4A3BG

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
molecule tags Transcription
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3bG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3bG01
5C44G 2JA5H 4BA2I 1PH1A 2GVBA 3KOJA 2CCZA 1UE7A 1Q46A 4AQYL 2ZTCA 4DR3Q 1K9MC 2VUMG 1PH5A 5C3EG 4K0KQ 4LFCQ 4WJ3M 4YHHQ 4JYAL 1L1OB 4MTNA 4R4QA 1IBKQ 3HOYG 3W1BA 1WCMH 1VQ5A 4GNXB 4OO1G 2E2JH 3ICEA 3L0OA 4RG1A 2I5LX 2PQAA 4X62L 1XJVA 4OWWB 3CMEA 2UU9L 2GVAA 2KENA 4PZ7A 2JQOA 3A5UA 5JJKA 4JCVE 4J15A 3CMAA 4A75A 1H95A 4A3LG 2VNUD 4O2DA 3CAMA 2KCMA 1BVSA 1VQKA 3K0XA 4C3IH 2D0OA 4GOPA 2ASBA 1J5EQ 1HNXQ 1PH7A 1XNQQ 2UXCQ 1YHBA 4GKJL 2JE6I 4WJ4A 1E3PA 3F8TA 2UUBL 3M4QA 4A3JG 1XTDA 4GNXA 4LF9Q 4DV3L 4GN4B 4A3KH 4JI8L 2AWNA 1V43A 4H02A 1Z47A 3E9IA 4NPSA 5JJLA 3ER0A 2B29A 3JC66 2JK8A 3S1RH 3H3VI 3Q8DA 1UE5A 4JI0Q 5GAHC 1N32L 3H0GG 2UXBQ 4GOPB 1K8AC 1WCMG 2K5VA 3W5OA 4EX5A 3ULJA 5C4XH 1JJ2A 1SN8A 3NEMA 2K5HA 4HIDA 1EQQA 4LF4L 3HOXH 2ZM6L 2B63H 4QY7A 3NENA 4BY1G 1X65A 1IXRA 1GD7A 4A3LH 1V9PA 1RIPA 5IP9G 1Q82C 2NVYH 4A3IG 1N34L 1Q7YC 2Q2IA 1YJNA 3D31A 1PFSA 3KF6A 4DR5Q 4AIMA 2MO0A 2IX1A 1VQAA 5FLXc 3T1HQ 2AMCB 1NMFA 3L7ZC 4PMWA 2HHHQ 2JA7H 2B3GA 2FXQA 2RHSB 1JB7A 1K0RA 4A3FH 4A3KG 3GTPH 4DAYB 4A3CH 1HH2P 1X6OA 1GO3E 3K80C 3VDYA 2PMZE 1Q86C 2JA6H 3J7ZC 1S3OA 2Y0SE 2ALYB 1SMXA 3PUYA 3CPFA 5JEAJ 4A3MH 1VQMA 3AEVA 4DUZL 1M1KC 1L1OA 5AJ3L 1EFWA 3AFQA 4JBMA 1C0AA 1QVFA 1AH9A 4GLAC 3HOWH 1QZHA 1CKNA 4OO1I 2QEXA 5C4XG 4LUZA 3KF8B 1VQ4A 3F2CA 4DR1Q 2YTYA 3M4PA 3MXNB 1CSPA 3F2BA 4GLVB 1PH9A 4YCWA 3STBD 4LF4Q 1S40A 1HJPA 4UP8A 4GNXC 2E2HH 1W2BA 5ELOA 2OCEA 3MEFA 3T1HL 1SE8A 4QJFA 5HGQA 1PH8A 1VQ8A 1N36L 4A3GG 1JT8A 1TWAH 3HOVH 4JBJA 4R4TA 3UDGA 3W1GA 5IYDH 1CKNB 4L5QA 1ASZA 4QQBX 1B7YB 1JJCB 3TS2A 4HIOA 5J3BA 1X3GA 4BXXH 1U0LA 1XMQL 1MKHA 1VQIA 3CW2C 2KCTA 1VQLA 4A3CG 5JJIA 3HKZE 1IZ6A 1Q12A 2Q2HA 1VQCA 4DK3C 2DUDA 5C0XI 1SRUA 4YCVA 3AFPA 3S1NH 3KF6B 1Y1WH 1PH6A 1KRSA 2Z6KC 2K50A 4BBRG 1PV4A 4JI5L 2OTLA 4DK6C 1YVCA 4JOIC 2ZJPA 4X66Q 3I4OA 1X3EA 4DV7L 4JI3Q 4LF5L 4A3GH 5IYCG 3J81j 3S2HH 3GDEA 1HNZL 3UDXA 4QGUA 3PV0A 5ELNA 2CWAA 2YTVA 4X65L 1N8RC 1UEBA 5M5WH 5FLMH 5JEAG 4JG2A 4L5RC 4OX9L 4DR6Q 2UXBL 2KHJA 3UE1A 4JI3L 1L0WA 5FJ8H 1RL2A 4HJ7A 1GVPA 3KLWA 4Y7NH 2ZJQA 4AQYQ 1YIJA 4DV5Q 1BBUA 1SFOH 1GKHA 5IP7G 2N78A 4A3IH 4B3SL 2D62A 2R7FA 4DUYL 4DR4Q 2VUMH 3G6EA 1QZGA 3BJUA 4X64L 1MJCA 1PA6A 1UE6A 3HKSA 3PSIA 1BBWA 2BA0A 2NVXH 1G51A 2AWOA 2LXJA 1N33Q 4B3RQ 4LUOA 4LFBQ 4JI2Q 5M3MG 1YEZA 2MNAA 1VQ6A 3PO3G 2I5MX 4IJHA 4DV6L 3PO2H 4JI2L 1PYBA 3GTJH 4GKJQ 1JJGA 4DR4L 1I5FA 4JBWA 4BA1I 4DUZQ 4HIMA 3S1QH 4JI5Q 3IRBA 1L2FA 2BH2A 2E8GA 4EQ5A 5GAGC 1G291 3TREA 1X3FA 2K75A 3CCUA 1G6PA 3DM3A 2VQFL 1CKOA 2A1AA 5IT9c 3DLLA 2WB1G 2HHHL 4HJ8A 3HOUG 2Z6KA 2R7ZH 5C0XJ 2ZTEA 3HOZH 4DR6L 4LWCA 4LF6L 3H3VH 2F3IA 1J6QA 4JI7L 3ULPA 3CC4A 2BH8A 1VQOA 1N9WA 4P75A 4DV2Q 3UDFA 3GD7A 1SR3A 3FKIH 4YHHL 3PIOA 1NTGA 3TQYA 4JI6Q 3J80i 2NVQH 4JYAQ 1UWVA 3S1MH 2MQHA 4PZ6A 4BXXG 1WJJA 1A62A 5M5YH 4B3SQ 2ATWA 1A0IA 1OXUA 1QVCA 1VQGA 1LTLA 1P16A 1X9NA 3U4ZA 4R4OA 3TS0A 1IBLL 5M3FH 2Y0SG 1Q8KA 2ES2A 4K0KL 4LW1A 1Z9FA 2IT1A 2N49A 3LGJA 3ERSX 5IP9H 5LMUL 1XMOQ 4GOPC 5IE8A 3OW2A 2B63G 3GO5A 1E1OA 2R92G 2QGQA 2VQEQ 1KIXA 3TEHB 4NXMQ 4B3MQ 5E7NA 2UXDQ 4Y52H 2EIFA 2JA7G 4JV5L 4TQUS 1TWFH 4DAMA 3L2PA 4JI4Q 1WYDA 2K5NA 4A4IA 1EWIA 1LM0A 1HR0L 4JI6L 1V1QA 1WFQA 1VQNA 2WAQG 1YJWA 3CQZH 1HR0Q 3PIPA 3GTKH 4A3BH 4IOAA 1XPRA 2HQLA 1O7IA 4OWTB 2K52A 4NXNL 3A5ZB 1OXSC 3GTGH 3PCOB 2KHIA 4NXNQ 5DLQE 4C2MH 2IHFA 4AH6A 2L15A 4IO9A 2JA8H 3RLOA 5AJ3Q 4DV3Q 1B8AA 1WOCA 4IJLA 4DNIA 4A3MG 1IL2A 4JOIA 3RN2A 4ALPA 4R1JA 2IY5B 1HZCA 1TXYA 4KHZA 3S2DH 1VQ7A 1CSQA 3K81C 4DUYQ 3CXCA 4NXML 1JE5A 1A8VA 1OXTA 3H15A 2JEBI 2IX0A 1E1TA 3I4MG 1SLJA 1VQEA 5M5XH 2MO1A 1Q1EA 4DV2L 4OXPA 1XMOL 4P74A 5C4JH 4IPHA 3KDFA 1QUQB 4LUVA 3H0GH 3S14H 1IBKL 2MFIA 3RLFA 5LMUQ 4MNOA 4OONA 2NZOA 1D7QA 3I7FA 4LF7L 4HJAA 2UUAQ 2GN5A 3CCEA 3HKZG 1IBLQ 3G4SA 2R7DA 3I2ZA 4LF5Q 3PUZA 4IFDG 5GADC 4DPGA 1CKMA 4A3DH 4DV4Q 4GS3A 1VQJA 2R93G 3J81c 1YZ6A 3ZJYC 4BY1H 2V1CC 4A76A 1KAWA 3KDFB 3CD6A 1QUQA 4X65Q 4B3ML 2UXDL 3PGZA 4GN3B 1YHQA 4LF9L 4UP9A 4LF8Q 4A3FG 4JI7Q 1OXXK 5H1SE 3CCRA 1HNZQ 2WFWA 1HR0W 4ME3A 2YU9H 3I4NH 2YTXA 1IYJB 4IPCA 4POFA 3CCVA 1MJEA 1PYSB 3AYHB 5M3FG 1Q1BA 1N32Q 1M90C 3S17H 1X55A 5GQOA 1HZAA 3A0JA 3CCJA 5FLMG 1HNWL 3RZDH 1I94Q 4LFAL 2CQOA 3M4OH 4DV5L 4TVAB 1E7ZA 1KD1C 3S16H 5GROA 5HY6A 2NN6G 2VS1A 4JI1Q 3UDIA 4LF7Q 2K4KA 2C35B 1VQBA 4X64Q 1N34Q 1PVOA 3BZCA 4JC0A 4HJ9A 1E24A 1X56A 3M9BA 1IBML 2R93H 2CFMA 1C7YA 3OTOQ 2R92H 3I4NG 4DV1Q 3KJPA 4APVA 5IYDG 1ASYA 4BBSH 3PUXA 1P8LA 3G71A 3F1ZA 2VQFQ 2RCNA 1AE2A 3J81i 2ZJRA 1J5EL 2UXCL 5M3MH 2ID0A 3J7A5 3PO2G 5LMNQ 2VQEL 2AHOB 4A3EG 2OQ0A 3U50C 5K36G 1PH2A 3GTOH 3OTOL 1MIUA 1Y1WG 3SGIA 1E22A 4PZ8A 4IFDJ 2JEAI 4C3HH 1VQPA 1S72A 2KBNA 3HFZB 4JI1L 1R9TH 1XNRL 3STBC 4O0AA 4KHPL 1VS0A 5LMNL 4L5SA 4HIKA 1KXLA 3S15H 3FP9A 4LFAQ 4GN5A 2F52A 3T1YL 3RN5A 4YWLA 3HOYH 3E0EA 1XPOA 5C44H 2JA5G 5IY0A 1LYLA 5EAYA 4FDBA 5IYCH 3M85A 1VQHA 2R6GA 3ULLA 5C3EH 4GKKQ 1KRTA 2XTIA 1YJ9A 2IHEA 2EQSA 4GKKL 1KC8C 4A3DG 3CCSA 5IP7H 3GTMH 3E9HA 1K8GA 4B3RL 4LFBL 2VY3A 1BKBA 2F4VQ 2RF4A 1NY4A 5IWAQ 1NJIC 1XPUA 4IPGA 1C9OA 2NVTH 2E2IH 3RR5A 1EQRA 2XGTA 4RMFA 4DV0L 2Q2TA 1AE3A 1VQ9A 2A8VA 4DR2Q 2WP8J 4XIGS 2Z0SA 1Q81C 3PO3H 2HIVA 4DR2L 3KYHC 3T1YQ 4A3BG 3JAMc 2UU9Q 1FJGL 1SROA 2OWOA 1Y1VG 1FL0A 3B6YA 4P72A 5IWAL 4AYBE 3GTLH 3KFUA 4IOCA 1XNRQ 4YWKA 1I3QH 2OTJA 3CPWA 3AQQA 4XTCS 1HNWQ 4DR7L 3OYYA 4IFDI 1FVIA 1HZBA 1JMCA 3EN2A 1FJGQ 4LNQA 2JA9A 3TRZA 1NBWA 1YITA 1A63A 2CWPA 3PF5A 2N3SA 1PHJA 1N36Q 1EIYB 1OXVA 3NBHB 4C3JH 3KJOA 1I94L 4JI0L 2JA8G 2PI2E 3GTQH 3F2DA 1KHIA 1WI5A 3RNUA 4A93H 4JV5Q 3CCMA 2WAQE 2I5HA 2Q2UA 1Y1VH 1FGUA 1KQSA 4BBRH 1XMQQ 1EYGA 1N33L 1EIFA 4DR5L 1D8LA 4YWMA 4YY3L 4UP7A 4DV6Q 1K83H 3I4MH 4P71A 3CF5A 2ZM6Q 4YY3Q 3K8AA 1HZ9A 3FKIG 3S24A 2LSSA 1EOVA 2YYZA 2I0QA 1LUZA 1YBYA 5FJ8G 1W3SA 4DV4L 2HT1A 2RHQB 2BA1A 1EUJA 4DV0Q 1VQFA 3JAMi 3M7NA 2D0PA 4JI4L 2ZTDA 1Y14B 1TWCH 2VL6A 3PUWA 4A3EH 1PH3A 2UUAL 1YNXA 1I6HH 1VQDA 4YCUA 2VW9A 4DR1L 4KHPQ 3HOWG 3RZOH 4L5TA 4B3TQ 4GLXA 1NMGA 4OX9Q 3D0FA 1PH4A 1L1OC 4KI0A 5IYBH 4DR3L 3CC2A 3CCQA 1T9HA 4DV7Q 3EIVA 1B70B 3G48A 3U4VA 4P73A 4LFCL 1QVGA 1CUKA 4KLKA 5BR8L 1U5KA 4X6AH 3K7AH 1NE3A 4BY7G 4NB3A 4X62Q 2CKZB 2DGYA 3BZKA 2WB1E 4R4CA 4UPAA 2E5LQ 1TWGH 3HOVG 4DV1L 3PUVA 2HIXA 2UUCQ 2AKWB 2LXKA 3EBEA 3HOUH 1I50H 1IBMQ 4OWXB 2EXDA 2PQAB 1OTCA 2H5XA 2NN6I 1KL9A 3HOXG 1YI2A 5LMNW 4B3TL 3FHWA 5IYBG 1DGSA 2N8NA 4X66L 2A19A 4PG3A 3WWVA 2R7ZG 1X54A 4BBSG 3HOZG 4QL5A 4JBKA 4MZ9A 1TWHH 2YV5A 3CC7A 1GM5A 2F4VL 4BY7H 2JJQA 4DKAC 2K14A 4IPDA 1YHAA 3I56A 1UE1A 4DR7Q 4LF6Q 2PNHA 2QA4A 4HJ5A 3BU2A 4JI8Q 4LF8L 2UUCL 4POGA 2JA6G 3A74A 3NELA 2UUBQ 2PI2A 4R4IA 3J80c 5GAEC 3CCLA 3CP0A 2NZHA 3K7UC 3RLNA 3UE0A 3M3YH 4A93G 3I55A 4UY8C 2VZAA 2OQKA 4QIWE 4A3JH 1K73C 5BR8Q 3U58A 1HNXL 2E5LL 5C0XG 1VCIA 1XNQL 1K3RA 3PF4A 4AYBG
chains in the Genus database with same CATH superfamily
2JA5H 4BA2I 2F0TA 1PH1A 2CCZA 2ALZA 5K5PA 1Q46A 3PIP3 1K9MC 3CQZB 4EBEA 3GV3A 1K83A 3T5JA 4YHHQ 1L1OB 1ZQ7A 4IWYA 1TWAA 5LHY1 2F0IA 2HVQA 3MWYW 2EE1A 2PQAA 4RG1A 5CORA 2UU9L 3FMAA 3VMMA 2KENA 1QG7A 3L3OC 5JJKA 3UFXB 1LT4D 1H9SB 4CDEC 2VNUD 2KCMA 2RKSA 2KECA 4C3IH 1VQKA 2ASBA 4DL2A 1EWCA 3S9WA 2F0UA 4FF2A 1HNXQ 5KFOA 5D65A 2JE6I 5L1IA 1E3PA 2BE5D 5A2QE 4DUYH 2PW7A 2OLSA 4UCRA 3M4QA 1YNNC 4MV8A 5IGGA 4GNXA 1JXLA 4LF7H 3Q2OA 2W9CB 2SNSA 5DNFA 5KFSA 2AWNA 2DLNA 3RV3A 2I07B 4CHTB 4O3OA 4RNOA 4X3TA 1ML0D 1Z2NX 3SDZA 1UE5A 1EL0A 4EYHB 2K04A 1F9RA 1LO5D 4GOPB 1GJXA 3W5OA 4EX5A 4NKLA 3ULJA 4R8IA 4A3DB 2HVSA 2BDOA 3VR3A 4ZI7F 2OH2A 1GD7A 3HS0C 3AMUA 1V9PA 5KT4A 3MXUA 4AYBB 3PW7A 1HRJA 4A3IG 5C5JA 1N34L 1E4FT 5EWGA 4OX9H 2EYFA 3OMGA 1GHKA 4LFAH 1NMFA 3GIMA 2DN8A 1KJQA 2B3GA 4YHHH 3T51B 1HH2P 3K80C 1KDAA 2JA6H 1B33N 1Q86C 5IYZF 3J7ZC 3R5FA 1LTBD 2UXBL 1SMXA 5JEAJ 3BS1A 1V1PB 3AFQA 4JBMA 3U9TA 1ZHSA 3OUUA 3SHLA 1IBLH 5C4XG 3KF8B 4QUFA 3F2CA 2YTYA 3M4PA 2QEJC 1GOZA 1CSPA 3F2BA 2DZDA 5FLXL 3MWEA 1HQMC 4ECUA 4L63B 1HJPA 3ND8A 3E5NA 4F50A 1XXGA 1SSOA 3TSSA 1PH8A 3VA7A 4QJFA 1JDBB 4GKJH 4RGOS 1N36L 1HR0H 1K1SA 2VQFH 1R4QB 5IYDH 3MVVA 1ASZA 3HP3A 1B7YB 3TS2A 5J3BA 3MHBA 1VQIA 2KCTA 1IZ6A 1VQCA 4DK3C 2DUDA 2PZUA 4WRDA 4RZQA 5JUMA 4DR1H 3ITPA 3KF6B 1U4RA 2Z6KC 3HOUB 1ENAA 4BBRG 4JI5L 1YVCA 3D6CA 4JOIC 4LF4H 4X66Q 3K58A 1QILA 2F0QA 3Q1KA 4DV7L 4A3GH 5KKNB 1TS2A 4UAIA 1HNZL 2IMWP 3UDXA 2PYKA 1AW7A 1F9SA 5ELNA 1TWCA 5KFJA 4X62H 2YTVA 3OMCA 2B2UA 1UEBA 2ASJA 4L5RC 3L4KA 1SDFA 3UE1A 1C30A 5G3LF 4KKSA 1TY2A 2E74C 5FJ8H 1JOOA 4Y7NH 4J9RA 1YIJA 1B6RA 1BBUA 4LJZC 2W9BB 2Q8IB 5IP7G 4B3SL 4A3IH 4O3SA 2R7FA 3PMFA 5KG1A 3W2DA 2XC9A 2BDNA 1PLFA 2XD4A 1MJCA 1PA6A 1U9RA 3ORQA 2LXJA 4U673 4B3RQ 3N6RA 2R8JA 2PZWA 3PO3G 3S15B 2RVLA 4BS9A 1VQ6A 3PO2H 4IJHA 4FVMA 4GKJQ 1RTOA 5COYA 3X3MA 1LTSD 1DJRD 5EPKA 3VR2A 3RB6A 1WTRA 1Z2PX 2W6PA 5DQGA 3MAQA 3IRBA 2BH2A 4EQ5A 5CYUA 1EY4A 5JVG3 2K75A 1EY5A 3DM3A 4XYQA 3GTQB 2EYHA 5BR8H 5JOBA 4A93B 2SNMA 2IW3A 1I50B 1ILQA 1CA6A 5F2DA 2CQAA 4J0MA 4Q45A 2W9CA 4OGQC 3KHHA 4LWCA 4C3IB 2VUGA 5DGBA 2BH8A 4ZKCB 4WFN3 3UDFA 3GILA 1S0OA 1BR9A 5KG2A 1STGA 2E2JB 2MQHA 3BG3A 5I4DA 3BA9A 4FBUA 5KFCA 1EY6A 2B2YC 2UVWA 1KJ9A 5DG7A 2W9BA 1VQGA 5KFLA 1LV9A 1SYFA 4HCSA 4IUUA 2N49A 2VA2A 2XCAA 4FYDA 3GO5A 1FKAH 4JI3H 5EBDA 1KIXA 3TEHB 5EGTA 1ONLA 2W8KA 1X3QA 4TQUS 3OW7A 1WYDA 2OEOA 2JA5B 3Q22A 1EWIA 1LM0A 1Y1VB 1I4PA 1IHZA 5L37A 4GC7A 1WFQA 5KFVA 2WAQG 1HR0Q 3GTKH 2C28A 2ZDGA 1TWGB 2B8GA 3K5IA 2TSSA 3PCOB 2KHIA 3PO2B 3K5HA 3D4RA 2M05A 2W71A 5KT5A 5AJ3Q 2IJ0A 2KA7A 3TMEA 2PVPA 4G57A 4R8NA 1S5DD 4IJLA 4DNIA 4DR4H 2F0GA 4F88A 4A3MB 1IL2A 1O7LA 3RN2A 2PCFB 2NYZD 3OIPA 4BBRB 4KHZA 4XYLB 4N9TA 4FXKC 3RD4A 4RWSC 5T1GA 4NXML 3GIJA 4M1UB 1A8VA 1J5EH 3JSLA 2IX0A 1E1TA 1GUOA 2CH4A 2R7ZB 2MO1A 5T14A 4HMIA 4FO2A 2QCPX 5E1FA 1AZPA 4P74A 4LUVA 3H0GH 3S14H 5A35A 2ICIA 5A2QL 2VR1A 2UUBH 1E2WA 2UVUA 2I8CA 3F8NA 4HJAA 3CCEA 2K03A 2CH4W 5KYLA 1IBLQ 3V05A 4N9PA 4CC6A 4B08A 3QZ7A 4ECVA 3NBIA 2EYOA 1PRTD 3R5XA 2NB0A 2V1CC 4A76A 3JAMW 1KAWA 1S5ED 4QMGA 3CD6A 4B3ML 4RHSA 4J9MA 4B9XA 3BZDB 2FLNA 1EYDA 3QR8A 3K7AB 2R87A 1TWGA 4A3FG 4JI7Q 2F0MA 3J7AF 3I4NH 2LS01 4YQWA 2FINB 1M8AA 1MJEA 1CHPD 1TA8A 4IALA 4FM9A 1PTOB 2EPBA 3CCJA 2J6SA 3A55A 1HNWL 2XIGA 3PW4A 4DL6A 3H20A 3GTGB 3TIIA 2AGOA 4DV5L 3Q8PB 3LP8A 1II3A 3BVMA 1FJGH 4TVAB 1E7ZA 1KD1C 3VPCA 1KLGD 1ZETA 5HY6A 2NN6G 4JI1Q 4C3IG 1D2BA 2K4KA 3MXPA 1TWHB 1SJED 4X64Q 1N34Q 1PVOA 2FKLA 5CA0F 4HJ9A 1E24A 3KTMA 3OTOQ 3Q8RB 2J0TD 1ASYA 1PRTF 3PUXA 1JX4A 2F0WA 2RCNA 4P2CB 3J81i 2UXCL 1WH2A 3CHBD 4LFCH 3FEWX 2MP1A 3J7A5 5JPMC 2CW8A 4ECZA 5FO7B 5K36G 3GTOH 3OTOL 4KJNA 3SGIA 3EPGA 4XXEA 5H80A 1XNRL 4O0AA 1MI2A 4L5SA 3SE0A 1EHIA 2V58A 1PZKD 4KTAA 3RB3A 1ZEQX 3RN5A 4V190 1EIHA 4KD4A 1XPOA 2PPBC 2FLPA 2MPMA 5IY0A 2DWCA 1LYLA 5EAYA 3M85A 1WTHA 2K5DA 5C3EH 3LNNA 4DA2A 4A3EB 1YJ9A 3S1MB 1STNA 5D1PA 2EQSA 