4A3BG

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3bG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3bG01
4OWTB 1G51A 4QY7A 3OW2A 4JC0A 4YCUA 3PIOA 3S1MH 1BKBA 1WFQA 3U50C 4GOPC 2A1AA 2F4VQ 4UP8A 2NVQH 4DR7L 4JYAL 3KJPA 1QZGA 1Q82C 3AYHB 2JA6G 2MFIA 1EWIA 2LSSA 2XTIA 1YEZA 4YWKA 4X66L 4TQUS 4MZ9A 4A3LG 4JBMA 1YNXA 1YI2A 1VQLA 4DV5L 1EQRA 2D0PA 4GKKL 1FGUA 2JE6I 4JI4L 3S2DH 4A3CG 4DV1Q 4HIOA 4L5RC 3F8TA 4DR1L 2VQEL 3HOWG 3ER0A 3UDGA 3OTOQ 1R9TH 4JI4Q 1FJGQ 3RNUA 1AE3A 1CKMA 4DV1L 1C9OA 3PF5A 3B6YA 2LXJA 1X3GA 3RZDH 1KXLA 1KRTA 4A3KG 1FL0A 5LMNL 4IPCA 3CCVA 4A3EG 4BBRH 4DUZL 5IY0A 5AJ3Q 1E7ZA 2B63G 1HZCA 2K50A 4A3KH 4LF4L 3HOVH 4JYAQ 1IBKL 4DV2L 4LWCA 4NXMQ 1CKNA 4C3IH 1MJCA 2K52A 5C4XH 1IBMQ 4HJAA 1XNQL 3UDIA 3JAMc 3FHWA 3NENA 3GTMH 5JJKA 3CPWA 2VW9A 3OYYA 1QZHA 1N33Q 1VQNA 4AYBG 1K73C 1IBML 2Z6KA 4GNXB 3D31A 4IJHA 1I6HH 2Q2HA 4A3FG 4DR1Q 1L1OB 2BH8A 2JA8H 2Q2TA 3CCMA 3H3VH 4A3LH 2K75A 1MIUA 4MNOA 2VNUD 4TVAB 5IWAQ 3K80C 4YCVA 1XMQQ 1J5EL 4JI5Q 3GTOH 1HZAA 4X65Q 1RIPA 2RCNA 3UE1A 5LMUQ 3CCUA 3RR5A 4HIKA 1XPOA 2E5LQ 3KF6A 2ZTDA 4DV5Q 3S14H 5IYBG 4LNQA 5M5WH 4A3GG 3PUXA 4JI1Q 1OTCA 2KHIA 1BBWA 4GNXC 1PH5A 1BBUA 1GD7A 2KCTA 2N8NA 2VQFL 2OWOA 5K36G 5IT9c 5HGQA 2CCZA 3I4NH 4JBWA 4JCVE 4IJLA 4C3HH 3CCQA 1PH1A 4FDBA 1N8RC 2DGYA 1KL9A 1Q7YC 1Z9FA 1VQBA 2IX0A 1JT8A 1X54A 1HJPA 5GAHC 4IFDI 3H0GG 1G6PA 2N78A 2N49A 3HOVG 4DUYL 4JBKA 2BA0A 1HNWL 4GN4B 4O2DA 3WWVA 1UE1A 3A5ZB 4BY7H 1LTLA 2VUMH 3CP0A 4DR3L 2E8GA 4A3MH 4DKAC 1IBLL 1SLJA 1S72A 4A93G 2WFWA 1AE2A 1NMFA 4X62L 4LF9Q 1YHAA 3STBC 3ULLA 2WB1E 5FLMH 1YZ6A 1WI5A 1QVCA 3BU2A 4LFCQ 3GTPH 4XTCS 5M5YH 4LF6Q 1NBWA 4K0KQ 3U4ZA 3FKIG 4PZ7A 3STBD 1EYGA 2AMCB 3M9BA 1EUJA 3AFQA 1JJCB 4A3GH 2VQEQ 2R6GA 3G6EA 3PCOB 3RZOH 2D62A 4POGA 2Y0SG 1I50H 1VQDA 4JV5L 4LFAL 1HZ9A 2R93G 2JA7G 1RL2A 4KHZA 3ERSX 1V9PA 4P73A 1CKOA 3I7FA 4PZ6A 4LFAQ 4JI2L 1X3EA 1YBYA 3S1RH 3S17H 3J7A5 2I5LX 4GNXA 5AJ3L 3A5UA 1XPRA 1IBLQ 4JI0L 2E2HH 2IY5B 1X65A 3UDXA 2QEXA 2ZM6Q 1E1TA 2FXQA 3T1HL 1Q8KA 3FP9A 4PMWA 4R4QA 3S16H 1VS0A 2NZHA 3M85A 1PV4A 2HIXA 3M4PA 3G71A 4KI0A 5IP9H 5ELNA 4LF8Q 3T1HQ 5LMUL 1JE5A 4DR4L 1T9HA 2KBNA 1E22A 3MEFA 1PH6A 5FLMG 4X6AH 4LF8L 1OXSC 3CD6A 2PMZE 2JQOA 3IRBA 4LFCL 4BBRG 2ALYB 1YIJA 4A3IH 4BY7G 2OCEA 1NY4A 3PUVA 3I4NG 4JI5L 3M3YH 2CQOA 3CAMA 3M7NA 1H95A 2QA4A 5C0XG 3AQQA 5C44H 3CCSA 1JJGA 1G291 2CWPA 4DR2L 1I3QH 4QGUA 3CCEA 4L5TA 4AQYQ 5FJ8H 1K3RA 4P75A 5IYBH 3J7ZC 1Y1WH 1PH4A 3BJUA 3PUZA 4A3EH 2C35B 3CC7A 5IYCG 5IYDH 2R7FA 5JEAJ 2A8VA 2OTJA 1E1OA 1HNZQ 3HOYH 2VL6A 4A3JH 4GS3A 2H5XA 2OQKA 4JI3Q 2JA9A 3SGIA 4B3RL 5M3FH 4BA2I 1SN8A 1UE6A 3KF6B 1X9NA 1VQPA 1SE8A 3ULJA 1IXRA 4X64Q 3ICEA 4AH6A 2DUDA 2E2IH 5E7NA 4NXNL 3LGJA 1SROA 1XMQL 3CPFA 3EIVA 4MTNA 4GOPB 1M90C 2JA5H 5M3MH 4QQBX 4LF7Q 2UXDL 3KYHC 2KCMA 3PO3H 5ELOA 3I55A 3CXCA 4B3SQ 4LF5L 2ES2A 3PO2H 2UUBQ 3E9HA 3TQYA 4DV3L 3S1NH 4A3FH 2R93H 4A3JG 1SFOH 4L5SA 5EAYA 4A3BG 1N9WA 4LUOA 1Q1BA 2Z0SA 3ZJYC 2NVXH 4LF5Q 1K8GA 2UUBL 4KLKA 4JV5Q 4YWMA 3F2BA 1VQFA 1Y1VH 1B70B 4K0KL 2IHEA 4DUZQ 1I94L 4OO1I 1SMXA 2K4KA 1FVIA 2ZJPA 1GM5A 1PYBA 4KHPQ 3E9IA 3S24A 3CMAA 2PI2E 4YY3Q 2IHFA 3K0XA 3KLWA 1B8AA 1SRUA 4JI3L 5GAEC 2I5MX 5LMNW 1PA6A 1X55A 5FJ8G 3TS0A 3HOWH 1IZ6A 4NXML 4KHPL 1XNQQ 1PFSA 3K7AH 2ZM6L 4BXXH 2UUCQ 1UEBA 4GN5A 4O0AA 4DR3Q 2MO1A 2F3IA 1K9MC 3HOZH 4ALPA 4A3IG 2JJQA 1N36L 2I0QA 3HOUG 1YJNA 2R7DA 3BZCA 3S1QH 2Q2UA 3I4MG 2KENA 1D7QA 4HIDA 2VUMG 4OWXB 1TWAH 4A3CH 1P16A 2VY3A 3J81j 3PIPA 3EN2A 2UU9Q 4JI7Q 3KOJA 1KRSA 2JEBI 1XNRL 1TWFH 2HQLA 4C2MH 4JI6L 3KDFB 1HR0L 2E5LL 2JA5G 3PO3G 4DV7L 1PVOA 1B7YB 1S3OA 2YU9H 2AHOB 4OONA 4OXPA 2ID0A 4JI1L 3Q8DA 2OTLA 1Z47A 4JI6Q 4DR4Q 4OO1G 1X56A 4DV7Q 4DR2Q 2VQFQ 4AQYL 3GTGH 4GLVB 5IP7G 1CKNB 3CQZH 1TWCH 4YY3L 1JMCA 3F2DA 3CC2A 1YITA 1N34L 2JA8G 5JJIA 1V43A 4IOAA 1HNZL 1VQJA 2EIFA 3TREA 1PH8A 4P71A 3EBEA 4LFBQ 1N32L 3D0FA 1X6OA 4DV2Q 4OX9Q 1OXTA 4A4IA 4PZ8A 4DV4Q 5GAGC 3HOXG 3JC66 2GN5A 1Q46A 3TS2A 1VQAA 1WCMG 1DGSA 2PNHA 2YTVA 5C3EH 2MNAA 2UU9L 3HOYG 3HOZG 3GTLH 1Y1VG 4LF9L 4X66Q 4HJ5A 2K5VA 4LF7L 2F52A 4R1JA 4B3SL 2L15A 2CWAA 2RHSB 1N36Q 1NJIC 5IWAL 3PUWA 1L0WA 5GADC 4X64L 4DR5Q 1MJEA 3GTQH 2PQAA 3TEHB 3I2ZA 5IP9G 4NXNQ 4GKJL 1VCIA 3UE0A 4DV6L 4BY1G 1VQ6A 3HOXH 3I4OA 3L7ZC 1I5FA 2Z6KC 1N34Q 3CCLA 4LW1A 4GOPA 3GTKH 3CC4A 3HKZE 4YCWA 3A0JA 4R4IA 1K83H 1Q12A 4YWLA 4IPDA 4LUZA 4JI8Q 1CSPA 4DNIA 4B3TL 4LFBL 4IO9A 3W1GA 3CMEA 5IP7H 4OX9L 3PF4A 2ASBA 2KHJA 1UE5A 3G48A 4YHHQ 4ME3A 3W5OA 2UUCL 4NPSA 1OXUA 5M5XH 3RLFA 1VQCA 5IYDG 3K7UC 3GDEA 3KDFA 4IPGA 3J80i 4IFDG 4YHHL 3I4MH 2AWOA 3BZKA 3ULPA 1HZBA 3F1ZA 4UP9A 4PG3A 3I56A 4WJ3M 1X3FA 4EQ5A 1A62A 1BVSA 5M3MG 1C0AA 3HKZG 4QL5A 4DV4L 1Q86C 1VQKA 1K0RA 3E0EA 3J81c 2UXBL 4L5QA 1TWGH 1IL2A 2JA7H 1E24A 1U5KA 2WAQE 1QUQA 4R4CA 4H02A 4DV6Q 4LF6L 1PH9A 4X65L 3PGZA 4R4OA 2D0OA 1YVCA 3VDYA 1KC8C 1EFWA 1VQ9A 3H15A 4NB3A 1HNXL 4DR6L 3GO5A 3U4VA 2IT1A 2WP8J 4IOCA 5FLXc 5C0XJ 3KJOA 1Q81C 4BY1H 1JB7A 1Y1WG 4B3MQ 4UP7A 1C7YA 1VQ5A 1XTDA 4RG1A 2ZTEA 5LMNQ 2VS1A 4JOIC 4C3JH 4DV0Q 4HJ7A 1HH2P 2OQ0A 1VQGA 1Y14B 2MO0A 3U58A 1YJWA 4GN3B 3T1YL 1VQ7A 4BA1I 5JJLA 2HHHL 1U0LA 1QVFA 4DAYB 1TXYA 3G4SA 2GVBA 2XGTA 2YYZA 3PV0A 2JEAI 3H0GH 1N32Q 1VQOA 3CCRA 3RLNA 3KF8B 1GKHA 3TRZA 3K81C 1EOVA 4JI7L 1Q1EA 5HY6A 1ASZA 1VQ8A 1OXXK 2WB1G 5C0XI 1M1KC 3AEVA 2HT1A 4GKJQ 4Y52H 2VZAA 3S15H 1J6QA 1L1OC 1NE3A 3KFUA 4IPHA 5M3FG 3DM3A 1VQMA 5C44G 1E3PA 2N3SA 4DK3C 1IYJB 2B29A 1WYDA 3RN5A 1EIFA 4BBSH 1WOCA 2IX1A 1OXVA 3RLOA 1VQHA 5C4JH 3F2CA 4HIMA 1LM0A 2K14A 4GLXA 3FKIH 3H3VI 1A0IA 4P74A 1NTGA 4XIGS 3JAMi 4Y7NH 2PQAB 3NELA 2MQHA 4JG2A 2F4VL 5C4XG 3HFZB 1XMOL 2ZJQA 1D8LA 1WCMH 1EQQA 4LF4Q 1KQSA 3J81i 1PYSB 2YTXA 4JI2Q 4BXXG 4JI8L 1UE7A 2UXCQ 1L2FA 2R7ZH 4A3DG 2B63H 3HOUH 4A75A 3K8AA 2NN6G 2ATWA 1HNWQ 3T1YQ 2ZTCA 3RN2A 3PUYA 2QGQA 4A76A 1GO3E 5H1SE 4UPAA 1TWHH 1PHJA 3PO2G 5C3EG 2UUAL 1VQEA 3W1BA 4X62Q 4QJFA 3DLLA 1FJGL 4DR5L 4AYBE 1LYLA 2UXDQ 1A63A 2E2JH 1EIYB 2AWNA 4GLAC 1QVGA 1A8VA 2EXDA 4DAMA 1K8AC 1HR0Q 2K5NA 5J3BA 2NVYH 2K5HA 2HIVA 1KD1C 2UUAQ 4GKKQ 1HNXQ 5DLQE 4AIMA 1CUKA 4R4TA 1V1QA 4LUVA 5JEAG 1W2BA 4DK6C 3A74A 4J15A 2PI2A 2A19A 1CSQA 5GQOA 2NVTH 1YHQA 1P8LA 5GROA 3UDFA 4DV0L 2RHQB 1IBKQ 3S2HH 1I94Q 4BBSG 3M4OH 2YV5A 3AFPA 1KHIA 1XPUA 4POFA 4DR6Q 3CW2C 2V1CC 2Q2IA 4WJ4A 1XJVA 2BA1A 4RMFA 1O7IA 1L1OA 4IFDJ 4EX5A 1ASYA 1VQ4A 4HJ8A 2JA6H 5IYCH 3CCJA 4A93H 2YTYA 4B3RQ 3NEMA 5BR8Q 1GVPA 4DPGA 4JI0Q 3GD7A 1UWVA 1YHBA 4P72A 1WJJA 2R7ZG 1MKHA 4A3DH 1S40A 1JJ2A 2UXCL 3L2PA 2UXBQ 4DR7Q 2HHHQ 5BR8L 3PSIA 1N33L 2R92H 3J80c 1LUZA 4QIWE 1KIXA 3M4QA 1PH7A 1XNRQ 2RF4A 2Y0SE 4UY8C 2I5HA 4JBJA 4A3MG 3NBHB 3HKSA 4DV3Q 4APVA 2R92G 5IE8A 1PH3A 1NMGA 1J5EQ 2CKZB 2EQSA 2ZJRA 1PH2A 1KAWA 3CF5A 1HR0W 1QUQB 1AH9A 1VQIA 2WAQG 4B3ML 3OTOL 1SR3A 4OWWB 2JK8A 2CFMA 2GVAA 2B3GA 2NZOA 2AKWB 4B3TQ 4A3BH 4HJ9A 1XMOQ 3L0OA 1YJ9A 2LXKA 4JOIA 4DUYQ 1W3SA 3GTJH 2NN6I 3MXNB 2BH2A
chains in the Genus database with same CATH superfamily
4OWTB 4XYMB 4J9KA 3PIOA 2PCFB 1XXGA 1BKBA 2ZM6H 1HUNA 2JP1A 4GOPC 4UP8A 1YNND 1QZGA 1AW7A 1Q82C 3AYHB 2JA6G 2WB1A 4DV4H 2MFIA 1EWIA 2LSSA 1SBBB 1YEZA 4YWKA 4MZ9A 4A3LG 1HFGA 1VQLA 4DV5L 4N8FA 2JE6I 2XCAA 1KDBA 2FMMA 4YB8B 1B3QA 1JQYD 1JWUD 1FJGQ 3MXNA 4DV1L 2EJMA 1K1SA 1WCMA 3U9TA 3B6YA 4IZ8A 1KRTA 5KT2A 1Y69U 4DL4A 3CCVA 3V05A 1DD2A 4RAYA 1LTBD 2AQ2B 3FDTA 2B63G 1E7ZA 1HZCA 1PMRA 4C3IG 4N9TA 2FJ2A 5C5MA 1IBKL 1LTAD 3KHLA 1FNUA 5C4XH 4WJ4A 5JJKA 1XNQL 3C46A 4K5VA 2NVXA 1JDBB 4I50F 1N33Q 2WYOA 1EQTA 1IKLA 1IBML 5J2UF 1EIHA 1Y8NB 2Q2TA 1ZQ7A 3CCMA 3H3VH 4XQNA 5I9PA 2DY7A 4MNOA 2VNUD 1KJQA 4XX0B 4TVAB 1XMQQ 1J5EL 1OO9B 3DHQA 2BR0A 1PDQA 3Q8SB 5CA1F 2DNCA 2IW3A 2E5LQ 1LACA 3T1YH 4DV6H 2ZTDA 4DV5Q 1ICFB 5M5WH 4EQNA 2MJ8A 3NWTA 3AMUA 4ZCKA 1M8AA 4BS9A 2KCTA 4CJ0B 2VQFL 1SNMA 3OSNA 3X3NA 1HCZA 3BYTB 4CDDC 5IT9c 4DLKA 3Q23A 3CCQA 1EUDB 2W9CA 1XMQH 1PH1A 4HNTA 1EEID 2AGPA 3MXGA 2IX0A 3D3RA 1JT8A 2FKLA 5GAHC 2GPSA 4IFDI 3NGDA 2N49A 1K83B 2VQEH 3PMFA 4DUYL 1AZPA 3GQCA 4DR3L 4KJOA 2E8GA 1TA8A 3W3AA 2PO4A 1S72A 4MN3A 1VF5C 5D3DA 1NMFA 1CZGA 2OXPA 4LFAH 5FLMH 4C2MA 5FKAC 3V2TA 1QVCA 2V9WA 1BCPC 4LFCQ 2PVPA 3ORQA 3WOEA 4LF6Q 4O3SA 5KG1A 1F9RA 5KG6A 4PZ7A 3I72A 3STBD 2AMCB 1W93A 1FNVA 4IRKA 3EPGA 1F9PA 2G9DA 1YNJC 2R6GA 2L4NA 4MA0A 3FMCA 3T1HH 4POGA 2Y0SG 1I50H 5J1ZA 2FK3A 4YY3H 4QIWB 3PN1A 2FE3A 5KFPA 3E5SA 3FEWX 1U9RA 3ERSX 3OWFA 4HR7B 5D3IB 1CKOA 3I7FA 1JXLA 5DAUA 3SI8A 1R9TA 5KFZA 1X3EA 4K2KA 3S1RH 2VA3A 2AGOA 4K2LA 3Q1KA 4GNXA 1IBLQ 4JI0L 1E2WA 3V6JA 3HKZB 3AB9A 3NE5B 5KRUA 2IY5B 2UXCH 2ZM6Q 1TT2A 1ZYRC 1B6RA 2FXQA 3K3PA 5A2QW 4RH6A 4Q5VA 1N34H 2HIXA 2R7LA 1VBGA 4KI0A 5IP9H 4LF8Q 1DYQA 3H94A 4RHSA 3T53B 1JE5A 1C30A 1CA5A 1T9HA 4F87A 4G4KA 5JUMA 4IRCA 5FLMG 3QOLA 4ULLA 2A69C 3SK4A 1KNEA 3MXPA 1DZ1A 3ZYYX 3BDOA 4KV6A 2JQOA 3QB3A 4LFCL 4JW0A 4BBRG 3I4NG 1NY4A 1K83A 1EOTA 4RGTA 3M7NA 1PRTC 2K6AA 4GZYC 4QWBA 1I6VC 5C0XG 3CCSA 2WTFA 1JJGA 1I3QH 2EPBA 1NAPA 5IYBH 3JRXA 3J7ZC 2NUAB 4IFDH 3BJUA 1D6EC 2AQ3B 1NR4A 5IYCG 4FF4A 5IYDH 5IGGA 5LYJF 2K28A 3HOYH 5IT9L 2AUJD 3P1HA 1ILQA 3NWSA 1UUPA 1VAJA 5KG0A 1SN8A 1ZETA 1UE6A 3RB3A 1LLRD 5E1FA 2E2IH 4RB2C 1ZKOA 1XMQL 2WAQA 5M3MH 2KCMA 5E4WC 5CV8A 1J5EH 4JI8H 1BQQT 2ES2A 1EY4A 3ERQA 3H6MA 4I7AA 4DV3L 1RJPA 4LFCH 5IT9E 3S9WA 3J81E 1FGBD 2HUGA 1SFOH 