1K28 A;  1PA6 A;  4JPB W;  1K3B C;  2EZV A;  2NU8 B;  1LUZ A;  2MO1 A;  1XMO H;  1PTO C;  1JIC A;  1MI2 A;  3ULL A;  4XQN A;  1J6Q A;  1GOZ A;  5M3F H;  1KL9 A;  1WCM B;  4J9S A;  5KG2 A;  3UI2 A;  4YY3 L;  2DGY A;  2W7P A;  2NVY H;  3JC6 6;  4P2C B;  3MEH A;  5I4D A;  2H4O A;  2NN6 H;  4LFC Q;  1STA A;  3M9O B;  5H80 A;  3C3L A;  1LM0 A;  3CCQ A;  3D31 A;  3RIZ A;  1PFN A;  3PCO B;  3HOZ H;  1P8L A;  3BZK A;  4DV4 L;  1CQJ B;  3MTS A;  2K5H A;  3GTJ B;  4JI0 Q;  2AUK A;  3K80 C;  1LTA D;  2W6P A;  1R9T H;  5ISR A;  1JCK B;  2ICE C;  3VPB A;  2ZDQ A;  1EQV A;  5KFU A;  4ME3 A;  1X6O A;  2B2W A;  2JA6 B;  3A55 A;  4N9T A;  4UY8 C;  3HS0 C;  1PTO B;  2KA7 A;  1K8G A;  1XNR Q;  3E6Z X;  2PNH A;  4JI7 Q;  4ECU A;  2JEA I;  1K3R A;  1ROD A;  1SFO A;  4M1U B;  5IT9 L;  4OX9 Q;  3K7A B;  2R7Z B;  2EOT A;  1K8A C;  2OF1 A;  1A15 A;  1I94 L;  3TRE A;  1UWV A;  1W93 A;  1VBG A;  3MZ5 A;  2F0Q A;  2Q8I B;  3S1M B;  1G2S A;  3K8A A;  4FS1 A;  5KT3 A;  2B2V C;  4O2A F;  1S4Z A;  1QB5 D;  2IX0 A;  3PUW A;  4B3S L;  3PO3 G;  1SYF A;  2YZN A;  4RUC A;  2VXW A;  1B3Q A;  3LWE A;  1EYC A;  5LMN L;  4FXG C;  2W57 A;  3CW2 C;  5KT2 A;  4KHP H;  4YCU A;  3VYR A;  3EPI A;  5LXT F;  3GTM B;  3PR4 A;  1IXR A;  1OXS C;  3LWB A;  1N48 A;  5KFO A;  5J3B A;  4B3T L;  2IA6 A;  5BN3 A;  2MJ8 A;  1V1Q A;  1ICF B;  2NBF A;  1JT8 A;  2L9H A;  1OWT A;  4MA0 A;  2ZJQ A;  1SN8 A;  5IGC A;  1A3T A;  2F0D A;  2L5T A;  3M85 A;  1VQN A;  5K36 G;  4HIM A;  1SXT A;  2MHV A;  3NBH B;  2W9C B;  3D6W A;  1HA6 A;  3JRX A;  1UC8 A;  1UNS A;  3MJF A;  4FM9 A;  1BF4 A;  2R8G A;  4IOA A;  3BQ2 A;  1IYV A;  2MNA A;  3KDF A;  3HFZ B;  1H9M A;  4GLA C;  2WB1 G;  3SEB A;  1W2B A;  1UNN C;  3H20 A;  2Q8T A;  2Q2T A;  5C1P A;  1WVL A;  4NLG A;  4OEM B;  3K5M A;  4EEY A;  4HMI A;  5DNF A;  3BG3 A;  4UCV A;  1SFO H;  1P16 A;  2FJ2 A;  4G4K A;  2JEJ A;  1RJR A;  4LF8 L;  2BDN A;  2PN1 A;  4HR7 B;  4A75 A;  2AGQ A;  1BNC A;  1Y1W G;  3H4B A;  2BE5 D;  1TWH B;  4ZQ3 A;  2QKI C;  3U9S A;  3J81 j;  2UUB L;  1GUS A;  4IRK A;  1CA6 A;  5FPR A;  1VQB A;  5IYD G;  