1KC8C 5IODA 3WO1A 1SE2A 4A3DG 3P75A 1TAEA 1K8GA 4B3RL 4Q0FA 3T4AC 2AUKA 1JOQA 2DJFC 3QZ8A 4ZUJA 4IPGA 3HOXB 5FPOA 2E2IH 4KY6A 1NR4A 4X65H 2Q2TA 3RAQA 2EYMA 1AE3A 4J9SA 2HD3A 1J9OA 4XIGS 4G7OC 2DNEA 5LL6X 1N34H 3KYHC 4ABNA 1Q90A 1QWYA 3T1YQ 3S1RB 4HNTA 2EZVA 4RGMA 3GTLH 4ECRA 4AYBE 1XNRQ 2E2IA 4HNVA 2OTJA 1AZQA 3KK7A 3L4JA 3CPWA 5M3FB 1U4LA 1FVIA 2EYPA 3CKIB 4C56C 2EVBA 3TRZA 1YITA 1ZYRD 2CWPA 3TP5A 3R3OA 1PHJA 2JA8G 1OXVA 4C3JH 3GTQH 2PI2E 2W7PA 3P1HA 1KHIA 3UI2A 3RNUA 4A93H 2WAQE 3LX0A 4EEYA 3TINA 4BBRH 4IQZA 1XMQQ 3S2DB 3ND9A 3GIPA 3WNZA 4YWMA 4J9OA 3DM1A 1BXRA 4I50F 5FD5A 3NQTA 3Q23A 2ZM6Q 1RODA 3K8AA 2MUYA 1CA5A 4LF8H 5E3FA 1HZ9A 3FKIG 4XQQA 2LSSA 2W6NA 3N44B 5I47A 2HT1A 5D3IB 1RD9D 2JN4A 3F2UA 2Z4IA 3NBHA 1DD2A 3RTXA 3DEOA 2D0PA 4A3EH 1WD1A 2UUAL 1YNXA 1EY8A 1I6HH 5BPFA 2RDJA 4ZQIA 4DR1L 2X6GA 5IGEA 4KHPQ 3GTMB 3RZOH 2E2HB 1V51A 2NU8B 3PW0A 1YNJC 1NMGA 2NVXB 2C2EA 4OX9Q 4BWSC 2BE5C 1Q3LA 4KI0A 2DY8A 1TWAB 5ISRA 1T9HA 4K0KH 1B70B 4Q43A 4C5CA 3NTKA 1CUKA 4EBCA 4KLKA 4ED6A 4X6AH 2L55A 1DZ1A 1TS3A 1NE3A 1AUXA 4NB3A 3E6ZX 4O3PA 1QB5D 1XWEA 4UPAA 3HOVG 3EJIA 2HIXA 3PUVA 4NLGA 2AKWB 3EBEA 4OWXB 4O3NA 2MCTA 4RB1A 2B2TA 2H5XA 2NN6I 2XCLA 1KNAA 2A6EC 3KUPA 1LTAD 1S5BD 5D1OB 1VDZA 2HDMA 1X54A 5EKIA 4QIWA 5FLXW 1GHJA 4LF9H 2L0CA 2JYOA 1HTLD 4MZ9A 2YU9B 3EYYA 1F9PA 4YIJA 2F4VL 2QDBA 4BY7H 3RUPA 3N43B 4XYOA 1CQFA 4Q5VA 4KHVA 4DKAC 3MFHA 3T5LA 1UE1A 1RCVD 4DR7Q 1K83B 1C3OA 2PNHA 2QYZA 3V6JA 3NK9A 2RDFA 4LSXA 2EYLA 1VKZA 3A74A 2PI2A 4ECXA 5EOYA 3R2TA 2G9HD 5GAEC 2CVRA 3CCLA 4O4IF 4QWDA 4A93G 5J22A 2NVYB 1AN8A 3BA8A 4HR7A 3H09A 3GTOB 4G7ZC 1HNXL 1H9SA 4J9PA 3PF4A 2NUCA 2K6AA 1NTGA 4AYBG 3HRZC 2A6HD 3KOJA 4XQNA 2EJMA 2V4DA 2ZTCA 5FO9B 2VUMG 3RZOB 4K6DA 2AQ1B 4E4TA 4DL4A 1DOMA 5C3EG 4K0KQ 4LFCQ 3WO0A 1ULZA 4JYAL 4LMQD 2PW5A 3RGZA 5C6AA 1WCMH 1VQ5A 4GNXB 3V4SA 5J2UF 3J80L 1G2TA 4RUAA 1WSCA 3K5MA 5I9PA 2GVAA 2JQOA 4JCVE 4HMJA 5CV6A 4O2DA 2IBKA 3ERQA 1PDQA 4GOPA 4K14A 2R6FA 5JVDF 2UXCQ 1XNQQ 1KAAA 1YHBA 4EEQA 1A3VA 3F8TA 1IKLA 1HHVA 1F9QA 1EIGA 1S4ZA 4A3JG 3GP7A 4LF9Q 4DV3L 4GN4B 1NUCA 4EQOA 4A3KH 4JI8L 4O3QA 1TT2A 4H02A 4NPSA 3O13A 2JK8A 3Q8DA 3Q8QB 2NVYA 2UXBQ 4UCUA 4IUVA 5HGTA 1ESFA 4OO1H 4R9WA 1EQQA 3NENA 5KFEA 4ODGA 4BY1B 5KFQA 4A3LH 1RF2D 1RIPA 2PZTA 1Q82C 2NVYH 2DPJA 4ECTA 2Q2IA 1PX2A 2WKCA 1GSOA 4DR5Q 4AIMA 4I7ZC 4WORA 3KHGA 3TN2A 2AMCB 4PMWA 1JB7A 1K0RA 4A3FH 1MGSA 2QK4A 1X6OA 1GO3E 3NXWA 2R84A 4QWEA 1PTOC 1LT3D 1S3OA 2Y0SE 5KFIA 1L1OA 1EFWA 1NSNS 2E2HA 1QVFA 2KVMA 3J7AV 1AN7A 3JRXA 3G6JB 3HBLA 2R7MA 4RCOA 1JE4A 3MR6A 4FS1A 3RF2A 2R85A 2R93B 3KLSA 1I6HB 4YCWA 5KFYA 1JR0D 2B2TC 5KT2A 1S40A 4B3MH 2R86A 4GNXC 3BYYB 1B6SA 2E2HH 4DAVA 1W2BA 3AB9A 3MEFA 1SE8A 4CDCC 4A3GG 2FPIB 4EFBA 1TWAH 3HOVH 4JBJA 4R4TA 2QDLA 3UDGA 3KAJA 4ECQA 4L5QA 5DM63 1G91A 1GUWA 1JJCB 4IRDA 4UCSA 3HKZB 1IKMA 4A3CG 1XMQL 4DR6H 1ENFA 3SVMA 2K32A 5C5LA 3I12A 1Q12A 2Q2HA 3MFIA 4DV5H 2Z9HA 1Y1WH 1CT1D 3RAXA 1PV4A 1Y8PB 1BBXC 4DK6C 1EOTA 4C3JB 3I4OA 2CZGA 3N8DA 1I4QA 4LF5L 2R7LA 2EY2A 3MR2A 1SNQA 3S2HH 3GDEA 1M6VA 2VB3X 1GUGA 4NMZA 4JI0H 1N8RC 5M5WH 4TSSA 5FLMH 2XRSD 5JEAG 1I7LA 1F2YA 5CV9A 1NAPA 2Z6BA 1RL2A 4HJ7A 1DIKA 3KLWA 2NBFA 2ZJQA 4DL5A 1CQJB 4OIJA 5IWAH 4DUYL 2FPPB 2VUMH 1QZGA 3NPPA 3RB4A 1IW7D 1X32A 4B9WA 5JJZA 1UE6A 1KLUD 1LT6D 4YR3A 1BBWA 2BA0A 4LSAA 2KCCA 3OIQA 4LUOA 1YEZA 2MNAA 1F2ZA 2I5MX 3MTSA 4JI2L 1PYBA 1I4GA 3JSNA 1I5FA 4MAMA 5K36H 4IUNA 1O80A 1HTPA 4DUZQ 4QWAA 1PZID 3Q8SB 1G291 2RA4A 3HGBA 3I3CA 3DLLA 2HHHL 5I6YA 4HJ8A 2K28A 2Z6KA 2XRQD 3K5NA 2DIKA 2YRWA 4I7AA 1KABA 3ULPA 1ET6A 1PMRA 4P75A 1VQOA 3FKIH 4YHHL 3T5KA 1UWVA 3M7GA 2FMMA 3TP7A 4BXXG 1A62A 1Y1VA 1A0IA 1E2VA 1GLVA 1TS5A 1X9NA 3U4ZA 3WOFA 1IBLL 1GSHA 3A8KE 4J9KA 3OWEB 1VMCA 3J80E 2WYOA 2ASDA 1KC7A 5IP9H 4RB0A 4ZAIA 5LMUL 2HVRA 5C4XB 2XVSA 4GOPC 3OW2A 1E0BA 1E1OA 4DN4M 2QGQA 2VQEQ 3HG9A 3OHXC 4NXMQ 4B3MQ 5E7NA 1BF4A 2EIFA 3BDCA 1T5EA 4JI4Q 1B3QA 2V4RA 2K5NA 1HR0L 2K1BA 5KFGA 4O2AF 5JEAH 1YJWA 4A3BH 4IOAA 1WCMA 3C0FB 3QO2A 4G4KA 2HQLA 1O7IA 4OWTB 3A5ZB 4RNNA 5DLQE 4AH6A 2D5DA 2L15A 3FDSA 2K5QA 4DV3Q 1WOCA 4DNTB 4A3MG 2Y0SB 3QB3A 1IBMH 3RV4A 2IY5B 3QWNA 3D4DA 1VQ7A 4BBSB 1OXTA 3H15A 2JEBI 3BVGA 5FKAC 2A68D 5LOVF 1VQEA 5M5XH 4DU9A 3D6WA 5M3MB 2EJFC 5LL6b 4IPHA 1IBKL 3SK4A 3J81E 2NTSA 3RLFA 4FF4A 4MNOA 2NUAB 1SNMA 1RKNA 2HGSA 2L12A 5NUCA 3OUZA 3CRLC 3I70A 2R7DA 3I2ZA 3K5LA 4LF5Q 3J7AK 2FJZA 3H4BA 1SBBB 5GADC 1CKMA 1I7NA 4GS3A 1PRTC 1VQJA 5EKKA 5I6WA 3J81c 3ZJYC 4BY1H 2L9HA 4JVZA 3DUZA 1KDCA 4CGYB 2NN6H 1UC9A 4LF9L 2RGVA 1EEID 1AEXA 1S5FD 4LF8Q 2ZM6H 3T1HH 1HNZQ 1HR0W 4LFBH 1FYCA 1EEFD 2YU9H 5FPRA 4YY3H 3CCVA 3J7YW 1FNUA 2OF1A 1Q1BA 5BN5A 4CJ0B 5KFXA 3SXHA 3S17H 1X55A 4YAJB 1EU4A 1S68A 2R92A 4QCLA 2R7KA 1XX8A 3IL8A 4QF4A 3RZDH 1I94Q 2LY7A 5T1IA 2JP1A 2RSOA 3SK5A 1V4YA 1VMPA 2VS1A 3A7AB 3UDIA 2M00A 3A8IE 1BCPB 1SCUB 1HNXH 4MHEA 1W93A 2DPIA 2H1EA 3BZCA 4IWXA 2CFMA 2R92H 2FMCA 3Q0AA 5CV8A 3I4NG 4DV1Q 3KJPA 4APVA 5IYDG 1P8LA 1M7JA 1Q8IA 4JYAH 1DXMA 4NW2A 1WD0A 1S10A 4KD3A 1STBA 4Y7NB 1EZ8A 4ZOLF 2OQ0A 2V9WA 2GPWA 5BN3A 1ICFB 4M7EA 2ZXRA 3TQ1A 2GA4B 3S1QB 2F0LA 1S72A 2O03A 2AQ2B 3HFZB 3H40A 5M9OA 4GC6A 4KHPL 1WR2A 2W6ZA 1K28A 3I4MB 4B3TH 3V4ZA 1JCKB 1W96A 3T1YL 1OWTA 3KXYT 1JWUD 2JA5G 4TQRA 3H3VC 3FDTA 5JPNC 4IR1A 1VQHA 2R6GA 2DJGC 2Z8LA 4K5XA 3MR3A 1EQVA 3GTPA 4CDDC 4DLKA 1B53A 2XTIA 2IHEA 4GKKL 3R2IA 2KOLA 2BCOA 5KFAA 4KK7A 4YAKB 2NVXA 3M9NB 2RF4A 5CGKA 1N36H 2NVTH 5C3WA 2HCCA 2LMCB 2SEBD 3RR5A 2XGTA 3GTJA 2A8VA 3PW5A 1VQ9A 1PFNA 3GTGA 2H4OA 2WP8J 1BQQT 3PO3H 3BAAA 5LA6F 5DG8A 2C2DA 3T13A 2UU9Q 2YZGA 2F0KA 1SROA 4IZ8A 4YB8B 2A73B 5KT7A 4DV1H 4P72A 2VA3A 4IOCA 3J80W 3JZIA 1I3QH 2FK3A 3KBXA 2Y0SA 4Q0YA 4DR7L 3OYYA 1JMCA 3C2PA 1VAJA 4O4HF 4LNQA 2JA9A 2B2WC 3GIKA 2UUAQ 3KJOA 3NBHB 2VQEH 4FXDA 1ESRA 1RJQA 3PN1A 4RB2C 5FLXE 2WIIB 2F0VA 3CCMA 3R23A 2FFKB 2Q2UA 1FGUA 4ED3A 4DGZA 4JI6H 4UP7A 3T53B 2GLTA 4FS2A 3CF5A 2K5WA 4YY3Q 2BQUA 3FKIB 5LMNH 3S24A 1HCZA 5J39A 1CQIB 1EOVA 2C2RA 4LF6H 1W3SA 3MFGA 1QOHA 2BA1A 4NP5A 1D5XC 1EUJA 4DV0Q 1JDEA 1HNWH 1VQFA 2D9UA 3GTOA 1EFID 2Q8TA 3U9SA 4JI4L 4MA5A 1Y14B 4XZ3B 1TWCH 1PZJD 5ELEA 5KGUA 2OT2A 1PH3A 5EZYF 1VQDA 1M0WA 5K2MA 3OOCA 3LWBA 3HOWG 3GV5B 2RDHA 4IFDH 3D0FA 1PH4A 5CV5A 2IA6A 4Q44A 5D8DA 3CC2A 4XX0B 4J6HA 2V5AA 4P73A 4LFCL 3T56B 3PO3B 3PZPA 5BR8L 1U5KA 1SMYC 2NTTA 4KJOA 2WDTA 4BY7G 1W6JA 2CKZB 2DGYA 3LWEA 2WB1E 2FB9A 1H9JA 2E5LQ 5BN4A 2LXKA 5JAVA 3HOUH 4LAAA 4L6TB 2PQAB 4APMA 5KRUA 1CHQD 2A6ED 3HOXG 1YI2A 5KFWA 1O7ZA 5IYBG 1DGSA 4QWCA 1V8QA 1KJ8A 4PG3A 4BBSG 1EYCA 1TIID 4HR7B 2G9DA 4JBKA 2HCIA 1BNCA 2YV5A 3GTLA 3CC7A 3KHLA 2JA7A 5JVLA 4JI2H 1Y1WA 2K14A 3I90A 4IPDA 1YHAA 3I56A 4Z9CB 1K8MA 3TZDA 4CKBA 4LF6Q 2HJWA 3LMLA 4UFZA 2UUBQ 1XMOH 2NZHA 3CP0A 3K7UC 3RLNA 4IN3A 5D1OA 4DV4H 4RCNA 3I55A 4UY8C 5IGFA 4C5AA 2OQKA 4QIWE 1XNQL 2E5LL 5C0XG 1VCIA 2BOSA 1K3RA 5C44G 1JORA 3C46A 1UE7A 4RGNA 4U68A 4AQYL 2YRXA 4KN4C 4DR3Q 3GTMA 1G2SA 4DXFA 2XIWA 4AYBA 4UHVA 1RJPA 4WJ3M 1IBKQ 3HOYG 3W1BA 1WVLA 3TIGA 1CM9A 1RHPA 4OO1G 3ICEA 3BQ1A 1CZGA 1XJVA 3TP6A 3CMEA 2AGPA 4PZ7A 3A5UA 5M5YB 1SNDA 4J15A 4A75A 1H95A 4A3LG 3M9MB 2O2LD 2R93A 2RGRA 2D0OA 5FD6A 4FP5D 4ZHQF 1DV2A 5KFDA 4GKJL 2W6QA 2B2WA 4IAJA 2A69C 3PW2A 2ATLA 1B1ZA 2RDGA 2UUBL 5ELFA 4JV0A 5DQHA 3MXGA 5C4HA 1T5XD 2XCPA 4Q8EA 1Z47A 3E9IA 5J1ZA 3FPUB 2B29A 3JC66 5KNBA 2PNRC 2C00A 3FVQA 5CBEE 5GAHC 5E4WC 5F9LA 4HTHA 4C3HG 1WCMG 4IHJF 5DM73 1JJ2A 1SN8A 2K5HA 4XQJA 4LF4L 3GIIA 3HOXH 1B2TA 4QY7A 4BY1G 2W7OA 3CRKC 4KKUA 3I4LA 1IXRA 2K33A 3GTKA 4K5WA 1A6XA 4YJ2F 1O78A 4IRKA 3D31A 3KF6A 4ZRZA 3HEJA 4EBDA 2MO0A 1N56A 5HURA 1H9RA 1IL8A 1TS4A 4TRDA 3VR5A 2BR0A 1OO9B 4BWGB 4JI7H 2FXQA 4K6LA 2D2CC 2N55A 4A3KG 3GTPH 4A3CH 1HA6A 3RGXA 3VDYA 4B3SH 2ALYB 3OSOA 3PUYA 3CPFA 4A3MH 4DUZL 1M1KC 1E4GT 3EA6A 2B2YA 4ZLTF 4LK1C 3HOWH 4Y8VB 1SYBA 4OO1I 1SAPA 3FPPA 1MBYA 4LUZA 3HKZA 4DR1Q 4IUPA 2ASLA 4LF4Q 3ETJA 3IN5A 4KV6A 3AU7A 3OTOH 1B3AA 3T1HL 2OCEA 1VQ8A 1JIHA 5HGQA 1JT8A 1I6VC 2IP4A 1S0MA 4HSPA 4J1MA 4DV0H 1QNUA 1IOWA 1CKNB 4CJ2C 1XNRH 4QQBX 4EFEA 2KQ3A 1DOLA 4HIOA 3A8JE 1LTID 4PMBA 1RYRA 3LWUA 4ETSA 3C1FA 4DAPA 4MV4A 1SRUA 4YCVA 3AFPA 3S1NH 4TUYF 2OTLA 1KRSA 2JEIA 3MWDA 4C5BA 3S16B 2ZJPA 1RJTA 4FXGC 2XWBB 3GIDA 1X3EA 5C1OA 2R8IA 4DR3H 4JI3Q 4ZK9B 5DAUA 3I4NB 5IYCG 4B3RH 1F2LA 2F0OA 2Z1CA 1AUVA 3H91A 5C3EB 1KEEA 4H7BA 3QG1A 2LFNA 2CWAA 2F3VA 4X65L 4GZYC 2FE3A 2VPSA 3Q6SA 2SCUB 4JG2A 4OX9L 1STYA 4ECWA 2KHJA 4JI3L 2B2VA 2F0PA 5CR3A 1LTRD 4AQYQ 5E4XA 1SFOH 1J8IA 1GKHA 1TU2B 2J9GA 2D62A 4DR4Q 1IW7C 3G6EA 4X66H 4KHPH 1H9MA 5IT9L 3M3YB 1X3PA 1LABA 4TQSA 2AWOA 4RB3C 2ZJTA 3MXNA 4LFBQ 3T1YH 1KDBA 4JI2Q 5M3MG 2IPKD 4DV6L 3MC0B 3D8GA 1JJGA 4DR4L 4JBWA 2JA5A 4C3HB 1C8CA 4JI5Q 5EDWA 1BO0A 4JV1A 2UUCH 5KFZA 1L2FA 2E8GA 2EY1A 4CJ1B 1ZKOA 1X3FA 1G6PA 1D1IA 2F03A 2VQFL 1CKOA 1EY7A 4E6IA 3DWQA 1G6ZA 5EJWA 1LTGD 2R7ZH 2IX3A 5C0XJ 3HOZH 1ZXTA 3RBDA 1NR2A 1M0TA 3H3VH 2F3IA 1J6QA 1E4EA 2VOBA 1N9WA 5CC4A 4ED1A 1SR3A 2HQEA 3PIOA 1SYGA 4JYAQ 2PN1A 4RNMA 3E5SA 3S1MH 4A3GB 1VF5C 4ILWA 1FNVA 1TKWB 1WJJA 2KCNA 4B3SQ 4N8FA 2J6TA 1T3NA 2ATWA 4HNUA 3K3PA 4G3IA 2L4NA 1LTLA 4H44C 4DR7H 4R4OA 1I4HA 5JVH3 1D1KA 1PYWD 2F0EA 2Y0SG 1Q8KA 2Z4HA 2ES2A 5L1LA 4K0KL 4H0LC 1JICA 3ERSX 2B63G 5DLGA 4KY5A 3NHHA 4F4ZA 4A3JB 4JI1H 4O2BF 4JV5L 2XNAC 3TZUA 4DAMA 2JXMB 3L2PA 3I72A 4EQNA 4JI6L 4ED8A 5BMVF 4MTEA 3NWSA 1PFBA 4YR0A 4MIUA 3CQZH 3EFXD 1H9KA 5KYIA 1WTQA 2XGPA 2K52A 4RAUC 4R7RA 3GTQA 1OXSC 1N32H 3GTGH 4F7XA 1B44D 3KF8A 4NXNQ 4I55F 4C2MH 2C22A 3I8ZA 2NZ1D 4R8UB 1L2ZA 1E4EB 4JOIA 3GLKA 2PMZB 5CMDA 4ALPA 4G7HC 1HZCA 2BQRA 2JA6A 1TXYA 2WACA 4NDXA 3S2DH 4TKOB 4DUYQ 1L0XB 3CXCA 2UVVA 2YYAA 2UU9H 2UXCH 5AFWA 1JQYD 5TSSA 3ZYYX 1UC8A 3I4MG 1SLJA 4QW9A 1F2MA 4J9QA 1Q1EA 4DV2L 4ZCKA 3EPIA 5C4JH 1UUPA 1QUQB 1IYUA 2BQ3A 4OL7A 5GONF 2NZOA 3OSPA 1A3TA 4MA0A 4LF7L 2GN5A 1B50A 2QW7A 1F77A 4IFDG 4DPGA 4A3DH 4K8JA 3QFFA 2R8KA 2ICEC 1FNWA 3NGDA 1EWHA 5KFHA 2R93G 1YZ6A 4CKCA 3KDFB 2CW0C 4X65Q 3K57A 2UXDL 3RB0A 4GN3B 3NP8A 2J7ZA 4UP9A 2OXPA 5H1SE 5BPHA 2L11A 2AGQA 2WFWA 4ME6A 4DR5H 2YTXA 1IYJB 4IPCA 1IYVA 1KJJA 4R8UA 5CV7A 3BDOA 1Y69U 1PYSB 3AYHB 1N32Q 5KG3A 4ZUIA 2WAQA 1DV1A 1JB3A 3JRWA 4ECYA 1HZAA 3KAKA 1MSHA 5FLMG 1DYQA 2I46A 3J81L 4LFAL 4I65A 3M4OH 4JI8H 4PV1C 2N88A 5GROA 4EQPA 1XNQH 4LF7Q 1VQBA 2PBZA 1X56A 3M9BA 1C7YA 2IWHA 4OHJA 2WTFA 4DXGA 1I4RA 4M8AA 2VQFQ 1AE2A 5CB4F 2ZJRA 1J5EL 3WDNA 2JSOA 3D3RA 2B2UC 2ID0A 5C4JB 2AHOB 4A3EG 4RKLA 1FGBD 1MIUA 1Y1WG 1E22A 2F0HA 4C3HH 4CBVA 2FLLA 3K0YA 3PVXA 4Q8FA 3N6XA 1KJIA 1VQPA 1QE6A 1HA5A 5KEEA 5KT6A 2KBNA 5EPJA 3IKJA 1WTPA 1R9TH 3VPBA 4O1NA 3S1NB 1MZBA 4X64H 1VS0A 2R8GA 4HIKA 3VYRA 1KXLA 2EYJA 3DF7A 4LFAQ 2I87A 4GN5A 2F52A 4YWLA 3GTJB 3HOYH 1TY0A 3E0EA 5KG6A 1K3BC 1SNOA 4MV9A 2AU0A 4FDBA 3A56A 1HUNA 3HZXA 5D3DA 4HCEA 2FJ2A 3ULLA 4DNRB 3MEHA 2YZMA 4JI5H 1S03G 4GKKQ 4FF3A 2F1MA 1RK5A 3GTMH 3E9HA 4MN3A 1BKBA 2F4VQ 2AUJD 1NY4A 1NJIC 1XPUA 1N48A 4CKEA 5C5MA 1EQRA 4RMFA 2A69D 1CE8A 3M4OB 3KALA 1Q81C 2MGSA 5KFNA 4K2LA 4DR2L 1ZHQA 3QOJA 5KG7A 