5EAYA 4A3BG 1HR0H 2Z0SA 3ZJYC 3J81W 1QJOA 4BBRB 2UUBL 3VR2A 4JV5Q 3MWYW 4YWMA 2HGSA 1HQRD 3TQTA 1VQFA 2BE5D 3J80L 4M8AA 2IHEA 2K1BA 3KLSX 5IWAH 2N55A 4HCEA 4KHPQ 2PI2E 5IIFA 2I07B 2I5MX 5LMNW 4EBCA 1X55A 1Y8PB 5FJ8G 3HOWH 5BN3A 2RCFA 1PFSA 5EGTA 4O0AA 1Z2PX 4DR3Q 4V190 2R8IA 2EY2A 1G2SA 3T5LA 4A3IG 1N36L 2XN9C 4A3IB 2W9AA 3I70A 4DA2A 2R7DA 3VYTA 3S1QH 2Q2UA 5KFDA 2KENA 2VUMG 1TWAH 3FMAA 5NUCA 1P16A 2VY3A 3J81j 2XRQD 3OUUA 5L37A 2JEBI 3GIJA 3PO3G 3KDFB 1HR0L 3GTKB 1PVOA 2Y0SB 4G3IA 2R92A 4OXPA 4JPBW 4UCTA 3K5IA 4MV7A 2ID0A 4JI1L 1YNJD 3OMGA 4JI6Q 3S16B 4AQYL 2HDMA 4LMQD 3GTGH 1B33N 1Y1VA 1K28A 4GLVB 5IP7G 4ED2A 4YY3L 4F8MA 2I8CA 5DEHA 3F2DA 3CC2A 4KTAA 2H4OA 5BPHA 2JA8G 4RB3C 1PRTB 1VQJA 2R8GA 2YU9A 3EBEA 1CM9A 1N32L 3NTHA 4DV2Q 2LKVA 1SXTA 1PTOH 5C3EB 1XTCD 3JC66 4ECVA 1VBHA 4IR9A 1UC8A 1WCMG 4DU9A 1PTOC 4YBZB 3HOZG 1GHKA 1T94A 2HCIA 4X66Q 1STYA 4JUZA 4YQWA 4B3SL 2GPWA 4N8X1 2KA7A 5FPRA 4J9MA 1EZ8A 1N36Q 3PUWA 4EQPA 4X64L 2DLNA 2V58A 1EWHA 5IP9G 3VYRA 1K0SA 4KY5A 4RCNA 2R6FA 3RV3A 1VCIA 1JKJB 2W71A 3UE0A 4DV6L 4BY1G 2SNMA 4RNNA 3MAQA 4X66H 5EPKA 3N6XA 3L7ZC 3CCLA 1N34Q 2QW7A 2UVRA 3A0JA 4ZKCB 3KBGA 4R4IA 1HA5A 4YWLA 2VUGA 2KEDA 1CSPA 3P20A 4B3TL 2UVWA 4DR5H 4F50A 4PQXA 4EEYA 3CMEA 3SHLA 5IP7H 1HXYD 2ASBA 1RCVD 2B2YA 4ID6A 3TBIB 1UE5A 4YHHQ 1NNXA 2WIIB 3MXUA 3W5OA 1B1ZA 1C4QA 3RLFA 4LH7A 1M7JA 3K7UC 4H44C 4KN4C 3GDEA 1Y8OB 4IFDG 3F1ZA 4PG3A 4EBDA 2K5QA 5KIXA 1IBMH 1GHJA 1C0AA 3HKZG 4QL5A 4FVMA 3VR3A 5JJZA 5CV5A 3J81c 3MFHA 4L5QA 1E24A 1U5KA 1HTPA 3N42B 2I87A 2E76C 1VQ9A 1EFWA 5CYUA 5KG5A 3KAKA 2KCNA 5IOCA 3J80E 1HNXL 5DM73 4DR6L 2F0IA 2FLPA 2E74C 2YCHA 2C5CA 1JB7A 3PO2B 3MR2A 3CQZA 4RG1A 2ZTEA 2W6NA 3L3OC 4C3JH 4DV0Q 4HJ7A 3S1QB 2YYAA 3KLSA 2OQ0A 2KCCA 2ICIA 2X6LA 3U58A 2MO0A 1EYAA 2K01A 5J22A 4RNMA 5COYA 1ET6A 4UCVA 4QWDA 2V4RA 1C8CA 2Z8LA 5EJWA 3T4AC 4DV2H 4I4TF 4O1NA 3DF7A 1K3BC 3TSSA 1VQOA 3CRLC 3RLNA 3QOJA 3CCRA 3MJFA 1EOVA 1W6KA 3R5FA 1VQ8A 3K57A 5KFTA 1WR2A 2WB1G 4DV3H 4B3TH 2W6QA 1EU4A 2B2TA 2A6EC 4K8JA 4GKJQ 4Y8VB 1NSNS 3I12A 1B4OA 2KQ3A 4C5AA 3HRZC 1VQMA 5C44G 1E3PA 1STAA 2DY8A 5EWGA 5DG8A 4HSVA 3RN5A 3GTLA 3FPUB 4BBSH 4K0KH 2IX1A 1Z2OX 1OXVA 5C4JH 4AYBB 4GLXA 2K14A 4BY1B 4XIGS 3A7AB 3L9AX 3VA7A 4Y7NH 1KJJA 4QUFA 3NELA 4GKKH 4JG2A 1E4EA 1XMOL 3JAMW 5AFWA 4LF4Q 1SYXB 4BXXG 4L1KA 1UE7A 4FF2A 1L2FA 2R7ZH 4A3DG 3T5JA 4TQRA 2EYHA 3EA6A 3HOYB 2F0FA 2L55A 3HOUH 2FPPB 2AUKA 1ZHQA 1BF4A 2QGQA 2JEFA 1I4QA 4F4XA 2OEOA 5H1SE 3M4IA 2BDNA 2Z4IA 5C3EG 1VQEA 3W1BA 2D9UA 2QYZA 3DLLA 1FJGL 3QO2A 1G91A 4AYBE 1LYLA 1EY6A 2UXDQ 4LF4H 1EIYB 4GLAC 2R3ZA 2EE1A 2K5HA 3AU7A 3M7GA 4GKKQ 1SEIA 4AIMA 3D6CA 4LUVA 3ETHA 2R82A 2PMZB 2J7ZA 5KT6A 5DLFA 1VF7A 4IZOA 5EOYA 1P8LA 5GROA 1IBKQ 3GTPB 4BBSG 2BCOA 1ZXTA 1SYGA 3AFPA 1XPUA 2X0SA 1N33H 2V1CC 2UVUA 1O7IA 1SAPA 2FMCA 3RUZA 1VQ4A 1ASYA 4PNYA 4XQQA 5IYCH 3C2PA 3CCJA 1EQVA 3R93A 5CV4A 5BR8Q 3RIZA 4JI0Q 1RK5A 3R23A 5LMNH 2C2DA 2R7ZG 4A3DH 1NCVA 1B6SA 3QFFA 1S40A 1TS5A 2VQDA 3RTXA 2Z4HA 2XCLA 1I50B 4KY6A 4X64H 4QIWE 2B2WA 1KIXA 1PH7A 2C2RA 3MEHA 3VYSA 1TWGA 4A3MG 4R8UA 2LY7A 2TMPA 4O4LF 2NTTA 5ELEA 1FYCA 5I2YA 3NQIA 2CKZB 2EQSA 3CRKC 5JPMC 1KEEA 4J9OA 3CF5A 1QUQB 1CQJB 2I46A 5EPJA 2HJWA 3TIIA 4ZAIA 2CFMA 4HJ9A 2R7ZB 1YJ9A 4JOIA 2ASJA 4DUYQ 1KDAA 3N52A 5HV6A 3V6HA 4IR1A 1EYCA 4ED3A 3A8KE 1S03G 4JC0A 5L1JA 5LXTF 5F9NA 2A68C 2Z9HA 1WFQA 3U50C 2A1AA 2F4VQ 4JYAL 5C4JB 4BBSB 4KN7C 1A2UA 3T13A 1JLLB 3KLRA 3PW4A 1BJTA 2X69A 4A3KB 4MV4A 2M2LA 4JBMA 1YNXA 3ONAB 3BG5A 4Q44A 4JV2A 1EQRA 2D0PA 1MBYA 3A7LA 3K7AB 4ODGA 4HIOA 2NZ1D 3F8TA 4DR1L 1ZHSA 5C5JA 2OH2A 1NUCA 1Q90A 4YAJB 4J0MA 1CKMA 3R2TA 1B2TA 1JWMD 4ECZA 1Q8IA 3RZDH 4F4YA 4A3KG 2YRXA 2R7NA 4IPCA 1LABA 1CA6A 4CHTB 2UUAH 5IY0A 5LMUH 2NVXB 4Q0YA 3G6VA 4LF4L 1GUTA 5LHY1 4A3FB 1F2MA 1D5MC 3MWMA 4LWCA 2XSCA 1CKNA 3TS2A 1MJCA 2K52A 4HJAA 3JAMc 2NVQB 3MA2B 5I4DA 1SE3A 4E4TA 5F2DA 3K5HA 4AYBG 1K73C 1D5ZC 2Z6KA 4C3HG 4GNXB 1BDOA 3R5XA 1JX4A 2F0MA 4FXKC 1N48A 2BH8A 3Q24A 4A3LH 2K75A 2A69D 5JVG3 2M05A 5IWAQ 2JA6A 4A3JB 1HZAA 4X65Q 3G6XA 3TQ1A 3CCUA 2G9HD 2VB3X 4WJWA 3KF6A 2EYOA 3BG3A 5KFQA 1B3AA 3ND9A 4LNQA 3T5HA 1H9JA 4A3GG 4TUYF 4JI1Q 5JEAH 2YS6A 1SNPA 5K36G 4J9LA 4RB1A 3NSWA 2DN8A 4IJLA 4CC5A 5BN5A 5L1KA 3PW5A 2CW8A 2RA4A 2EY6A 2L12A 3H0GG 4KK7A 4OHJA 2N78A 4I7ZC 3DWAA 3WWVA 1UE1A 4B9WA 3I73A 2VUMH 1SJHD 1XDNA 3ITPA 3X3MA 2VUMA 2WFWA 2A73B 2ALZA 4K6LA 1YZ6A 2E2HB 4HYKA 2F0SA 4FBUA 5M5YH 4KHPH 2RBMA 1NBWA 3V6KA 3FKIG 5D1PA 4J9QA 1PZKD 4OELB 2OLSA 1JJCB 5CAEB 2D5DA 1ENFA 3RZOH 1M0TA 1DXMA 4LFAL 4V0BA 4C5BA 3GTGA 5ELBA 5JVH3 5EKLA 4FYDA 4PZ6A 3GTJA 3Q2OA 5EWFA 4UAIA 2B2VA 1STGA 3OHXC 3OPOA 2KECA 1QG7A 3BA9A 3A5UA 4JYAH 3UDXA 3GTGB 4XYOA 3IG0A 3T1HL 3S16H 1ENCA 5BN4A 3FP9A 4ZYSA 4QWAA 1VS0A 2NZHA 3M85A 4K5WA 1ML0D 3V96A 3H40A 4HMIA 3M4PA 1ET9A 3G71A 5EZYF 3MVVA 4C3JG 3VR6A 3FKIB 2YL2A 4QUCA 1H9SB 4X6AH 4LF8L 2VOBA 1TWAB 1AZQA 4CJ1B 1QWYA 4ZUIA 4DV1H 1YIJA 4A3IH 2OCEA 2CQOA 3CHBD 1H95A 3BAAA 4DL5A 1G291 3KALA 2KEEA 1GJXA 3IN5A 4ED0A 3HOWB 2A68D 4KHVA 3BVZA 3PUZA 4CJ2C 4JI2H 3CC7A 3TP8A 1A6XA 4LF8H 2CQYA 4O4HF 3H0GB 1GSOA 3GIPA 2B2TC 2H5XA 4DAVA 2BQ3A 1TIID 5KG3A 2JA8B 3BZDB 4BA2I 5I6WA 1R4QB 1X9NA 1K8MA 1SE8A 4X64Q 1IXRA 5E3FA 4AH6A 2DUDA 5FD5A 1JDEA 5KFEA 3GLKA 5FD6A 3H91A 4MTNA 1SYFA 1EYZA 2EOTA 3KYHC 3PO3H 1D1IA 1W6JA 5ELOA 3CXCA 2NBFA 3E9HA 3S1NH 1WH2A 4CC6A 4ZOLF 4A3JG 4L5SA 1WVLA 1N9WA 1RHPA 1Q1BA 4KLKA 4LF9H 2CHBD 2CW0D 3F2BA 4IUUA 2K4KA 1FVIA 1CI3M 1PYBA 4WBNF 5KX5F 3S24A 3CMAA 3KUPA 3OOCA 2IHFA 3KLWA 2K04A 1B8AA 3DXJC 4JI3L 2Q8TA 2CH4A 4J9RA 4NXML 4KHPL 1HRJA 4FXGC 2ZM6L 4BXXH 1UEBA 4GN5A 3I4MB 4ZRZA 2F3IA 1B9MA 4DR7H 2XD4A 2EYMA 3SE7A 1YJNA 3N41B 1S5CD 4NDXA 1CQVA 4C1NI 1II3A 4MTDA 3PIPA 5C1PA 2MGSA 4CBVA 4JI7Q 1FR3A 1HA6A 5D1OA 4C2MH 4UCUA 1EHIA 5C8YF 1X3PA 2JA5G 1LTSD 4DV7L 3I8ZA 5KG7A 1B7YB 3RBDA 2H1EA 1I4PA 1J9OA 5CORA 4DR4Q 2NU9B 1EY8A 3UI2A 2W8LA 3OHBA 2UU9H 1CKNB 3CQZH 4DGZA 2YZMA 3BA8A 1I6UA 3J80W 5JJIA 1V43A 4LH6A 1H9KA 3QIAA 1PH8A 3BABA 1LO5D 2SOBA 4P71A 4X3KA 3WNZA 4LFBQ 1BNCA 5JVLA 3D0FA 1X6OA 1HHVA 5JPNC 2DPJA 2DIKA 4DV4Q 3HOXG 4CKCA 1XWEA 4NKLA 1DGSA 2PNHA 4AQYH 3LMLA 5CV9A 4X62H 2UU9L 3A56A 1ESRA 2IBKA 5IGCA 1W96A 1H9SA 2L15A 2BQUA 1BO0A 4TSSA 5C3XA 1NJIC 2FPGB 5IGEA 1WTWA 4DR5Q 3GTQH 1S97A 4NXNQ 2L11A 2NU7B 5HGTA 2HVRA 2YU9B 3M4OB 4CGYB 1MI2A 2RDFA 3CC4A 2W6OA 1SNCA 4UDUC 1WTQA 1K83H 2R93H 4IPDA 2QK4A 3VR5A 4G7HC 2E2DC 2VXWA 1WTPA 2JN4A 4KY7A 4IO9A 3W1GA 3GTLB 4OX9L 4O42A 1BUVT 2KHJA 1I3QA 4RU9A 4ZHQF 1LTID 1XNRH 2BE5C 1UNSA 2IPKD 5C4HA 5IYDG 2A6HC 3KDFA 3J80i 3PIP3 4YHHL 1RK6A 1A3UA 3BZKA 1HZBA 4UP9A 3I56A 3C1EA 1TY2A 3GTQA 5KFRA 5M3MG 5M5WB 1A62A 3P75A 3MR6A 3H0GA 2F0HA 4KKSA 4H0LC 4DV4L 1Q86C 4NP5A 3TP5A 2J0TD 3RGXA 1HQMC 3I91A 2E2IA 5A2QL 4P2CB 4H02A 3IL8A 4DV5H 2Q8RE 3RB4A 1Z6HA 3PGZA 1KC8C 3KHGA 1DOMA 4KJNA 1GYFA 1QNUA 4NB3A 3C1FA 5FLXW 4KD4A 1TWFB 3GO5A 4JV1A 3NHHA 1CFMA 3M4YA 5FLXc 2R84A 3KJOA 2W6ZA 3VYUA 5KYLA 2F0QA 4UP7A 4UCOA 5I47A 4PV1C 2VS1A 4JOIC 1JOOA 3SDZA 3PVXA 1SMYC 4C1NK 3SK5A 1LT6D 4EBEA 1X3QA 4DV7H 3BDLA 5FK9C 3K5NA 1QVFA 2C28A 4DAYB 4ZLTF 1TXYA 1TQOA 2GVBA 2YYZA 3PV0A 1AP0A 4H13C 4EFEA 2C00A 3TRZA 4MIUA 4JI7L 1Q1EA 5HY6A 4FM9A 1LTTD 1SE2A 1ASZA 2B63A 3QJYA 1M1KC 4DNTB 5C0XI 3AEVA 2CQAA 5CV7A 2HT1A 5C44B 4XDXA 1A2TA 2B8GA 2E75C 3EJIA 1FJGH 3S15H 1L1OC 1NE3A 4IPHA 5M3FG 3DM3A 2A8VA 2N3SA 3MTSA 2B29A 1ZYRD 1S0OA 1DV1A 1EIFA 1AN7A 2XCPA 4DL7A 2UVVA 1WOCA 3RLOA 1FNWA 5CMDA 4HIMA 1LM0A 5EKIA 3H3VI 1PX2A 4ED7A 4JV0A 2DJGC 5D1OB 3K59A 2ZDGA 1LT5D 4E6IA 5J39A 2F4VL 5C4XG 1D8LA 1WCMH 4RUAA 1KQSA 2XWJB 1I50A 2UXCQ 4OL7A 3Q6SA 4MHEA 5KFJA 2FMAA 2QF7A 3WO0A 4MTKA 2B63H 4A75A 3K8AA 2WDTA 2PW5A 2ZTCA 4RFBA 3RN2A 4B08A 4A3EB 2PNRC 4UCSA 1SJED 1GO3E 1WD0A 1Y1WB 5IYZF 1E0BA 4GC7A 2K03A 4DR5L 2F0UA 1PZJD 1A63A 2E2JH 2FLLA 2AWNA 5KNBA 1QVGA 4OX9H 2EXDA 2K5NA 4QF4A 5J3BA 5KFNA 2W8KA 1HNXQ 2XGPA 4R7RA 1L2ZA 4IAJA 2YS7A 4LK1C 5JEAG 1W2BA 4ECXA 1ILPA 4X3TA 3GIMA 2PI2A 4HAEA 5GQOA 2X6GA 4DV0L 1CHQD 3MWEA 1I4XA 1KLUD 4Q8FA 3IFTA 5EPLA 1I94Q 2P0AA 2JA6B 3M4OH 2EYLA 1KHIA 5EKKA 4CDFC 3JSNA 3N8DA 1EEFD 3CW2C 3DM1A 1WTXA 2W6MA 3GIDA 3MWDA 2YZGA 2UUCH 2BA1A 4RMFA 1F2YA 1L1OA 1KJIA 4ZQIA 4NW2A 4RCOA 2V5AA 1ULZA 3S17B 1SMYD 1JWSD 1WTVA 3NEMA 1GVPA 2ZXPA 4DPGA 4WD3A 3GV7B 4P72A 5IGDA 1T3NA 1WJJA 1MKHA 2UXCL 2PZTA 3I3CA 4Q0FA 5BR8L 1C48A 3PSIA 4ED8A 1D1KA 3GTMA 1RTNA 2NVYB 2XWBB 2Z1CA 2PPBC 3M4QA 1XNRQ 3UQ8A 2Y0SE 1M6VA 1S0NA 1JB3A 3NBHB 3HKSA 4DF7A 4APVA 4DV3Q 2JXMB 1NMGA 1PH3A 1PH2A 1TWHB 1HR0W 2B39A 4OIKA 2W57A 5KT3A 4MV9A 3O13A 4IHJF 3Q22A 1SR3A 5KFIA 5DGAA 1L0XB 2AKWB 1PTOD 4A3BH 5DG9A 3NK9A 1XMOQ 3FKIA 2LXKA 1FGUA 1TU2B 4A3MB 4JVZA 2WB1B 4R4QA 2BH2A 2R8JA 1G51A 4QY7A 1I6HB 5KNCA 2DWCA 3SVMA 1F77A 4QW9A 3S1MH 1EY0A 1IOVA 2RDJA 4WORA 2L0CA 4IUPA 3SR1A 2HDLA 4DR7L 4C3IB 1O75A 4IWXA 2EZVA 3FPPA 2XTIA 3I4NB 2V59A 5HURA 2FLNA 3ETJA 2FHTA 5C4ZA 4GKKL 4JI4L 3S2DH 4A3CG 1S5BD 4XXEA 5KFFA 3HOWG 1CQFA 2WE6A 4FS2A 5CC4A 3TZDA 1SCUB 3OTOQ 4TQSA 3RNUA 1AE3A 2LXJA 1X3GA 2PQEA 2IX3A 2PBZA 2VPQA 3CVZA 3E0JA 5JQWA 3GV5B 3Q8PB 2F0JA 4A3EG 3S2DB 3JSLA 2RVLA 1CE8A 2QDBA 2O2LD 1V51A 3GIQA 3RJ0A 4XZ3B 4ABNA 2ATLA 4DV2L 4QWCA 4NXMQ 5KT4A 4C3IH 1TR5A 2L5TA 3UDIA 3NENA 2NVYA 3S1MB 3PW7A 5KNDA 1VQNA 4LF7H 2JA5A 4MV6A 4O3QA 1I6HH 4A3FG 