3AMU A;  1WTQ A;  4BWS C;  2Q2I A;  5DQG A;  5HY6 A;  5CBE E;  1VQ8 A;  1O7Y A;  2PYK A;  4J9K A;  2YTY A;  3DM1 A;  5HGT A;  4EX5 A;  2EY5 A;  2F0V A;  3TBI B;  4DKA C;  2QYZ A;  4P75 A;  1O80 A;  4QQB X;  2P0A A;  1RF2 D;  4LSA A;  4QW9 A;  3D3R A;  4DV7 L;  2FP4 B;  2K28 A;  4WJ3 M;  4MV3 A;  1Z2P X;  3CQZ B;  2F0M A;  4FF2 A;  2JA8 G;  5C44 H; 
#chains in the Genus database with same CATH homology
 1TWF H;  3KLW A;  4KHP L;  4A3J G;  2NVQ H;  1C9O A;  5FLM G;  4JI8 L;  1FJG Q;  3A5U A;  1M90 C;  1K0R A;  1MKH A;  4JI4 L;  1L1O C;  4NXN Q;  1NY4 A;  1GVP A;  1HZA A;  3GTK H;  1NJI C;  1Z47 A;  2CWA A;  5LMU Q;  3T1H L;  1HNZ L;  1X9N A;  2E2J H;  1YZ6 A;  5GQO A;  1X55 A;  5C4J H;  5GRO A;  3STB C;  1QZG A;  5IP9 H;  2KEN A;  3EIV A;  3AEV A;  1YHQ A;  2H5X A;  1HR0 L;  3GTO H;  3GDE A;  2K14 A;  1QUQ A;  1YHA A;  4LFA Q;  4DV1 Q;  1IBL Q;  4IFD J;  1N32 L;  2IHF A;  5EAY A;  1KXL A;  4QL5 A;  1Y1V H;  1PH4 A;  4BY7 G;  3F8T A;  2JA7 H;  1PH8 A;  4A3C H;  4X65 Q;  4BBR H;  4H02 A;  2L15 A;  4HID A;  4A4I A;  4C2M H;  4JI5 Q;  4A3M H;  1J5E L;  1VQL A;  4IPG A;  3KF6 A;  3G4S A;  3CAM A;  1L1O B;  3CD6 A;  2ALY B;  4IPD A;  4HJA A;  4BBS G;  4LW1 A;  1UE5 A;  1GKH A;  3M4P A;  5IP7 G;  2R7D A;  2I0Q A;  4GKK L;  5E7N A;  3EN2 A;  3HOU H;  3D0F A;  3J80 c;  4TVA B;  3RZO H;  4DV6 Q;  1FJG L;  1U5K A;  3K0X A;  1CSP A;  4NXN L;  3E9H A;  3CCS A;  3A74 A;  2OWO A;  3S15 H;  2UXC Q;  3AFQ A;  2ZJP A;  1BKB A;  1AE3 A;  3PV0 A;  5LMU L;  1TWC H;  1HZ9 A;  3L0O A;  4APV A;  3PSI A;  3A0J A;  4IPC A;  2R92 G;  5IYC H;  3J81 i;  5C4X H;  3W5O A;  1VQ7 A;  1WI5 A;  4XTC S;  4LUZ A;  4YHH Q;  4BY1 H;  2PQA A;  4GKK Q;  1MJC A;  3OW2 A;  2CFM A;  1GM5 A;  3S17 H;  2JQO A;  2N78 A;  4DV1 L;  1IBL L;  4LFA L;  4KI0 A;  1CKO A;  3S24 A;  1XPO A;  2B29 A;  4JG2 A;  1EYG A;  2UXB Q;  3G48 A;  2IT1 A;  1PH9 A;  3MXN B;  3CCR A;  3KYH C;  5C3E G;  5IT9 c;  4X65 L;  1I50 H;  2OCE A;  2ZTE A;  1A8V A;  3L7Z C;  1Q86 C;  1S40 A;  4JI5 L;  1MJE A;  3S1N H;  1LYL A;  1E1O A;  1Q1B A;  3MEF A;  2ES2 A;  4LWC A;  2A19 