2R8HA 3JAMc 1FJGL 5L1JA 2DY7A 2KHSA 2F4IA 4K8IA 3GQCA 1IBKH 2JEGA 1Y1VG 3B6YA 3H4DA 2GPSA 2PO4A 3KFUA 3CVZA 1GYFA 3OHAA 1YNJD 3AQQA 2JA6B 1CTMA 3EROA 4IFDI 1HZBA 4DUZH 3EN2A 1FJGQ 5DG9A 1NBWA 1XYIA 1A63A 3G8CA 2N3SA 1EIYB 3K6OA 3DHQA 1I94L 4JI0L 3HOWB 2WV6D 2F0JA 4I7HA 2R7ZA 3F2DA 1LTTD 2FP4B 1G8ZD 1WI5A 1S97A 3MFYA 3BDLA 2I5HA 1SYEA 2P5ZX 3HOZB 1EYGA 4YP3A 1EIFA 2VQDA 4A3BB 4YY3L 2R3ZA 4MV6A 4ZYSA 1K83H 4DV6Q 2YL2A 5EQ0A 4FF1A 4QIWB 4RAYA 2E75C 2YYZA 1BJTA 1LUZA 1YBYA 1Z7TA 5FJ8G 4NXNH 2K05A 2RHQB 3BABA 1CK1A 1WTWA 3V6HA 2XN9C 2ZXPA 2ZTDA 5C8YF 2G5DA 3G6XA 3R8BA 2W6MA 1U4PA 3T5HA 3A54A 1QJOA 4YCUA 1ILPA 4H13C 3N41B 1HFGA 3KLRA 5J2TF 5EWEA 4GLXA 4ED2A 5IYBH 4DR3L 2ZXOA 3CCQA 4DV7Q 3EIVA 2MJ8A 3RMHA 2R61A 3ONAB 2WAQB 4JW0A 2HHHH 1SMYD 1K0SA 1PTOF 3K7AH 1TVXA 3SK6A 1EYZA 1WTXA 5JQWA 3BZKA 2F0NA 2CQYA 1TWGH 2RDIA 4JV2A 3V6KA 1Y1WB 2UXBH 1D6EC 2WB1B 1PTOH 2EXDA 4DV3H 4F4WA 2M9VA 3VPDA 4B3TL 5LYJF 3SEBA 3C1EA 2K01A 4A3IB 4X66L 2IL8A 3WWVA 2R7ZG 3IAYA 3HOZG 5LL6S 1TWHH 1GM5A 4U6PA 4DV6H 4IUQA 1C4QA 1I3QA 4GKKH 3S17B 3L9AX 2TMPA 3H0GB 3S14B 3QIAA 2QA4A 4OEMB 3RZDB 4HJ5A 1SJHD 2CW0D 4JI8Q 3FKIA 2UUCL 4PDBA 4LF8L 1ICWA 3K5OA 3J80c 2E2DC 4C2MA 3UE0A 4RKBA 5KFUA 1HFNA 3U58A 4QUCA 4ULLA 4HQ6A 4WJWA 2JA7B 2GVBA 4A3FB 1R9TB 4YR2A 1TWFA 3R5HA 1PH5A 4C1NI 4JK1C 3GV8B 1SFOA 1V1PA 1B9MA 4MTNA 3EVQA 4R4QA 4C1NK 1QCBD 3VA5A 3K3VA 2E2JH 1GSAA 2RQXA 3L0OA 2I5LX 4X62L 3BYTB 4OWWB 5CBAE 3CMAA 4A2AA 5KG4A 5EKLA 2YZNA 4F4YA 3CAMA 4OELB 4FBTA 1BVSA 3K0XA 4RHRA 3T16A 3DMUA 1GUTA 2KJXA 3GIQA 1J5EQ 1PH7A 2YW2A 5IT9W 4WJ4A 1SNPA 2E2IB 4JV5H 1XTDA 4F87A 5KFMA 5C0XH 2CW7A 2FMAA 5JH7F 3RJ0A 1V43A 4J9LA 4LH6A 5HBRB 5JJLA 3C3LA 1M4VA 3ER0A 3S1RH 3H3VI 3G7LA 4JI0Q 3PR5B 1N32L 4BY7B 3H0GG 3QOLA 3GTLB 1K8AC 3G6VA 2K5VA 2K7VA 2F4VH 5C4XH 3NEMA 2B63H 4HIDA 1BGWA 2ZM6L 1B9NA 3OSNA 2X6LA 4LF5H 3SR1A 1JKJB 5KT3A 1X65A 3H6MA 2X0SA 1TWFB 5IP9G 2EOTA 1Q7YC 1YJNA 2ZDHA 1PFSA 4F8MA 3K59A 2B63A 3P7JA 3TQTA 1DCZA 2IX1A 1VQAA 5FLXc 3T1HQ 2JA7H 1AP0A 3L7ZC 2O4XA 1STEA 1WTVA 4XDXA 2HHHQ 2RHSB 4F4XA 1EU3A 4DAYB 2PMZE 2RBMA 3I73A 4LMYA 3AEVA 1VQMA 4KN7C 1V1OA 5HV6A 5AJ3L 2PQEA 1C0AA 3V96A 1AH9A 4GLAC 1QZHA 1CKNA 2QEXA 1A3UA 2XGQA 4TV8F 1VQ4A 3GV6A 1SXTA 3MXNB 5D14A 2YS6A 3U9OA 4GLVB 1PH9A 3ETHA 4X3SA 3STBD 2UXDH 1T94A 4UP8A 4MV7A 1N33H 1JC7A 1LT5D 3HB9A 5ELOA 1S9FA 3NWTA 3VR4A 1ENCA 1BXTA 3W1GA 1I4XA 1DOKA 1TWCB 4O3RA 4BXXH 1X3GA 1U0LA 1MKHA 1STHA 3CW2C 1VQLA 5JJIA 3HKZE 1KTKA 1A2UA 3H94A 2XWJB 1Z6HA 4IZOA 3MZ5A 5C0XI 1EUDB 5FK9C 1PH6A 2B63B 3UQ8A 3GV7B 2K50A 1PK8A 1CQVA 2YU9A 1PTOD 2L1BA 3NTIA 5EPLA 5FOBB 2HDLA 4HAEA 4HN7A 3J81j 4DL3A 3H0GA 2NU6B 4QGUA 1QNKA 3PV0A 1FR3A 5FO8B 3URYA 3NTHA 3IFDA 3RFCA 5LMUH 2A68C 5KFPA 4DR6Q 2F0DA 1L0WA 1GVPA 4V0BA 4DV5Q 4RAZA 1S0NA 1EY0A 2FPGB 1RDPD 4MV3A 3PQIA 2N78A 4UCVA 2MHVA 2DNCA 2R92B 1MHWC 1TQOA 1HUMA 3W3AA 3BJUA 5ELDA 4X64L 4JUZA 4N8X1 3HKSA 3NSWA 3PSIA 1LLRD 1U4MA 2NVXH 1G51A 3FRPB 4JPBW 1N33Q 1SYXB 4IR9A 5DLFA 1C48A 4WD3A 1GUNA 4FNFA 3GTJH 3HOYB 3FMCA 2R7NA 3DWPA 1EUCB 3M4YA 4KY7A 2W9AA 4BA1I 3VYTA 4HSVA 4HIMA 1RTNA 3S1QH 2ZDQA 5KFBA 5IT9E 1MD2D 1BOSA 1WCMB 5GAGC 3TREA 3CCUA 1JWSD 5ELBA 2KSWA 1FD7D 2W6OA 2A1AA 5IT9c 4FU0A 2WB1G 2I80A 4KMUC 3HOUG 3EQLC 2VB2X 1NNXA 1RJRA 2ZTEA 4DR6L 1XMQH 4LF6L 1VBGA 5C44B 3SK8A 3DXJC 1D5MC 1XTCD 3CC4A 4JI7L 4DV2Q 4DR2H 3GD7A 3PIO3 2NVQH 3MJFA 4JI4H 2AQ3B 1D5ZC 3TQYA 4JI6Q 3J80i 1PXUA 1GXDC 4PZ6A 2X69A 5M5YH 1OXUA 1QVCA 2C5CA 1I50A 1P16A 5G3LD 1IOVA 2NVTB 3TS0A 4UCOA 3I91A 5M3FH 1DM0B 4HEDA 4LW1A 1Z9FA 3MWMA 2IT1A 1VBHA 3LGJA 1XMOQ 4EGVA 1I94H 5IE8A 2HUGA 2R92G 3WOEA 2UXDQ 5IGBA 4DK1A 2JA7G 4Y52H 2VPQA 1TWFH 4DAYA 4A4IA 2W8LA 3RBEA 5KG0A 2M2LA 1V1QA 2WKDA 1VQNA 4IRCA 3PIPA 1KNEA 1XPRA 3DEPA 4NXNL 2E76C 1NCVA 5CAEB 4DK0A 2IHFA 1ET9A 2RSNA 2SDFA 4IO9A 2JA8H 3RLOA 5KNDA 4UCTA 1B8AA 3BJYA 1A2TA 3TBIB 4R1JA 5CV4A 1JLLB 1TR5A 2F0FA 4RU9A 1CSQA 3K81C 4ZKBB 4ME5A 1JE5A 2W57A 4K2KA 1UEAB 3PR4A 2JEJA 1SYCA 4OXPA 4RGTA 1XMOL 3V2TA 1JOKA 5EWFA 3KDFA 4A3KB 4CDFC 2MFIA 5LMUQ 4OONA 5KFFA 2V4QA 1UAPA 3D4WA 4DFAA 3I7FA 1D7QA 1EZ1A 1GUSA 3HOVB 3HKZG 3R93A 1STAA 3G4SA 2QILA 5KFRA 4U7CA 4RUCA 3PUZA 1JWMD 4IURA 2KEDA 4DV4Q 3RIZA 4ED0A 4XT3B 1SNCA 3Q24A 3N40P 4L8JA 1WTOA 1QUQA 3PGZA 1YHQA 3NQIA 1YNND 2B2VC 5KG5A 1OXXK 5KIXA 3CCRA 4HYKA 2KUMA 1MSGA 3RUZA 2P0AA 4ME3A 5IGDA 5IIFA 4EVOA 4POFA 1AFPA 2FHTA 1T36A 5F9NA 4L1KA 5M3FG 4MTKA 1BCPC 4PQXA 1M90C 5GQOA 3A0JA 2J4XA 1GGOA 4QWBA 4RZRA 4ID6A 2CQOA 5C4ZA 4XYMB 2Q8RE 2ZT9C 3X3NA 4RH6A 2UUAH 1L0YB 1LACA 4WBNF 2C35B 4DL7A 5IGCA 3SE7A 4DV7H 4JC0A 2PMZA 4PMCA 2UVRA 2XSCA 1IBML 2R93H 4X3KA 4I4TF 2F0SA 2RCFA 1HNZH 4KKTA 4RFBA 4XT1B 4BBSH 3BG5A 3G71A 3F1ZA 5M5XB 2VUMA 5M3MH 3PO2G 2W70A 5LMNQ 4EGQA 2VQEL 3ORRA 5C1PA 3U50C 1PRTB 1PH2A 2WE6A 2YS7A 4PZ8A 4IFDJ 2JEAI 1TWHA 4RA8A 4EYIB 1O7YA 4UDUC 4EG0A 1E2ZA 4JI1L 4M9UA 5DQIA 1K8OA 1SE4A 3STBC 4TV9F 3P20A 3N42B 5LMNL 3MR5A 3TDQA 4IUTA 3S15H 4EGJA 3FP9A 4K5VA 2JEFA 2AQ4A 1CFMA 2LKVA 1BUVT 3VYUA 5C44H 1RK6A 2EY6A 5I2XA 3VR6A 3S2HB 5IYCH 1EYAA 4OIKA 1CS0A 3IFTA 1KRTA 3CQZA 4LH7A 1B04A 4O4LF 3CCSA 5IP7H 4LFBL 3OHBA 4O42A 3VYSA 2ENBA 1A9XA 2L5TA 2VY3A 5CA1F 5IOCA 5IWAQ 3HXLA 1C9OA 2SOBA 5I9OA 1SYDA 4ZQ3A 4DV0L 3E3XA 4DR2Q 1XDNA 4DV2H 2Z0SA 2HIVA 5EBCA 2VUMB 4S3SA 1Z2OX 5KFKA 4A3BG 1UNNC 5KFTA 3N52A 2OWOA 2F3WA 2O5IC 1FL0A 4QW8A 5IWAL 5C3XA 5KNCA 2FK2A 4YWKA 1O75A 4YJ3F 3IG0A 3KHRA 2R82A 5A2QW 1PFMA 4XTCS 1HNWQ 1B4OA 1KBLA 1BNZA 3PF5A 1N36Q 2QKIC 3NE5B 2WINB 3S16H 1CZWA 2JA8B 3BVZA 3NUCA 3JAML 3G6YA 2YCHA 4JV5Q 4DF7A 4CC5A 2B8FA 5LP6F 1Y1VH 3GQBA 1KQSA 1BCPD 4ED7A 4A2BA 1HPCA 1S5CD 4DR5L 1D8LA 1N33L 3GTPB 3GTKB 3DWAA 3I4MH 4P71A 2NVQB 1Y8NB 2I0QA 4DV4L 4C2MB 3MA2B 2CHBD 3JAMi 1A15A 1VF7A 4MV1A 1EZ6A 5ELCA 2E5LH 3M7NA 4J9NA 2NU7B 2VL6A 3PUWA 4QB4A 4X3UA 4ECSA 4AQYH 1DONA 2NU9B 2VW9A 1R9TA 4L5TA 1BDOA 4B3TQ 4MTDA 5DGAA 4NXMH 3KBGA 5I2YA 4C3JG 2WB1A 4J8QA 3JAME 1L1OC 3A7LA 3QJYA 1SEBD 3BQ2A 1BCPF 2A5HA 3U4VA 2KEEA 3G48A 1QVGA 2EXZA 2A74C 2C9OA 3BQ0A 3M9OB 3OWFA 2FK1A 1R4PB 3OPOA 2QF7A 4X62Q 5LXTF 4YBZB 1I6UA 4R4CA 5M5WB 4PNYA 1RYSA 4DV1L 1EQTA 2UUCQ 1I3QB 1I50H 1IBMQ 2NWGA 1OTCA 1Y8OB 1K1QA 1KL9A 5LMNW 3FHWA 3KLSX 2N8NA 5L1KA 5L9XA 2EJGC 1EY9A 2VXWA 5DEHA 2A19A 2J6UA 4QL5A 5KX5F 1CI3M 2JJQA 1HQRD 2EDGA 2O5JC 2EY5A 1SFOB 3M4IA 3TP8A 3J81W 3BU2A 1SE3A 2B39A 4POGA 2JA6G 3NELA 4R4IA 3CU7A 1ZYRC 2V59A 3M3YH 3SI8A 1UNSA 2VZAA 4PWQA 4A3JH 1SEIA 1K73C 5BR8Q 2A6HC 1W6KA 1HXYD 3E0JA
chains in the Genus database with same CATH topology
5C44G 2JA5H 4BA2I 1PH1A 2GVBA 3KOJA 2CCZA 1UE7A 1Q46A 4AQYL 2ZTCA 4DR3Q 1K9MC 2VUMG 1PH5A 5C3EG 4K0KQ 4LFCQ 4WJ3M 4YHHQ 4JYAL 1L1OB 4MTNA 4R4QA 1IBKQ 3HOYG 3W1BA 1WCMH 1VQ5A 4GNXB 4OO1G 2E2JH 3ICEA 3L0OA 4RG1A 2I5LX 2PQAA 4X62L 1XJVA 4OWWB 3CMEA 2UU9L 2GVAA 2KENA 4PZ7A 2JQOA 3A5UA 5JJKA 4JCVE 4J15A 3CMAA 4A75A 1H95A 4A3LG 2VNUD 4O2DA 3CAMA 2KCMA 1BVSA 1VQKA 3K0XA 4C3IH 2D0OA 4GOPA 2ASBA 1J5EQ 1HNXQ 1PH7A 1XNQQ 2UXCQ 1YHBA 4GKJL 2JE6I 4WJ4A 1E3PA 3F8TA 2UUBL 3M4QA 4A3JG 1XTDA 4GNXA 4LF9Q 4DV3L 4GN4B 4A3KH 4JI8L 2AWNA 1V43A 4H02A 1Z47A 3E9IA 4NPSA 5JJLA 3ER0A 2B29A 3JC66 2JK8A 3S1RH 3H3VI 3Q8DA 1UE5A 4JI0Q 5GAHC 1N32L 3H0GG 2UXBQ 4GOPB 1K8AC 1WCMG 2K5VA 3W5OA 4EX5A 3ULJA 5C4XH 1JJ2A 1SN8A 3NEMA 2K5HA 4HIDA 1EQQA 4LF4L 3HOXH 2ZM6L 2B63H 4QY7A 3NENA 4BY1G 1X65A 1IXRA 1GD7A 4A3LH 1V9PA 1RIPA 5IP9G 1Q82C 2NVYH 4A3IG 1N34L 1Q7YC 2Q2IA 1YJNA 3D31A 1PFSA 3KF6A 4DR5Q 4AIMA 2MO0A 2IX1A 1VQAA 5FLXc 3T1HQ 2AMCB 1NMFA 3L7ZC 4PMWA 2HHHQ 2JA7H 2B3GA 2FXQA 2RHSB 1JB7A 1K0RA 4A3FH 4A3KG 3GTPH 4DAYB 4A3CH 1HH2P 1X6OA 1GO3E 3K80C 3VDYA 2PMZE 1Q86C 2JA6H 3J7ZC 1S3OA 2Y0SE 2ALYB 1SMXA 3PUYA 3CPFA 5JEAJ 4A3MH 1VQMA 3AEVA 4DUZL 1M1KC 1L1OA 5AJ3L 1EFWA 3AFQA 4JBMA 1C0AA 1QVFA 1AH9A 4GLAC 3HOWH 1QZHA 1CKNA 4OO1I 2QEXA 5C4XG 4LUZA 3KF8B 1VQ4A 3F2CA 4DR1Q 2YTYA 3M4PA 3MXNB 1CSPA 3F2BA 4GLVB 1PH9A 4YCWA 3STBD 4LF4Q 1S40A 1HJPA 4UP8A 4GNXC 2E2HH 1W2BA 5ELOA 2OCEA 3MEFA 3T1HL 1SE8A 4QJFA 5HGQA 1PH8A 1VQ8A 1N36L 4A3GG 1JT8A 1TWAH 3HOVH 4JBJA 4R4TA 3UDGA 3W1GA 5IYDH 1CKNB 4L5QA 1ASZA 4QQBX 1B7YB 1JJCB 3TS2A 4HIOA 5J3BA 1X3GA 4BXXH 1U0LA 1XMQL 1MKHA 1VQIA 3CW2C 2KCTA 1VQLA 4A3CG 5JJIA 3HKZE 1IZ6A 1Q12A 2Q2HA 1VQCA 4DK3C 2DUDA 5C0XI 1SRUA 4YCVA 3AFPA 3S1NH 3KF6B 1Y1WH 1PH6A 1KRSA 2Z6KC 2K50A 4BBRG 1PV4A 4JI5L 2OTLA 4DK6C 1YVCA 4JOIC 2ZJPA 4X66Q 3I4OA 1X3EA 4DV7L 4JI3Q 4LF5L 4A3GH 5IYCG 3J81j 3S2HH 3GDEA 1HNZL 3UDXA 4QGUA 3PV0A 5ELNA 2CWAA 2YTVA 4X65L 1N8RC 1UEBA 5M5WH 5FLMH 5JEAG 4JG2A 4L5RC 4OX9L 4DR6Q 2UXBL 2KHJA 3UE1A 4JI3L 1L0WA 5FJ8H 1RL2A 4HJ7A 1GVPA 3KLWA 4Y7NH 2ZJQA 4AQYQ 1YIJA 4DV5Q 1BBUA 1SFOH 1GKHA 5IP7G 2N78A 4A3IH 4B3SL 2D62A 2R7FA 4DUYL 4DR4Q 2VUMH 3G6EA 1QZGA 3BJUA 4X64L 1MJCA 1PA6A 1UE6A 3HKSA 3PSIA 1BBWA 2BA0A 2NVXH 1G51A 2AWOA 2LXJA 1N33Q 4B3RQ 4LUOA 4LFBQ 4JI2Q 5M3MG 1YEZA 2MNAA 1VQ6A 3PO3G 2I5MX 4IJHA 4DV6L 3PO2H 4JI2L 1PYBA 3GTJH 4GKJQ 1JJGA 4DR4L 1I5FA 4JBWA 4BA1I 4DUZQ 4HIMA 3S1QH 4JI5Q 3IRBA 1L2FA 2BH2A 2E8GA 4EQ5A 5GAGC 1G291 3TREA 1X3FA 2K75A 3CCUA 1G6PA 3DM3A 2VQFL 1CKOA 2A1AA 5IT9c 3DLLA 2WB1G 2HHHL 4HJ8A 3HOUG 2Z6KA 2R7ZH 5C0XJ 2ZTEA 3HOZH 4DR6L 4LWCA 4LF6L 3H3VH 2F3IA 1J6QA 4JI7L 3ULPA 3CC4A 2BH8A 1VQOA 1N9WA 4P75A 4DV2Q 3UDFA 3GD7A 1SR3A 3FKIH 4YHHL 3PIOA 1NTGA 3TQYA 4JI6Q 3J80i 2NVQH 4JYAQ 1UWVA 3S1MH 2MQHA 4PZ6A 4BXXG 1WJJA 1A62A 5M5YH 4B3SQ 2ATWA 1A0IA 1OXUA 1QVCA 1VQGA 1LTLA 1P16A 1X9NA 3U4ZA 4R4OA 3TS0A 1IBLL 5M3FH 2Y0SG 1Q8KA 2ES2A 4K0KL 4LW1A 1Z9FA 2IT1A 2N49A 3LGJA 3ERSX 5IP9H 5LMUL 1XMOQ 4GOPC 5IE8A 3OW2A 2B63G 3GO5A 1E1OA 2R92G 2QGQA 2VQEQ 1KIXA 3TEHB 4NXMQ 4B3MQ 5E7NA 2UXDQ 4Y52H 2EIFA 2JA7G 4JV5L 4TQUS 1TWFH 4DAMA 3L2PA 4JI4Q 1WYDA 2K5NA 4A4IA 1EWIA 1LM0A 1HR0L 4JI6L 1V1QA 1WFQA 1VQNA 2WAQG 1YJWA 3CQZH 1HR0Q 3PIPA 3GTKH 4A3BH 4IOAA 1XPRA 2HQLA 1O7IA 4OWTB 2K52A 4NXNL 3A5ZB 1OXSC 3GTGH 3PCOB 2KHIA 4NXNQ 5DLQE 4C2MH 2IHFA 4AH6A 2L15A 4IO9A 2JA8H 3RLOA 5AJ3Q 4DV3Q 1B8AA 1WOCA 4IJLA 4DNIA 4A3MG 1IL2A 4JOIA 3RN2A 4ALPA 4R1JA 2IY5B 1HZCA 1TXYA 4KHZA 3S2DH 1VQ7A 1CSQA 3K81C 4DUYQ 3CXCA 4NXML 1JE5A 1A8VA 1OXTA 3H15A 2JEBI 2IX0A 1E1TA 3I4MG 1SLJA 1VQEA 5M5XH 2MO1A 1Q1EA 4DV2L 4OXPA 1XMOL 4P74A 5C4JH 4IPHA 3KDFA 1QUQB 4LUVA 3H0GH 3S14H 1IBKL 2MFIA 3RLFA 5LMUQ 4MNOA 4OONA 2NZOA 1D7QA 3I7FA 4LF7L 4HJAA 2UUAQ 2GN5A 3CCEA 3HKZG 1IBLQ 3G4SA 2R7DA 3I2ZA 4LF5Q 3PUZA 4IFDG 5GADC 4DPGA 1CKMA 4A3DH 4DV4Q 4GS3A 1VQJA 2R93G 3J81c 1YZ6A 3ZJYC 4BY1H 2V1CC 4A76A 1KAWA 3KDFB 3CD6A 1QUQA 4X65Q 4B3ML 2UXDL 3PGZA 4GN3B 1YHQA 4LF9L 4UP9A 4LF8Q 4A3FG 4JI7Q 1OXXK 5H1SE 3CCRA 1HNZQ 2WFWA 1HR0W 4ME3A 2YU9H 3I4NH 2YTXA 1IYJB 4IPCA 4POFA 3CCVA 1MJEA 1PYSB 3AYHB 5M3FG 1Q1BA 1N32Q 1M90C 3S17H 1X55A 5GQOA 1HZAA 3A0JA 3CCJA 5FLMG 1HNWL 3RZDH 1I94Q 4LFAL 2CQOA 3M4OH 4DV5L 4TVAB 1E7ZA 1KD1C 3S16H 5GROA 5HY6A 2NN6G 2VS1A 4JI1Q 3UDIA 4LF7Q 2K4KA 2C35B 1VQBA 4X64Q 1N34Q 1PVOA 3BZCA 4JC0A 4HJ9A 1E24A 1X56A 3M9BA 1IBML 2R93H 2CFMA 1C7YA 3OTOQ 2R92H 3I4NG 4DV1Q 3KJPA 4APVA 5IYDG 1ASYA 4BBSH 3PUXA 1P8LA 3G71A 3F1ZA 2VQFQ 2RCNA 