1L1OB 5IT9W 2JA8H 1E2ZA 3D6WA 1MIUA 4A3BB 5CGKA 3RFCA 2JA7B 2RCNA 5LMUQ 3MC0B 3UE1A 4HIKA 3RR5A 4FF1A 3S14H 1Z7TA 5IYBG 1LT4D 3N40P 4IUQA 4LAAA 4WFN3 2EY1A 2ZDHA 3V4ZA 1BBWA 3HXLA 4GNXC 1PH5A 4YP3A 1JC7A 1RYRA 5LL6X 4FP5D 4QCLA 2CCZA 4C3HH 4JCVE 3G6JB 5M5XB 4O4IF 4DAYA 4FDBA 2B2UC 3TIGA 3G6YA 1PK8A 1HUMA 4J8QA 1KL9A 4ME5A 1Q7YC 1SFOA 4Q8EA 3GIIA 4JI3H 1HJPA 1MD2D 3E6ZX 2O5IC 1B50A 4YHHH 2BA0A 1HNWL 4GN4B 4O2DA 3A5ZB 4ECYA 2KUMA 4R9WA 4BY7H 1LTLA 1GLVA 1BR9A 2IA6A 4DXFA 4FS1A 1RYSA 4DKAC 1IBLL 5JH7F 1WTOA 4X62L 1AE2A 3RAXA 2PN1A 2F3WA 3NPPA 1WI5A 3VA5A 1TWFA 4DL3A 3Q8RB 3SE0A 3BU2A 1B04A 4XTCS 2F0EA 4X3UA 3U4ZA 4HQ6A 3H4DA 1EYGA 1K8OA 4MAMA 2V4QA 4F4WA 1EUJA 3OTOH 3AFQA 4A3GH 2VQEQ 2D62A 2R92B 1FD7D 4M9UA 1HZ9A 4O2AF 2R93G 4KHZA 3J7AV 4P73A 1XMOH 4LFAQ 5KFXA 4JI2L 4DUYH 4MV3A 3PW0A 1DCZA 2I5LX 1IL8A 1SDFA 2EY5A 5AJ3L 5JVDF 1A15A 2CVRA 1XPRA 2E2HH 2B63B 5KFOA 3L4KA 1PFMA 2LS01 1X65A 4ZK9B 4QIWA 3HGBA 2ASDA 1E1TA 4G57A 1VKZA 1BCPB 2MHVA 3WOFA 3S2HB 2FJZA 2VQFH 3T1HQ 1KNAA 3PR4A 4DR4L 1DOLA 2OT2A 2J6TA 1B44D 1E22A 3MEFA 3K58A 1PH6A 2R7ZA 4RAUC 1TY0A 5T1IA 1OXSC 3CD6A 3J7AK 3K5LA 2PMZE 4GKJH 1T5EA 3EVQA 3IRBA 2ICEC 2ALYB 2WINB 3HBLA 3HKZA 4JI5L 2NWGA 2L1BA 5C44H 2EXZA 1C3OA 4DR2L 1EWCA 2CWPA 4LJZC 4RA8A 4QGUA 3NTKA 4JK1C 5FJ8H 2SDFA 4P75A 3CCEA 5KFYA 1PH4A 4U7CA 3QZ7A 5DQHA 5JEAJ 2OTJA 1E1OA 1HNZQ 3U9SA 2VL6A 4A3JH 1JOKA 2DPIA 4GS3A 1BXRA 3R2IA 1IYVA 3SGIA 4B3RL 5BMVF 1Y1VB 1BGWA 5M3FH 1I7NA 2KSWA 3ICEA 4F4ZA 4NXNL 2R61A 3LNNA 3J7YW 3LGJA 1SROA 4GOPB 2UXDL 4LF7Q 2RGRA 1KAAA 5KKNB 4LF5L 2JA5B 3TQYA 2R7MA 4A3FH 4DL2A 4DAPA 2C9OA 1CTMA 4PMBA 2NVXH 1KABA 3QG1A 3QR8A 5I9OA 1PRTF 1B70B 4K0KL 4DUZQ 3RZDB 3BVMA 1ICWA 1EU3A 2ZXOA 1EL0A 3A8JE 3E9IA 4C56C 4YY3Q 3R5HA 3K0XA 5GAEC 1SRUA 4IALA 3SXHA 3WO1A 5DQIA 5CBAE 5JAVA 5KFVA 1G2TA 5IGFA 3KHRA 3G7LA 3T5KA 3K7AH 1RJTA 2SNSA 2UUCQ 3HOZH 2MO1A 1K9MC 2JEIA 3M3YB 4ECUA 4ALPA 4J6HA 2JJQA 2I0QA 3OSOA 2F0NA 3MHBA 1D7QA 4HIDA 1XX8A 4OWXB 4TV9F 3EQLC 2K5WA 1SNDA 1KRSA 1RDPD 4JI4H 2R93B 1TKWB 4AYBA 2YU9H 3F2UA 1S68A 4FU0A 4YAKB 3Q8DA 1A3TA 2EDGA 2OTLA 4OO1G 4UFZA 4DV7Q 1U4LA 4XT1B 2A6HD 2CW0C 1RD9D 1TWCH 5ELFA 1JMCA 1HFNA 4IUNA 5EBDA 1AUVA 2BQRA 1YITA 1N34L 1VMPA 2PZWA 2EIFA 4IOAA 4NXNH 1EYDA 4NXMH 1KJ8A 5GONF 4HNUA 1LTGD 3A8IE 5A2QE 1OXTA 5GAGC 1UNNC 4HN7A 1Q46A 5ISRA 1VQAA 3HP3A 1E2VA 1F9SA 3U9OA 2VR1A 4YJ3F 2YTVA 1TWHA 1GUNA 2MNAA 3HOYG 5KFWA 1Y1VG 3NBHA 4LF9L 4HJ5A 2K5VA 5KT5A 2F52A 2HCCA 4R1JA 4A3DB 5FO7B 2CWAA 1STHA 1STNA 3MR5A 2E5LH 4ECQA 2F0PA 3DWPA 1L0WA 1MJEA 3CQZB 2PQAA 1IW7C 2C2EA 3TDQA 2R86A 4X65H 3HOXH 1R4PB 2OF1A 2F0KA 3HKZE 4YCWA 1N36H 1Q12A 2K32A 4LUZA 4EGVA 2GLTA 5DGBA 4HCSA 3PF4A 2D2CC 4DFAA 3PQIA 2ZJTA 4ME3A 2FPIB 2J6UA 1VQCA 1BOSA 4HSPA 5C6AA 3I4MH 3C0FB 3ULPA 1IKMA 2A74C 1MGSA 1X3FA 4EQ5A 1VDZA 3J7AF 5KFLA 3E0EA 2UXBL 1TWCB 5IGBA 3PW2A 3GTOB 5KG4A 2VA2A 2ZXRA 2WAQE 4R4CA 4DV6Q 4LF6L 3T56B 3URYA 4R8NA 4X65L 4FXDA 2D0OA 1YVCA 3VDYA 1EUCB 5CA0F 2IL8A 1N32H 3H15A 4QW8A 3RAQA 2E2HA 2F0WA 4IN3A 5EBCA 2IT1A 4Y7NB 2WP8J 5LL6b 2B2WC 4L63B 4HEDA 3TP6A 4DN4M 4F88A 4RGMA 1PRTD 3IKJA 5C0XJ 4BY1H 3GTMB 4XYQA 3S1NB 1Y1WG 5H80A 4B3MQ 1C7YA 5KFSA 2N88A 3D4RA 3PO3B 4XYLB 1HH2P 3RB0A 1RJRA 3HOVB 1YJWA 3GTOA 3DMUA 2GA4B 4GN3B 3T1YL 2F4VH 2TSSA 2HVQA 5EWEA 4DNRB 5JJLA 4JI6H 2VB2X 1RF2D 2DNEA 4FBTA 1RTOA 4Q43A 1MSHA 2AQ1B 4B3MH 3HG9A 1O78A 3BVGA 3H0GH 3N43B 3KF8B 1GKHA 1R9TB 2AGQA 3K81C 4ED6A 1IHZA 3MFYA 5KEEA 1D2BA 3BQ0A 2XC9A 2EYPA 2B8FA 3GQBA 1J6QA 3GILA 4ECTA 1EY7A 4DK3C 1IYJB 4ECSA 1WYDA 5ELCA 4C3JB 5FO9B 5T14A 1E4FT 3F2CA 4EFBA 3FKIH 4P74A 4K14A 2PQAB 4MV1A 1DM0B 2MQHA 3DEOA 3HFZB 2L9HA 3K5MA 2ZJQA 2NN6H 1GXDC 4O3RA 1QNKA 1Y1WA 4JI8L 3HS0C 4KMUC 2NN6G 4NMZA 2ATWA 3T1YQ 3NUCA 1HNWQ 1S9FA 5A35A 4A76A 4UPAA 3HEJA 2UUAL 4XT3B 2J6SA 4X62Q 4LFBH 1I94H 1VMCA 1RODA 5K2MA 1TS3A 1IW7D 2W9CB 3IAYA 1A8VA 4DAMA 1SYBA 3H4BA 3RZOB 1CUKA 4JI1H 4R4TA 1V1QA 1DV2A 4ETSA 5M9OA 4DK6C 3KHHA 2RKSA 4EGQA 4EYHB 2QEJC 2NVTH 1CSQA 1F2LA 2XNAC 4U6PA 1YHQA 3K5OA 3M9NB 3UDFA 2FP4B 3S2HH 4A93B 2NU8B 2YV5A 2HVSA 4POFA 2R93A 1GSAA 5L1IA 1EIGA 3LWUA 3NTIA 4ECWA 3E5NA 4HJ8A 2F4IA 2VUMB 5D8DA 1SYCA 4A93H 4U68A 1JCKB 1JORA 2YTYA 1AUXA 1KTKA 1HNXH 3GD7A 1UWVA 1YHBA 1K1QA 1O7YA 2K5DA 2NVTB 3QWNA 1JJ2A 2W9BA 2UXBQ 2HHHQ 2EJFC 1SSOA 1N33L 2R92H 3J80c 4A3GB 1I4HA 3EROA 2RF4A 4UY8C 2JEJA 2I5HA 4JBJA 4ZI7F 2F0OA 2R92G 3BQ1A 1J5EQ 4RUCA 1CT1D 1KAWA 1KJ9A 4CDEC 4U673 1AH9A 1ONLA 1VQIA 2WAQB 4B3ML 4OWWB 2JK8A 2GVAA 2B3GA 2NZOA 5BR8H 3L0OA 4MA5A 3J81i 1KBLA 5J2TF 3OW2A 2HD3A 4DUZH 2XIWA 3GV3A 2F0VA 4YCUA 1AN8A 5ELDA 3D4WA 4TRDA 2NVQH 3KJPA 4L6TB 2K7VA 4X66L 4JI7H 1BXTA 1RKNA 4TQUS 4RKBA 3GV8B 3SK8A 1N56A 1XYIA 1YI2A 1QOHA 4LF6H 4EGJA 4L8JA 4DV1Q 4L5RC 1UC9A 1U4MA 3ND8A 4O3PA 2VQEL 1MZBA 4B9XA 3ER0A 2R85A 4DK0A 4K5XA 3UDGA 1R9TH 4JI4Q 1C9OA 3PF5A 3UFXB 1J8IA 1KXLA 2F3VA 1S5FD 1FL0A 5LMNL 3N44B 4I65A 3HB9A 1V1PB 4BBRH 4R8UB 5FLXL 4DUZL 1MSGA 5AJ3Q 3OUZA 2K50A 3K6OA 5G3LF 4A3KH 3HOVH 2W7PA 4DR1H 1ENAA 1F2ZA 4JYAQ 1UAPA 5CV6A 3RD4A 4UCRA 3PZPA 3SK6A 1IBMQ 1SYDA 5M3MB 2WACA 3FHWA 4M1UB 3GTMH 3CPWA 4HR7A 2VW9A 2R8KA 1CZWA 3OYYA 1QZHA 2QCPX 3D31A 3E3XA 4IJHA 2Q2HA 2K33A 5KYIA 1DJRD 2RSNA 1GSHA 2CZGA 4DR1Q 1B53A 2EYFA 4QWEA 2F0TA 1D5XC 3K80C 4YCVA 4WRDA 4JI5Q 3GTOH 4LF5H 1RIPA 1BBXC 2QILA 1XPOA 2M9VA 1U4PA 1I3QB 2XGQA 3PUXA 1OTCA 2RSOA 4Z9CB 2KHIA 1DOKA 1TS4A 2R8HA 1BBUA 1GD7A 2N8NA 2OWOA 3MFGA 5HGQA 3I4NH 4JBWA 1DONA 4K8IA 4RB0A 1N8RC 2DGYA 2HQEA 4YJ2F 5KFBA 3RF2A 1Z9FA 1VQBA 1PLFA 1X54A 4LMYA 1G6PA 1EFID 1NR2A 3HOVG 2FB9A 4JBKA 4EG0A 2UUBH 2WKDA 3CKIB 3Q8QB 4JI5H 5KFHA 4QMGA 3CP0A 4GC6A 1E4GT 1TWAA 3HOXB 4A3MH 3HZXA 3MR3A 1SLJA 4A93G 4LF9Q 3KTMA 4JV5H 1YHAA 3STBC 2EJGC 3ULLA 1CHPD 1STBA 2WB1E 3D8GA 1V8QA 3KBXA 5DM63 4RHRA 2RDHA 2AU0A 1JIHA 1M0WA 3GTPH 3EPIA 3S1RB 1WTRA 4DR4H 4PWQA 4PDBA 4K0KQ 3TMEA 2NB0A 5KT7A 2O4XA 3RV4A 4H7BA 2IJ0A 3M9BA 3FRPB 3DEPA 4RZRA 3G6EA 3PCOB 4ZUJA 5DLGA 2JYOA 3NXWA 3SEBA 3FVQA 1VQDA 4JV5L 2JA7G 3OMCA 1RL2A 4RGOS 1EY9A 1V9PA 1TWCA 5CBEE 4BWSC 2YRWA 1LTRD 1YBYA 5F9LA 3S17H 1QB5D 1HNWH 3J7A5 3DUZA 3HOUB 3EFXD 2QEXA 4IUTA 2KVMA 1X32A 1GUWA 1Q8KA 4PMWA 2F1MA 1L0YB 4Q45A 1O7ZA 1PV4A 2B2UA 4IQZA 5ELNA 1BNZA 5EQ0A 4DXGA 3KAJA 1HNZH 5LMUL 3BDCA 2KJXA 4IUVA 1TS2A 2ZT9C 5CR3A 5DNFA 2KBNA 3D4DA 5KGUA 2Z6BA 3BYYB 2CH4W 3OHAA 4MV8A 4DK1A 1FKAH 4IWYA 1Z2NX 3RBEA 4BY7G 3PUVA 4K6DA 1PYWD 2E2JB 3M3YH 2RDGA 3CAMA 4OGQC 2QA4A 3C3LA 3KK7A 3HOZB 3AQQA 4B3SH 5FO8B 2MUYA 1SYEA 4AQYQ 3TINA 1Y1WH 4L5TA 4J9PA 1K3RA 3JAME 5G3LD 5T1GA 3RMHA 4HMJA 1UEAB 1GUSA 4A3EH 2C35B 5LA6F 4M7EA 2RQXA 2R7FA 3KXYT 1MHWC 1TAEA 5K36H 3LWBA 1JE4A 2SEBD 2OQKA 4JI3Q 2JA9A 4I55F 1PFNA 2QDLA 3OSPA 5KG2A 4O3NA 3KF6B 3K0YA 1IOWA 1VQPA 2W6PA 3ULJA 1G6ZA 5KFGA 3R8BA 5E7NA 1KDCA 1SNQA 2W70A 4IURA 3CPFA 1PFBA 3EIVA 1M90C 2JA5H 4QQBX 2NU6B 4ME6A 5C4XB 3VR4A 4TV8F 3I55A 4HNVA 4B3SQ 1PTOF 3PO2H 1ESFA 2UUBQ 5HBRB 4FNFA 5KFUA 4TKOB 3PR5B 3S15B 4OEMB 4LUOA 4LF5Q 2V4DA 3G8CA 3LWEA 1K8GA 3JAML 4HTHA 5M3FB 5LP6F 1Y1VH 4RNOA 5EDWA 3LP8A 1M4VA 1I94L 4OO1I 3WDNA 4RAZA 1SMXA 5C0XH 1LT3D 2ZJPA 1GM5A 2Q8IB 5E4XA 5C3WA 1PA6A 3H09A 2NUCA 3TZUA 3TS0A 1IZ6A 2LFNA 1XNQQ 2SCUB 2C22A 2J4XA 3FDSA 3T51B 3M9MB 1G8ZD 3K3VA 3HOUG 1V1PA 1IBLH 3BZCA 5D14A 3I4MG 1S0MA 4QB4A 1STEA 2XVSA 1V1OA 5IODA 4A3CH 1SNOA 2UU9Q 3EN2A 3H3VC 2MPMA 1S4ZA 3KOJA 3RGZA 2KHSA 3GP7A 1RJQA 2I80A 1XNRL 1TWFH 2HQLA 4JI6L 2E5LL 1S3OA 2IP4A 2AHOB 2B2YC 4OONA 1PZID 3GTJB 3M9OB 3H20A 3V4SA 1O80A 1Z47A 4J1MA 3VPBA 5KFKA 4S3SA 1X56A 3NQTA 1XNQH 4DR2Q 2VQFQ 5KFMA 2YW2A 4C5CA 4XQJA 4DL6A 2Y0SA 1U4RA 2AQ4A 1HNZL 3TREA 1AEXA 2CW7A 3MZ5A 4OX9Q 2ENBA 2VPSA 4A4IA 4PZ8A 4KD3A 3L4JA 2GN5A 4ED1A 2MCTA 5C3EH 4UHVA 1PTOB 3T16A 1I7LA 2JSOA 1ZEQX 3GTLH 4LF7L 3GIKA 4DR2H 2RHSB 1DIKA 1KLGD 3JZIA 2FINB 2ASLA 5IWAL 5TSSA 4EYIB 5GADC 4YR2A 4N9PA 3NBIA 3TEHB 3I2ZA 2DJFC 1PXUA 3DWQA 4NLGA 4GKJL 2EYJA 5DQGA 3NP8A 1VQ6A 3OW7A 3GTQB 2XRSD 1V4YA 3I4OA 3MXNB 1I5FA 2Z6KC 4KKUA 4BY7B 4LW1A 2FFKB 4GOPA 4OO1H 3GTKH 3BQ2A 4JI8Q 4DNIA 5I2XA 1EZ6A 1GUOA 1A9XA 3GTKA 4LFBL 4LSXA 2WV6D 2UXBH 2P5ZX 2K05A 3GV6A 3G48A 3OIQA 3GTPA 2UUCL 4NPSA 1OXUA 1F9QA 5M5XH 4IRDA 4JI0H 4C3HB 5FOBB 1T5XD 4IPGA 5BPFA 2AWOA 3I4LA 4MTEA 2PYKA 1S10A 3TN2A 4APMA 5FPOA 2HHHH 4KKTA 4WJ3M 4DV0H 1BVSA 3VPDA 4A2AA 3S14B 1HTLD 4EVOA 1VQKA 2FK1A 1K0RA 1TWGH 1IL2A 2JA7H 1QE6A 1IBKH 1QUQA 1BCPF 4RWSC 5D65A 1PH9A 2IMWP 5KFCA 1JICA 3IFDA 4R4OA 2W9BB 1EY5A 2WKCA 2F0GA 4C2MB 1SFOB 1H9RA 3U4VA 4IOCA 1QILA 1Q81C 4ECRA 1QCBD 2FK2A 1VQ5A 3BJYA 1XTDA 5LMNQ 1HPCA 1Q3LA 1SEBD 3Q0AA 1VQGA 1Y14B 1VQ7A 2E2IB 2KOLA 3A54A 4BA1I 2HHHL 1U0LA 4RKLA 2JA7A 2MP1A 4PMCA 5L1LA 4I7HA 1A3VA 2A5HA 3G4SA 2XGTA 2M00A 2JEAI 3OWEB 1S5ED 1YNNC 5JOBA 1N32Q 2R7KA 5C1OA 1KC7A 2NYZD 4FF3A 1I4RA 1OXXK 2O5JC 4YR0A 5CB4F 4Y52H 1GOZA 2VZAA 3QZ8A 3KFUA 4OIJA 4J9NA 2IWHA 2R87A 5LOVF 3PIO3 1GGOA 3TP7A 1VQHA 3VMMA 4RZQA 3MFIA 1A0IA 3JAMi 1NTGA 2NTSA 3W2DA 1WSCA 4R8IA 5DG7A 5KFAA 1EQQA 2EVBA 2F0LA 2UXDH 4ZQ3A 1PYSB 2YTXA 4JI2Q 5L9XA 4F7XA 1WTHA 1JOQA 1TWGB 3PUYA 3N6RA 1CS0A 2O03A 2ZDQA 3EYYA 2LMCB 4DR6H 4EEQA 1TWHH 1PHJA 3PO2G 3VPCA 4FO2A 4QJFA 1B9NA 1H9MA 4CKEA 1HR0Q 1K8AC 2UUAQ 2PZUA 1AFPA 3RUPA 2NVYH 1GUGA 2HIVA 3J81L 1KD1C 1OWTA 1LV9A 5DLQE 2BDOA 3KF8A 3A74A 4J15A 2A19A 2BOSA 4A2BA 2F0DA 1CK1A 2W7OA 1IYUA 2RHQB 2YZNA 3LX0A 4CKBA 3OIPA 3ORRA 4BWGB 4DR6Q 2B2VC 2RDIA 1T36A 2Q2IA 1XJVA 2PMZA 4O3OA 4IFDJ 4EX5A 3BS1A 5I6YA 2JEGA 2JA6H 4G7ZC 5LL6S 2F03A 4B3RQ 1EZ1A 3JRWA 4LSAA 1O7LA 1I4GA 1S5DD 2PW7A 4ILWA 3L2PA 4DR3H 3RB6A 4DR7Q 4J9SA 4EQOA 3R3OA 4ZKBB 2QKIC 1TVXA 3I90A 4CDCC 1LUZA 2G5DA 2XIGA 1BCPD 5FLXE 4O2BF 2J9GA 1CQIB 4B3RH 2DZDA 5C5LA 5IE8A 1WD1A 2A6ED 2ZJRA 5M5YB 3CU7A 1JR0D 4YIJA 5K5PA 4YR3A 1SE4A 2WAQG 1E4EB 2RGVA 3A55A 4X3SA 3OTOL 4G7OC 3F8NA 4B3TQ 4RGNA 3P7JA 1W3SA 3GTJH 2NN6I 1WCMB