A;  3KDF B;  4A3D G;  3RLF A;  4IFD I;  3PO2 G;  3H3V I;  1YEZ A;  4DV5 Q;  1ASY A;  3CC2 A;  3CMA A;  3HOY H;  4TQU S;  1YNX A;  4DV6 L;  1BBW A;  2N49 A;  1EOV A;  4HIK A;  2UXC L;  2R93 H;  4NXM Q;  3JAM i;  4R4O A;  2N8N A;  3HOX G;  1H95 A;  2F52 A;  3AQQ A;  4NB3 A;  3F2D A;  3PIO A;  3I56 A;  1O7I A;  4A3I G;  3AFP A;  5C44 G;  4JI4 Q;  3GTQ H;  1BVS A;  1WJJ A;  2CKZ B;  1SRU A;  5C0X G;  4LF9 Q;  3G6E A;  2Z6K A;  1V43 A;  1EFW A;  1JJC B;  4YCV A;  5ELN A;  3TS2 A;  4YHH L;  1NBW A;  1JJ2 A;  1MIU A;  1VQI A;  2AWN A;  2BH2 A;  2PMZ E;  3HOV H;  1XNR Q;  5FJ8 H;  3AYH B;  4DR4 Q;  1EQQ A;  4UP8 A;  2UXB L;  2K5V A;  4DV2 Q;  4DR2 Q;  4OWT B;  4B3M Q;  1X3F A;  5IP9 G;  3J80 i;  2B63 H;  3GD7 A;  4P71 A;  4RMF A;  4GLX A;  4C3H H;  4GNX A;  1QZH A;  2RF4 A;  1ASZ A;  4A3D H;  2F4V Q;  4R4I A;  3PO2 H;  3GTJ H;  4YWK A;  1T9H A;  3NEM A;  1VQP A;  4KLK A;  3S2D H;  4JBJ A;  1WFQ A;  3BJU A;  4AIM A;  2HIX A;  1UEB A;  2IHE A;  3EBE A;  2JA7 G;  4A3C G;  2KCM A;  1C0A A;  2WP8 J;  4A3F H;  4BBR G;  4GN4 B;  4DV5 L;  2RCN A;  4OO1 G;  1AH9 A;  1HZB A;  4O2D A;  2JA6 H;  4BA2 I;  1CUK A;  3PGZ A;  4A3M G;  4HJ7 A;  2UXD Q;  1E3P A;  1UE6 A;  5M5Y H;  2MO0 A;  3RN5 A;  2ATW A;  1S3O A;  3UDF A;  4NXM L;  3H15 A;  2D0P A;  2YV5 A;  4MZ9 A;  4A3G H;  1AE2 A;  2LXK A;  2OQ0 A;  2NVX H;  3K7A H;  2F3I A;  2R7Z H;  2VY3 A;  2JA5 H;  3BZC A;  1X3E A;  4JI6 Q;  4IO9 A;  1VQM A;  4DR7 Q;  3UE1 A;  4QGU A;  1YIT A;  5DLQ E;  3VDY A;  4LF9 L;  4LNQ A;  3HOU G;  4EQ5 A;  2UU9 Q;  4IJH A;  4YWM A;  2HQL A;  1UE7 A;  3CCJ A;  4ALP A;  4R4C A;  1B8A A;  4DV0 Q;  4PMW A;  5IY0 A;  3S1M H;  2K52 A;  2AMC B;  2NN6 I;  1FL0 A;  4PG3 A;  1VS0 A;  4X64 Q;  1SE8 A;  3KFU A;  1JMC A;  4DR4 L;  2I5L X;  5IYC G;  1IBM Q;  1OXU A;  1BBU A;  2I5M X;  3KOJ A;  4DV2 L;  3KF6 B;  4DR2 L;  1PV4 A;  4B3M L;  2Y0S E;  2CQO A;  5C4X G;  1HNW Q;  3L2P A;  1TWG H;  4BY1 G;  4DV3 L;  4B3R Q;  4L5T A;  1TXY A;  2ZTC A;  2XGT A;  3I7F A;  3PUZ A;  1FVI A;  4JOI C;  2A8V A;  2F4V L;  4LUO A;  4GOP A;  1EWI A;  3UE0 A;  2VUM H;  3U58 