1AE2A 3J81i 2ZJRA 1J5EL 2UXCL 5M3MH 2ID0A 3J7A5 3PO2G 5LMNQ 2VQEL 2AHOB 4A3EG 2OQ0A 3U50C 5K36G 1PH2A 3GTOH 3OTOL 1MIUA 1Y1WG 3SGIA 1E22A 4PZ8A 4IFDJ 2JEAI 4C3HH 1VQPA 1S72A 2KBNA 3HFZB 4JI1L 1R9TH 1XNRL 3STBC 4O0AA 4KHPL 1VS0A 5LMNL 4L5SA 4HIKA 1KXLA 3S15H 3FP9A 4LFAQ 4GN5A 2F52A 3T1YL 3RN5A 4YWLA 3HOYH 3E0EA 1XPOA 5C44H 2JA5G 5IY0A 1LYLA 5EAYA 4FDBA 5IYCH 3M85A 1VQHA 2R6GA 3ULLA 5C3EH 4GKKQ 1KRTA 2XTIA 1YJ9A 2IHEA 2EQSA 4GKKL 1KC8C 4A3DG 3CCSA 5IP7H 3GTMH 3E9HA 1K8GA 4B3RL 4LFBL 2VY3A 1BKBA 2F4VQ 2RF4A 1NY4A 5IWAQ 1NJIC 1XPUA 4IPGA 1C9OA 2NVTH 2E2IH 3RR5A 1EQRA 2XGTA 4RMFA 4DV0L 2Q2TA 1AE3A 1VQ9A 2A8VA 4DR2Q 2WP8J 4XIGS 2Z0SA 1Q81C 3PO3H 2HIVA 4DR2L 3KYHC 3T1YQ 4A3BG 3JAMc 2UU9Q 1FJGL 1SROA 2OWOA 1Y1VG 1FL0A 3B6YA 4P72A 5IWAL 4AYBE 3GTLH 3KFUA 4IOCA 1XNRQ 4YWKA 1I3QH 2OTJA 3CPWA 3AQQA 4XTCS 1HNWQ 4DR7L 3OYYA 4IFDI 1FVIA 1HZBA 1JMCA 3EN2A 1FJGQ 4LNQA 2JA9A 3TRZA 1NBWA 1YITA 1A63A 2CWPA 3PF5A 2N3SA 1PHJA 1N36Q 1EIYB 1OXVA 3NBHB 4C3JH 3KJOA 1I94L 4JI0L 2JA8G 2PI2E 3GTQH 3F2DA 1KHIA 1WI5A 3RNUA 4A93H 4JV5Q 3CCMA 2WAQE 2I5HA 2Q2UA 1Y1VH 1FGUA 1KQSA 4BBRH 1XMQQ 1EYGA 1N33L 1EIFA 4DR5L 1D8LA 4YWMA 4YY3L 4UP7A 4DV6Q 1K83H 3I4MH 4P71A 3CF5A 2ZM6Q 4YY3Q 3K8AA 1HZ9A 3FKIG 3S24A 2LSSA 1EOVA 2YYZA 2I0QA 1LUZA 1YBYA 5FJ8G 1W3SA 4DV4L 2HT1A 2RHQB 2BA1A 1EUJA 4DV0Q 1VQFA 3JAMi 3M7NA 2D0PA 4JI4L 2ZTDA 1Y14B 1TWCH 2VL6A 3PUWA 4A3EH 1PH3A 2UUAL 1YNXA 1I6HH 1VQDA 4YCUA 2VW9A 4DR1L 4KHPQ 3HOWG 3RZOH 4L5TA 4B3TQ 4GLXA 1NMGA 4OX9Q 3D0FA 1PH4A 1L1OC 4KI0A 5IYBH 4DR3L 3CC2A 3CCQA 1T9HA 4DV7Q 3EIVA 1B70B 3G48A 3U4VA 4P73A 4LFCL 1QVGA 1CUKA 4KLKA 5BR8L 1U5KA 4X6AH 3K7AH 1NE3A 4BY7G 4NB3A 4X62Q 2CKZB 2DGYA 3BZKA 2WB1E 4R4CA 4UPAA 2E5LQ 1TWGH 3HOVG 4DV1L 3PUVA 2HIXA 2UUCQ 2AKWB 2LXKA 3EBEA 3HOUH 1I50H 1IBMQ 4OWXB 2EXDA 2PQAB 1OTCA 2H5XA 2NN6I 1KL9A 3HOXG 1YI2A 5LMNW 4B3TL 3FHWA 5IYBG 1DGSA 2N8NA 4X66L 2A19A 4PG3A 3WWVA 2R7ZG 1X54A 4BBSG 3HOZG 4QL5A 4JBKA 4MZ9A 1TWHH 2YV5A 3CC7A 1GM5A 2F4VL 4BY7H 2JJQA 4DKAC 2K14A 4IPDA 1YHAA 3I56A 1UE1A 4DR7Q 4LF6Q 2PNHA 2QA4A 4HJ5A 3BU2A 4JI8Q 4LF8L 2UUCL 4POGA 2JA6G 3A74A 3NELA 2UUBQ 2PI2A 4R4IA 3J80c 5GAEC 3CCLA 3CP0A 2NZHA 3K7UC 3RLNA 3UE0A 3M3YH 4A93G 3I55A 4UY8C 2VZAA 2OQKA 4QIWE 4A3JH 1K73C 5BR8Q 3U58A 1HNXL 2E5LL 5C0XG 1VCIA 1XNQL 1K3RA 3PF4A 4AYBG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C44 G;  2JA5 H;  4BA2 I;  1PH1 A;  2GVB A;  3KOJ A;  2CCZ A;  1UE7 A;  1Q46 A;  4AQY L;  2ZTC A;  4DR3 Q;  1K9M C;  2VUM G;  1PH5 A;  5C3E G;  4K0K Q;  4LFC Q;  4WJ3 M;  4YHH Q;  4JYA L;  1L1O B;  4MTN A;  4R4Q A;  1IBK Q;  3HOY G;  3W1B A;  1WCM H;  1VQ5 A;  4GNX B;  4OO1 G;  2E2J H;  3ICE A;  3L0O A;  4RG1 A;  2I5L X;  2PQA A;  4X62 L;  1XJV A;  4OWW B;  3CME A;  2UU9 L;  2GVA A;  2KEN A;  4PZ7 A;  2JQO A;  3A5U A;  5JJK A;  4JCV E;  4J15 A;  3CMA A;  4A75 A;  1H95 A;  4A3L G;  2VNU D;  4O2D A;  3CAM A;  2KCM A;  1BVS A;  1VQK A;  3K0X A;  4C3I H;  2D0O A;  4GOP A;  2ASB A;  1J5E Q;  1HNX Q;  1PH7 A;  1XNQ Q;  2UXC Q;  1YHB A;  4GKJ L;  2JE6 I;  4WJ4 A;  1E3P A;  3F8T A;  2UUB L;  3M4Q A;  4A3J G;  1XTD A;  4GNX A;  4LF9 Q;  4DV3 L;  4GN4 B;  4A3K H;  4JI8 L;  2AWN A;  1V43 A;  4H02 A;  1Z47 A;  3E9I A;  4NPS A;  5JJL A;  3ER0 A;  2B29 A;  3JC6 6;  2JK8 A;  3S1R H;  3H3V I;  3Q8D A;  1UE5 A;  4JI0 Q;  5GAH C;  1N32 L;  3H0G G;  2UXB Q;  4GOP B;  1K8A C;  1WCM G;  2K5V A;  3W5O A;  4EX5 A;  3ULJ A;  5C4X H;  1JJ2 A;  1SN8 A;  3NEM A;  2K5H A;  4HID A;  1EQQ A;  4LF4 L;  3HOX H;  2ZM6 L;  2B63 H;  4QY7 A;  3NEN A;  4BY1 G;  1X65 A;  1IXR A;  1GD7 A;  4A3L H;  1V9P A;  1RIP A;  5IP9 G;  1Q82 C;  2NVY H;  4A3I G;  1N34 L;  1Q7Y C;  2Q2I A;  1YJN A;  3D31 A;  1PFS A;  3KF6 A;  4DR5 Q;  4AIM A;  2MO0 A;  2IX1 A;  1VQA A;  5FLX c;  3T1H Q;  2AMC B;  1NMF A;  3L7Z C;  4PMW A;  2HHH Q;  2JA7 H;  2B3G A;  2FXQ A;  2RHS B;  1JB7 A;  1K0R A;  4A3F H;  4A3K G;  3GTP H;  4DAY B;  4A3C H;  1HH2 P;  1X6O A;  1GO3 E;  3K80 C;  3VDY A;  2PMZ E;  1Q86 C;  2JA6 H;  3J7Z C;  1S3O A;  2Y0S E;  2ALY B;  1SMX A;  3PUY A;  3CPF A;  5JEA J;  4A3M H;  1VQM A;  3AEV A;  4DUZ L;  1M1K C;  1L1O A;  5AJ3 L;  1EFW A;  3AFQ A;  4JBM A;  1C0A A;  1QVF A;  1AH9 A;  4GLA C;  3HOW H;  1QZH A;  1CKN A;  4OO1 I;  2QEX A;  5C4X G;  4LUZ A;  3KF8 B;  1VQ4 A;  3F2C A;  4DR1 Q;  2YTY A;  3M4P A;  3MXN B;  1CSP A;  3F2B A;  4GLV B;  1PH9 A;  4YCW A;  3STB D;  4LF4 Q;  1S40 A;  1HJP A;  4UP8 A;  4GNX C;  2E2H H;  1W2B A;  5ELO A;  2OCE A;  3MEF A;  3T1H L;  1SE8 A;  4QJF A;  5HGQ A;  1PH8 A;  1VQ8 A;  1N36 L;  4A3G G;  1JT8 A;  1TWA H;  3HOV H;  4JBJ A;  4R4T A;  3UDG A;  3W1G A;  5IYD H;  1CKN B;  4L5Q A;  1ASZ A;  4QQB X;  1B7Y B;  1JJC B;  3TS2 A;  4HIO A;  5J3B A;  1X3G A;  4BXX H;  1U0L A;  1XMQ L;  1MKH A;  1VQI A;  3CW2 C;  2KCT A;  1VQL A;  4A3C G;  5JJI A;  3HKZ E;  1IZ6 A;  1Q12 A;  2Q2H A;  1VQC A;  4DK3 C;  2DUD A;  5C0X I;  1SRU A;  4YCV A;  3AFP A;  3S1N H;  3KF6 B;  1Y1W H;  1PH6 A;  1KRS A;  2Z6K C;  2K50 A;  4BBR G;  1PV4 A;  4JI5 L;  2OTL A;  4DK6 C;  1YVC A;  4JOI C;  2ZJP A;  4X66 Q;  3I4O A;  1X3E A;  4DV7 L;  4JI3 Q;  4LF5 L;  4A3G H;  5IYC G;  3J81 j;  3S2H H;  3GDE A;  1HNZ L;  3UDX A;  4QGU A;  3PV0 A;  5ELN A;  2CWA A;  2YTV A;  4X65 L;  1N8R C;  1UEB A;  5M5W H;  5FLM H;  5JEA G;  4JG2 A;  4L5R C;  4OX9 L;  4DR6 Q;  2UXB L;  2KHJ A;  3UE1 A;  4JI3 L;  1L0W A;  5FJ8 H;  1RL2 A;  4HJ7 A;  1GVP A;  3KLW A;  4Y7N H;  2ZJQ A;  4AQY Q;  1YIJ A;  4DV5 Q;  1BBU A;  1SFO H;  1GKH A;  5IP7 G;  2N78 A;  4A3I H;  4B3S L;  2D62 A;  2R7F A;  4DUY L;  4DR4 Q;  2VUM H;  3G6E A;  1QZG A;  3BJU A;  4X64 L;  1MJC A;  1PA6 A;  1UE6 A;  3HKS A;  3PSI A;  1BBW A;  2BA0 A;  2NVX H;  1G51 A;  2AWO A;  2LXJ A;  1N33 Q;  4B3R Q;  4LUO A;  4LFB Q;  4JI2 Q;  5M3M G;  1YEZ A;  2MNA A;  1VQ6 A;  3PO3 G;  2I5M X;  4IJH A;  4DV6 L;  3PO2 H;  4JI2 L;  1PYB A;  3GTJ H;  4GKJ Q;  1JJG A;  4DR4 L;  1I5F A;  4JBW A;  4BA1 I;  4DUZ Q;  4HIM A;  3S1Q H;  4JI5 Q;  3IRB A;  1L2F A;  2BH2 A;  2E8G A;  4EQ5 A;  5GAG C;  1G29 1;  3TRE A;  1X3F A;  2K75 A;  3CCU A;  1G6P A;  3DM3 A;  2VQF L;  1CKO A;  2A1A A;  5IT9 c;  3DLL A;  2WB1 G;  2HHH L;  4HJ8 A;  3HOU G;  2Z6K A;  2R7Z H;  5C0X J;  2ZTE A;  3HOZ H;  4DR6 L;  4LWC A;  4LF6 L;  3H3V H;  2F3I A;  1J6Q A;  4JI7 L;  3ULP A;  3CC4 A;  2BH8 A;  1VQO A;  1N9W A;  4P75 A;  4DV2 Q;  3UDF A;  3GD7 A;  1SR3 A;  3FKI H;  4YHH L;  3PIO A;  1NTG A;  3TQY A;  4JI6 Q;  3J80 i;  2NVQ H;  4JYA Q;  1UWV A;  3S1M H;  2MQH A;  4PZ6 A;  4BXX G;  1WJJ A;  1A62 A;  5M5Y H;  4B3S Q;  2ATW A;  1A0I A;  1OXU A;  1QVC A;  1VQG A;  1LTL A;  1P16 A;  1X9N A;  3U4Z A;  4R4O A;  3TS0 A;  1IBL L;  5M3F H;  2Y0S G;  1Q8K A;  2ES2 A;  4K0K L;  4LW1 A;  1Z9F A;  2IT1 A;  2N49 A;  3LGJ A;  3ERS X;  5IP9 H;  5LMU L;  1XMO Q;  4GOP C;  5IE8 A;  3OW2 A;  2B63 G;  3GO5 A;  1E1O A;  2R92 G;  2QGQ A;  2VQE Q;  1KIX A;  3TEH B;  4NXM Q;  4B3M Q;  5E7N A;  2UXD Q;  4Y52 H;  2EIF A;  2JA7 G;  4JV5 L;  4TQU S;  1TWF H;  4DAM A;  3L2P A;  4JI4 Q;  1WYD A;  2K5N A;  4A4I A;  1EWI A;  1LM0 A;  1HR0 L;  4JI6 L;  1V1Q A;  1WFQ A;  1VQN A;  2WAQ G;  1YJW A;  3CQZ H;  1HR0 Q;  3PIP A;  3GTK H;  4A3B H;  4IOA A;  1XPR A;  2HQL A;  1O7I A;  4OWT B;  2K52 A;  4NXN L;  3A5Z B;  1OXS C;  3GTG H;  3PCO B;  2KHI A;  4NXN Q;  5DLQ E;  4C2M H;  2IHF A;  4AH6 A;  2L15 A;  4IO9 A;  2JA8 H;  3RLO A;  5AJ3 Q;  4DV3 Q;  1B8A A;  1WOC A;  4IJL A;  4DNI A;  4A3M G;  1IL2 A;  4JOI A;  3RN2 A;  4ALP A;  4R1J A;  2IY5 B;  1HZC A;  1TXY A;  4KHZ A;  3S2D H;  1VQ7 A;  1CSQ A;  3K81 C;  4DUY Q;  3CXC A;  4NXM L;  1JE5 A;  1A8V A;  1OXT A;  3H15 A;  2JEB I;  2IX0 A;  1E1T A;  3I4M G;  1SLJ A;  1VQE A;  5M5X H;  2MO1 A;  1Q1E A;  4DV2 L;  4OXP A;  1XMO L;  4P74 A;  5C4J H;  4IPH A;  3KDF A;  1QUQ B;  4LUV A;  3H0G H;  3S14 H;  1IBK L;  2MFI A;  3RLF A;  5LMU Q;  4MNO A;  4OON A;  2NZO A;  1D7Q A;  3I7F A;  4LF7 L;  4HJA A;  2UUA Q;  2GN5 A;  3CCE A;  3HKZ G;  1IBL Q;  3G4S A;  2R7D A;  3I2Z A;  4LF5 Q;  3PUZ A;  4IFD G;  5GAD C;  4DPG A;  1CKM A;  4A3D H;  4DV4 Q;  4GS3 A;  1VQJ A;  2R93 G;  3J81 c;  1YZ6 A;  3ZJY C;  4BY1 H;  2V1C C;  4A76 A;  1KAW A;  3KDF B;  3CD6 A;  1QUQ A;  4X65 Q;  4B3M L;  2UXD L;  3PGZ A;  4GN3 B;  1YHQ A;  4LF9 L;  4UP9 A;  4LF8 Q;  4A3F G;  4JI7 Q;  1OXX K;  5H1S E;  3CCR A;  1HNZ Q;  2WFW A;  1HR0 W;  4ME3 A;  2YU9 H;  3I4N H;  2YTX A;  1IYJ B;  4IPC A;  4POF A;  3CCV A;  1MJE A;  1PYS B;  3AYH B;  5M3F G;  1Q1B A;  1N32 Q;  1M90 C;  3S17 H;  1X55 A;  5GQO A;  1HZA A;  3A0J A;  3CCJ A;  5FLM G;  1HNW L;  3RZD H;  1I94 Q;  4LFA L;  2CQO A;  3M4O H;  4DV5 L;  4TVA B;  1E7Z A;  1KD1 C;  3S16 H;  5GRO A;  5HY6 A;  2NN6 G;  2VS1 A;  4JI1 Q;  3UDI A;  4LF7 Q;  2K4K A;  2C35 B;  1VQB A;  4X64 Q;  1N34 Q;  1PVO A;  3BZC A;  4JC0 A;  4HJ9 A;  1E24 A;  1X56 A;  3M9B A;  1IBM L;  2R93 H;  2CFM A;  1C7Y A;  3OTO Q;  2R92 H;  3I4N G;  4DV1 Q;  3KJP A;  4APV A;  5IYD G;  1ASY A;  4BBS H;  3PUX A;  1P8L A;  3G71 A;  3F1Z A;  2VQF Q;  2RCN A;  1AE2 A;  3J81 i;  2ZJR A;  1J5E L;  2UXC L;  5M3M H;  2ID0 A;  3J7A 5;  3PO2 G;  5LMN Q;  2VQE L;  2AHO B;  4A3E G;  2OQ0 A;  3U50 C;  5K36 G;  1PH2 A;  3GTO H;  3OTO L;  1MIU A;  1Y1W G;  3SGI A;  1E22 A;  4PZ8 A;  4IFD J;  2JEA I;  4C3H H;  1VQP A;  1S72 A;  2KBN A;  3HFZ B;  4JI1 L;  1R9T H;  1XNR L;  3STB C;  4O0A A;  4KHP L;  1VS0 A;  5LMN L;  4L5S A;  4HIK A;  1KXL A;  3S15 H;  3FP9 A;  4LFA Q;  4GN5 A;  2F52 A;  3T1Y L;  3RN5 A;  4YWL A;  3HOY H;  3E0E A;  1XPO A;  5C44 H;  2JA5 G;  5IY0 A;  1LYL A;  5EAY A;  4FDB A;  5IYC H;  3M85 A;  1VQH A;  2R6G A;  3ULL A;  5C3E H;  4GKK Q;  1KRT A;  2XTI A;  1YJ9 A;  2IHE A;  2EQS A;  4GKK L;  1KC8 C;  4A3D G;  3CCS A;  5IP7 H;  3GTM H;  3E9H A;  1K8G A;  4B3R L;  4LFB L;  2VY3 A;  1BKB A;  2F4V Q;  2RF4 A;  1NY4 A;  5IWA Q;  1NJI C;  1XPU A;  4IPG A;  1C9O A;  2NVT H;  2E2I H;  3RR5 A;  1EQR A;  2XGT A;  4RMF A;  4DV0 L;  2Q2T A;  1AE3 A;  1VQ9 A;  2A8V A;  4DR2 Q;  2WP8 J;  4XIG S;  2Z0S A;  1Q81 C;  3PO3 H;  2HIV A;  4DR2 L;  3KYH C;  3T1Y Q;  4A3B G;  3JAM c;  2UU9 Q;  1FJG L;  1SRO A;  2OWO A;  1Y1V G;  1FL0 A;  3B6Y A;  4P72 A;  5IWA L;  4AYB E;  3GTL H;  3KFU A;  4IOC A;  1XNR Q;  4YWK A;  1I3Q H;  2OTJ A;  3CPW A;  3AQQ A;  4XTC S;  1HNW Q;  4DR7 L;  3OYY A;  4IFD I;  1FVI A;  1HZB A;  1JMC A;  3EN2 A;  1FJG Q;  4LNQ A;  2JA9 A;  3TRZ A;  1NBW A;  1YIT A;  1A63 A;  2CWP A;  3PF5 A;  2N3S A;  1PHJ A;  1N36 Q;  1EIY B;  1OXV A;  3NBH B;  4C3J H;  3KJO A;  1I94 L;  4JI0 L;  2JA8 G;  2PI2 E;  3GTQ H;  3F2D A;  1KHI A;  1WI5 A;  3RNU A;  4A93 H;  4JV5 Q;  3CCM A;  2WAQ E;  2I5H A;  2Q2U A;  1Y1V H;  1FGU A;  1KQS A;  4BBR H;  1XMQ Q;  1EYG A;  1N33 L;  1EIF A;  4DR5 L;  1D8L A;  4YWM A;  4YY3 L;  4UP7 A;  4DV6 Q;  1K83 H;  3I4M H;  4P71 A;  3CF5 A;  2ZM6 Q;  4YY3 Q;  3K8A A;  1HZ9 A;  3FKI G;  3S24 A;  2LSS A;  1EOV A;  2YYZ A;  2I0Q A;  1LUZ A;  1YBY A;  5FJ8 G;  1W3S A;  4DV4 L;  2HT1 A;  2RHQ B;  2BA1 A;  1EUJ A;  4DV0 Q;  1VQF A;  3JAM i;  3M7N A;  2D0P A;  4JI4 L;  2ZTD A;  1Y14 B;  1TWC H;  2VL6 A;  3PUW A;  4A3E H;  1PH3 A;  2UUA L;  1YNX A;  1I6H H;  1VQD A;  4YCU A;  2VW9 A;  4DR1 L;  4KHP Q;  3HOW G;  3RZO H;  4L5T A;  4B3T Q;  4GLX A;  1NMG A;  4OX9 Q;  3D0F A;  1PH4 A;  1L1O C;  4KI0 A;  5IYB H;  4DR3 L;  3CC2 A;  3CCQ A;  1T9H A;  4DV7 Q;  3EIV A;  1B70 B;  3G48 A;  3U4V A;  4P73 A;  4LFC L;  1QVG A;  1CUK A;  4KLK A;  5BR8 L;  1U5K A;  4X6A H;  3K7A H;  1NE3 A;  4BY7 G;  4NB3 A;  4X62 Q;  2CKZ B;  2DGY A;  3BZK A;  2WB1 E;  4R4C A;  4UPA A;  2E5L Q;  1TWG H;  3HOV G;  4DV1 L;  3PUV A;  2HIX A;  2UUC Q;  2AKW B;  2LXK A;  3EBE A;  3HOU H;  1I50 H;  1IBM Q;  4OWX B;  2EXD A;  2PQA B;  1OTC A;  2H5X A;  2NN6 I;  1KL9 A;  3HOX G;  1YI2 A;  5LMN W;  4B3T L;  3FHW A;  5IYB G;  1DGS A;  2N8N A;  4X66 L;  2A19 A;  4PG3 A;  3WWV A;  2R7Z G;  1X54 A;  4BBS G;  3HOZ G;  4QL5 A;  4JBK A;  4MZ9 A;  1TWH H;  2YV5 A;  3CC7 A;  1GM5 A;  2F4V L;  4BY7 H;  2JJQ A;  4DKA C;  2K14 A;  4IPD A;  1YHA A;  3I56 A;  1UE1 A;  4DR7 Q;  4LF6 Q;  2PNH A;  2QA4 A;  4HJ5 A;  3BU2 A;  4JI8 Q;  4LF8 L;  2UUC L;  4POG A;  2JA6 G;  3A74 A;  3NEL A;  2UUB Q;  2PI2 A;  4R4I A;  3J80 c;  5GAE C;  3CCL A;  3CP0 A;  2NZH A;  3K7U C;  3RLN A;  3UE0 A;  3M3Y H;  4A93 G;  3I55 A;  4UY8 C;  2VZA A;  2OQK A;  4QIW E;  4A3J H;  1K73 C;  5BR8 Q;  3U58 A;  1HNX L;  2E5L L;  5C0X G;  1VCI A;  1XNQ L;  1K3R A;  3PF4 A;  4AYB G; 