chains in the Genus database with same CATH topology
4OWTB 1G51A 4QY7A 3OW2A 4JC0A 4YCUA 3PIOA 3S1MH 1BKBA 1WFQA 3U50C 4GOPC 2A1AA 2F4VQ 4UP8A 2NVQH 4DR7L 4JYAL 3KJPA 1QZGA 1Q82C 3AYHB 2JA6G 2MFIA 1EWIA 2LSSA 2XTIA 1YEZA 4YWKA 4X66L 4TQUS 4MZ9A 4A3LG 4JBMA 1YNXA 1YI2A 1VQLA 4DV5L 1EQRA 2D0PA 4GKKL 1FGUA 2JE6I 4JI4L 3S2DH 4A3CG 4DV1Q 4HIOA 4L5RC 3F8TA 4DR1L 2VQEL 3HOWG 3ER0A 3UDGA 3OTOQ 1R9TH 4JI4Q 1FJGQ 3RNUA 1AE3A 1CKMA 4DV1L 1C9OA 3PF5A 3B6YA 2LXJA 1X3GA 3RZDH 1KXLA 1KRTA 4A3KG 1FL0A 5LMNL 4IPCA 3CCVA 4A3EG 4BBRH 4DUZL 5IY0A 5AJ3Q 1E7ZA 2B63G 1HZCA 2K50A 4A3KH 4LF4L 3HOVH 4JYAQ 1IBKL 4DV2L 4LWCA 4NXMQ 1CKNA 4C3IH 1MJCA 2K52A 5C4XH 1IBMQ 4HJAA 1XNQL 3UDIA 3JAMc 3FHWA 3NENA 3GTMH 5JJKA 3CPWA 2VW9A 3OYYA 1QZHA 1N33Q 1VQNA 4AYBG 1K73C 1IBML 2Z6KA 4GNXB 3D31A 4IJHA 1I6HH 2Q2HA 4A3FG 4DR1Q 1L1OB 2BH8A 2JA8H 2Q2TA 3CCMA 3H3VH 4A3LH 2K75A 1MIUA 4MNOA 2VNUD 4TVAB 5IWAQ 3K80C 4YCVA 1XMQQ 1J5EL 4JI5Q 3GTOH 1HZAA 4X65Q 1RIPA 2RCNA 3UE1A 5LMUQ 3CCUA 3RR5A 4HIKA 1XPOA 2E5LQ 3KF6A 2ZTDA 4DV5Q 3S14H 5IYBG 4LNQA 5M5WH 4A3GG 3PUXA 4JI1Q 1OTCA 2KHIA 1BBWA 4GNXC 1PH5A 1BBUA 1GD7A 2KCTA 2N8NA 2VQFL 2OWOA 5K36G 5IT9c 5HGQA 2CCZA 3I4NH 4JBWA 4JCVE 4IJLA 4C3HH 3CCQA 1PH1A 4FDBA 1N8RC 2DGYA 1KL9A 1Q7YC 1Z9FA 1VQBA 2IX0A 1JT8A 1X54A 1HJPA 5GAHC 4IFDI 3H0GG 1G6PA 2N78A 2N49A 3HOVG 4DUYL 4JBKA 2BA0A 1HNWL 4GN4B 4O2DA 3WWVA 1UE1A 3A5ZB 4BY7H 1LTLA 2VUMH 3CP0A 4DR3L 2E8GA 4A3MH 4DKAC 1IBLL 1SLJA 1S72A 4A93G 2WFWA 1AE2A 1NMFA 4X62L 4LF9Q 1YHAA 3STBC 3ULLA 2WB1E 5FLMH 1YZ6A 1WI5A 1QVCA 3BU2A 4LFCQ 3GTPH 4XTCS 5M5YH 4LF6Q 1NBWA 4K0KQ 3U4ZA 3FKIG 4PZ7A 3STBD 1EYGA 2AMCB 3M9BA 1EUJA 3AFQA 1JJCB 4A3GH 2VQEQ 2R6GA 3G6EA 3PCOB 3RZOH 2D62A 4POGA 2Y0SG 1I50H 1VQDA 4JV5L 4LFAL 1HZ9A 2R93G 2JA7G 1RL2A 4KHZA 3ERSX 1V9PA 4P73A 1CKOA 3I7FA 4PZ6A 4LFAQ 4JI2L 1X3EA 1YBYA 3S1RH 3S17H 3J7A5 2I5LX 4GNXA 5AJ3L 3A5UA 1XPRA 1IBLQ 4JI0L 2E2HH 2IY5B 1X65A 3UDXA 2QEXA 2ZM6Q 1E1TA 2FXQA 3T1HL 1Q8KA 3FP9A 4PMWA 4R4QA 3S16H 1VS0A 2NZHA 3M85A 1PV4A 2HIXA 3M4PA 3G71A 4KI0A 5IP9H 5ELNA 4LF8Q 3T1HQ 5LMUL 1JE5A 4DR4L 1T9HA 2KBNA 1E22A 3MEFA 1PH6A 5FLMG 4X6AH 4LF8L 1OXSC 3CD6A 2PMZE 2JQOA 3IRBA 4LFCL 4BBRG 2ALYB 1YIJA 4A3IH 4BY7G 2OCEA 1NY4A 3PUVA 3I4NG 4JI5L 3M3YH 2CQOA 3CAMA 3M7NA 1H95A 2QA4A 5C0XG 3AQQA 5C44H 3CCSA 1JJGA 1G291 2CWPA 4DR2L 1I3QH 4QGUA 3CCEA 4L5TA 4AQYQ 5FJ8H 1K3RA 4P75A 5IYBH 3J7ZC 1Y1WH 1PH4A 3BJUA 3PUZA 4A3EH 2C35B 3CC7A 5IYCG 5IYDH 2R7FA 5JEAJ 2A8VA 2OTJA 1E1OA 1HNZQ 3HOYH 2VL6A 4A3JH 4GS3A 2H5XA 2OQKA 4JI3Q 2JA9A 3SGIA 4B3RL 5M3FH 4BA2I 1SN8A 1UE6A 3KF6B 1X9NA 1VQPA 1SE8A 3ULJA 1IXRA 4X64Q 3ICEA 4AH6A 2DUDA 2E2IH 5E7NA 4NXNL 3LGJA 1SROA 1XMQL 3CPFA 3EIVA 4MTNA 4GOPB 1M90C 2JA5H 5M3MH 4QQBX 4LF7Q 2UXDL 3KYHC 2KCMA 3PO3H 5ELOA 3I55A 3CXCA 4B3SQ 4LF5L 2ES2A 3PO2H 2UUBQ 3E9HA 3TQYA 4DV3L 3S1NH 4A3FH 2R93H 4A3JG 1SFOH 4L5SA 5EAYA 4A3BG 1N9WA 4LUOA 1Q1BA 2Z0SA 3ZJYC 2NVXH 4LF5Q 1K8GA 2UUBL 4KLKA 4JV5Q 4YWMA 3F2BA 1VQFA 1Y1VH 1B70B 4K0KL 2IHEA 4DUZQ 1I94L 4OO1I 1SMXA 2K4KA 1FVIA 2ZJPA 1GM5A 1PYBA 4KHPQ 3E9IA 3S24A 3CMAA 2PI2E 4YY3Q 2IHFA 3K0XA 3KLWA 1B8AA 1SRUA 4JI3L 5GAEC 2I5MX 5LMNW 1PA6A 1X55A 5FJ8G 3TS0A 3HOWH 1IZ6A 4NXML 4KHPL 1XNQQ 1PFSA 3K7AH 2ZM6L 4BXXH 2UUCQ 1UEBA 4GN5A 4O0AA 4DR3Q 2MO1A 2F3IA 1K9MC 3HOZH 4ALPA 4A3IG 2JJQA 1N36L 2I0QA 3HOUG 1YJNA 2R7DA 3BZCA 3S1QH 2Q2UA 3I4MG 2KENA 1D7QA 4HIDA 2VUMG 4OWXB 1TWAH 4A3CH 1P16A 2VY3A 3J81j 3PIPA 3EN2A 2UU9Q 4JI7Q 3KOJA 1KRSA 2JEBI 1XNRL 1TWFH 2HQLA 4C2MH 4JI6L 3KDFB 1HR0L 2E5LL 2JA5G 3PO3G 4DV7L 1PVOA 1B7YB 1S3OA 2YU9H 2AHOB 4OONA 4OXPA 2ID0A 4JI1L 3Q8DA 2OTLA 1Z47A 4JI6Q 4DR4Q 4OO1G 1X56A 4DV7Q 4DR2Q 2VQFQ 4AQYL 3GTGH 4GLVB 5IP7G 1CKNB 3CQZH 1TWCH 4YY3L 1JMCA 3F2DA 3CC2A 1YITA 1N34L 2JA8G 5JJIA 1V43A 4IOAA 1HNZL 1VQJA 2EIFA 3TREA 1PH8A 4P71A 3EBEA 4LFBQ 1N32L 3D0FA 1X6OA 4DV2Q 4OX9Q 1OXTA 4A4IA 4PZ8A 4DV4Q 5GAGC 3HOXG 3JC66 2GN5A 1Q46A 3TS2A 1VQAA 1WCMG 1DGSA 2PNHA 2YTVA 5C3EH 2MNAA 2UU9L 3HOYG 3HOZG 3GTLH 1Y1VG 4LF9L 4X66Q 4HJ5A 2K5VA 4LF7L 2F52A 4R1JA 4B3SL 2L15A 2CWAA 2RHSB 1N36Q 1NJIC 5IWAL 3PUWA 1L0WA 5GADC 4X64L 4DR5Q 1MJEA 3GTQH 2PQAA 3TEHB 3I2ZA 5IP9G 4NXNQ 4GKJL 1VCIA 3UE0A 4DV6L 4BY1G 1VQ6A 3HOXH 3I4OA 3L7ZC 1I5FA 2Z6KC 1N34Q 3CCLA 4LW1A 4GOPA 3GTKH 3CC4A 3HKZE 4YCWA 3A0JA 4R4IA 1K83H 1Q12A 4YWLA 4IPDA 4LUZA 4JI8Q 1CSPA 4DNIA 4B3TL 4LFBL 4IO9A 3W1GA 3CMEA 5IP7H 4OX9L 3PF4A 2ASBA 2KHJA 1UE5A 3G48A 4YHHQ 4ME3A 3W5OA 2UUCL 4NPSA 1OXUA 5M5XH 3RLFA 1VQCA 5IYDG 3K7UC 3GDEA 3KDFA 4IPGA 3J80i 4IFDG 4YHHL 3I4MH 2AWOA 3BZKA 3ULPA 1HZBA 3F1ZA 4UP9A 4PG3A 3I56A 4WJ3M 1X3FA 4EQ5A 1A62A 1BVSA 5M3MG 1C0AA 3HKZG 4QL5A 4DV4L 1Q86C 1VQKA 1K0RA 3E0EA 3J81c 2UXBL 4L5QA 1TWGH 1IL2A 2JA7H 1E24A 1U5KA 2WAQE 1QUQA 4R4CA 4H02A 4DV6Q 4LF6L 1PH9A 4X65L 3PGZA 4R4OA 2D0OA 1YVCA 3VDYA 1KC8C 1EFWA 1VQ9A 3H15A 4NB3A 1HNXL 4DR6L 3GO5A 3U4VA 2IT1A 2WP8J 4IOCA 5FLXc 5C0XJ 3KJOA 1Q81C 4BY1H 1JB7A 1Y1WG 4B3MQ 4UP7A 1C7YA 1VQ5A 1XTDA 4RG1A 2ZTEA 5LMNQ 2VS1A 4JOIC 4C3JH 4DV0Q 4HJ7A 1HH2P 2OQ0A 1VQGA 1Y14B 2MO0A 3U58A 1YJWA 4GN3B 3T1YL 1VQ7A 4BA1I 5JJLA 2HHHL 1U0LA 1QVFA 4DAYB 1TXYA 3G4SA 2GVBA 2XGTA 2YYZA 3PV0A 2JEAI 3H0GH 1N32Q 1VQOA 3CCRA 3RLNA 3KF8B 1GKHA 3TRZA 3K81C 1EOVA 4JI7L 1Q1EA 5HY6A 1ASZA 1VQ8A 1OXXK 2WB1G 5C0XI 1M1KC 3AEVA 2HT1A 4GKJQ 4Y52H 2VZAA 3S15H 1J6QA 1L1OC 1NE3A 3KFUA 4IPHA 5M3FG 3DM3A 1VQMA 5C44G 1E3PA 2N3SA 4DK3C 1IYJB 2B29A 1WYDA 3RN5A 1EIFA 4BBSH 1WOCA 2IX1A 1OXVA 3RLOA 1VQHA 5C4JH 3F2CA 4HIMA 1LM0A 2K14A 4GLXA 3FKIH 3H3VI 1A0IA 4P74A 1NTGA 4XIGS 3JAMi 4Y7NH 2PQAB 3NELA 2MQHA 4JG2A 2F4VL 5C4XG 3HFZB 1XMOL 2ZJQA 1D8LA 1WCMH 1EQQA 4LF4Q 1KQSA 3J81i 1PYSB 2YTXA 4JI2Q 4BXXG 4JI8L 1UE7A 2UXCQ 1L2FA 2R7ZH 4A3DG 2B63H 3HOUH 4A75A 3K8AA 2NN6G 2ATWA 1HNWQ 3T1YQ 2ZTCA 3RN2A 3PUYA 2QGQA 4A76A 1GO3E 5H1SE 4UPAA 1TWHH 1PHJA 3PO2G 5C3EG 2UUAL 1VQEA 3W1BA 4X62Q 4QJFA 3DLLA 1FJGL 4DR5L 4AYBE 1LYLA 2UXDQ 1A63A 2E2JH 1EIYB 2AWNA 4GLAC 1QVGA 1A8VA 2EXDA 4DAMA 1K8AC 1HR0Q 2K5NA 5J3BA 2NVYH 2K5HA 2HIVA 1KD1C 2UUAQ 4GKKQ 1HNXQ 5DLQE 4AIMA 1CUKA 4R4TA 1V1QA 4LUVA 5JEAG 1W2BA 4DK6C 3A74A 4J15A 2PI2A 2A19A 1CSQA 5GQOA 2NVTH 1YHQA 1P8LA 5GROA 3UDFA 4DV0L 2RHQB 1IBKQ 3S2HH 1I94Q 4BBSG 3M4OH 2YV5A 3AFPA 1KHIA 1XPUA 4POFA 4DR6Q 3CW2C 2V1CC 2Q2IA 4WJ4A 1XJVA 2BA1A 4RMFA 1O7IA 1L1OA 4IFDJ 4EX5A 1ASYA 1VQ4A 4HJ8A 2JA6H 5IYCH 3CCJA 4A93H 2YTYA 4B3RQ 3NEMA 5BR8Q 1GVPA 4DPGA 4JI0Q 3GD7A 1UWVA 1YHBA 4P72A 1WJJA 2R7ZG 1MKHA 4A3DH 1S40A 1JJ2A 2UXCL 3L2PA 2UXBQ 4DR7Q 2HHHQ 5BR8L 3PSIA 1N33L 2R92H 3J80c 1LUZA 4QIWE 1KIXA 3M4QA 1PH7A 1XNRQ 2RF4A 2Y0SE 4UY8C 2I5HA 4JBJA 4A3MG 3NBHB 3HKSA 4DV3Q 4APVA 2R92G 5IE8A 1PH3A 1NMGA 1J5EQ 2CKZB 2EQSA 2ZJRA 1PH2A 1KAWA 3CF5A 1HR0W 1QUQB 1AH9A 1VQIA 2WAQG 4B3ML 3OTOL 1SR3A 4OWWB 2JK8A 2CFMA 2GVAA 2B3GA 2NZOA 2AKWB 4B3TQ 4A3BH 4HJ9A 1XMOQ 3L0OA 1YJ9A 2LXKA 4JOIA 4DUYQ 1W3SA 3GTJH 2NN6I 3MXNB 2BH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OWT B;  1G51 A;  4QY7 A;  3OW2 A;  4JC0 A;  4YCU A;  3PIO A;  3S1M H;  1BKB A;  1WFQ A;  3U50 C;  4GOP C;  2A1A A;  2F4V Q;  4UP8 A;  2NVQ H;  4DR7 L;  4JYA L;  3KJP A;  1QZG A;  1Q82 C;  3AYH B;  2JA6 G;  2MFI A;  1EWI A;  2LSS A;  2XTI A;  1YEZ A;  4YWK A;  4X66 L;  4TQU S;  4MZ9 A;  4A3L G;  4JBM A;  1YNX A;  1YI2 A;  1VQL A;  4DV5 L;  1EQR A;  2D0P A;  4GKK L;  1FGU A;  2JE6 I;  4JI4 L;  3S2D H;  4A3C G;  4DV1 Q;  4HIO A;  4L5R C;  3F8T A;  4DR1 L;  2VQE L;  3HOW G;  3ER0 A;  3UDG A;  3OTO Q;  1R9T H;  4JI4 Q;  1FJG Q;  3RNU A;  1AE3 A;  1CKM A;  4DV1 L;  1C9O A;  3PF5 A;  3B6Y A;  2LXJ A;  1X3G A;  3RZD H;  1KXL A;  1KRT A;  4A3K G;  1FL0 A;  5LMN L;  4IPC A;  3CCV A;  4A3E G;  4BBR H;  4DUZ L;  5IY0 A;  5AJ3 Q;  1E7Z A;  2B63 G;  1HZC A;  2K50 A;  4A3K H;  4LF4 L;  3HOV H;  4JYA Q;  1IBK L;  4DV2 L;  4LWC A;  4NXM Q;  1CKN A;  4C3I H;  1MJC A;  2K52 A;  5C4X H;  1IBM Q;  4HJA A;  1XNQ L;  3UDI A;  3JAM c;  3FHW A;  3NEN A;  3GTM H;  5JJK A;  3CPW A;  2VW9 A;  3OYY A;  1QZH A;  1N33 Q;  1VQN A;  4AYB G;  1K73 C;  1IBM L;  2Z6K A;  4GNX B;  3D31 A;  4IJH A;  1I6H H;  2Q2H A;  4A3F G;  4DR1 Q;  1L1O B;  2BH8 A;  2JA8 H;  2Q2T A;  3CCM A;  3H3V H;  4A3L H;  2K75 A;  1MIU A;  4MNO A;  2VNU D;  4TVA B;  5IWA Q;  3K80 C;  4YCV A;  1XMQ Q;  1J5E L;  4JI5 Q;  3GTO H;  1HZA A;  4X65 Q;  1RIP A;  2RCN A;  3UE1 A;  5LMU Q;  3CCU A;  3RR5 A;  4HIK A;  1XPO A;  2E5L Q;  3KF6 A;  2ZTD A;  4DV5 Q;  3S14 H;  5IYB G;  4LNQ A;  5M5W H;  4A3G G;  3PUX A;  4JI1 Q;  1OTC A;  2KHI A;  1BBW A;  4GNX C;  1PH5 A;  1BBU A;  1GD7 A;  2KCT A;  2N8N A;  2VQF L;  2OWO A;  5K36 G;  5IT9 c;  5HGQ A;  2CCZ A;  3I4N H;  4JBW A;  4JCV E;  4IJL A;  4C3H H;  3CCQ A;  1PH1 A;  4FDB A;  1N8R C;  2DGY A;  1KL9 A;  1Q7Y C;  1Z9F A;  1VQB A;  2IX0 A;  1JT8 A;  1X54 A;  1HJP A;  5GAH C;  4IFD