A;  3CCL A;  4AQY Q;  4A3L H;  4JI3 Q;  2RHQ B;  3B6Y A;  4IPH A;  3WWV A;  3RZD H;  1IL2 A;  2N3S A;  2FXQ A;  3GTG H;  2R7F A;  4LUV A;  1OXT A;  1VQC A;  3FHW A;  1KAW A;  3E0E A;  1QVF A;  1G29 1;  4JI2 Q;  3Q8D A;  4GKJ Q;  3M7N A;  3U50 C;  2UXD L;  2OQK A;  1DGS A;  1QVG A;  1KHI A;  1VQK A;  2K50 A;  3STB D;  1EIF A;  4OWW B;  1OXV A;  4JV5 Q;  3RR5 A;  4DR7 L;  1G6P A;  4JI6 L;  1VQ6 A;  4LF7 Q;  2UUA Q;  2I5H A;  2VZA A;  3I4M H;  3HOY G;  4K0K Q;  2UU9 L;  2ID0 A;  1CKM A;  3LGJ A;  3CP0 A;  5M3M H;  1XMQ Q;  1Q82 C;  4JYA Q;  4DV0 L;  1VQJ A;  2R93 G;  2Z6K C;  2VQF Q;  3S16 H;  2UUC Q;  4HIO A;  4X64 L;  1YJ9 A;  1TWH H;  5BR8 Q;  2AWO A;  4Y7N H;  2WFW A;  5C0X J;  3CCV A;  1IBM L;  4A3K H;  1CKN B;  1N33 Q;  1UE1 A;  3I55 A;  4LF4 Q;  1HNW L;  4A76 A;  4O0A A;  3W1G A;  2IY5 B;  4B3R L;  1WCM G;  1PYB A;  4GS3 A;  4GN3 B;  1L1O A;  2C35 B;  3U4Z A;  4JC0 A;  5JEA G;  2KCT A;  3UDI A;  1Q81 C;  1HR0 W;  4POF A;  3HOV G;  1HJP A;  5FJ8 G;  1N36 Q;  1KRS A;  5GAG C;  4AQY L;  3PIP A;  4GNX C;  4JI3 L;  4DPG A;  1PH2 A;  3E9I A;  1B7Y B;  2B63 G;  1L2F A;  1D7Q A;  1YHB A;  2AKW B;  3CC7 A;  3CF5 A;  4GLV B;  1HH2 P;  3G71 A;  2AHO B;  4JI2 L;  4GKJ L;  3PUY A;  4LFB Q;  2OTJ A;  2QA4 A;  3TEH B;  3PF5 A;  4UP7 A;  5M5X H;  2IX1 A;  1VQG A;  5AJ3 L;  4LF6 Q;  1HNX Q;  1A62 A;  4DUY Q;  4DK6 C;  1JE5 A;  1N34 Q;  1K9M C;  3DLL A;  4OWX B;  1FGU A;  1I5F A;  1C7Y A;  4DAY B;  4A3F G;  4JV5 L;  2JA9 A;  4LF7 L;  1TWA H;  4JBK A;  2UUA L;  2A1A A;  5IE8 A;  2JA6 G;  4A93 H;  1VQ5 A;  3GTP H;  4K0K L;  2E2I H;  1XMQ L;  3RNU A;  4JYA L;  2VQF L;  1NMF A;  1RL2 A;  2YTV A;  2UUC L;  4A3G G;  2VNU D;  3IRB A;  5BR8 L;  1WCM H;  4X6A H;  1VQ4 A;  2R7Z G;  4GNX B;  2JA5 G;  3ULJ A;  1VCI A;  2BH8 A;  3M9B A;  4HJ5 A;  4A3E H;  1N33 L;  2DUD A;  3RLO A;  3F2C A;  1LTL A;  4X66 Q;  3T1Y Q;  4LF4 L;  3HKZ G;  3H0G H;  4DR5 Q;  1Q46 A;  2YU9 H;  2V1C C;  1OTC A;  3KJO A;  3TQY A;  4YCW A;  4DR6 Q;  2YYZ A;  2E5L Q;  3FKI H;  1S72 A;  4DV3 Q;  1N36 L;  2VW9 A;  1K73 C;  4IOC A;  1SR3 A;  1PH1 A;  