#chains in the Genus database with same CATH topology
 2JA5 H;  4BA2 I;  2F0T A;  1PH1 A;  2CCZ A;  2ALZ A;  5K5P A;  1Q46 A;  3PIP 3;  1K9M C;  3CQZ B;  4EBE A;  3GV3 A;  1K83 A;  3T5J A;  4YHH Q;  1L1O B;  1ZQ7 A;  4IWY A;  1TWA A;  5LHY 1;  2F0I A;  2HVQ A;  3MWY W;  2EE1 A;  2PQA A;  4RG1 A;  5COR A;  2UU9 L;  3FMA A;  3VMM A;  2KEN A;  1QG7 A;  3L3O C;  5JJK A;  3UFX B;  1LT4 D;  1H9S B;  4CDE C;  2VNU D;  2KCM A;  2RKS A;  2KEC A;  4C3I H;  1VQK A;  2ASB A;  4DL2 A;  1EWC A;  3S9W A;  2F0U A;  4FF2 A;  1HNX Q;  5KFO A;  5D65 A;  2JE6 I;  5L1I A;  1E3P A;  2BE5 D;  5A2Q E;  4DUY H;  2PW7 A;  2OLS A;  4UCR A;  3M4Q A;  1YNN C;  4MV8 A;  5IGG A;  4GNX A;  1JXL A;  4LF7 H;  3Q2O A;  2W9C B;  2SNS A;  5DNF A;  5KFS A;  2AWN A;  2DLN A;  3RV3 A;  2I07 B;  4CHT B;  4O3O A;  4RNO A;  4X3T A;  1ML0 D;  1Z2N X;  3SDZ A;  1UE5 A;  1EL0 A;  4EYH B;  2K04 A;  1F9R A;  1LO5 D;  4GOP B;  1GJX A;  3W5O A;  4EX5 A;  4NKL A;  3ULJ A;  4R8I A;  4A3D B;  2HVS A;  2BDO A;  3VR3 A;  4ZI7 F;  2OH2 A;  1GD7 A;  3HS0 C;  3AMU A;  1V9P A;  5KT4 A;  3MXU A;  4AYB B;  3PW7 A;  1HRJ A;  4A3I G;  5C5J A;  1N34 L;  1E4F T;  5EWG A;  4OX9 H;  2EYF A;  3OMG A;  1GHK A;  4LFA H;  1NMF A;  3GIM A;  2DN8 A;  1KJQ A;  2B3G A;  4YHH H;  3T51 B;  1HH2 P;  3K80 C;  1KDA A;  2JA6 H;  1B33 N;  1Q86 C;  5IYZ F;  3J7Z C;  3R5F A;  1LTB D;  2UXB L;  1SMX A;  5JEA J;  3BS1 A;  1V1P B;  3AFQ A;  4JBM A;  3U9T A;  1ZHS A;  3OUU A;  3SHL A;  1IBL H;  5C4X G;  3KF8 B;  4QUF A;  3F2C A;  2YTY A;  3M4P A;  2QEJ C;  1GOZ A;  1CSP A;  3F2B A;  2DZD A;  5FLX L;  3MWE A;  1HQM C;  4ECU A;  4L63 B;  1HJP A;  3ND8 A;  3E5N A;  4F50 A;  1XXG A;  1SSO A;  3TSS A;  1PH8 A;  3VA7 A;  4QJF A;  1JDB B;  4GKJ H;  4RGO S;  1N36 L;  1HR0 H;  1K1S A;  2VQF H;  1R4Q B;  5IYD H;  3MVV A;  1ASZ A;  3HP3 A;  1B7Y B;  3TS2 A;  5J3B A;  3MHB A;  1VQI A;  2KCT A;  1IZ6 A;  1VQC A;  4DK3 C;  2DUD A;  2PZU A;  4WRD A;  4RZQ A;  5JUM A;  4DR1 H;  3ITP A;  3KF6 B;  1U4R A;  2Z6K C;  3HOU B;  1ENA A;  4BBR G;  4JI5 L;  1YVC A;  3D6C A;  4JOI C;  4LF4 H;  4X66 Q;  3K58 A;  1QIL A;  2F0Q A;  3Q1K A;  4DV7 L;  4A3G H;  5KKN B;  1TS2 A;  4UAI A;  1HNZ L;  2IMW P;  3UDX A;  2PYK A;  1AW7 A;  1F9S A;  5ELN A;  1TWC A;  5KFJ A;  4X62 H;  2YTV A;  3OMC A;  2B2U A;  1UEB A;  2ASJ A;  4L5R C;  3L4K A;  1SDF A;  3UE1 A;  1C30 A;  5G3L F;  4KKS A;  1TY2 A;  2E74 C;  5FJ8 H;  1JOO A;  4Y7N H;  4J9R A;  1YIJ A;  1B6R A;  1BBU A;  4LJZ C;  2W9B B;  2Q8I B;  5IP7 G;  4B3S L;  4A3I H;  4O3S A;  2R7F A;  3PMF A;  5KG1 A;  3W2D A;  2XC9 A;  2BDN A;  1PLF A;  2XD4 A;  1MJC A;  1PA6 A;  1U9R A;  3ORQ A;  2LXJ A;  4U67 3;  4B3R Q;  3N6R A;  2R8J A;  2PZW A;  3PO3 G;  3S15 B;  2RVL A;  4BS9 A;  1VQ6 A;  3PO2 H;  4IJH A;  4FVM A;  4GKJ Q;  1RTO A;  5COY A;  3X3M A;  1LTS D;  1DJR D;  5EPK A;  3VR2 A;  3RB6 A;  1WTR A;  1Z2P X;  2W6P A;  5DQG A;  3MAQ A;  3IRB A;  2BH2 A;  4EQ5 A;  5CYU A;  1EY4 A;  5JVG 3;  2K75 A;  1EY5 A;  3DM3 A;  4XYQ A;  3GTQ B;  2EYH A;  5BR8 H;  5JOB A;  4A93 B;  2SNM A;  2IW3 A;  1I50 B;  1ILQ A;  1CA6 A;  5F2D A;  2CQA A;  4J0M A;  4Q45 A;  2W9C A;  4OGQ C;  3KHH A;  4LWC A;  4C3I B;  2VUG A;  5DGB A;  2BH8 A;  4ZKC B;  4WFN 3;  3UDF A;  3GIL A;  1S0O A;  1BR9 A;  5KG2 A;  1STG A;  2E2J B;  2MQH A;  3BG3 A;  5I4D A;  3BA9 A;  4FBU A;  5KFC A;  1EY6 A;  2B2Y C;  2UVW A;  1KJ9 A;  5DG7 A;  2W9B A;  1VQG A;  5KFL A;  1LV9 A;  1SYF A;  4HCS A;  4IUU A;  2N49 A;  2VA2 A;  2XCA A;  4FYD A;  3GO5 A;  1FKA H;  4JI3 H;  5EBD A;  1KIX A;  3TEH B;  5EGT A;  1ONL A;  2W8K A;  1X3Q A;  4TQU S;  3OW7 A;  1WYD A;  2OEO A;  2JA5 B;  3Q22 A;  1EWI A;  1LM0 A;  1Y1V B;  1I4P A;  1IHZ A;  5L37 A;  4GC7 A;  1WFQ A;  5KFV A;  2WAQ G;  1HR0 Q;  3GTK H;  2C28 A;  2ZDG A;  1TWG B;  2B8G A;  3K5I A;  2TSS A;  3PCO B;  2KHI A;  3PO2 B;  3K5H A;  3D4R A;  2M05 A;  2W71 A;  5KT5 A;  5AJ3 Q;  2IJ0 A;  2KA7 A;  3TME A;  2PVP A;  4G57 A;  4R8N A;  1S5D D;  4IJL A;  4DNI A;  4DR4 H;  2F0G A;  4F88 A;  4A3M B;  1IL2 A;  1O7L A;  3RN2 A;  2PCF B;  2NYZ D;  3OIP A;  4BBR B;  4KHZ A;  4XYL B;  4N9T A;  4FXK C;  3RD4 A;  4RWS C;  5T1G A;  4NXM L;  3GIJ A;  4M1U B;  1A8V A;  1J5E H;  3JSL A;  2IX0 A;  1E1T A;  1GUO A;  2CH4 A;  2R7Z B;  2MO1 A;  5T14 A;  4HMI A;  4FO2 A;  2QCP X;  5E1F A;  1AZP A;  4P74 A;  4LUV A;  3H0G H;  3S14 H;  5A35 A;  2ICI A;  5A2Q L;  2VR1 A;  2UUB H;  1E2W A;  2UVU A;  2I8C A;  3F8N A;  4HJA A;  3CCE A;  2K03 A;  2CH4 W;  5KYL A;  1IBL Q;  3V05 A;  4N9P A;  4CC6 A;  4B08 A;  3QZ7 A;  4ECV A;  3NBI A;  2EYO A;  1PRT D;  3R5X A;  2NB0 A;  2V1C C;  4A76 A;  3JAM W;  1KAW A;  1S5E D;  4QMG A;  3CD6 A;  4B3M L;  4RHS A;  4J9M A;  4B9X A;  3BZD B;  2FLN A;  1EYD A;  3QR8 A;  3K7A B;  2R87 A;  1TWG A;  4A3F G;  4JI7 Q;  2F0M A;  3J7A F;  3I4N H;  2LS0 1;  4YQW A;  2FIN B;  1M8A A;  1MJE A;  1CHP D;  1TA8 A;  4IAL A;  4FM9 A;  1PTO B;  2EPB A;  3CCJ A;  2J6S A;  3A55 A;  1HNW L;  2XIG A;  3PW4 A;  4DL6 A;  3H20 A;  3GTG B;  3TII A;  2AGO A;  4DV5 L;  3Q8P B;  3LP8 A;  1II3 A;  3BVM A;  1FJG H;  4TVA B;  1E7Z A;  1KD1 C;  3VPC A;  1KLG D;  1ZET A;  5HY6 A;  2NN6 G;  4JI1 Q;  4C3I G;  1D2B A;  2K4K A;  3MXP A;  1TWH B;  1SJE D;  4X64 Q;  1N34 Q;  1PVO A;  2FKL A;  5CA0 F;  4HJ9 A;  1E24 A;  3KTM A;  3OTO Q;  3Q8R B;  2J0T D;  1ASY A;  1PRT F;  3PUX A;  1JX4 A;  2F0W A;  2RCN A;  4P2C B;  3J81 i;  2UXC L;  1WH2 A;  3CHB D;  4LFC H;  3FEW X;  2MP1 A;  3J7A 5;  5JPM C;  2CW8 A;  4ECZ A;  5FO7 B;  5K36 G;  3GTO H;  3OTO L;  4KJN A;  3SGI A;  3EPG A;  4XXE A;  5H80 A;  1XNR L;  4O0A A;  1MI2 A;  4L5S A;  3SE0 A;  1EHI A;  2V58 A;  1PZK D;  4KTA A;  3RB3 A;  1ZEQ X;  3RN5 A;  4V19 0;  1EIH A;  4KD4 A;  1XPO A;  2PPB C;  2FLP A;  2MPM A;  5IY0 A;  2DWC A;  1LYL A;  5EAY A;  3M85 A;  1WTH A;  2K5D A;  5C3E H;  3LNN A;  4DA2 A;  4A3E B;  1YJ9 A;  3S1M B;  1STN A;  5D1P A;  2EQS A;  1KC8 C;  5IOD A;  3WO1 A;  1SE2 A;  4A3D G;  3P75 A;  1TAE A;  1K8G A;  4B3R L;  4Q0F A;  3T4A C;  2AUK A;  1JOQ A;  2DJF C;  3QZ8 A;  4ZUJ A;  4IPG A;  3HOX B;  5FPO A;  2E2I H;  4KY6 A;  1NR4 A;  4X65 H;  2Q2T A;  3RAQ A;  2EYM A;  1AE3 A;  4J9S A;  2HD3 A;  1J9O A;  4XIG S;  4G7O C;  2DNE A;  5LL6 X;  1N34 H;  3KYH C;  4ABN A;  1Q90 A;  1QWY A;  3T1Y Q;  3S1R B;  4HNT A;  2EZV A;  4RGM A;  3GTL H;  4ECR A;  4AYB E;  1XNR Q;  2E2I A;  4HNV A;  2OTJ A;  1AZQ A;  3KK7 A;  3L4J A;  3CPW A;  5M3F B;  1U4L A;  1FVI A;  2EYP A;  3CKI B;  4C56 C;  2EVB A;  3TRZ A;  1YIT A;  1ZYR D;  2CWP A;  3TP5 A;  3R3O A;  1PHJ A;  2JA8 G;  1OXV A;  4C3J H;  3GTQ H;  2PI2 E;  2W7P A;  3P1H A;  1KHI A;  3UI2 A;  3RNU A;  4A93 H;  2WAQ E;  3LX0 A;  4EEY A;  3TIN A;  4BBR H;  4IQZ A;  1XMQ Q;  3S2D B;  3ND9 A;  3GIP A;  3WNZ A;  4YWM A;  4J9O A;  3DM1 A;  1BXR A;  4I50 F;  5FD5 A;  3NQT A;  3Q23 A;  2ZM6 Q;  1ROD A;  3K8A A;  2MUY A;  1CA5 A;  4LF8 H;  5E3F A;  1HZ9 A;  3FKI G;  4XQQ A;  2LSS A;  2W6N A;  3N44 B;  5I47 A;  2HT1 A;  5D3I B;  1RD9 D;  2JN4 A;  3F2U A;  2Z4I A;  3NBH A;  1DD2 A;  3RTX A;  3DEO A;  2D0P A;  4A3E H;  1WD1 A;  2UUA L;  1YNX A;  1EY8 A;  1I6H H;  5BPF A;  2RDJ A;  4ZQI A;  4DR1 L;  2X6G A;  5IGE A;  4KHP Q;  3GTM B;  3RZO H;  2E2H B;  1V51 A;  2NU8 B;  3PW0 A;  1YNJ C;  1NMG A;  2NVX B;  2C2E A;  4OX9 Q;  4BWS C;  2BE5 C;  1Q3L A;  4KI0 A;  2DY8 A;  1TWA B;  5ISR A;  1T9H A;  4K0K H;  1B70 B;  4Q43 A;  4C5C A;  3NTK A;  1CUK A;  4EBC A;  4KLK A;  4ED6 A;  4X6A H;  2L55 A;  1DZ1 A;  1TS3 A;  1NE3 A;  1AUX A;  4NB3 A;  3E6Z X;  4O3P A;  1QB5 D;  1XWE A;  4UPA A;  3HOV G;  3EJI A;  2HIX A;  3PUV A;  4NLG A;  2AKW B;  3EBE A;  4OWX B;  4O3N A;  2MCT A;  4RB1 A;  2B2T A;  2H5X A;  2NN6 I;  2XCL A;  1KNA A;  2A6E C;  3KUP A;  1LTA D;  1S5B D;  5D1O B;  1VDZ A;  2HDM A;  1X54 A;  5EKI A;  4QIW A;  5FLX W;  1GHJ A;  4LF9 H;  2L0C A;  2JYO A;  1HTL D;  4MZ9 A;  2YU9 B;  3EYY A;  1F9P A;  4YIJ A;  2F4V L;  2QDB A;  4BY7 H;  3RUP A;  3N43 B;  4XYO A;  1CQF A;  4Q5V A;  4KHV A;  4DKA C;  3MFH A;  3T5L A;  1UE1 A;  1RCV D;  4DR7 Q;  1K83 B;  1C3O A;  2PNH A;  2QYZ A;  3V6J A;  3NK9 A;  2RDF A;  4LSX A;  2EYL A;  1VKZ A;  3A74 A;  2PI2 A;  4ECX A;  5EOY A;  3R2T A;  2G9H D;  5GAE C;  2CVR A;  3CCL A;  4O4I F;  4QWD A;  4A93 G;  5J22 A;  2NVY B;  1AN8 A;  3BA8 A;  4HR7 A;  3H09 A;  3GTO B;  4G7Z C;  1HNX L;  1H9S A;  4J9P A;  3PF4 A;  2NUC A;  2K6A A;  1NTG A;  4AYB G;  3HRZ C;  2A6H D;  3KOJ A;  4XQN A;  2EJM A;  2V4D A;  2ZTC A;  5FO9 B;  2VUM G;  3RZO B;  4K6D A;  2AQ1 B;  4E4T A;  4DL4 A;  1DOM A;  5C3E G;  4K0K Q;  4LFC Q;  3WO0 A;  1ULZ A;  4JYA L;  4LMQ D;  2PW5 A;  3RGZ A;  5C6A A;  1WCM H;  1VQ5 A;  4GNX B;  3V4S A;  5J2U F;  3J80 L;  1G2T A;  4RUA A;  1WSC A;  3K5M A;  5I9P A;  2GVA A;  2JQO A;  4JCV E;  4HMJ A;  5CV6 A;  4O2D A;  2IBK A;  3ERQ A;  1PDQ A;  4GOP A;  4K14 A;  2R6F A;  5JVD F;  2UXC Q;  1XNQ Q;  1KAA A;  1YHB A;  4EEQ A;  1A3V A;  3F8T A;  1IKL A;  1HHV A;  1F9Q A;  1EIG A;  1S4Z A;  4A3J G;  3GP7 A;  4LF9 Q;  4DV3 L;  4GN4 B;  1NUC A;  4EQO A;  4A3K H;  4JI8 L;  4O3Q A;  1TT2 A;  4H02 A;  4NPS A;  3O13 A;  2JK8 A;  3Q8D A;  3Q8Q B;  2NVY A;  2UXB Q;  4UCU A;  4IUV A;  5HGT A;  1ESF A;  4OO1 H;  4R9W A;  1EQQ A;  3NEN A;  5KFE A;  4ODG A;  4BY1 B;  5KFQ A;  4A3L H;  1RF2 D;  1RIP A;  2PZT A;  1Q82 C;  2NVY H;  2DPJ A;  4ECT A;  2Q2I A;  1PX2 A;  2WKC A;  