I;  3H0G G;  1G6P A;  2N78 A;  2N49 A;  3HOV G;  4DUY L;  4JBK A;  2BA0 A;  1HNW L;  4GN4 B;  4O2D A;  3WWV A;  1UE1 A;  3A5Z B;  4BY7 H;  1LTL A;  2VUM H;  3CP0 A;  4DR3 L;  2E8G A;  4A3M H;  4DKA C;  1IBL L;  1SLJ A;  1S72 A;  4A93 G;  2WFW A;  1AE2 A;  1NMF A;  4X62 L;  4LF9 Q;  1YHA A;  3STB C;  3ULL A;  2WB1 E;  5FLM H;  1YZ6 A;  1WI5 A;  1QVC A;  3BU2 A;  4LFC Q;  3GTP H;  4XTC S;  5M5Y H;  4LF6 Q;  1NBW A;  4K0K Q;  3U4Z A;  3FKI G;  4PZ7 A;  3STB D;  1EYG A;  2AMC B;  3M9B A;  1EUJ A;  3AFQ A;  1JJC B;  4A3G H;  2VQE Q;  2R6G A;  3G6E A;  3PCO B;  3RZO H;  2D62 A;  4POG A;  2Y0S G;  1I50 H;  1VQD A;  4JV5 L;  4LFA L;  1HZ9 A;  2R93 G;  2JA7 G;  1RL2 A;  4KHZ A;  3ERS X;  1V9P A;  4P73 A;  1CKO A;  3I7F A;  4PZ6 A;  4LFA Q;  4JI2 L;  1X3E A;  1YBY A;  3S1R H;  3S17 H;  3J7A 5;  2I5L X;  4GNX A;  5AJ3 L;  3A5U A;  1XPR A;  1IBL Q;  4JI0 L;  2E2H H;  2IY5 B;  1X65 A;  3UDX A;  2QEX A;  2ZM6 Q;  1E1T A;  2FXQ A;  3T1H L;  1Q8K A;  3FP9 A;  4PMW A;  4R4Q A;  3S16 H;  1VS0 A;  2NZH A;  3M85 A;  1PV4 A;  2HIX A;  3M4P A;  3G71 A;  4KI0 A;  5IP9 H;  5ELN A;  4LF8 Q;  3T1H Q;  5LMU L;  1JE5 A;  4DR4 L;  1T9H A;  2KBN A;  1E22 A;  3MEF A;  1PH6 A;  5FLM G;  4X6A H;  4LF8 L;  1OXS C;  3CD6 A;  2PMZ E;  2JQO A;  3IRB A;  4LFC L;  4BBR G;  2ALY B;  1YIJ A;  4A3I H;  4BY7 G;  2OCE A;  1NY4 A;  3PUV A;  3I4N G;  4JI5 L;  3M3Y H;  2CQO A;  3CAM A;  3M7N A;  1H95 A;  2QA4 A;  5C0X G;  3AQQ A;  5C44 H;  3CCS A;  1JJG A;  1G29 1;  2CWP A;  4DR2 L;  1I3Q H;  4QGU A;  3CCE A;  4L5T A;  4AQY Q;  5FJ8 H;  1K3R A;  4P75 A;  5IYB H;  3J7Z C;  1Y1W H;  1PH4 A;  3BJU A;  3PUZ A;  4A3E H;  2C35 B;  3CC7 A;  5IYC G;  5IYD H;  2R7F A;  5JEA J;  2A8V A;  2OTJ A;  1E1O A;  1HNZ Q;  3HOY H;  2VL6 A;  4A3J H;  4GS3 A;  2H5X A;  2OQK A;  4JI3 Q;  2JA9 A;  3SGI A;  4B3R L;  5M3F H;  4BA2 I;  1SN8 A;  1UE6 A;  3KF6 B;  1X9N A;  1VQP A;  1SE8 A;  3ULJ A;  1IXR A;  4X64 Q;  3ICE A;  4AH6 A;  2DUD A;  2E2I H;  5E7N A;  4NXN L;  3LGJ A;  1SRO A;  1XMQ L;  3CPF A;  3EIV A;  4MTN A;  4GOP B;  1M90 C;  2JA5 H;  5M3M H;  4QQB X;  4LF7 Q;  2UXD L;  3KYH C;  2KCM A;  3PO3 H;  5ELO A;  3I55 A;  3CXC A;  4B3S Q;  4LF5 L;  2ES2 A;  3PO2 H;  2UUB Q;  3E9H A;  3TQY A;  4DV3 L;  3S1N H;  4A3F H;  2R93 H;  4A3J G;  1SFO H;  4L5S A;  5EAY A;  4A3B G;  1N9W A;  4LUO A;  1Q1B A;  2Z0S A;  3ZJY C;  2NVX H;  4LF5 Q;  1K8G A;  2UUB L;  4KLK A;  4JV5 Q;  4YWM A;  3F2B A;  1VQF A;  1Y1V H;  1B70 B;  4K0K L;  2IHE A;  4DUZ Q;  1I94 L;  4OO1 I;  1SMX A;  2K4K A;  1FVI A;  2ZJP A;  1GM5 A;  1PYB A;  4KHP Q;  3E9I A;  3S24 A;  3CMA A;  2PI2 E;  4YY3 Q;  2IHF A;  3K0X A;  3KLW A;  1B8A A;  1SRU A;  4JI3 L;  5GAE C;  2I5M X;  5LMN W;  1PA6 A;  1X55 A;  5FJ8 G;  3TS0 A;  3HOW H;  1IZ6 A;  4NXM L;  4KHP L;  1XNQ Q;  1PFS A;  3K7A H;  2ZM6 L;  4BXX H;  2UUC Q;  1UEB A;  4GN5 A;  4O0A A;  4DR3 Q;  2MO1 A;  2F3I A;  1K9M C;  3HOZ H;  4ALP A;  4A3I G;  2JJQ A;  1N36 L;  2I0Q A;  3HOU G;  1YJN A;  2R7D A;  3BZC A;  3S1Q H;  2Q2U A;  3I4M G;  2KEN A;  1D7Q A;  4HID A;  2VUM G;  4OWX B;  1TWA H;  4A3C H;  1P16 A;  2VY3 A;  3J81 j;  3PIP A;  3EN2 A;  2UU9 Q;  4JI7 Q;  3KOJ A;  1KRS A;  2JEB I;  1XNR L;  1TWF H;  2HQL A;  4C2M H;  4JI6 L;  3KDF B;  1HR0 L;  2E5L L;  2JA5 G;  3PO3 G;  4DV7 L;  1PVO A;  1B7Y B;  1S3O A;  2YU9 H;  2AHO B;  4OON A;  4OXP A;  2ID0 A;  4JI1 L;  3Q8D A;  2OTL A;  1Z47 A;  4JI6 Q;  4DR4 Q;  4OO1 G;  1X56 A;  4DV7 Q;  4DR2 Q;  2VQF Q;  4AQY L;  3GTG H;  4GLV B;  5IP7 G;  1CKN B;  3CQZ H;  1TWC H;  4YY3 L;  1JMC A;  3F2D A;  3CC2 A;  1YIT A;  1N34 L;  2JA8 G;  5JJI A;  1V43 A;  4IOA A;  1HNZ L;  1VQJ A;  2EIF A;  3TRE A;  1PH8 A;  4P71 A;  3EBE A;  4LFB Q;  1N32 L;  3D0F A;  1X6O A;  4DV2 Q;  4OX9 Q;  1OXT A;  4A4I A;  4PZ8 A;  4DV4 Q;  5GAG C;  3HOX G;  3JC6 6;  2GN5 A;  1Q46 A;  3TS2 A;  1VQA A;  1WCM G;  1DGS A;  2PNH A;  2YTV A;  5C3E H;  2MNA A;  2UU9 L;  3HOY G;  3HOZ G;  3GTL H;  1Y1V G;  4LF9 L;  4X66 Q;  4HJ5 A;  2K5V A;  4LF7 L;  2F52 A;  4R1J A;  4B3S L;  2L15 A;  2CWA A;  2RHS B;  1N36 Q;  1NJI C;  5IWA L;  3PUW A;  1L0W A;  5GAD C;  4X64 L;  4DR5 Q;  1MJE A;  3GTQ H;  2PQA A;  3TEH B;  3I2Z A;  5IP9 G;  4NXN Q;  4GKJ L;  1VCI A;  3UE0 A;  4DV6 L;  4BY1 G;  1VQ6 A;  3HOX H;  3I4O A;  3L7Z C;  1I5F A;  2Z6K C;  1N34 Q;  3CCL A;  4LW1 A;  4GOP A;  3GTK H;  3CC4 A;  3HKZ E;  4YCW A;  3A0J A;  4R4I A;  1K83 H;  1Q12 A;  4YWL A;  4IPD A;  4LUZ A;  4JI8 Q;  1CSP A;  4DNI A;  4B3T L;  4LFB L;  4IO9 A;  3W1G A;  3CME A;  5IP7 H;  4OX9 L;  3PF4 A;  2ASB A;  2KHJ A;  1UE5 A;  3G48 A;  4YHH Q;  4ME3 A;  3W5O A;  2UUC L;  4NPS A;  1OXU A;  5M5X H;  3RLF A;  1VQC A;  5IYD G;  3K7U C;  3GDE A;  3KDF A;  4IPG A;  3J80 i;  4IFD G;  4YHH L;  3I4M H;  2AWO A;  3BZK A;  3ULP A;  1HZB A;  3F1Z A;  4UP9 A;  4PG3 A;  3I56 A;  4WJ3 M;  1X3F A;  4EQ5 A;  1A62 A;  1BVS A;  5M3M G;  1C0A A;  3HKZ G;  4QL5 A;  4DV4 L;  1Q86 C;  1VQK A;  1K0R A;  3E0E A;  3J81 c;  2UXB L;  4L5Q A;  1TWG H;  1IL2 A;  2JA7 H;  1E24 A;  1U5K A;  2WAQ E;  1QUQ A;  4R4C A;  4H02 A;  4DV6 Q;  4LF6 L;  1PH9 A;  4X65 L;  3PGZ A;  4R4O A;  2D0O A;  1YVC A;  3VDY A;  1KC8 C;  1EFW A;  1VQ9 A;  3H15 A;  4NB3 A;  1HNX L;  4DR6 L;  3GO5 A;  3U4V A;  2IT1 A;  2WP8 J;  4IOC A;  5FLX c;  5C0X J;  3KJO A;  1Q81 C;  4BY1 H;  1JB7 A;  1Y1W G;  4B3M Q;  4UP7 A;  1C7Y A;  1VQ5 A;  1XTD A;  4RG1 A;  2ZTE A;  5LMN Q;  2VS1 A;  4JOI C;  4C3J H;  4DV0 Q;  4HJ7 A;  1HH2 P;  2OQ0 A;  1VQG A;  1Y14 B;  2MO0 A;  3U58 A;  1YJW A;  4GN3 B;  3T1Y L;  1VQ7 A;  4BA1 I;  5JJL A;  2HHH L;  1U0L A;  1QVF A;  4DAY B;  1TXY A;  3G4S A;  2GVB A;  2XGT A;  2YYZ A;  3PV0 A;  2JEA I;  3H0G H;  1N32 Q;  1VQO A;  3CCR A;  3RLN A;  3KF8 B;  1GKH A;  3TRZ A;  3K81 C;  1EOV A;  4JI7 L;  1Q1E A;  5HY6 A;  1ASZ A;  1VQ8 A;  1OXX K;  2WB1 G;  5C0X I;  1M1K C;  3AEV A;  2HT1 A;  4GKJ Q;  4Y52 H;  2VZA A;  3S15 H;  1J6Q A;  1L1O C;  1NE3 A;  3KFU A;  4IPH A;  5M3F G;  3DM3 A;  1VQM A;  5C44 G;  1E3P A;  2N3S A;  4DK3 C;  1IYJ B;  2B29 A;  1WYD A;  3RN5 A;  1EIF A;  4BBS H;  1WOC A;  2IX1 A;  1OXV A;  3RLO A;  1VQH A;  5C4J H;  3F2C A;  4HIM A;  1LM0 A;  2K14 A;  4GLX A;  3FKI H;  3H3V I;  1A0I A;  4P74 A;  1NTG A;  4XIG S;  3JAM i;  4Y7N H;  2PQA B;  3NEL A;  2MQH A;  4JG2 A;  2F4V L;  5C4X G;  3HFZ B;  1XMO L;  2ZJQ A;  1D8L A;  1WCM H;  1EQQ A;  4LF4 Q;  1KQS A;  3J81 i;  1PYS B;  2YTX A;  4JI2 Q;  4BXX G;  4JI8 L;  1UE7 A;  2UXC Q;  1L2F A;  2R7Z H;  4A3D G;  2B63 H;  3HOU H;  4A75 A;  3K8A A;  2NN6 G;  2ATW A;  1HNW Q;  3T1Y Q;  2ZTC A;  3RN2 A;  3PUY A;  2QGQ A;  4A76 A;  1GO3 E;  5H1S E;  4UPA A;  1TWH H;  1PHJ A;  3PO2 G;  5C3E G;  2UUA L;  1VQE A;  3W1B A;  4X62 Q;  4QJF A;  3DLL A;  1FJG L;  4DR5 L;  4AYB E;  1LYL A;  2UXD Q;  1A63 A;  2E2J H;  1EIY B;  2AWN A;  4GLA C;  1QVG A;  1A8V A;  2EXD A;  4DAM A;  1K8A C;  1HR0 Q;  2K5N A;  5J3B A;  2NVY H;  2K5H A;  2HIV A;  1KD1 C;  2UUA Q;  4GKK Q;  1HNX Q;  5DLQ E;  4AIM A;  1CUK A;  4R4T A;  1V1Q A;  4LUV A;  5JEA G;  1W2B A;  4DK6 C;  3A74 A;  4J15 A;  2PI2 A;  2A19 A;  1CSQ A;  5GQO A;  2NVT H;  1YHQ A;  1P8L A;  5GRO A;  3UDF A;  4DV0 L;  2RHQ B;  1IBK Q;  3S2H H;  1I94 Q;  4BBS G;  3M4O H;  2YV5 A;  3AFP A;  1KHI A;  1XPU A;  4POF A;  4DR6 Q;  3CW2 C;  2V1C C;  2Q2I A;  4WJ4 A;  1XJV A;  2BA1 A;  4RMF A;  1O7I A;  1L1O A;  4IFD J;  4EX5 A;  1ASY A;  1VQ4 A;  4HJ8 A;  2JA6 H;  5IYC H;  3CCJ A;  4A93 H;  2YTY A;  4B3R Q;  3NEM A;  5BR8 Q;  1GVP A;  4DPG A;  4JI0 Q;  3GD7 A;  1UWV A;  1YHB A;  4P72 A;  1WJJ A;  2R7Z G;  1MKH A;  4A3D H;  1S40 A;  1JJ2 A;  2UXC L;  3L2P A;  2UXB Q;  4DR7 Q;  2HHH Q;  5BR8 L;  3PSI A;  1N33 L;  2R92 H;  3J80 c;  1LUZ A;  4QIW E;  1KIX A;  3M4Q A;  1PH7 A;  1XNR Q;  2RF4 A;  2Y0S E;  4UY8 C;  2I5H A;  4JBJ A;  4A3M G;  3NBH B;  3HKS A;  4DV3 Q;  4APV A;  2R92 G;  5IE8 A;  1PH3 A;  1NMG A;  1J5E Q;  2CKZ B;  2EQS A;  2ZJR A;  1PH2 A;  1KAW A;  3CF5 A;  1HR0 W;  1QUQ B;  1AH9 A;  1VQI A;  2WAQ G;  4B3M L;  3OTO L;  1SR3 A;  4OWW B;  2JK8 A;  2CFM A;  2GVA A;  2B3G A;  2NZO A;  2AKW B;  4B3T Q;  4A3B H;  4HJ9 A;  1XMO Q;  3L0O A;  1YJ9 A;  2LXK A;  4JOI A;  4DUY Q;  1W3S A;  3GTJ H;  2NN6 I;  3MXN B;  2BH2 A; 
#chains in the Genus database with same CATH topology