1PH5 A;  3H3V H;  2GVA A;  4A3B H;  2HT1 A;  4GOP C;  5FLX c;  2GVB A;  1E22 A;  1KQS A;  3HKZ E;  3S2H H;  3ER0 A;  2CWP A;  4UP9 A;  2MQH A;  5C0X I;  3W1B A;  4R4Q A;  4FDB A;  2JK8 A;  5LMN W;  3U4V A;  1PH7 A;  3PO3 H;  4LFB L;  4POG A;  3K81 C;  2E2H H;  2VUM G;  1Q8K A;  4LF6 L;  4A3L G;  1HNX L;  4DUY L;  1N34 L;  4DR3 Q;  3ICE A;  5IYB H;  2WB1 E;  4OXP A;  3SGI A;  4YY3 Q;  2B3G A;  2JJQ A;  2PI2 A;  3NEN A;  3CCM A;  4R1J A;  4BXX H;  1X65 A;  3NEL A;  3M3Y H;  3HKS A;  3TS0 A;  4L5Q A;  3UDX A;  2WAQ E;  1QUQ B;  2LXJ A;  2Y0S G;  3DM3 A;  3J81 c;  4JBM A;  1JJG A;  1EQR A;  2R6G A;  2D0O A;  3F2B A;  4DUZ Q;  4IJL A;  4DV4 Q;  1YJN A;  2Q2H A;  3I4N H;  4WJ4 A;  3I4O A;  2MFI A;  4PZ6 A;  2RHS B;  3M4Q A;  1PH3 A;  4L5S A;  3HOW H;  2EXD A;  3PUV A;  3CCE A;  4GOP B;  3I4M G;  4X66 L;  2E8G A;  3T1Y L;  4QY7 A;  1EUJ A;  4P72 A;  2Q2U A;  4OON A;  5M3M G;  4DR5 L;  1JB7 A;  5ELO A;  1YBY A;  1PFS A;  1OXX K;  1VQ9 A;  4DR6 L;  1XJV A;  1SRO A;  2E5L L;  1KRT A;  4DR1 Q;  4JI1 Q;  4C3J H;  3GTM H;  2EIF A;  2JEB I;  1IBK Q;  1VQD A;  2HHH Q;  5GAE C;  3CME A;  4A3K G;  1Q7Y C;  5JJI A;  2PI2 E;  4KHZ A;  2BA1 A;  4X62 Q;  4OO1 I;  1W3S A;  1E1T A;  1Y1W H;  1IBK L;  4HJ8 A;  1PA6 A;  5JEA J;  1VQE A;  4JCV E;  3KF8 B;  3ZJY C;  1LUZ A;  1VQF A;  2MO1 A;  2ZM6 Q;  1KIX A;  4L5R C;  4DNI A;  5IYD H;  1I94 Q;  3ULL A;  5M3F H;  1J6Q A;  4DR3 L;  2K5N A;  1KL9 A;  1KC8 C;  1Q1E A;  2ZTD A;  5H1S E;  1PYS B;  4YY3 L;  2HIV A;  5AJ3 Q;  1YI2 A;  2DGY A;  3JAM c;  1QVC A;  4B3S Q;  1K83 H;  2NVY H;  3JC6 6;  2KBN A;  5JJK A;  2PQA B;  2GN5 A;  4LFC Q;  4P74 A;  3GO5 A;  5LMN Q;  1LM0 A;  3CCQ A;  3D31 A;  3CC4 A;  2ASB A;  3PCO B;  5IWA Q;  4DUZ L;  3HOZ H;  1P8L A;  3BZK A;  4DV4 L;  2JA8 H;  3F1Z A;  1U0L A;  1XMO Q;  2K5H A;  4B3T Q;  4A3J H;  4LF5 Q;  4JI0 Q;  4A93 G;  1PVO A;  5FLM H;  3K80 C;  3OYY A;  2K75 A;  4RG1 A;  4DK3 C;  2QEX A;  1R9T H;  2VL6 A;  2BA0 A;  1XNQ Q;  4ME3 A;  1X6O A;  4DR1 L;  4UY8 C;  4MTN A;  4JI1 L;  4AH6 A;  4UPA A;  1K8G A;  1GO3 E;  4A3E G;  2HHH L;  2PNH A;  