1GSO A;  4DR5 Q;  4AIM A;  4I7Z C;  4WOR A;  3KHG A;  3TN2 A;  2AMC B;  4PMW A;  1JB7 A;  1K0R A;  4A3F H;  1MGS A;  2QK4 A;  1X6O A;  1GO3 E;  3NXW A;  2R84 A;  4QWE A;  1PTO C;  1LT3 D;  1S3O A;  2Y0S E;  5KFI A;  1L1O A;  1EFW A;  1NSN S;  2E2H A;  1QVF A;  2KVM A;  3J7A V;  1AN7 A;  3JRX A;  3G6J B;  3HBL A;  2R7M A;  4RCO A;  1JE4 A;  3MR6 A;  4FS1 A;  3RF2 A;  2R85 A;  2R93 B;  3KLS A;  1I6H B;  4YCW A;  5KFY A;  1JR0 D;  2B2T C;  5KT2 A;  1S40 A;  4B3M H;  2R86 A;  4GNX C;  3BYY B;  1B6S A;  2E2H H;  4DAV A;  1W2B A;  3AB9 A;  3MEF A;  1SE8 A;  4CDC C;  4A3G G;  2FPI B;  4EFB A;  1TWA H;  3HOV H;  4JBJ A;  4R4T A;  2QDL A;  3UDG A;  3KAJ A;  4ECQ A;  4L5Q A;  5DM6 3;  1G91 A;  1GUW A;  1JJC B;  4IRD A;  4UCS A;  3HKZ B;  1IKM A;  4A3C G;  1XMQ L;  4DR6 H;  1ENF A;  3SVM A;  2K32 A;  5C5L A;  3I12 A;  1Q12 A;  2Q2H A;  3MFI A;  4DV5 H;  2Z9H A;  1Y1W H;  1CT1 D;  3RAX A;  1PV4 A;  1Y8P B;  1BBX C;  4DK6 C;  1EOT A;  4C3J B;  3I4O A;  2CZG A;  3N8D A;  1I4Q A;  4LF5 L;  2R7L A;  2EY2 A;  3MR2 A;  1SNQ A;  3S2H H;  3GDE A;  1M6V A;  2VB3 X;  1GUG A;  4NMZ A;  4JI0 H;  1N8R C;  5M5W H;  4TSS A;  5FLM H;  2XRS D;  5JEA G;  1I7L A;  1F2Y A;  5CV9 A;  1NAP A;  2Z6B A;  1RL2 A;  4HJ7 A;  1DIK A;  3KLW A;  2NBF A;  2ZJQ A;  4DL5 A;  1CQJ B;  4OIJ A;  5IWA H;  4DUY L;  2FPP B;  2VUM H;  1QZG A;  3NPP A;  3RB4 A;  1IW7 D;  1X32 A;  4B9W A;  5JJZ A;  1UE6 A;  1KLU D;  1LT6 D;  4YR3 A;  1BBW A;  2BA0 A;  4LSA A;  2KCC A;  3OIQ A;  4LUO A;  1YEZ A;  2MNA A;  1F2Z A;  2I5M X;  3MTS A;  4JI2 L;  1PYB A;  1I4G A;  3JSN A;  1I5F A;  4MAM A;  5K36 H;  4IUN A;  1O80 A;  1HTP A;  4DUZ Q;  4QWA A;  1PZI D;  3Q8S B;  1G29 1;  2RA4 A;  3HGB A;  3I3C A;  3DLL A;  2HHH L;  5I6Y A;  4HJ8 A;  2K28 A;  2Z6K A;  2XRQ D;  3K5N A;  2DIK A;  2YRW A;  4I7A A;  1KAB A;  3ULP A;  1ET6 A;  1PMR A;  4P75 A;  1VQO A;  3FKI H;  4YHH L;  3T5K A;  1UWV A;  3M7G A;  2FMM A;  3TP7 A;  4BXX G;  1A62 A;  1Y1V A;  1A0I A;  1E2V A;  1GLV A;  1TS5 A;  1X9N A;  3U4Z A;  3WOF A;  1IBL L;  1GSH A;  3A8K E;  4J9K A;  3OWE B;  1VMC A;  3J80 E;  2WYO A;  2ASD A;  1KC7 A;  5IP9 H;  4RB0 A;  4ZAI A;  5LMU L;  2HVR A;  5C4X B;  2XVS A;  4GOP C;  3OW2 A;  1E0B A;  1E1O A;  4DN4 M;  2QGQ A;  2VQE Q;  3HG9 A;  3OHX C;  4NXM Q;  4B3M Q;  5E7N A;  1BF4 A;  2EIF A;  3BDC A;  1T5E A;  4JI4 Q;  1B3Q A;  2V4R A;  2K5N A;  1HR0 L;  2K1B A;  5KFG A;  4O2A F;  5JEA H;  1YJW A;  4A3B H;  4IOA A;  1WCM A;  3C0F B;  3QO2 A;  4G4K A;  2HQL A;  1O7I A;  4OWT B;  3A5Z B;  4RNN A;  5DLQ E;  4AH6 A;  2D5D A;  2L15 A;  3FDS A;  2K5Q A;  4DV3 Q;  1WOC A;  4DNT B;  4A3M G;  2Y0S B;  3QB3 A;  1IBM H;  3RV4 A;  2IY5 B;  3QWN A;  3D4D A;  1VQ7 A;  4BBS B;  1OXT A;  3H15 A;  2JEB I;  3BVG A;  5FKA C;  2A68 D;  5LOV F;  1VQE A;  5M5X H;  4DU9 A;  3D6W A;  5M3M B;  2EJF C;  5LL6 b;  4IPH A;  1IBK L;  3SK4 A;  3J81 E;  2NTS A;  3RLF A;  4FF4 A;  4MNO A;  2NUA B;  1SNM A;  1RKN A;  2HGS A;  2L12 A;  5NUC A;  3OUZ A;  3CRL C;  3I70 A;  2R7D A;  3I2Z A;  3K5L A;  4LF5 Q;  3J7A K;  2FJZ A;  3H4B A;  1SBB B;  5GAD C;  1CKM A;  1I7N A;  4GS3 A;  1PRT C;  1VQJ A;  5EKK A;  5I6W A;  3J81 c;  3ZJY C;  4BY1 H;  2L9H A;  4JVZ A;  3DUZ A;  1KDC A;  4CGY B;  2NN6 H;  1UC9 A;  4LF9 L;  2RGV A;  1EEI D;  1AEX A;  1S5F D;  4LF8 Q;  2ZM6 H;  3T1H H;  1HNZ Q;  1HR0 W;  4LFB H;  1FYC A;  1EEF D;  2YU9 H;  5FPR A;  4YY3 H;  3CCV A;  3J7Y W;  1FNU A;  2OF1 A;  1Q1B A;  5BN5 A;  4CJ0 B;  5KFX A;  3SXH A;  3S17 H;  1X55 A;  4YAJ B;  1EU4 A;  1S68 A;  2R92 A;  4QCL A;  2R7K A;  1XX8 A;  3IL8 A;  4QF4 A;  3RZD H;  1I94 Q;  2LY7 A;  5T1I A;  2JP1 A;  2RSO A;  3SK5 A;  1V4Y A;  1VMP A;  2VS1 A;  3A7A B;  3UDI A;  2M00 A;  3A8I E;  1BCP B;  1SCU B;  1HNX H;  4MHE A;  1W93 A;  2DPI A;  2H1E A;  3BZC A;  4IWX A;  2CFM A;  2R92 H;  2FMC A;  3Q0A A;  5CV8 A;  3I4N G;  4DV1 Q;  3KJP A;  4APV A;  5IYD G;  1P8L A;  1M7J A;  1Q8I A;  4JYA H;  1DXM A;  4NW2 A;  1WD0 A;  1S10 A;  4KD3 A;  1STB A;  4Y7N B;  1EZ8 A;  4ZOL F;  2OQ0 A;  2V9W A;  2GPW A;  5BN3 A;  1ICF B;  4M7E A;  2ZXR A;  3TQ1 A;  2GA4 B;  3S1Q B;  2F0L A;  1S72 A;  2O03 A;  2AQ2 B;  3HFZ B;  3H40 A;  5M9O A;  4GC6 A;  4KHP L;  1WR2 A;  2W6Z A;  1K28 A;  3I4M B;  4B3T H;  3V4Z A;  1JCK B;  1W96 A;  3T1Y L;  1OWT A;  3KXY T;  1JWU D;  2JA5 G;  4TQR A;  3H3V C;  3FDT A;  5JPN C;  4IR1 A;  1VQH A;  2R6G A;  2DJG C;  2Z8L A;  4K5X A;  3MR3 A;  1EQV A;  3GTP A;  4CDD C;  4DLK A;  1B53 A;  2XTI A;  2IHE A;  4GKK L;  3R2I A;  2KOL A;  2BCO A;  5KFA A;  4KK7 A;  4YAK B;  2NVX A;  3M9N B;  2RF4 A;  5CGK A;  1N36 H;  2NVT H;  5C3W A;  2HCC A;  2LMC B;  2SEB D;  3RR5 A;  2XGT A;  3GTJ A;  2A8V A;  3PW5 A;  1VQ9 A;  1PFN A;  3GTG A;  2H4O A;  2WP8 J;  1BQQ T;  3PO3 H;  3BAA A;  5LA6 F;  5DG8 A;  2C2D A;  3T13 A;  2UU9 Q;  2YZG A;  2F0K A;  1SRO A;  4IZ8 A;  4YB8 B;  2A73 B;  5KT7 A;  4DV1 H;  4P72 A;  2VA3 A;  4IOC A;  3J80 W;  3JZI A;  1I3Q H;  2FK3 A;  3KBX A;  2Y0S A;  4Q0Y A;  4DR7 L;  3OYY A;  1JMC A;  3C2P A;  1VAJ A;  4O4H F;  4LNQ A;  2JA9 A;  2B2W C;  3GIK A;  2UUA Q;  3KJO A;  3NBH B;  2VQE H;  4FXD A;  1ESR A;  1RJQ A;  3PN1 A;  4RB2 C;  5FLX E;  2WII B;  2F0V A;  3CCM A;  3R23 A;  2FFK B;  2Q2U A;  1FGU A;  4ED3 A;  4DGZ A;  4JI6 H;  4UP7 A;  3T53 B;  2GLT A;  4FS2 A;  3CF5 A;  2K5W A;  4YY3 Q;  2BQU A;  3FKI B;  5LMN H;  3S24 A;  1HCZ A;  5J39 A;  1CQI B;  1EOV A;  2C2R A;  4LF6 H;  1W3S A;  3MFG A;  1QOH A;  2BA1 A;  4NP5 A;  1D5X C;  1EUJ A;  4DV0 Q;  1JDE A;  1HNW H;  1VQF A;  2D9U A;  3GTO A;  1EFI D;  2Q8T A;  3U9S A;  4JI4 L;  4MA5 A;  1Y14 B;  4XZ3 B;  1TWC H;  1PZJ D;  5ELE A;  5KGU A;  2OT2 A;  1PH3 A;  5EZY F;  1VQD A;  1M0W A;  5K2M A;  3OOC A;  3LWB A;  3HOW G;  3GV5 B;  2RDH A;  4IFD H;  3D0F A;  1PH4 A;  5CV5 A;  2IA6 A;  4Q44 A;  5D8D A;  3CC2 A;  4XX0 B;  4J6H A;  2V5A A;  4P73 A;  4LFC L;  3T56 B;  3PO3 B;  3PZP A;  5BR8 L;  1U5K A;  1SMY C;  2NTT A;  4KJO A;  2WDT A;  4BY7 G;  1W6J A;  2CKZ B;  2DGY A;  3LWE A;  2WB1 E;  2FB9 A;  1H9J A;  2E5L Q;  5BN4 A;  2LXK A;  5JAV A;  3HOU H;  4LAA A;  4L6T B;  2PQA B;  4APM A;  5KRU A;  1CHQ D;  2A6E D;  3HOX G;  1YI2 A;  5KFW A;  1O7Z A;  5IYB G;  1DGS A;  4QWC A;  1V8Q A;  1KJ8 A;  4PG3 A;  4BBS G;  1EYC A;  1TII D;  4HR7 B;  2G9D A;  4JBK A;  2HCI A;  1BNC A;  2YV5 A;  3GTL A;  3CC7 A;  3KHL A;  2JA7 A;  5JVL A;  4JI2 H;  1Y1W A;  2K14 A;  3I90 A;  4IPD A;  1YHA A;  3I56 A;  4Z9C B;  1K8M A;  3TZD A;  4CKB A;  4LF6 Q;  2HJW A;  3LML A;  4UFZ A;  2UUB Q;  1XMO H;  2NZH A;  3CP0 A;  3K7U C;  3RLN A;  4IN3 A;  5D1O A;  4DV4 H;  4RCN A;  3I55 A;  4UY8 C;  5IGF A;  4C5A A;  2OQK A;  4QIW E;  1XNQ L;  2E5L L;  5C0X G;  1VCI A;  2BOS A;  1K3R A;  5C44 G;  1JOR A;  3C46 A;  1UE7 A;  4RGN A;  4U68 A;  4AQY L;  2YRX A;  4KN4 C;  4DR3 Q;  3GTM A;  1G2S A;  4DXF A;  2XIW A;  4AYB A;  4UHV A;  1RJP A;  4WJ3 M;  1IBK Q;  3HOY G;  3W1B A;  1WVL A;  3TIG A;  1CM9 A;  1RHP A;  4OO1 G;  3ICE A;  3BQ1 A;  1CZG A;  1XJV A;  3TP6 A;  3CME A;  2AGP A;  4PZ7 A;  3A5U A;  5M5Y B;  1SND A;  4J15 A;  4A75 A;  1H95 A;  4A3L G;  3M9M B;  2O2L D;  2R93 A;  2RGR A;  2D0O A;  5FD6 A;  4FP5 D;  4ZHQ F;  1DV2 A;  5KFD A;  4GKJ L;  2W6Q A;  2B2W A;  4IAJ A;  2A69 C;  3PW2 A;  2ATL A;  1B1Z A;  2RDG A;  2UUB L;  5ELF A;  4JV0 A;  5DQH A;  3MXG A;  5C4H A;  1T5X D;  2XCP A;  4Q8E A;  1Z47 A;  3E9I A;  5J1Z A;  3FPU B;  2B29 A;  3JC6 6;  5KNB A;  2PNR C;  2C00 A;  3FVQ A;  5CBE E;  5GAH C;  5E4W C;  5F9L A;  4HTH A;  4C3H G;  1WCM G;  4IHJ F;  5DM7 3;  1JJ2 A;  1SN8 A;  2K5H A;  4XQJ A;  4LF4 L;  3GII A;  3HOX H;  1B2T A;  4QY7 A;  4BY1 G;  2W7O A;  3CRK C;  4KKU A;  3I4L A;  1IXR A;  2K33 A;  3GTK A;  4K5W A;  1A6X A;  4YJ2 F;  1O78 A;  4IRK A;  3D31 A;  3KF6 A;  4ZRZ A;  3HEJ A;  4EBD A;  2MO0 A;  1N56 A;  5HUR A;  1H9R A;  1IL8 A;  1TS4 A;  4TRD A;  3VR5 A;  2BR0 A;  1OO9 B;  4BWG B;  4JI7 H;  2FXQ A;  4K6L A;  2D2C C;  2N55 A;  4A3K G;  3GTP H;  4A3C H;  1HA6 A;  3RGX A;  3VDY A;  4B3S H;  2ALY B;  3OSO A;  3PUY A;  3CPF A;  4A3M H;  4DUZ L;  1M1K C;  1E4G T;  3EA6 A;  2B2Y A;  4ZLT F;  4LK1 C;  3HOW H;  4Y8V B;  1SYB A;  4OO1 I;  1SAP A;  3FPP A;  1MBY A;  4LUZ A;  3HKZ A;  4DR1 Q;  4IUP A;  2ASL A;  4LF4 Q;  3ETJ A;  3IN5 A;  4KV6 A;  3AU7 A;  3OTO H;  1B3A A;  3T1H L;  2OCE A;  1VQ8 A;  1JIH A;  5HGQ A;  1JT8 A;  1I6V C;  2IP4 A;  1S0M A;  4HSP A;  4J1M A;  4DV0 H;  1QNU A;  1IOW A;  1CKN B;  4CJ2 C;  1XNR H;  4QQB X;  4EFE A;  2KQ3 A;  1DOL A;  4HIO A;  3A8J E;  1LTI D;  4PMB A;  1RYR A;  3LWU A;  4ETS A;  3C1F A;  4DAP A;  4MV4 A;  1SRU A;  4YCV A;  3AFP A;  3S1N H;  4TUY F;  2OTL A;  1KRS A;  2JEI A;  3MWD A;  4C5B A;  3S16 B;  2ZJP A;  1RJT A;  4FXG C;  2XWB B;  3GID A;  1X3E A;  5C1O A;  2R8I A;  4DR3 H;  4JI3 Q;  4ZK9 B;  5DAU A;  3I4N B;  5IYC G;  4B3R H;  1F2L A;  2F0O A;  2Z1C A;  1AUV A;  3H91 A;  5C3E B;  1KEE A;  4H7B A;  3QG1 A;  2LFN A;  2CWA A;  2F3V A;  4X65 L;  4GZY C;  2FE3 A;  2VPS A;  3Q6S A;  2SCU B;  4JG2 A;  4OX9 L;  1STY A;  4ECW A;  2KHJ A;  4JI3 L;  2B2V A;  2F0P A;  5CR3 A;  1LTR D;  4AQY Q;  5E4X A;  1SFO H;  1J8I A;  1GKH A;  1TU2 B;  2J9G A;  2D62 A;  4DR4 Q;  1IW7 C;  3G6E A;  4X66 H;  4KHP H;  1H9M A;  5IT9 L;  3M3Y B;  1X3P A;  1LAB A;  4TQS A;  2AWO A;  4RB3 C;  2ZJT A;  3MXN A;  4LFB Q;  3T1Y H;  1KDB A;  4JI2 Q;  5M3M G;  2IPK D;  4DV6 L;  3MC0 B;  3D8G A;  1JJG A;  4DR4 L;  4JBW A;  2JA5 A;  4C3H B;  1C8C A;  4JI5 Q;  5EDW A;  1BO0 A;  4JV1 A;  2UUC H;  5KFZ A;  1L2F A;  2E8G A;  2EY1 A;  4CJ1 B;  1ZKO A;  1X3F A;  1G6P A;  1D1I A;  2F03 A;  2VQF L;  1CKO A;  1EY7 A;  4E6I A;  3DWQ A;  1G6Z A;  5EJW A;  1LTG D;  2R7Z H;  2IX3 A;  5C0X J;  3HOZ H;  1ZXT A;  3RBD A;  1NR2 A;  1M0T A;  3H3V H;  2F3I A;  1J6Q A;  1E4E A;  2VOB A;  1N9W A;  5CC4 A;  4ED1 A;  1SR3 A;  2HQE A;  3PIO A;  1SYG A;  4JYA Q;  2PN1 A;  4RNM A;  3E5S A;  3S1M H;  4A3G B;  1VF5 C;  4ILW A;  1FNV A;  1TKW B;  1WJJ A;  2KCN A;  4B3S Q;  4N8F A;  2J6T A;  1T3N A;  2ATW A;  4HNU A;  3K3P A;  4G3I A;  2L4N A;  1LTL A;  4H44 C;  4DR7 H;  4R4O A;  1I4H A;  5JVH 3;  1D1K A;  1PYW D;  2F0E A;  2Y0S G;  1Q8K A;  2Z4H A;  2ES2 A;  5L1L A;  4K0K L;  4H0L C;  1JIC A;  3ERS X;  2B63 G;  5DLG A;  4KY5 A;  3NHH A;  4F4Z A;  4A3J B;  4JI1 H;  4O2B F;  4JV5 L;  2XNA C;  3TZU A;  4DAM A;  2JXM B;  3L2P A;  3I72 A;  4EQN A;  4JI6 L;  4ED8 A;  5BMV F;  4MTE A;  3NWS A;  1PFB A;  4YR0 A;  4MIU A;  3CQZ H;  3EFX D;  1H9K A;  5KYI A;  1WTQ A;  2XGP A;  2K52 A;  4RAU C;  4R7R A;  3GTQ A;  1OXS C;  1N32 H;  3GTG H;  4F7X A;  1B44 D;  3KF8 A;  4NXN Q;  4I55 F;  4C2M H;  2C22 A;  3I8Z A;  2NZ1 D;  4R8U B;  1L2Z A;  1E4E B;  4JOI A;  3GLK A;  2PMZ B;  5CMD A;  4ALP A;  4G7H C;  1HZC A;  2BQR A;  2JA6 A;  1TXY A;  2WAC A;  4NDX A;  3S2D H;  4TKO B;  4DUY Q;  1L0X B;  3CXC A;  2UVV A;  2YYA A;  2UU9 H;  2UXC H;  5AFW A;  1JQY D;  