 4OWT B;  4XYM B;  4J9K A;  3PIO A;  2PCF B;  1XXG A;  1BKB A;  2ZM6 H;  1HUN A;  2JP1 A;  4GOP C;  4UP8 A;  1YNN D;  1QZG A;  1AW7 A;  1Q82 C;  3AYH B;  2JA6 G;  2WB1 A;  4DV4 H;  2MFI A;  1EWI A;  2LSS A;  1SBB B;  1YEZ A;  4YWK A;  4MZ9 A;  4A3L G;  1HFG A;  1VQL A;  4DV5 L;  4N8F A;  2JE6 I;  2XCA A;  1KDB A;  2FMM A;  4YB8 B;  1B3Q A;  1JQY D;  1JWU D;  1FJG Q;  3MXN A;  4DV1 L;  2EJM A;  1K1S A;  1WCM A;  3U9T A;  3B6Y A;  4IZ8 A;  1KRT A;  5KT2 A;  1Y69 U;  4DL4 A;  3CCV A;  3V05 A;  1DD2 A;  4RAY A;  1LTB D;  2AQ2 B;  3FDT A;  2B63 G;  1E7Z A;  1HZC A;  1PMR A;  4C3I G;  4N9T A;  2FJ2 A;  5C5M A;  1IBK L;  1LTA D;  3KHL A;  1FNU A;  5C4X H;  4WJ4 A;  5JJK A;  1XNQ L;  3C46 A;  4K5V A;  2NVX A;  1JDB B;  4I50 F;  1N33 Q;  2WYO A;  1EQT A;  1IKL A;  1IBM L;  5J2U F;  1EIH A;  1Y8N B;  2Q2T A;  1ZQ7 A;  3CCM A;  3H3V H;  4XQN A;  5I9P A;  2DY7 A;  4MNO A;  2VNU D;  1KJQ A;  4XX0 B;  4TVA B;  1XMQ Q;  1J5E L;  1OO9 B;  3DHQ A;  2BR0 A;  1PDQ A;  3Q8S B;  5CA1 F;  2DNC A;  2IW3 A;  2E5L Q;  1LAC A;  3T1Y H;  4DV6 H;  2ZTD A;  4DV5 Q;  1ICF B;  5M5W H;  4EQN A;  2MJ8 A;  3NWT A;  3AMU A;  4ZCK A;  1M8A A;  4BS9 A;  2KCT A;  4CJ0 B;  2VQF L;  1SNM A;  3OSN A;  3X3N A;  1HCZ A;  3BYT B;  4CDD C;  5IT9 c;  4DLK A;  3Q23 A;  3CCQ A;  1EUD B;  2W9C A;  1XMQ H;  1PH1 A;  4HNT A;  1EEI D;  2AGP A;  3MXG A;  2IX0 A;  3D3R A;  1JT8 A;  2FKL A;  5GAH C;  2GPS A;  4IFD I;  3NGD A;  2N49 A;  1K83 B;  2VQE H;  3PMF A;  4DUY L;  1AZP A;  3GQC A;  4DR3 L;  4KJO A;  2E8G A;  1TA8 A;  3W3A A;  2PO4 A;  1S72 A;  4MN3 A;  1VF5 C;  5D3D A;  1NMF A;  1CZG A;  2OXP A;  4LFA H;  5FLM H;  4C2M A;  5FKA C;  3V2T A;  1QVC A;  2V9W A;  1BCP C;  4LFC Q;  2PVP A;  3ORQ A;  3WOE A;  4LF6 Q;  4O3S A;  5KG1 A;  1F9R A;  5KG6 A;  4PZ7 A;  3I72 A;  3STB D;  2AMC B;  1W93 A;  1FNV A;  4IRK A;  3EPG A;  1F9P A;  2G9D A;  1YNJ C;  2R6G A;  2L4N A;  4MA0 A;  3FMC A;  3T1H H;  4POG A;  2Y0S G;  1I50 H;  5J1Z A;  2FK3 A;  4YY3 H;  4QIW B;  3PN1 A;  2FE3 A;  5KFP A;  3E5S A;  3FEW X;  1U9R A;  3ERS X;  3OWF A;  4HR7 B;  5D3I B;  1CKO A;  3I7F A;  1JXL A;  5DAU A;  3SI8 A;  1R9T A;  5KFZ A;  1X3E A;  4K2K A;  3S1R H;  2VA3 A;  2AGO A;  4K2L A;  3Q1K A;  4GNX A;  1IBL Q;  4JI0 L;  1E2W A;  3V6J A;  3HKZ B;  3AB9 A;  3NE5 B;  5KRU A;  2IY5 B;  2UXC H;  2ZM6 Q;  1TT2 A;  1ZYR C;  1B6R A;  2FXQ A;  3K3P A;  5A2Q W;  4RH6 A;  4Q5V A;  1N34 H;  2HIX A;  2R7L A;  1VBG A;  4KI0 A;  5IP9 H;  4LF8 Q;  1DYQ A;  3H94 A;  4RHS A;  3T53 B;  1JE5 A;  1C30 A;  1CA5 A;  1T9H A;  4F87 A;  4G4K A;  5JUM A;  4IRC A;  5FLM G;  3QOL A;  4ULL A;  2A69 C;  3SK4 A;  1KNE A;  3MXP A;  1DZ1 A;  3ZYY X;  3BDO A;  4KV6 A;  2JQO A;  3QB3 A;  4LFC L;  4JW0 A;  4BBR G;  3I4N G;  1NY4 A;  1K83 A;  1EOT A;  4RGT A;  3M7N A;  1PRT C;  2K6A A;  4GZY C;  4QWB A;  1I6V C;  5C0X G;  3CCS A;  2WTF A;  1JJG A;  1I3Q H;  2EPB A;  1NAP A;  5IYB H;  3JRX A;  3J7Z C;  2NUA B;  4IFD H;  3BJU A;  1D6E C;  2AQ3 B;  1NR4 A;  5IYC G;  4FF4 A;  5IYD H;  5IGG A;  5LYJ F;  2K28 A;  3HOY H;  5IT9 L;  2AUJ D;  3P1H A;  1ILQ A;  3NWS A;  1UUP A;  1VAJ A;  5KG0 A;  1SN8 A;  1ZET A;  1UE6 A;  3RB3 A;  1LLR D;  5E1F A;  2E2I H;  4RB2 C;  1ZKO A;  1XMQ L;  2WAQ A;  5M3M H;  2KCM A;  5E4W C;  5CV8 A;  1J5E H;  4JI8 H;  1BQQ T;  2ES2 A;  1EY4 A;  3ERQ A;  3H6M A;  4I7A A;  4DV3 L;  1RJP A;  4LFC H;  5IT9 E;  3S9W A;  3J81 E;  1FGB D;  2HUG A;  1SFO H;  5EAY A;  4A3B G;  1HR0 H;  2Z0S A;  3ZJY C;  3J81 W;  1QJO A;  4BBR B;  2UUB L;  3VR2 A;  4JV5 Q;  3MWY W;  4YWM A;  2HGS A;  1HQR D;  3TQT A;  1VQF A;  2BE5 D;  3J80 L;  4M8A A;  2IHE A;  2K1B A;  3KLS X;  5IWA H;  2N55 A;  4HCE A;  4KHP Q;  2PI2 E;  5IIF A;  2I07 B;  2I5M X;  5LMN W;  4EBC A;  1X55 A;  1Y8P B;  5FJ8 G;  3HOW H;  5BN3 A;  2RCF A;  1PFS A;  5EGT A;  4O0A A;  1Z2P X;  4DR3 Q;  4V19 0;  2R8I A;  2EY2 A;  1G2S A;  3T5L A;  4A3I G;  1N36 L;  2XN9 C;  4A3I B;  2W9A A;  3I70 A;  4DA2 A;  2R7D A;  3VYT A;  3S1Q H;  2Q2U A;  5KFD A;  2KEN A;  2VUM G;  1TWA H;  3FMA A;  5NUC A;  1P16 A;  2VY3 A;  3J81 j;  2XRQ D;  3OUU A;  5L37 A;  2JEB I;  3GIJ A;  3PO3 G;  3KDF B;  1HR0 L;  3GTK B;  1PVO A;  2Y0S B;  4G3I A;  2R92 A;  4OXP A;  4JPB W;  4UCT A;  3K5I A;  4MV7 A;  2ID0 A;  4JI1 L;  1YNJ D;  3OMG A;  4JI6 Q;  3S16 B;  4AQY L;  2HDM A;  4LMQ D;  3GTG H;  1B33 N;  1Y1V A;  1K28 A;  4GLV B;  5IP7 G;  4ED2 A;  4YY3 L;  4F8M A;  2I8C A;  5DEH A;  3F2D A;  3CC2 A;  4KTA A;  2H4O A;  5BPH A;  2JA8 G;  4RB3 C;  1PRT B;  1VQJ A;  2R8G A;  2YU9 A;  3EBE A;  1CM9 A;  1N32 L;  3NTH A;  4DV2 Q;  2LKV A;  1SXT A;  1PTO H;  5C3E B;  1XTC D;  3JC6 6;  4ECV A;  1VBH A;  4IR9 A;  1UC8 A;  1WCM G;  4DU9 A;  1PTO C;  4YBZ B;  3HOZ G;  1GHK A;  1T94 A;  2HCI A;  4X66 Q;  1STY A;  4JUZ A;  4YQW A;  4B3S L;  2GPW A;  4N8X 1;  2KA7 A;  5FPR A;  4J9M A;  1EZ8 A;  1N36 Q;  3PUW A;  4EQP A;  4X64 L;  2DLN A;  2V58 A;  1EWH A;  5IP9 G;  3VYR A;  1K0S A;  4KY5 A;  4RCN A;  2R6F A;  3RV3 A;  1VCI A;  1JKJ B;  2W71 A;  3UE0 A;  4DV6 L;  4BY1 G;  2SNM A;  4RNN A;  3MAQ A;  4X66 H;  5EPK A;  3N6X A;  3L7Z C;  3CCL A;  1N34 Q;  2QW7 A;  2UVR A;  3A0J A;  4ZKC B;  3KBG A;  4R4I A;  1HA5 A;  4YWL A;  2VUG A;  2KED A;  1CSP A;  3P20 A;  4B3T L;  2UVW A;  4DR5 H;  4F50 A;  4PQX A;  4EEY A;  3CME A;  3SHL A;  5IP7 H;  1HXY D;  2ASB A;  1RCV D;  2B2Y A;  4ID6 A;  3TBI B;  1UE5 A;  4YHH Q;  1NNX A;  2WII B;  3MXU A;  3W5O A;  1B1Z A;  1C4Q A;  3RLF A;  4LH7 A;  1M7J A;  3K7U C;  4H44 C;  4KN4 C;  3GDE A;  1Y8O B;  4IFD G;  3F1Z A;  4PG3 A;  4EBD A;  2K5Q A;  5KIX A;  1IBM H;  1GHJ A;  1C0A A;  3HKZ G;  4QL5 A;  4FVM A;  3VR3 A;  5JJZ A;  5CV5 A;  3J81 c;  3MFH A;  4L5Q A;  1E24 A;  1U5K A;  1HTP A;  3N42 B;  2I87 A;  2E76 C;  1VQ9 A;  1EFW A;  5CYU A;  5KG5 A;  3KAK A;  2KCN A;  5IOC A;  3J80 E;  1HNX L;  5DM7 3;  4DR6 L;  2F0I A;  2FLP A;  2E74 C;  2YCH A;  2C5C A;  1JB7 A;  3PO2 B;  3MR2 A;  3CQZ A;  4RG1 A;  2ZTE A;  2W6N A;  3L3O C;  4C3J H;  4DV0 Q;  4HJ7 A;  3S1Q B;  2YYA A;  3KLS A;  2OQ0 A;  2KCC A;  2ICI A;  2X6L A;  3U58 A;  2MO0 A;  1EYA A;  2K01 A;  5J22 A;  4RNM A;  5COY A;  1ET6 A;  4UCV A;  4QWD A;  2V4R A;  1C8C A;  2Z8L A;  5EJW A;  3T4A C;  4DV2 H;  4I4T F;  4O1N A;  3DF7 A;  1K3B C;  3TSS A;  1VQO A;  3CRL C;  3RLN A;  3QOJ A;  3CCR A;  3MJF A;  1EOV A;  1W6K A;  3R5F A;  1VQ8 A;  3K57 A;  5KFT A;  1WR2 A;  2WB1 G;  4DV3 H;  4B3T H;  2W6Q A;  1EU4 A;  2B2T A;  2A6E C;  4K8J A;  4GKJ Q;  4Y8V B;  1NSN S;  3I12 A;  1B4O A;  2KQ3 A;  4C5A A;  3HRZ C;  1VQM A;  5C44 G;  1E3P A;  1STA A;  2DY8 A;  5EWG A;  5DG8 A;  4HSV A;  3RN5 A;  3GTL A;  3FPU B;  4BBS H;  4K0K H;  2IX1 A;  1Z2O X;  1OXV A;  5C4J H;  4AYB B;  4GLX A;  2K14 A;  4BY1 B;  4XIG S;  3A7A B;  3L9A X;  3VA7 A;  4Y7N H;  1KJJ A;  4QUF A;  3NEL A;  4GKK H;  4JG2 A;  1E4E A;  1XMO L;  3JAM W;  5AFW A;  4LF4 Q;  1SYX B;  4BXX G;  4L1K A;  1UE7 A;  4FF2 A;  1L2F A;  2R7Z H;  4A3D G;  3T5J A;  4TQR A;  2EYH A;  3EA6 A;  3HOY B;  2F0F A;  2L55 A;  3HOU H;  2FPP B;  2AUK A;  1ZHQ A;  1BF4 A;  2QGQ A;  2JEF A;  1I4Q A;  4F4X A;  2OEO A;  5H1S E;  3M4I A;  2BDN A;  2Z4I A;  5C3E G;  1VQE A;  3W1B A;  2D9U A;  2QYZ A;  3DLL A;  1FJG L;  3QO2 A;  1G91 A;  4AYB E;  1LYL A;  1EY6 A;  2UXD Q;  4LF4 H;  1EIY B;  4GLA C;  2R3Z A;  2EE1 A;  2K5H A;  3AU7 A;  3M7G A;  4GKK Q;  1SEI A;  4AIM A;  3D6C A;  4LUV A;  3ETH A;  2R82 A;  2PMZ B;  2J7Z A;  5KT6 A;  5DLF A;  1VF7 A;  4IZO A;  5EOY A;  1P8L A;  5GRO A;  1IBK Q;  3GTP B;  4BBS G;  2BCO A;  1ZXT A;  1SYG A;  3AFP A;  1XPU A;  2X0S A;  1N33 H;  2V1C C;  2UVU A;  1O7I A;  1SAP A;  2FMC A;  3RUZ A;  1VQ4 A;  1ASY A;  4PNY A;  4XQQ A;  5IYC H;  3C2P A;  3CCJ A;  1EQV A;  3R93 A;  5CV4 A;  5BR8 Q;  3RIZ A;  4JI0 Q;  1RK5 A;  3R23 A;  5LMN H;  2C2D A;  2R7Z G;  4A3D H;  1NCV A;  1B6S A;  3QFF A;  1S40 A;  1TS5 A;  2VQD A;  3RTX A;  2Z4H A;  2XCL A;  1I50 B;  4KY6 A;  4X64 H;  4QIW E;  2B2W A;  1KIX A;  1PH7 A;  2C2R A;  3MEH A;  3VYS A;  1TWG A;  4A3M G;  4R8U A;  2LY7 A;  2TMP A;  4O4L F;  2NTT A;  5ELE A;  1FYC A;  5I2Y A;  3NQI A;  2CKZ B;  2EQS A;  3CRK C;  5JPM C;  1KEE A;  4J9O A;  3CF5 A;  1QUQ B;  1CQJ B;  2I46 A;  5EPJ A;  2HJW A;  3TII A;  4ZAI A;  2CFM A;  4HJ9 A;  2R7Z B;  1YJ9 A;  4JOI A;  2ASJ A;  4DUY Q;  1KDA A;  3N52 A;  5HV6 A;  3V6H A;  4IR1 A;  1EYC A;  4ED3 A;  3A8K E;  1S03 G;  4JC0 A;  5L1J A;  5LXT F;  5F9N A;  2A68 C;  2Z9H A;  1WFQ A;  3U50 C;  2A1A A;  2F4V Q;  4JYA L;  5C4J B;  4BBS B;  4KN7 C;  1A2U A;  3T13 A;  1JLL B;  3KLR A;  3PW4 A;  1BJT A;  2X69 A;  4A3K B;  4MV4 A;  2M2L A;  4JBM A;  1YNX A;  3ONA B;  3BG5 A;  4Q44 A;  4JV2 A;  1EQR A;  2D0P A;  1MBY A;  3A7L A;  3K7A B;  4ODG A;  4HIO A;  2NZ1 D;  3F8T A;  4DR1 L;  1ZHS A;  5C5J A;  2OH2 A;  1NUC A;  1Q90 A;  4YAJ B;  4J0M A;  1CKM A;  3R2T A;  1B2T A;  1JWM D;  4ECZ A;  1Q8I A;  3RZD H;  4F4Y A;  4A3K G;  2YRX A;  2R7N A;  4IPC A;  1LAB A;  1CA6 A;  4CHT B;  2UUA H;  5IY0 A;  5LMU H;  2NVX B;  4Q0Y A;  3G6V A;  4LF4 L;  1GUT A;  5LHY 1;  4A3F B;  1F2M A;  1D5M C;  3MWM A;  4LWC A;  2XSC A;  1CKN A;  3TS2 A;  1MJC A;  2K52 A;  4HJA A;  3JAM c;  2NVQ B;  3MA2 B;  5I4D A;  1SE3 A;  4E4T A;  5F2D A;  3K5H A;  4AYB G;  1K73 C;  1D5Z C;  2Z6K A;  4C3H G;  4GNX B;  1BDO A;  3R5X A;  1JX4 A;  2F0M A;  4FXK C;  1N48 A;  2BH8 A;  3Q24 A;  4A3L H;  2K75 A;  2A69 D;  5JVG 3;  2M05 A;  5IWA Q;  2JA6 A;  4A3J B;  1HZA A;  4X65 Q;  3G6X A;  3TQ1 A;  3CCU A;  2G9H D;  2VB3 X;  4WJW A;  3KF6 A;  2EYO A;  3BG3 A;  5KFQ A;  1B3A A;  3ND9 A;  4LNQ A;  3T5H A;  1H9J A;  4A3G G;  4TUY F;  4JI1 Q;  5JEA H;  2YS6 A;  1SNP A;  5K36 G;  4J9L A;  4RB1 A;  3NSW A;  2DN8 A;  4IJL A;  4CC5 A;  5BN5 A;  5L1K A;  3PW5 A;  2CW8 A;  2RA4 A;  2EY6 A;  2L12 A;  3H0G G;  4KK7 A;  4OHJ A;  2N78 A;  4I7Z C;  3DWA A;  3WWV A;  1UE1 A;  4B9W A;  3I73 A;  2VUM H;  1SJH D;  1XDN A;  3ITP A;  3X3M A;  2VUM A;  2WFW A;  2A73 B;  2ALZ A;  4K6L A;  1YZ6 A;  2E2H B;  4HYK A;  2F0S A;  4FBU A;  5M5Y H;  4KHP H;  2RBM A;  1NBW A;  3V6K A;  3FKI G;  5D1P A;  4J9Q A;  1PZK D;  4OEL B;  2OLS