4JI7 Q;  3ULP A;  4C3I H;  1X56 A;  4X62 L;  4HJ9 A;  2CCZ A;  2JEA I;  1K3R A;  3H0G G;  3K7U C;  1CSQ A;  4OX9 Q;  1EIY B;  3FKI G;  1K8A C;  4JBW A;  2JE6 I;  4MNO A;  2ZM6 L;  3OTO Q;  1XPU A;  3CQZ H;  4IFD G;  2ZJR A;  2OTL A;  1I94 L;  3TRE A;  1UWV A;  2VQE Q;  4BY7 H;  4LF8 Q;  4A3B G;  3RLN A;  3K8A A;  4J15 A;  3KJP A;  3PUW A;  1I6H H;  2IX0 A;  4B3S L;  4XIG S;  1L0W A;  2NZH A;  3CCU A;  2UUB Q;  3PO3 G;  3M4O H;  1V9P A;  3PUX A;  4JOI A;  4LFC L;  2NZO A;  5LMN L;  4PZ8 A;  3CW2 C;  1X54 A;  3PF4 A;  4YCU A;  3CPW A;  4BBS H;  2EQS A;  5IYB G;  3BU2 A;  1VQA A;  4QJF A;  5IWA L;  1IXR A;  1CKN A;  1OXS C;  5IP7 H;  1Y14 B;  5J3B A;  1XMO L;  4B3T L;  4BXX G;  4LF5 L;  4JI0 L;  1V1Q A;  1JT8 A;  1NTG A;  3J7Z C;  1RIP A;  2ZJQ A;  1SN8 A;  3M85 A;  3CXC A;  1VQN A;  5K36 G;  1GD7 A;  1KD1 C;  4HIM A;  4P73 A;  4DV7 Q;  2XTI A;  1B70 B;  5HGQ A;  1XNQ L;  4Y52 H;  3J7A 5;  3NBH B;  1D8L A;  1NE3 A;  3I4N G;  2R92 H;  3RN2 A;  1XNR L;  4KHP Q;  3HOW G;  4JI7 L;  1M1K C;  2QGQ A;  4IOA A;  4JI8 Q;  1PHJ A;  2MNA A;  3KDF A;  1YJW A;  1WOC A;  3S14 H;  2D62 A;  5JJL A;  1IZ6 A;  2Z0S A;  3HFZ B;  2WB1 G;  2KHJ A;  4GLA C;  1W2B A;  4YWL A;  2Q2T A;  4OX9 L;  1A63 A;  3T1H Q;  3OTO L;  3I2Z A;  1NMG A;  1SLJ A;  1SFO H;  4DAM A;  1P16 A;  1XTD A;  3FP9 A;  1HNZ Q;  2VQE L;  2KHI A;  3A5Z B;  1WYD A;  1Z9F A;  1I3Q H;  4AYB G;  4LF8 L;  5C3E H;  1HZC A;  2WAQ G;  1N9W A;  4A75 A;  1N8R C;  1Y1W G;  5M5W H;  1HR0 Q;  2K4K A;  3J81 j;  2UUB L;  3CPF A;  1SMX A;  1Q12 A;  3GTL H;  3ERS X;  1G51 A;  1IYJ B;  1YVC A;  4BA1 I;  1VQB A;  2VS1 A;  1N32 Q;  5IYD G;  1YIJ A;  2NVT H;  5M3F G;  1A0I A;  2Q2I A;  5HY6 A;  5GAD C;  5GAH C;  1VQH A;  1VQ8 A;  4AYB E;  2YTY A;  4QIW E;  1VQO A;  4GN5 A;  3UDG A;  1XPR A;  1Y1V G;  4EX5 A;  1E7Z A;  2LSS A;  3S1Q H;  2NN6 G;  4DKA C;  1J5E Q;  4P75 A;  4QQB X;  4NPS A;  3S1R H;  4PZ7 A;  4DV7 L;  3TRZ A;  1X3G A;  1PH6 A;  1E24 A;  3HOX H;  4R4T A;  4WJ3 M;  2YTX A;  3HOZ G;  4A3I H;  2JA8 G;  5C44 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...