5TSS A;  3ZYY X;  1UC8 A;  3I4M G;  1SLJ A;  4QW9 A;  1F2M A;  4J9Q A;  1Q1E A;  4DV2 L;  4ZCK A;  3EPI A;  5C4J H;  1UUP A;  1QUQ B;  1IYU A;  2BQ3 A;  4OL7 A;  5GON F;  2NZO A;  3OSP A;  1A3T A;  4MA0 A;  4LF7 L;  2GN5 A;  1B50 A;  2QW7 A;  1F77 A;  4IFD G;  4DPG A;  4A3D H;  4K8J A;  3QFF A;  2R8K A;  2ICE C;  1FNW A;  3NGD A;  1EWH A;  5KFH A;  2R93 G;  1YZ6 A;  4CKC A;  3KDF B;  2CW0 C;  4X65 Q;  3K57 A;  2UXD L;  3RB0 A;  4GN3 B;  3NP8 A;  2J7Z A;  4UP9 A;  2OXP A;  5H1S E;  5BPH A;  2L11 A;  2AGQ A;  2WFW A;  4ME6 A;  4DR5 H;  2YTX A;  1IYJ B;  4IPC A;  1IYV A;  1KJJ A;  4R8U A;  5CV7 A;  3BDO A;  1Y69 U;  1PYS B;  3AYH B;  1N32 Q;  5KG3 A;  4ZUI A;  2WAQ A;  1DV1 A;  1JB3 A;  3JRW A;  4ECY A;  1HZA A;  3KAK A;  1MSH A;  5FLM G;  1DYQ A;  2I46 A;  3J81 L;  4LFA L;  4I65 A;  3M4O H;  4JI8 H;  4PV1 C;  2N88 A;  5GRO A;  4EQP A;  1XNQ H;  4LF7 Q;  1VQB A;  2PBZ A;  1X56 A;  3M9B A;  1C7Y A;  2IWH A;  4OHJ A;  2WTF A;  4DXG A;  1I4R A;  4M8A A;  2VQF Q;  1AE2 A;  5CB4 F;  2ZJR A;  1J5E L;  3WDN A;  2JSO A;  3D3R A;  2B2U C;  2ID0 A;  5C4J B;  2AHO B;  4A3E G;  4RKL A;  1FGB D;  1MIU A;  1Y1W G;  1E22 A;  2F0H A;  4C3H H;  4CBV A;  2FLL A;  3K0Y A;  3PVX A;  4Q8F A;  3N6X A;  1KJI A;  1VQP A;  1QE6 A;  1HA5 A;  5KEE A;  5KT6 A;  2KBN A;  5EPJ A;  3IKJ A;  1WTP A;  1R9T H;  3VPB A;  4O1N A;  3S1N B;  1MZB A;  4X64 H;  1VS0 A;  2R8G A;  4HIK A;  3VYR A;  1KXL A;  2EYJ A;  3DF7 A;  4LFA Q;  2I87 A;  4GN5 A;  2F52 A;  4YWL A;  3GTJ B;  3HOY H;  1TY0 A;  3E0E A;  5KG6 A;  1K3B C;  1SNO A;  4MV9 A;  2AU0 A;  4FDB A;  3A56 A;  1HUN A;  3HZX A;  5D3D A;  4HCE A;  2FJ2 A;  3ULL A;  4DNR B;  3MEH A;  2YZM A;  4JI5 H;  1S03 G;  4GKK Q;  4FF3 A;  2F1M A;  1RK5 A;  3GTM H;  3E9H A;  4MN3 A;  1BKB A;  2F4V Q;  2AUJ D;  1NY4 A;  1NJI C;  1XPU A;  1N48 A;  4CKE A;  5C5M A;  1EQR A;  4RMF A;  2A69 D;  1CE8 A;  3M4O B;  3KAL A;  1Q81 C;  2MGS A;  5KFN A;  4K2L A;  4DR2 L;  1ZHQ A;  3QOJ A;  5KG7 A;  2R8H A;  3JAM c;  1FJG L;  5L1J A;  2DY7 A;  2KHS A;  2F4I A;  4K8I A;  3GQC A;  1IBK H;  2JEG A;  1Y1V G;  3B6Y A;  3H4D A;  2GPS A;  2PO4 A;  3KFU A;  3CVZ A;  1GYF A;  3OHA A;  1YNJ D;  3AQQ A;  2JA6 B;  1CTM A;  3ERO A;  4IFD I;  1HZB A;  4DUZ H;  3EN2 A;  1FJG Q;  5DG9 A;  1NBW A;  1XYI A;  1A63 A;  3G8C A;  2N3S A;  1EIY B;  3K6O A;  3DHQ A;  1I94 L;  4JI0 L;  3HOW B;  2WV6 D;  2F0J A;  4I7H A;  2R7Z A;  3F2D A;  1LTT D;  2FP4 B;  1G8Z D;  1WI5 A;  1S97 A;  3MFY A;  3BDL A;  2I5H A;  1SYE A;  2P5Z X;  3HOZ B;  1EYG A;  4YP3 A;  1EIF A;  2VQD A;  4A3B B;  4YY3 L;  2R3Z A;  4MV6 A;  4ZYS A;  1K83 H;  4DV6 Q;  2YL2 A;  5EQ0 A;  4FF1 A;  4QIW B;  4RAY A;  2E75 C;  2YYZ A;  1BJT A;  1LUZ A;  1YBY A;  1Z7T A;  5FJ8 G;  4NXN H;  2K05 A;  2RHQ B;  3BAB A;  1CK1 A;  1WTW A;  3V6H A;  2XN9 C;  2ZXP A;  2ZTD A;  5C8Y F;  2G5D A;  3G6X A;  3R8B A;  2W6M A;  1U4P A;  3T5H A;  3A54 A;  1QJO A;  4YCU A;  1ILP A;  4H13 C;  3N41 B;  1HFG A;  3KLR A;  5J2T F;  5EWE A;  4GLX A;  4ED2 A;  5IYB H;  4DR3 L;  2ZXO A;  3CCQ A;  4DV7 Q;  3EIV A;  2MJ8 A;  3RMH A;  2R61 A;  3ONA B;  2WAQ B;  4JW0 A;  2HHH H;  1SMY D;  1K0S A;  1PTO F;  3K7A H;  1TVX A;  3SK6 A;  1EYZ A;  1WTX A;  5JQW A;  3BZK A;  2F0N A;  2CQY A;  1TWG H;  2RDI A;  4JV2 A;  3V6K A;  1Y1W B;  2UXB H;  1D6E C;  2WB1 B;  1PTO H;  2EXD A;  4DV3 H;  4F4W A;  2M9V A;  3VPD A;  4B3T L;  5LYJ F;  3SEB A;  3C1E A;  2K01 A;  4A3I B;  4X66 L;  2IL8 A;  3WWV A;  2R7Z G;  3IAY A;  3HOZ G;  5LL6 S;  1TWH H;  1GM5 A;  4U6P A;  4DV6 H;  4IUQ A;  1C4Q A;  1I3Q A;  4GKK H;  3S17 B;  3L9A X;  2TMP A;  3H0G B;  3S14 B;  3QIA A;  2QA4 A;  4OEM B;  3RZD B;  4HJ5 A;  1SJH D;  2CW0 D;  4JI8 Q;  3FKI A;  2UUC L;  4PDB A;  4LF8 L;  1ICW A;  3K5O A;  3J80 c;  2E2D C;  4C2M A;  3UE0 A;  4RKB A;  5KFU A;  1HFN A;  3U58 A;  4QUC A;  4ULL A;  4HQ6 A;  4WJW A;  2JA7 B;  2GVB A;  4A3F B;  1R9T B;  4YR2 A;  1TWF A;  3R5H A;  1PH5 A;  4C1N I;  4JK1 C;  3GV8 B;  1SFO A;  1V1P A;  1B9M A;  4MTN A;  3EVQ A;  4R4Q A;  4C1N K;  1QCB D;  3VA5 A;  3K3V A;  2E2J H;  1GSA A;  2RQX A;  3L0O A;  2I5L X;  4X62 L;  3BYT B;  4OWW B;  5CBA E;  3CMA A;  4A2A A;  5KG4 A;  5EKL A;  2YZN A;  4F4Y A;  3CAM A;  4OEL B;  4FBT A;  1BVS A;  3K0X A;  4RHR A;  3T16 A;  3DMU A;  1GUT A;  2KJX A;  3GIQ A;  1J5E Q;  1PH7 A;  2YW2 A;  5IT9 W;  4WJ4 A;  1SNP A;  2E2I B;  4JV5 H;  1XTD A;  4F87 A;  5KFM A;  5C0X H;  2CW7 A;  2FMA A;  5JH7 F;  3RJ0 A;  1V43 A;  4J9L A;  4LH6 A;  5HBR B;  5JJL A;  3C3L A;  1M4V A;  3ER0 A;  3S1R H;  3H3V I;  3G7L A;  4JI0 Q;  3PR5 B;  1N32 L;  4BY7 B;  3H0G G;  3QOL A;  3GTL B;  1K8A C;  3G6V A;  2K5V A;  2K7V A;  2F4V H;  5C4X H;  3NEM A;  2B63 H;  4HID A;  1BGW A;  2ZM6 L;  1B9N A;  3OSN A;  2X6L A;  4LF5 H;  3SR1 A;  1JKJ B;  5KT3 A;  1X65 A;  3H6M A;  2X0S A;  1TWF B;  5IP9 G;  2EOT A;  1Q7Y C;  1YJN A;  2ZDH A;  1PFS A;  4F8M A;  3K59 A;  2B63 A;  3P7J A;  3TQT A;  1DCZ A;  2IX1 A;  1VQA A;  5FLX c;  3T1H Q;  2JA7 H;  1AP0 A;  3L7Z C;  2O4X A;  1STE A;  1WTV A;  4XDX A;  2HHH Q;  2RHS B;  4F4X A;  1EU3 A;  4DAY B;  2PMZ E;  2RBM A;  3I73 A;  4LMY A;  3AEV A;  1VQM A;  4KN7 C;  1V1O A;  5HV6 A;  5AJ3 L;  2PQE A;  1C0A A;  3V96 A;  1AH9 A;  4GLA C;  1QZH A;  1CKN A;  2QEX A;  1A3U A;  2XGQ A;  4TV8 F;  1VQ4 A;  3GV6 A;  1SXT A;  3MXN B;  5D14 A;  2YS6 A;  3U9O A;  4GLV B;  1PH9 A;  3ETH A;  4X3S A;  3STB D;  2UXD H;  1T94 A;  4UP8 A;  4MV7 A;  1N33 H;  1JC7 A;  1LT5 D;  3HB9 A;  5ELO A;  1S9F A;  3NWT A;  3VR4 A;  1ENC A;  1BXT A;  3W1G A;  1I4X A;  1DOK A;  1TWC B;  4O3R A;  4BXX H;  1X3G A;  1U0L A;  1MKH A;  1STH A;  3CW2 C;  1VQL A;  5JJI A;  3HKZ E;  1KTK A;  1A2U A;  3H94 A;  2XWJ B;  1Z6H A;  4IZO A;  3MZ5 A;  5C0X I;  1EUD B;  5FK9 C;  1PH6 A;  2B63 B;  3UQ8 A;  3GV7 B;  2K50 A;  1PK8 A;  1CQV A;  2YU9 A;  1PTO D;  2L1B A;  3NTI A;  5EPL A;  5FOB B;  2HDL A;  4HAE A;  4HN7 A;  3J81 j;  4DL3 A;  3H0G A;  2NU6 B;  4QGU A;  1QNK A;  3PV0 A;  1FR3 A;  5FO8 B;  3URY A;  3NTH A;  3IFD A;  3RFC A;  5LMU H;  2A68 C;  5KFP A;  4DR6 Q;  2F0D A;  1L0W A;  1GVP A;  4V0B A;  4DV5 Q;  4RAZ A;  1S0N A;  1EY0 A;  2FPG B;  1RDP D;  4MV3 A;  3PQI A;  2N78 A;  4UCV A;  2MHV A;  2DNC A;  2R92 B;  1MHW C;  1TQO A;  1HUM A;  3W3A A;  3BJU A;  5ELD A;  4X64 L;  4JUZ A;  4N8X 1;  3HKS A;  3NSW A;  3PSI A;  1LLR D;  1U4M A;  2NVX H;  1G51 A;  3FRP B;  4JPB W;  1N33 Q;  1SYX B;  4IR9 A;  5DLF A;  1C48 A;  4WD3 A;  1GUN A;  4FNF A;  3GTJ H;  3HOY B;  3FMC A;  2R7N A;  3DWP A;  1EUC B;  3M4Y A;  4KY7 A;  2W9A A;  4BA1 I;  3VYT A;  4HSV A;  4HIM A;  1RTN A;  3S1Q H;  2ZDQ A;  5KFB A;  5IT9 E;  1MD2 D;  1BOS A;  1WCM B;  5GAG C;  3TRE A;  3CCU A;  1JWS D;  5ELB A;  2KSW A;  1FD7 D;  2W6O A;  2A1A A;  5IT9 c;  4FU0 A;  2WB1 G;  2I80 A;  4KMU C;  3HOU G;  3EQL C;  2VB2 X;  1NNX A;  1RJR A;  2ZTE A;  4DR6 L;  1XMQ H;  4LF6 L;  1VBG A;  5C44 B;  3SK8 A;  3DXJ C;  1D5M C;  1XTC D;  3CC4 A;  4JI7 L;  4DV2 Q;  4DR2 H;  3GD7 A;  3PIO 3;  2NVQ H;  3MJF A;  4JI4 H;  2AQ3 B;  1D5Z C;  3TQY A;  4JI6 Q;  3J80 i;  1PXU A;  1GXD C;  4PZ6 A;  2X69 A;  5M5Y H;  1OXU A;  1QVC A;  2C5C A;  1I50 A;  1P16 A;  5G3L D;  1IOV A;  2NVT B;  3TS0 A;  4UCO A;  3I91 A;  5M3F H;  1DM0 B;  4HED A;  4LW1 A;  1Z9F A;  3MWM A;  2IT1 A;  1VBH A;  3LGJ A;  1XMO Q;  4EGV A;  1I94 H;  5IE8 A;  2HUG A;  2R92 G;  3WOE A;  2UXD Q;  5IGB A;  4DK1 A;  2JA7 G;  4Y52 H;  2VPQ A;  1TWF H;  4DAY A;  4A4I A;  2W8L A;  3RBE A;  5KG0 A;  2M2L A;  1V1Q A;  2WKD A;  1VQN A;  4IRC A;  3PIP A;  1KNE A;  1XPR A;  3DEP A;  4NXN L;  2E76 C;  1NCV A;  5CAE B;  4DK0 A;  2IHF A;  1ET9 A;  2RSN A;  2SDF A;  4IO9 A;  2JA8 H;  3RLO A;  5KND A;  4UCT A;  1B8A A;  3BJY A;  1A2T A;  3TBI B;  4R1J A;  5CV4 A;  1JLL B;  1TR5 A;  2F0F A;  4RU9 A;  1CSQ A;  3K81 C;  4ZKB B;  4ME5 A;  1JE5 A;  2W57 A;  4K2K A;  1UEA B;  3PR4 A;  2JEJ A;  1SYC A;  4OXP A;  4RGT A;  1XMO L;  3V2T A;  1JOK A;  5EWF A;  3KDF A;  4A3K B;  4CDF C;  2MFI A;  5LMU Q;  4OON A;  5KFF A;  2V4Q A;  1UAP A;  3D4W A;  4DFA A;  3I7F A;  1D7Q A;  1EZ1 A;  1GUS A;  3HOV B;  3HKZ G;  3R93 A;  1STA A;  3G4S A;  2QIL A;  5KFR A;  4U7C A;  4RUC A;  3PUZ A;  1JWM D;  4IUR A;  2KED A;  4DV4 Q;  3RIZ A;  4ED0 A;  4XT3 B;  1SNC A;  3Q24 A;  3N40 P;  4L8J A;  1WTO A;  1QUQ A;  3PGZ A;  1YHQ A;  3NQI A;  1YNN D;  2B2V C;  5KG5 A;  1OXX K;  5KIX A;  3CCR A;  4HYK A;  2KUM A;  1MSG A;  3RUZ A;  2P0A A;  4ME3 A;  5IGD A;  5IIF A;  4EVO A;  4POF A;  1AFP A;  2FHT A;  1T36 A;  5F9N A;  4L1K A;  5M3F G;  4MTK A;  1BCP C;  4PQX A;  1M90 C;  5GQO A;  3A0J A;  2J4X A;  1GGO A;  4QWB A;  4RZR A;  4ID6 A;  2CQO A;  5C4Z A;  4XYM B;  2Q8R E;  2ZT9 C;  3X3N A;  4RH6 A;  2UUA H;  1L0Y B;  1LAC A;  4WBN F;  2C35 B;  4DL7 A;  5IGC A;  3SE7 A;  4DV7 H;  4JC0 A;  2PMZ A;  4PMC A;  2UVR A;  2XSC A;  1IBM L;  2R93 H;  4X3K A;  4I4T F;  2F0S A;  2RCF A;  1HNZ H;  4KKT A;  4RFB A;  4XT1 B;  4BBS H;  3BG5 A;  3G71 A;  3F1Z A;  5M5X B;  2VUM A;  5M3M H;  3PO2 G;  2W70 A;  5LMN Q;  4EGQ A;  2VQE L;  3ORR A;  5C1P A;  3U50 C;  1PRT B;  1PH2 A;  2WE6 A;  2YS7 A;  4PZ8 A;  4IFD J;  2JEA I;  1TWH A;  4RA8 A;  4EYI B;  1O7Y A;  4UDU C;  4EG0 A;  1E2Z A;  4JI1 L;  4M9U A;  5DQI A;  1K8O A;  1SE4 A;  3STB C;  4TV9 F;  3P20 A;  3N42 B;  5LMN L;  3MR5 A;  3TDQ A;  4IUT A;  3S15 H;  4EGJ A;  3FP9 A;  4K5V A;  2JEF A;  2AQ4 A;  1CFM A;  2LKV A;  1BUV T;  3VYU A;  5C44 H;  1RK6 A;  2EY6 A;  5I2X A;  3VR6 A;  3S2H B;  5IYC H;  1EYA A;  4OIK A;  1CS0 A;  3IFT A;  1KRT A;  3CQZ A;  4LH7 A;  1B04 A;  4O4L F;  3CCS A;  5IP7 H;  4LFB L;  3OHB A;  4O42 A;  3VYS A;  2ENB A;  1A9X A;  2L5T A;  2VY3 A;  5CA1 F;  5IOC A;  5IWA Q;  3HXL A;  1C9O A;  2SOB A;  5I9O A;  1SYD A;  4ZQ3 A;  4DV0 L;  3E3X A;  4DR2 Q;  1XDN A;  4DV2 H;  2Z0S A;  2HIV A;  5EBC A;  2VUM B;  4S3S A;  1Z2O X;  5KFK A;  4A3B G;  1UNN C;  5KFT A;  3N52 A;  2OWO A;  2F3W A;  2O5I C;  1FL0 A;  4QW8 A;  5IWA L;  5C3X A;  5KNC A;  2FK2 A;  4YWK A;  1O75 A;  4YJ3 F;  3IG0 A;  3KHR A;  2R82 A;  5A2Q W;  1PFM A;  4XTC S;  1HNW Q;  1B4O A;  1KBL A;  1BNZ A;  3PF5 A;  1N36 Q;  2QKI C;  3NE5 B;  2WIN B;  3S16 H;  1CZW A;  2JA8 B;  3BVZ A;  3NUC A;  3JAM L;  3G6Y A;  2YCH A;  4JV5 Q;  4DF7 A;  4CC5 A;  2B8F A;  5LP6 F;  1Y1V H;  3GQB A;  1KQS A;  1BCP D;  4ED7 A;  4A2B A;  1HPC A;  1S5C D;  4DR5 L;  1D8L A;  1N33 L;  3GTP B;  3GTK B;  3DWA A;  3I4M H;  4P71 A;  2NVQ B;  1Y8N B;  2I0Q A;  4DV4 L;  4C2M B;  3MA2 B;  2CHB D;  3JAM i;  1A15 A;  1VF7 A;  4MV1 A;  1EZ6 A;  5ELC A;  2E5L H;  3M7N A;  4J9N A;  2NU7 B;  2VL6 A;  3PUW A;  4QB4 A;  4X3U A;  4ECS A;  4AQY H;  1DON A;  2NU9 B;  2VW9 A;  1R9T A;  4L5T A;  1BDO A;  4B3T Q;  4MTD A;  5DGA A;  4NXM H;  3KBG A;  5I2Y A;  4C3J G;  2WB1 A;  4J8Q A;  3JAM E;  1L1O C;  3A7L A;  3QJY A;  1SEB D;  3BQ2 A;  1BCP F;  2A5H A;  3U4V A;  2KEE A;  3G48 A;  1QVG A;  2EXZ A;  2A74 C;  2C9O A;  3BQ0 A;  3M9O B;  3OWF A;  2FK1 A;  1R4P B;  3OPO A;  2QF7 A;  4X62 Q;  5LXT F;  4YBZ B;  1I6U A;  4R4C A;  5M5W B;  4PNY A;  1RYS A;  4DV1 L;  1EQT A;  2UUC Q;  1I3Q B;  1I50 H;  1IBM Q;  2NWG A;  1OTC A;  1Y8O B;  1K1Q A;  1KL9 A;  5LMN W;  3FHW A;  3KLS X;  2N8N A;  5L1K A;  5L9X A;  2EJG C;  1EY9 A;  2VXW A;  5DEH A;  2A19 A;  2J6U A;  4QL5 A;  5KX5 F;  1CI3 M;  2JJQ A;  1HQR D;  2EDG A;  2O5J C;  2EY5 A;  1SFO B;  3M4I A;  3TP8 A;  3J81 W;  3BU2 A;  1SE3 A;  2B39 A;  4POG A;  2JA6 G;  3NEL A;  4R4I A;  3CU7 A;  1ZYR C;  2V59 A;  3M3Y H;  3SI8 A;  1UNS A;  2VZA A;  4PWQ A;  4A3J H;  1SEI A;  1K73 C;  5BR8 Q;  2A6H C;  1W6K A;  1HXY D;  3E0J A; 