A;  1JJC B;  5CAE B;  2D5D A;  1ENF A;  3RZO H;  1M0T A;  1DXM A;  4LFA L;  4V0B A;  4C5B A;  3GTG A;  5ELB A;  5JVH 3;  5EKL A;  4FYD A;  4PZ6 A;  3GTJ A;  3Q2O A;  5EWF A;  4UAI A;  2B2V A;  1STG A;  3OHX C;  3OPO A;  2KEC A;  1QG7 A;  3BA9 A;  3A5U A;  4JYA H;  3UDX A;  3GTG B;  4XYO A;  3IG0 A;  3T1H L;  3S16 H;  1ENC A;  5BN4 A;  3FP9 A;  4ZYS A;  4QWA A;  1VS0 A;  2NZH A;  3M85 A;  4K5W A;  1ML0 D;  3V96 A;  3H40 A;  4HMI A;  3M4P A;  1ET9 A;  3G71 A;  5EZY F;  3MVV A;  4C3J G;  3VR6 A;  3FKI B;  2YL2 A;  4QUC A;  1H9S B;  4X6A H;  4LF8 L;  2VOB A;  1TWA B;  1AZQ A;  4CJ1 B;  1QWY A;  4ZUI A;  4DV1 H;  1YIJ A;  4A3I H;  2OCE A;  2CQO A;  3CHB D;  1H95 A;  3BAA A;  4DL5 A;  1G29 1;  3KAL A;  2KEE A;  1GJX A;  3IN5 A;  4ED0 A;  3HOW B;  2A68 D;  4KHV A;  3BVZ A;  3PUZ A;  4CJ2 C;  4JI2 H;  3CC7 A;  3TP8 A;  1A6X A;  4LF8 H;  2CQY A;  4O4H F;  3H0G B;  1GSO A;  3GIP A;  2B2T C;  2H5X A;  4DAV A;  2BQ3 A;  1TII D;  5KG3 A;  2JA8 B;  3BZD B;  4BA2 I;  5I6W A;  1R4Q B;  1X9N A;  1K8M A;  1SE8 A;  4X64 Q;  1IXR A;  5E3F A;  4AH6 A;  2DUD A;  5FD5 A;  1JDE A;  5KFE A;  3GLK A;  5FD6 A;  3H91 A;  4MTN A;  1SYF A;  1EYZ A;  2EOT A;  3KYH C;  3PO3 H;  1D1I A;  1W6J A;  5ELO A;  3CXC A;  2NBF A;  3E9H A;  3S1N H;  1WH2 A;  4CC6 A;  4ZOL F;  4A3J G;  4L5S A;  1WVL A;  1N9W A;  1RHP A;  1Q1B A;  4KLK A;  4LF9 H;  2CHB D;  2CW0 D;  3F2B A;  4IUU A;  2K4K A;  1FVI A;  1CI3 M;  1PYB A;  4WBN F;  5KX5 F;  3S24 A;  3CMA A;  3KUP A;  3OOC A;  2IHF A;  3KLW A;  2K04 A;  1B8A A;  3DXJ C;  4JI3 L;  2Q8T A;  2CH4 A;  4J9R A;  4NXM L;  4KHP L;  1HRJ A;  4FXG C;  2ZM6 L;  4BXX H;  1UEB A;  4GN5 A;  3I4M B;  4ZRZ A;  2F3I A;  1B9M A;  4DR7 H;  2XD4 A;  2EYM A;  3SE7 A;  1YJN A;  3N41 B;  1S5C D;  4NDX A;  1CQV A;  4C1N I;  1II3 A;  4MTD A;  3PIP A;  5C1P A;  2MGS A;  4CBV A;  4JI7 Q;  1FR3 A;  1HA6 A;  5D1O A;  4C2M H;  4UCU A;  1EHI A;  5C8Y F;  1X3P A;  2JA5 G;  1LTS D;  4DV7 L;  3I8Z A;  5KG7 A;  1B7Y B;  3RBD A;  2H1E A;  1I4P A;  1J9O A;  5COR A;  4DR4 Q;  2NU9 B;  1EY8 A;  3UI2 A;  2W8L A;  3OHB A;  2UU9 H;  1CKN B;  3CQZ H;  4DGZ A;  2YZM A;  3BA8 A;  1I6U A;  3J80 W;  5JJI A;  1V43 A;  4LH6 A;  1H9K A;  3QIA A;  1PH8 A;  3BAB A;  1LO5 D;  2SOB A;  4P71 A;  4X3K A;  3WNZ A;  4LFB Q;  1BNC A;  5JVL A;  3D0F A;  1X6O A;  1HHV A;  5JPN C;  2DPJ A;  2DIK A;  4DV4 Q;  3HOX G;  4CKC A;  1XWE A;  4NKL A;  1DGS A;  2PNH A;  4AQY H;  3LML A;  5CV9 A;  4X62 H;  2UU9 L;  3A56 A;  1ESR A;  2IBK A;  5IGC A;  1W96 A;  1H9S A;  2L15 A;  2BQU A;  1BO0 A;  4TSS A;  5C3X A;  1NJI C;  2FPG B;  5IGE A;  1WTW A;  4DR5 Q;  3GTQ H;  1S97 A;  4NXN Q;  2L11 A;  2NU7 B;  5HGT A;  2HVR A;  2YU9 B;  3M4O B;  4CGY B;  1MI2 A;  2RDF A;  3CC4 A;  2W6O A;  1SNC A;  4UDU C;  1WTQ A;  1K83 H;  2R93 H;  4IPD A;  2QK4 A;  3VR5 A;  4G7H C;  2E2D C;  2VXW A;  1WTP A;  2JN4 A;  4KY7 A;  4IO9 A;  3W1G A;  3GTL B;  4OX9 L;  4O42 A;  1BUV T;  2KHJ A;  1I3Q A;  4RU9 A;  4ZHQ F;  1LTI D;  1XNR H;  2BE5 C;  1UNS A;  2IPK D;  5C4H A;  5IYD G;  2A6H C;  3KDF A;  3J80 i;  3PIP 3;  4YHH L;  1RK6 A;  1A3U A;  3BZK A;  1HZB A;  4UP9 A;  3I56 A;  3C1E A;  1TY2 A;  3GTQ A;  5KFR A;  5M3M G;  5M5W B;  1A62 A;  3P75 A;  3MR6 A;  3H0G A;  2F0H A;  4KKS A;  4H0L C;  4DV4 L;  1Q86 C;  4NP5 A;  3TP5 A;  2J0T D;  3RGX A;  1HQM C;  3I91 A;  2E2I A;  5A2Q L;  4P2C B;  4H02 A;  3IL8 A;  4DV5 H;  2Q8R E;  3RB4 A;  1Z6H A;  3PGZ A;  1KC8 C;  3KHG A;  1DOM A;  4KJN A;  1GYF A;  1QNU A;  4NB3 A;  3C1F A;  5FLX W;  4KD4 A;  1TWF B;  3GO5 A;  4JV1 A;  3NHH A;  1CFM A;  3M4Y A;  5FLX c;  2R84 A;  3KJO A;  2W6Z A;  3VYU A;  5KYL A;  2F0Q A;  4UP7 A;  4UCO A;  5I47 A;  4PV1 C;  2VS1 A;  4JOI C;  1JOO A;  3SDZ A;  3PVX A;  1SMY C;  4C1N K;  3SK5 A;  1LT6 D;  4EBE A;  1X3Q A;  4DV7 H;  3BDL A;  5FK9 C;  3K5N A;  1QVF A;  2C28 A;  4DAY B;  4ZLT F;  1TXY A;  1TQO A;  2GVB A;  2YYZ A;  3PV0 A;  1AP0 A;  4H13 C;  4EFE A;  2C00 A;  3TRZ A;  4MIU A;  4JI7 L;  1Q1E A;  5HY6 A;  4FM9 A;  1LTT D;  1SE2 A;  1ASZ A;  2B63 A;  3QJY A;  1M1K C;  4DNT B;  5C0X I;  3AEV A;  2CQA A;  5CV7 A;  2HT1 A;  5C44 B;  4XDX A;  1A2T A;  2B8G A;  2E75 C;  3EJI A;  1FJG H;  3S15 H;  1L1O C;  1NE3 A;  4IPH A;  5M3F G;  3DM3 A;  2A8V A;  2N3S A;  3MTS A;  2B29 A;  1ZYR D;  1S0O A;  1DV1 A;  1EIF A;  1AN7 A;  2XCP A;  4DL7 A;  2UVV A;  1WOC A;  3RLO A;  1FNW A;  5CMD A;  4HIM A;  1LM0 A;  5EKI A;  3H3V I;  1PX2 A;  4ED7 A;  4JV0 A;  2DJG C;  5D1O B;  3K59 A;  2ZDG A;  1LT5 D;  4E6I A;  5J39 A;  2F4V L;  5C4X G;  1D8L A;  1WCM H;  4RUA A;  1KQS A;  2XWJ B;  1I50 A;  2UXC Q;  4OL7 A;  3Q6S A;  4MHE A;  5KFJ A;  2FMA A;  2QF7 A;  3WO0 A;  4MTK A;  2B63 H;  4A75 A;  3K8A A;  2WDT A;  2PW5 A;  2ZTC A;  4RFB A;  3RN2 A;  4B08 A;  4A3E B;  2PNR C;  4UCS A;  1SJE D;  1GO3 E;  1WD0 A;  1Y1W B;  5IYZ F;  1E0B A;  4GC7 A;  2K03 A;  4DR5 L;  2F0U A;  1PZJ D;  1A63 A;  2E2J H;  2FLL A;  2AWN A;  5KNB A;  1QVG A;  4OX9 H;  2EXD A;  2K5N A;  4QF4 A;  5J3B A;  5KFN A;  2W8K A;  1HNX Q;  2XGP A;  4R7R A;  1L2Z A;  4IAJ A;  2YS7 A;  4LK1 C;  5JEA G;  1W2B A;  4ECX A;  1ILP A;  4X3T A;  3GIM A;  2PI2 A;  4HAE A;  5GQO A;  2X6G A;  4DV0 L;  1CHQ D;  3MWE A;  1I4X A;  1KLU D;  4Q8F A;  3IFT A;  5EPL A;  1I94 Q;  2P0A A;  2JA6 B;  3M4O H;  2EYL A;  1KHI A;  5EKK A;  4CDF C;  3JSN A;  3N8D A;  1EEF D;  3CW2 C;  3DM1 A;  1WTX A;  2W6M A;  3GID A;  3MWD A;  2YZG A;  2UUC H;  2BA1 A;  4RMF A;  1F2Y A;  1L1O A;  1KJI A;  4ZQI A;  4NW2 A;  4RCO A;  2V5A A;  1ULZ A;  3S17 B;  1SMY D;  1JWS D;  1WTV A;  3NEM A;  1GVP A;  2ZXP A;  4DPG A;  4WD3 A;  3GV7 B;  4P72 A;  5IGD A;  1T3N A;  1WJJ A;  1MKH A;  2UXC L;  2PZT A;  3I3C A;  4Q0F A;  5BR8 L;  1C48 A;  3PSI A;  4ED8 A;  1D1K A;  3GTM A;  1RTN A;  2NVY B;  2XWB B;  2Z1C A;  2PPB C;  3M4Q A;  1XNR Q;  3UQ8 A;  2Y0S E;  1M6V A;  1S0N A;  1JB3 A;  3NBH B;  3HKS A;  4DF7 A;  4APV A;  4DV3 Q;  2JXM B;  1NMG A;  1PH3 A;  1PH2 A;  1TWH B;  1HR0 W;  2B39 A;  4OIK A;  2W57 A;  5KT3 A;  4MV9 A;  3O13 A;  4IHJ F;  3Q22 A;  1SR3 A;  5KFI A;  5DGA A;  1L0X B;  2AKW B;  1PTO D;  4A3B H;  5DG9 A;  3NK9 A;  1XMO Q;  3FKI A;  2LXK A;  1FGU A;  1TU2 B;  4A3M B;  4JVZ A;  2WB1 B;  4R4Q A;  2BH2 A;  2R8J A;  1G51 A;  4QY7 A;  1I6H B;  5KNC A;  2DWC A;  3SVM A;  1F77 A;  4QW9 A;  3S1M H;  1EY0 A;  1IOV A;  2RDJ A;  4WOR A;  2L0C A;  4IUP A;  3SR1 A;  2HDL A;  4DR7 L;  4C3I B;  1O75 A;  4IWX A;  2EZV A;  3FPP A;  2XTI A;  3I4N B;  2V59 A;  5HUR A;  2FLN A;  3ETJ A;  2FHT A;  5C4Z A;  4GKK L;  4JI4 L;  3S2D H;  4A3C G;  1S5B D;  4XXE A;  5KFF A;  3HOW G;  1CQF A;  2WE6 A;  4FS2 A;  5CC4 A;  3TZD A;  1SCU B;  3OTO Q;  4TQS A;  3RNU A;  1AE3 A;  2LXJ A;  1X3G A;  2PQE A;  2IX3 A;  2PBZ A;  2VPQ A;  3CVZ A;  3E0J A;  5JQW A;  3GV5 B;  3Q8P B;  2F0J A;  4A3E G;  3S2D B;  3JSL A;  2RVL A;  1CE8 A;  2QDB A;  2O2L D;  1V51 A;  3GIQ A;  3RJ0 A;  4XZ3 B;  4ABN A;  2ATL A;  4DV2 L;  4QWC A;  4NXM Q;  5KT4 A;  4C3I H;  1TR5 A;  2L5T A;  3UDI A;  3NEN A;  2NVY A;  3S1M B;  3PW7 A;  5KND A;  1VQN A;  4LF7 H;  2JA5 A;  4MV6 A;  4O3Q A;  1I6H H;  4A3F G;  1L1O B;  5IT9 W;  2JA8 H;  1E2Z A;  3D6W A;  1MIU A;  4A3B B;  5CGK A;  3RFC A;  2JA7 B;  2RCN A;  5LMU Q;  3MC0 B;  3UE1 A;  4HIK A;  3RR5 A;  4FF1 A;  3S14 H;  1Z7T A;  5IYB G;  1LT4 D;  3N40 P;  4IUQ A;  4LAA A;  4WFN 3;  2EY1 A;  2ZDH A;  3V4Z A;  1BBW A;  3HXL A;  4GNX C;  1PH5 A;  4YP3 A;  1JC7 A;  1RYR A;  5LL6 X;  4FP5 D;  4QCL A;  2CCZ A;  4C3H H;  4JCV E;  3G6J B;  5M5X B;  4O4I F;  4DAY A;  4FDB A;  2B2U C;  3TIG A;  3G6Y A;  1PK8 A;  1HUM A;  4J8Q A;  1KL9 A;  4ME5 A;  1Q7Y C;  1SFO A;  4Q8E A;  3GII A;  4JI3 H;  1HJP A;  1MD2 D;  3E6Z X;  2O5I C;  1B50 A;  4YHH H;  2BA0 A;  1HNW L;  4GN4 B;  4O2D A;  3A5Z B;  4ECY A;  2KUM A;  4R9W A;  4BY7 H;  1LTL A;  1GLV A;  1BR9 A;  2IA6 A;  4DXF A;  4FS1 A;  1RYS A;  4DKA C;  1IBL L;  5JH7 F;  1WTO A;  4X62 L;  1AE2 A;  3RAX A;  2PN1 A;  2F3W A;  3NPP A;  1WI5 A;  3VA5 A;  1TWF A;  4DL3 A;  3Q8R B;  3SE0 A;  3BU2 A;  1B04 A;  4XTC S;  2F0E A;  4X3U A;  3U4Z A;  4HQ6 A;  3H4D A;  1EYG A;  1K8O A;  4MAM A;  2V4Q A;  4F4W A;  1EUJ A;  3OTO H;  3AFQ A;  4A3G H;  2VQE Q;  2D62 A;  2R92 B;  1FD7 D;  4M9U A;  1HZ9 A;  4O2A F;  2R93 G;  4KHZ A;  3J7A V;  4P73 A;  1XMO H;  4LFA Q;  5KFX A;  4JI2 L;  4DUY H;  4MV3 A;  3PW0 A;  1DCZ A;  2I5L X;  1IL8 A;  1SDF A;  2EY5 A;  5AJ3 L;  5JVD F;  1A15 A;  2CVR A;  1XPR A;  2E2H H;  2B63 B;  5KFO A;  3L4K A;  1PFM A;  2LS0 1;  1X65 A;  4ZK9 B;  4QIW A;  3HGB A;  2ASD A;  1E1T A;  4G57 A;  1VKZ A;  1BCP B;  2MHV A;  3WOF A;  3S2H B;  2FJZ A;  2VQF H;  3T1H Q;  1KNA A;  3PR4 A;  4DR4 L;  1DOL A;  2OT2 A;  2J6T A;  1B44 D;  1E22 A;  3MEF A;  3K58 A;  1PH6 A;  2R7Z A;  4RAU C;  1TY0 A;  5T1I A;  1OXS C;  3CD6 A;  3J7A K;  3K5L A;  2PMZ E;  4GKJ H;  1T5E A;  3EVQ A;  3IRB A;  2ICE C;  2ALY B;  2WIN B;  3HBL A;  3HKZ A;  4JI5 L;  2NWG A;  2L1B A;  5C44 H;  2EXZ A;  1C3O A;  4DR2 L;  1EWC A;  2CWP A;  4LJZ C;  4RA8 A;  4QGU A;  3NTK A;  4JK1 C;  5FJ8 H;  2SDF A;  4P75 A;  3CCE A;  5KFY A;  1PH4 A;  4U7C A;  3QZ7 A;  5DQH A;  5JEA J;  2OTJ A;  1E1O A;  1HNZ Q;  3U9S A;  2VL6 A;  4A3J H;  1JOK