#chains in the Genus database with same CATH homology
 5C44 G;  2JA5 H;  4BA2 I;  1PH1 A;  2GVB A;  3KOJ A;  2CCZ A;  1UE7 A;  1Q46 A;  4AQY L;  2ZTC A;  4DR3 Q;  1K9M C;  2VUM G;  1PH5 A;  5C3E G;  4K0K Q;  4LFC Q;  4WJ3 M;  4YHH Q;  4JYA L;  1L1O B;  4MTN A;  4R4Q A;  1IBK Q;  3HOY G;  3W1B A;  1WCM H;  1VQ5 A;  4GNX B;  4OO1 G;  2E2J H;  3ICE A;  3L0O A;  4RG1 A;  2I5L X;  2PQA A;  4X62 L;  1XJV A;  4OWW B;  3CME A;  2UU9 L;  2GVA A;  2KEN A;  4PZ7 A;  2JQO A;  3A5U A;  5JJK A;  4JCV E;  4J15 A;  3CMA A;  4A75 A;  1H95 A;  4A3L G;  2VNU D;  4O2D A;  3CAM A;  2KCM A;  1BVS A;  1VQK A;  3K0X A;  4C3I H;  2D0O A;  4GOP A;  2ASB A;  1J5E Q;  1HNX Q;  1PH7 A;  1XNQ Q;  2UXC Q;  1YHB A;  4GKJ L;  2JE6 I;  4WJ4 A;  1E3P A;  3F8T A;  2UUB L;  3M4Q A;  4A3J G;  1XTD A;  4GNX A;  4LF9 Q;  4DV3 L;  4GN4 B;  4A3K H;  4JI8 L;  2AWN A;  1V43 A;  4H02 A;  1Z47 A;  3E9I A;  4NPS A;  5JJL A;  3ER0 A;  2B29 A;  3JC6 6;  2JK8 A;  3S1R H;  3H3V I;  3Q8D A;  1UE5 A;  4JI0 Q;  5GAH C;  1N32 L;  3H0G G;  2UXB Q;  4GOP B;  1K8A C;  1WCM G;  2K5V A;  3W5O A;  4EX5 A;  3ULJ A;  5C4X H;  1JJ2 A;  1SN8 A;  3NEM A;  2K5H A;  4HID A;  1EQQ A;  4LF4 L;  3HOX H;  2ZM6 L;  2B63 H;  4QY7 A;  3NEN A;  4BY1 G;  1X65 A;  1IXR A;  1GD7 A;  4A3L H;  1V9P A;  1RIP A;  5IP9 G;  1Q82 C;  2NVY H;  4A3I G;  1N34 L;  1Q7Y C;  2Q2I A;  1YJN A;  3D31 A;  1PFS A;  3KF6 A;  4DR5 Q;  4AIM A;  2MO0 A;  2IX1 A;  1VQA A;  5FLX c;  3T1H Q;  2AMC B;  1NMF A;  3L7Z C;  4PMW A;  2HHH Q;  2JA7 H;  2B3G A;  2FXQ A;  2RHS B;  1JB7 A;  1K0R A;  4A3F H;  4A3K G;  3GTP H;  4DAY B;  4A3C H;  1HH2 P;  1X6O A;  1GO3 E;  3K80 C;  3VDY A;  2PMZ E;  1Q86 C;  2JA6 H;  3J7Z C;  1S3O A;  2Y0S E;  2ALY B;  1SMX A;  3PUY A;  3CPF A;  5JEA J;  4A3M H;  1VQM A;  3AEV A;  4DUZ L;  1M1K C;  1L1O A;  5AJ3 L;  1EFW A;  3AFQ A;  4JBM A;  1C0A A;  1QVF A;  1AH9 A;  4GLA C;  3HOW H;  1QZH A;  1CKN A;  4OO1 I;  2QEX A;  5C4X G;  4LUZ A;  3KF8 B;  1VQ4 A;  3F2C A;  4DR1 Q;  2YTY A;  3M4P A;  3MXN B;  1CSP A;  3F2B A;  4GLV B;  1PH9 A;  4YCW A;  3STB D;  4LF4 Q;  1S40 A;  1HJP A;  4UP8 A;  4GNX C;  2E2H H;  1W2B A;  5ELO A;  2OCE A;  3MEF A;  3T1H L;  1SE8 A;  4QJF A;  5HGQ A;  1PH8 A;  1VQ8 A;  1N36 L;  4A3G G;  1JT8 A;  1TWA H;  3HOV H;  4JBJ A;  4R4T A;  3UDG A;  3W1G A;  5IYD H;  1CKN B;  4L5Q A;  1ASZ A;  4QQB X;  1B7Y B;  1JJC B;  3TS2 A;  4HIO A;  5J3B A;  1X3G A;  4BXX H;  1U0L A;  1XMQ L;  1MKH A;  1VQI A;  3CW2 C;  2KCT A;  1VQL A;  4A3C G;  5JJI A;  3HKZ E;  1IZ6 A;  1Q12 A;  2Q2H A;  1VQC A;  4DK3 C;  2DUD A;  5C0X I;  1SRU A;  4YCV A;  3AFP A;  3S1N H;  3KF6 B;  1Y1W H;  1PH6 A;  1KRS A;  2Z6K C;  2K50 A;  4BBR G;  1PV4 A;  4JI5 L;  2OTL A;  4DK6 C;  1YVC A;  4JOI C;  2ZJP A;  4X66 Q;  3I4O A;  1X3E A;  4DV7 L;  4JI3 Q;  4LF5 L;  4A3G H;  5IYC G;  3J81 j;  3S2H H;  3GDE A;  1HNZ L;  3UDX A;  4QGU A;  3PV0 A;  5ELN A;  2CWA A;  2YTV A;  4X65 L;  1N8R C;  1UEB A;  5M5W H;  5FLM H;  5JEA G;  4JG2 A;  4L5R C;  4OX9 L;  4DR6 Q;  2UXB L;  2KHJ A;  3UE1 A;  4JI3 L;  1L0W A;  5FJ8 H;  1RL2 A;  4HJ7 A;  1GVP A;  3KLW A;  4Y7N H;  2ZJQ A;  4AQY Q;  1YIJ A;  4DV5 Q;  1BBU A;  1SFO H;  1GKH A;  5IP7 G;  2N78 A;  4A3I H;  4B3S L;  2D62 A;  2R7F A;  4DUY L;  4DR4 Q;  2VUM H;  3G6E A;  1QZG A;  3BJU A;  4X64 L;  1MJC A;  1PA6 A;  1UE6 A;  3HKS A;  3PSI A;  1BBW A;  2BA0 A;  2NVX H;  1G51 A;  2AWO A;  2LXJ A;  1N33 Q;  4B3R Q;  4LUO A;  4LFB Q;  4JI2 Q;  5M3M G;  1YEZ A;  2MNA A;  1VQ6 A;  3PO3 G;  2I5M X;  4IJH A;  4DV6 L;  3PO2 H;  4JI2 L;  1PYB A;  3GTJ H;  4GKJ Q;  1JJG A;  4DR4 L;  1I5F A;  4JBW A;  4BA1 I;  4DUZ Q;  4HIM A;  3S1Q H;  4JI5 Q;  3IRB A;  1L2F A;  2BH2 A;  2E8G A;  4EQ5 A;  5GAG C;  1G29 1;  3TRE A;  1X3F A;  2K75 A;  3CCU A;  1G6P A;  3DM3 A;  2VQF L;  1CKO A;  2A1A A;  5IT9 c;  3DLL A;  2WB1 G;  2HHH L;  4HJ8 A;  3HOU G;  2Z6K A;  2R7Z H;  5C0X J;  2ZTE A;  3HOZ H;  4DR6 L;  4LWC A;  4LF6 L;  3H3V H;  2F3I A;  1J6Q A;  4JI7 L;  3ULP A;  3CC4 A;  2BH8 A;  1VQO A;  1N9W A;  4P75 A;  4DV2 Q;  3UDF A;  3GD7 A;  1SR3 A;  3FKI H;  4YHH L;  3PIO A;  1NTG A;  3TQY A;  4JI6 Q;  3J80 i;  2NVQ H;  4JYA Q;  1UWV A;  3S1M H;  2MQH A;  4PZ6 A;  4BXX G;  1WJJ A;  1A62 A;  5M5Y H;  4B3S Q;  2ATW A;  1A0I A;  1OXU A;  1QVC A;  1VQG A;  1LTL A;  1P16 A;  1X9N A;  3U4Z A;  4R4O A;  3TS0 A;  1IBL L;  5M3F H;  2Y0S G;  1Q8K A;  2ES2 A;  4K0K L;  4LW1 A;  1Z9F A;  2IT1 A;  2N49 A;  3LGJ A;  3ERS X;  5IP9 H;  5LMU L;  1XMO Q;  4GOP C;  5IE8 A;  3OW2 A;  2B63 G;  3GO5 A;  1E1O A;  2R92 G;  2QGQ A;  2VQE Q;  1KIX A;  3TEH B;  4NXM Q;  4B3M Q;  5E7N A;  2UXD Q;  4Y52 H;  2EIF A;  2JA7 G;  4JV5 L;  4TQU S;  1TWF H;  4DAM A;  3L2P A;  4JI4 Q;  1WYD A;  2K5N A;  4A4I A;  1EWI A;  1LM0 A;  1HR0 L;  4JI6 L;  1V1Q A;  1WFQ A;  1VQN A;  2WAQ G;  1YJW A;  3CQZ H;  1HR0 Q;  3PIP A;  3GTK H;  4A3B H;  4IOA A;  1XPR A;  2HQL A;  1O7I A;  4OWT B;  2K52 A;  4NXN L;  3A5Z B;  1OXS C;  3GTG H;  3PCO B;  2KHI A;  4NXN Q;  5DLQ E;  4C2M H;  2IHF A;  4AH6 A;  2L15 A;  4IO9 A;  2JA8 H;  3RLO A;  5AJ3 Q;  4DV3 Q;  1B8A A;  1WOC A;  4IJL A;  4DNI A;  4A3M G;  1IL2 A;  4JOI A;  3RN2 A;  4ALP A;  4R1J A;  2IY5 B;  1HZC A;  1TXY A;  4KHZ A;  3S2D H;  1VQ7 A;  1CSQ A;  3K81 C;  4DUY Q;  3CXC A;  4NXM L;  1JE5 A;  1A8V A;  1OXT A;  3H15 A;  2JEB I;  2IX0 A;  1E1T A;  3I4M G;  1SLJ A;  1VQE A;  5M5X H;  2MO1 A;  1Q1E A;  4DV2 L;  4OXP A;  1XMO L;  4P74 A;  5C4J H;  4IPH A;  3KDF A;  1QUQ B;  4LUV A;  3H0G H;  3S14 H;  1IBK L;  2MFI A;  3RLF A;  5LMU Q;  4MNO A;  4OON A;  2NZO A;  1D7Q A;  3I7F A;  4LF7 L;  4HJA A;  2UUA Q;  2GN5 A;  3CCE A;  3HKZ G;  1IBL Q;  3G4S A;  2R7D A;  3I2Z A;  4LF5 Q;  3PUZ A;  4IFD G;  5GAD C;  4DPG A;  1CKM A;  4A3D H;  4DV4 Q;  4GS3 A;  1VQJ A;  2R93 G;  3J81 c;  1YZ6 A;  3ZJY C;  4BY1 H;  2V1C C;  4A76 A;  1KAW A;  3KDF B;  3CD6 A;  1QUQ A;  4X65 Q;  4B3M L;  2UXD L;  3PGZ A;  4GN3 B;  1YHQ A;  4LF9 L;  4UP9 A;  4LF8 Q;  4A3F G;  4JI7 Q;  1OXX K;  5H1S E;  3CCR A;  1HNZ Q;  2WFW A;  1HR0 W;  4ME3 A;  2YU9 H;  3I4N H;  2YTX A;  1IYJ B;  4IPC A;  4POF A;  3CCV A;  1MJE A;  1PYS B;  3AYH B;  5M3F G;  1Q1B A;  1N32 Q;  1M90 C;  3S17 H;  1X55 A;  5GQO A;  1HZA A;  3A0J A;  3CCJ A;  5FLM G;  1HNW L;  3RZD H;  1I94 Q;  4LFA L;  2CQO A;  3M4O H;  4DV5 L;  4TVA B;  1E7Z A;  1KD1 C;  3S16 H;  5GRO A;  5HY6 A;  2NN6 G;  2VS1 A;  4JI1 Q;  3UDI A;  4LF7 Q;  2K4K A;  2C35 B;  1VQB A;  4X64 Q;  1N34 Q;  1PVO A;  3BZC A;  4JC0 A;  4HJ9 A;  1E24 A;  1X56 A;  3M9B A;  1IBM L;  2R93 H;  2CFM A;  1C7Y A;  3OTO Q;  2R92 H;  3I4N G;  4DV1 Q;  3KJP A;  4APV A;  5IYD G;  1ASY A;  4BBS H;  3PUX A;  1P8L A;  3G71 A;  3F1Z A;  2VQF Q;  2RCN A;  1AE2 A;  3J81 i;  2ZJR A;  1J5E L;  2UXC L;  5M3M H;  2ID0 A;  3J7A 5;  3PO2 G;  5LMN Q;  2VQE L;  2AHO B;  4A3E G;  2OQ0 A;  3U50 C;  5K36 G;  1PH2 A;  3GTO H;  3OTO L;  1MIU A;  1Y1W G;  3SGI A;  1E22 A;  4PZ8 A;  4IFD J;  2JEA I;  4C3H H;  1VQP A;  1S72 A;  2KBN A;  3HFZ B;  4JI1 L;  1R9T H;  1XNR L;  3STB C;  4O0A A;  4KHP L;  1VS0 A;  5LMN L;  4L5S A;  4HIK A;  1KXL A;  3S15 H;  3FP9 A;  4LFA Q;  4GN5 A;  2F52 A;  3T1Y L;  3RN5 A;  4YWL A;  3HOY H;  3E0E A;  1XPO A;  5C44 H;  2JA5 G;  5IY0 A;  1LYL A;  5EAY A;  4FDB A;  5IYC H;  3M85 A;  1VQH A;  2R6G A;  3ULL A;  5C3E H;  4GKK Q;  1KRT A;  2XTI A;  1YJ9 A;  2IHE A;  2EQS A;  4GKK L;  1KC8 C;  4A3D G;  3CCS A;  5IP7 H;  3GTM H;  3E9H A;  1K8G A;  4B3R L;  4LFB L;  2VY3 A;  1BKB A;  2F4V Q;  2RF4 A;  1NY4 A;  5IWA Q;  1NJI C;  1XPU A;  4IPG A;  1C9O A;  2NVT H;  2E2I H;  3RR5 A;  1EQR A;  2XGT A;  4RMF A;  4DV0 L;  2Q2T A;  1AE3 A;  1VQ9 A;  2A8V A;  4DR2 Q;  2WP8 J;  4XIG S;  2Z0S A;  1Q81 C;  3PO3 H;  2HIV A;  4DR2 L;  3KYH C;  3T1Y Q;  4A3B G;  3JAM c;  2UU9 Q;  1FJG L;  1SRO A;  2OWO A;  1Y1V G;  1FL0 A;  3B6Y A;  4P72 A;  5IWA L;  4AYB E;  3GTL H;  3KFU A;  4IOC A;  1XNR Q;  4YWK A;  1I3Q H;  2OTJ A;  3CPW A;  3AQQ A;  4XTC S;  1HNW Q;  4DR7 L;  3OYY A;  4IFD I;  1FVI A;  1HZB A;  1JMC A;  3EN2 A;  1FJG Q;  4LNQ A;  2JA9 A;  3TRZ A;  1NBW A;  1YIT A;  1A63 A;  2CWP A;  3PF5 A;  2N3S A;  1PHJ A;  1N36 Q;  1EIY B;  1OXV A;  3NBH B;  4C3J H;  3KJO A;  1I94 L;  4JI0 L;  2JA8 G;  2PI2 E;  3GTQ H;  3F2D A;  1KHI A;  1WI5 A;  3RNU A;  4A93 H;  4JV5 Q;  3CCM A;  2WAQ E;  2I5H A;  2Q2U A;  1Y1V H;  1FGU A;  1KQS A;  4BBR H;  1XMQ Q;  1EYG A;  1N33 L;  1EIF A;  4DR5 L;  1D8L A;  4YWM A;  4YY3 L;  4UP7 A;  4DV6 Q;  1K83 H;  3I4M H;  4P71 A;  3CF5 A;  2ZM6 Q;  4YY3 Q;  3K8A A;  1HZ9 A;  3FKI G;  3S24 A;  2LSS A;  1EOV A;  2YYZ A;  2I0Q A;  1LUZ A;  1YBY A;  5FJ8 G;  1W3S A;  4DV4 L;  2HT1 A;  2RHQ B;  2BA1 A;  1EUJ A;  4DV0 Q;  1VQF A;  3JAM i;  3M7N A;  2D0P A;  4JI4 L;  2ZTD A;  1Y14 B;  1TWC H;  2VL6 A;  3PUW A;  4A3E H;  1PH3 A;  2UUA L;  1YNX A;  1I6H H;  1VQD A;  4YCU A;  2VW9 A;  4DR1 L;  4KHP Q;  3HOW G;  3RZO H;  4L5T A;  4B3T Q;  4GLX A;  1NMG A;  4OX9 Q;  3D0F A;  1PH4 A;  1L1O C;  4KI0 A;  5IYB H;  4DR3 L;  3CC2 A;  3CCQ A;  1T9H A;  4DV7 Q;  3EIV A;  1B70 B;  3G48 A;  3U4V A;  4P73 A;  4LFC L;  1QVG A;  1CUK A;  4KLK A;  5BR8 L;  1U5K A;  4X6A H;  3K7A H;  1NE3 A;  4BY7 G;  4NB3 A;  4X62 Q;  2CKZ B;  2DGY A;  3BZK A;  2WB1 E;  4R4C A;  4UPA A;  2E5L Q;  1TWG H;  3HOV G;  4DV1 L;  3PUV A;  2HIX A;  2UUC Q;  2AKW B;  2LXK A;  3EBE A;  3HOU H;  1I50 H;  1IBM Q;  4OWX B;  2EXD A;  2PQA B;  1OTC A;  2H5X A;  2NN6 I;  1KL9 A;  3HOX G;  1YI2 A;  5LMN W;  4B3T L;  3FHW A;  5IYB G;  1DGS A;  2N8N A;  4X66 L;  2A19 A;  4PG3 A;  3WWV A;  2R7Z G;  1X54 A;  4BBS G;  3HOZ G;  4QL5 A;  4JBK A;  4MZ9 A;  1TWH H;  2YV5 A;  3CC7 A;  1GM5 A;  2F4V L;  4BY7 H;  2JJQ A;  4DKA C;  2K14 A;  4IPD A;  1YHA A;  3I56 A;  1UE1 A;  4DR7 Q;  4LF6 Q;  2PNH A;  2QA4 A;  4HJ5 A;  3BU2 A;  4JI8 Q;  4LF8 L;  2UUC L;  4POG A;  2JA6 G;  3A74 A;  3NEL A;  2UUB Q;  2PI2 A;  4R4I A;  3J80 c;  5GAE C;  3CCL A;  3CP0 A;  2NZH A;  3K7U C;  3RLN A;  3UE0 A;  3M3Y H;  4A93 G;  3I55 A;  4UY8 C;  2VZA A;  2OQK A;  4QIW E;  4A3J H;  1K73 C;  5BR8 Q;  3U58 A;  1HNX L;  2E5L L;  5C0X G;  1VCI A;  1XNQ L;  1K3R A;  3PF4 A;  4AYB G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...