A;  2DPI A;  4GS3 A;  1BXR A;  3R2I A;  1IYV A;  3SGI A;  4B3R L;  5BMV F;  1Y1V B;  1BGW A;  5M3F H;  1I7N A;  2KSW A;  3ICE A;  4F4Z A;  4NXN L;  2R61 A;  3LNN A;  3J7Y W;  3LGJ A;  1SRO A;  4GOP B;  2UXD L;  4LF7 Q;  2RGR A;  1KAA A;  5KKN B;  4LF5 L;  2JA5 B;  3TQY A;  2R7M A;  4A3F H;  4DL2 A;  4DAP A;  2C9O A;  1CTM A;  4PMB A;  2NVX H;  1KAB A;  3QG1 A;  3QR8 A;  5I9O A;  1PRT F;  1B70 B;  4K0K L;  4DUZ Q;  3RZD B;  3BVM A;  1ICW A;  1EU3 A;  2ZXO A;  1EL0 A;  3A8J E;  3E9I A;  4C56 C;  4YY3 Q;  3R5H A;  3K0X A;  5GAE C;  1SRU A;  4IAL A;  3SXH A;  3WO1 A;  5DQI A;  5CBA E;  5JAV A;  5KFV A;  1G2T A;  5IGF A;  3KHR A;  3G7L A;  3T5K A;  3K7A H;  1RJT A;  2SNS A;  2UUC Q;  3HOZ H;  2MO1 A;  1K9M C;  2JEI A;  3M3Y B;  4ECU A;  4ALP A;  4J6H A;  2JJQ A;  2I0Q A;  3OSO A;  2F0N A;  3MHB A;  1D7Q A;  4HID A;  1XX8 A;  4OWX B;  4TV9 F;  3EQL C;  2K5W A;  1SND A;  1KRS A;  1RDP D;  4JI4 H;  2R93 B;  1TKW B;  4AYB A;  2YU9 H;  3F2U A;  1S68 A;  4FU0 A;  4YAK B;  3Q8D A;  1A3T A;  2EDG A;  2OTL A;  4OO1 G;  4UFZ A;  4DV7 Q;  1U4L A;  4XT1 B;  2A6H D;  2CW0 C;  1RD9 D;  1TWC H;  5ELF A;  1JMC A;  1HFN A;  4IUN A;  5EBD A;  1AUV A;  2BQR A;  1YIT A;  1N34 L;  1VMP A;  2PZW A;  2EIF A;  4IOA A;  4NXN H;  1EYD A;  4NXM H;  1KJ8 A;  5GON F;  4HNU A;  1LTG D;  3A8I E;  5A2Q E;  1OXT A;  5GAG C;  1UNN C;  4HN7 A;  1Q46 A;  5ISR A;  1VQA A;  3HP3 A;  1E2V A;  1F9S A;  3U9O A;  2VR1 A;  4YJ3 F;  2YTV A;  1TWH A;  1GUN A;  2MNA A;  3HOY G;  5KFW A;  1Y1V G;  3NBH A;  4LF9 L;  4HJ5 A;  2K5V A;  5KT5 A;  2F52 A;  2HCC A;  4R1J A;  4A3D B;  5FO7 B;  2CWA A;  1STH A;  1STN A;  3MR5 A;  2E5L H;  4ECQ A;  2F0P A;  3DWP A;  1L0W A;  1MJE A;  3CQZ B;  2PQA A;  1IW7 C;  2C2E A;  3TDQ A;  2R86 A;  4X65 H;  3HOX H;  1R4P B;  2OF1 A;  2F0K A;  3HKZ E;  4YCW A;  1N36 H;  1Q12 A;  2K32 A;  4LUZ A;  4EGV A;  2GLT A;  5DGB A;  4HCS A;  3PF4 A;  2D2C C;  4DFA A;  3PQI A;  2ZJT A;  4ME3 A;  2FPI B;  2J6U A;  1VQC A;  1BOS A;  4HSP A;  5C6A A;  3I4M H;  3C0F B;  3ULP A;  1IKM A;  2A74 C;  1MGS A;  1X3F A;  4EQ5 A;  1VDZ A;  3J7A F;  5KFL A;  3E0E A;  2UXB L;  1TWC B;  5IGB A;  3PW2 A;  3GTO B;  5KG4 A;  2VA2 A;  2ZXR A;  2WAQ E;  4R4C A;  4DV6 Q;  4LF6 L;  3T56 B;  3URY A;  4R8N A;  4X65 L;  4FXD A;  2D0O A;  1YVC A;  3VDY A;  1EUC B;  5CA0 F;  2IL8 A;  1N32 H;  3H15 A;  4QW8 A;  3RAQ A;  2E2H A;  2F0W A;  4IN3 A;  5EBC A;  2IT1 A;  4Y7N B;  2WP8 J;  5LL6 b;  2B2W C;  4L63 B;  4HED A;  3TP6 A;  4DN4 M;  4F88 A;  4RGM A;  1PRT D;  3IKJ A;  5C0X J;  4BY1 H;  3GTM B;  4XYQ A;  3S1N B;  1Y1W G;  5H80 A;  4B3M Q;  1C7Y A;  5KFS A;  2N88 A;  3D4R A;  3PO3 B;  4XYL B;  1HH2 P;  3RB0 A;  1RJR A;  3HOV B;  1YJW A;  3GTO A;  3DMU A;  2GA4 B;  4GN3 B;  3T1Y L;  2F4V H;  2TSS A;  2HVQ A;  5EWE A;  4DNR B;  5JJL A;  4JI6 H;  2VB2 X;  1RF2 D;  2DNE A;  4FBT A;  1RTO A;  4Q43 A;  1MSH A;  2AQ1 B;  4B3M H;  3HG9 A;  1O78 A;  3BVG A;  3H0G H;  3N43 B;  3KF8 B;  1GKH A;  1R9T B;  2AGQ A;  3K81 C;  4ED6 A;  1IHZ A;  3MFY A;  5KEE A;  1D2B A;  3BQ0 A;  2XC9 A;  2EYP A;  2B8F A;  3GQB A;  1J6Q A;  3GIL A;  4ECT A;  1EY7 A;  4DK3 C;  1IYJ B;  4ECS A;  1WYD A;  5ELC A;  4C3J B;  5FO9 B;  5T14 A;  1E4F T;  3F2C A;  4EFB A;  3FKI H;  4P74 A;  4K14 A;  2PQA B;  4MV1 A;  1DM0 B;  2MQH A;  3DEO A;  3HFZ B;  2L9H A;  3K5M A;  2ZJQ A;  2NN6 H;  1GXD C;  4O3R A;  1QNK A;  1Y1W A;  4JI8 L;  3HS0 C;  4KMU C;  2NN6 G;  4NMZ A;  2ATW A;  3T1Y Q;  3NUC A;  1HNW Q;  1S9F A;  5A35 A;  4A76 A;  4UPA A;  3HEJ A;  2UUA L;  4XT3 B;  2J6S A;  4X62 Q;  4LFB H;  1I94 H;  1VMC A;  1ROD A;  5K2M A;  1TS3 A;  1IW7 D;  2W9C B;  3IAY A;  1A8V A;  4DAM A;  1SYB A;  3H4B A;  3RZO B;  1CUK A;  4JI1 H;  4R4T A;  1V1Q A;  1DV2 A;  4ETS A;  5M9O A;  4DK6 C;  3KHH A;  2RKS A;  4EGQ A;  4EYH B;  2QEJ C;  2NVT H;  1CSQ A;  1F2L A;  2XNA C;  4U6P A;  1YHQ A;  3K5O A;  3M9N B;  3UDF A;  2FP4 B;  3S2H H;  4A93 B;  2NU8 B;  2YV5 A;  2HVS A;  4POF A;  2R93 A;  1GSA A;  5L1I A;  1EIG A;  3LWU A;  3NTI A;  4ECW A;  3E5N A;  4HJ8 A;  2F4I A;  2VUM B;  5D8D A;  1SYC A;  4A93 H;  4U68 A;  1JCK B;  1JOR A;  2YTY A;  1AUX A;  1KTK A;  1HNX H;  3GD7 A;  1UWV A;  1YHB A;  1K1Q A;  1O7Y A;  2K5D A;  2NVT B;  3QWN A;  1JJ2 A;  2W9B A;  2UXB Q;  2HHH Q;  2EJF C;  1SSO A;  1N33 L;  2R92 H;  3J80 c;  4A3G B;  1I4H A;  3ERO A;  2RF4 A;  4UY8 C;  2JEJ A;  2I5H A;  4JBJ A;  4ZI7 F;  2F0O A;  2R92 G;  3BQ1 A;  1J5E Q;  4RUC A;  1CT1 D;  1KAW A;  1KJ9 A;  4CDE C;  4U67 3;  1AH9 A;  1ONL A;  1VQI A;  2WAQ B;  4B3M L;  4OWW B;  2JK8 A;  2GVA A;  2B3G A;  2NZO A;  5BR8 H;  3L0O A;  4MA5 A;  3J81 i;  1KBL A;  5J2T F;  3OW2 A;  2HD3 A;  4DUZ H;  2XIW A;  3GV3 A;  2F0V A;  4YCU A;  1AN8 A;  5ELD A;  3D4W A;  4TRD A;  2NVQ H;  3KJP A;  4L6T B;  2K7V A;  4X66 L;  4JI7 H;  1BXT A;  1RKN A;  4TQU S;  4RKB A;  3GV8 B;  3SK8 A;  1N56 A;  1XYI A;  1YI2 A;  1QOH A;  4LF6 H;  4EGJ A;  4L8J A;  4DV1 Q;  4L5R C;  1UC9 A;  1U4M A;  3ND8 A;  4O3P A;  2VQE L;  1MZB A;  4B9X A;  3ER0 A;  2R85 A;  4DK0 A;  4K5X A;  3UDG A;  1R9T H;  4JI4 Q;  1C9O A;  3PF5 A;  3UFX B;  1J8I A;  1KXL A;  2F3V A;  1S5F D;  1FL0 A;  5LMN L;  3N44 B;  4I65 A;  3HB9 A;  1V1P B;  4BBR H;  4R8U B;  5FLX L;  4DUZ L;  1MSG A;  5AJ3 Q;  3OUZ A;  2K50 A;  3K6O A;  5G3L F;  4A3K H;  3HOV H;  2W7P A;  4DR1 H;  1ENA A;  1F2Z A;  4JYA Q;  1UAP A;  5CV6 A;  3RD4 A;  4UCR A;  3PZP A;  3SK6 A;  1IBM Q;  1SYD A;  5M3M B;  2WAC A;  3FHW A;  4M1U B;  3GTM H;  3CPW A;  4HR7 A;  2VW9 A;  2R8K A;  1CZW A;  3OYY A;  1QZH A;  2QCP X;  3D31 A;  3E3X A;  4IJH A;  2Q2H A;  2K33 A;  5KYI A;  1DJR D;  2RSN A;  1GSH A;  2CZG A;  4DR1 Q;  1B53 A;  2EYF A;  4QWE A;  2F0T A;  1D5X C;  3K80 C;  4YCV A;  4WRD A;  4JI5 Q;  3GTO H;  4LF5 H;  1RIP A;  1BBX C;  2QIL A;  1XPO A;  2M9V A;  1U4P A;  1I3Q B;  2XGQ A;  3PUX A;  1OTC A;  2RSO A;  4Z9C B;  2KHI A;  1DOK A;  1TS4 A;  2R8H A;  1BBU A;  1GD7 A;  2N8N A;  2OWO A;  3MFG A;  5HGQ A;  3I4N H;  4JBW A;  1DON A;  4K8I A;  4RB0 A;  1N8R C;  2DGY A;  2HQE A;  4YJ2 F;  5KFB A;  3RF2 A;  1Z9F A;  1VQB A;  1PLF A;  1X54 A;  4LMY A;  1G6P A;  1EFI D;  1NR2 A;  3HOV G;  2FB9 A;  4JBK A;  4EG0 A;  2UUB H;  2WKD A;  3CKI B;  3Q8Q B;  4JI5 H;  5KFH A;  4QMG A;  3CP0 A;  4GC6 A;  1E4G T;  1TWA A;  3HOX B;  4A3M H;  3HZX A;  3MR3 A;  1SLJ A;  4A93 G;  4LF9 Q;  3KTM A;  4JV5 H;  1YHA A;  3STB C;  2EJG C;  3ULL A;  1CHP D;  1STB A;  2WB1 E;  3D8G A;  1V8Q A;  3KBX A;  5DM6 3;  4RHR A;  2RDH A;  2AU0 A;  1JIH A;  1M0W A;  3GTP H;  3EPI A;  3S1R B;  1WTR A;  4DR4 H;  4PWQ A;  4PDB A;  4K0K Q;  3TME A;  2NB0 A;  5KT7 A;  2O4X A;  3RV4 A;  4H7B A;  2IJ0 A;  3M9B A;  3FRP B;  3DEP A;  4RZR A;  3G6E A;  3PCO B;  4ZUJ A;  5DLG A;  2JYO A;  3NXW A;  3SEB A;  3FVQ A;  1VQD A;  4JV5 L;  2JA7 G;  3OMC A;  1RL2 A;  4RGO S;  1EY9 A;  1V9P A;  1TWC A;  5CBE E;  4BWS C;  2YRW A;  1LTR D;  1YBY A;  5F9L A;  3S17 H;  1QB5 D;  1HNW H;  3J7A 5;  3DUZ A;  3HOU B;  3EFX D;  2QEX A;  4IUT A;  2KVM A;  1X32 A;  1GUW A;  1Q8K A;  4PMW A;  2F1M A;  1L0Y B;  4Q45 A;  1O7Z A;  1PV4 A;  2B2U A;  4IQZ A;  5ELN A;  1BNZ A;  5EQ0 A;  4DXG A;  3KAJ A;  1HNZ H;  5LMU L;  3BDC A;  2KJX A;  4IUV A;  1TS2 A;  2ZT9 C;  5CR3 A;  5DNF A;  2KBN A;  3D4D A;  5KGU A;  2Z6B A;  3BYY B;  2CH4 W;  3OHA A;  4MV8 A;  4DK1 A;  1FKA H;  4IWY A;  1Z2N X;  3RBE A;  4BY7 G;  3PUV A;  4K6D A;  1PYW D;  2E2J B;  3M3Y H;  2RDG A;  3CAM A;  4OGQ C;  2QA4 A;  3C3L A;  3KK7 A;  3HOZ B;  3AQQ A;  4B3S H;  5FO8 B;  2MUY A;  1SYE A;  4AQY Q;  3TIN A;  1Y1W H;  4L5T A;  4J9P A;  1K3R A;  3JAM E;  5G3L D;  5T1G A;  3RMH A;  4HMJ A;  1UEA B;  1GUS A;  4A3E H;  2C35 B;  5LA6 F;  4M7E A;  2RQX A;  2R7F A;  3KXY T;  1MHW C;  1TAE A;  5K36 H;  3LWB A;  1JE4 A;  2SEB D;  2OQK A;  4JI3 Q;  2JA9 A;  4I55 F;  1PFN A;  2QDL A;  3OSP A;  5KG2 A;  4O3N A;  3KF6 B;  3K0Y A;  1IOW A;  1VQP A;  2W6P A;  3ULJ A;  1G6Z A;  5KFG A;  3R8B A;  5E7N A;  1KDC A;  1SNQ A;  2W70 A;  4IUR A;  3CPF A;  1PFB A;  3EIV A;  1M90 C;  2JA5 H;  4QQB X;  2NU6 B;  4ME6 A;  5C4X B;  3VR4 A;  4TV8 F;  3I55 A;  4HNV A;  4B3S Q;  1PTO F;  3PO2 H;  1ESF A;  2UUB Q;  5HBR B;  4FNF A;  5KFU A;  4TKO B;  3PR5 B;  3S15 B;  4OEM B;  4LUO A;  4LF5 Q;  2V4D A;  3G8C A;  3LWE A;  1K8G A;  3JAM L;  4HTH A;  5M3F B;  5LP6 F;  1Y1V H;  4RNO A;  5EDW A;  3LP8 A;  1M4V A;  1I94 L;  4OO1 I;  3WDN A;  4RAZ A;  1SMX A;  5C0X H;  1LT3 D;  2ZJP A;  1GM5 A;  2Q8I B;  5E4X A;  5C3W A;  1PA6 A;  3H09 A;  2NUC A;  3TZU A;  3TS0 A;  1IZ6 A;  2LFN A;  1XNQ Q;  2SCU B;  2C22 A;  2J4X A;  3FDS A;  3T51 B;  3M9M B;  1G8Z D;  3K3V A;  3HOU G;  1V1P A;  1IBL H;  3BZC A;  5D14 A;  3I4M G;  1S0M A;  4QB4 A;  1STE A;  2XVS A;  1V1O A;  5IOD A;  4A3C H;  1SNO A;  2UU9 Q;  3EN2 A;  3H3V C;  2MPM A;  1S4Z A;  3KOJ A;  3RGZ A;  2KHS A;  3GP7 A;  1RJQ A;  2I80 A;  1XNR L;  1TWF H;  2HQL A;  4JI6 L;  2E5L L;  1S3O A;  2IP4 A;  2AHO B;  2B2Y C;  4OON A;  1PZI D;  3GTJ B;  3M9O B;  3H20 A;  3V4S A;  1O80 A;  1Z47 A;  4J1M A;  3VPB A;  5KFK A;  4S3S A;  1X56 A;  3NQT A;  1XNQ H;  4DR2 Q;  2VQF Q;  5KFM A;  2YW2 A;  4C5C A;  4XQJ A;  4DL6 A;  2Y0S A;  1U4R A;  2AQ4 A;  1HNZ L;  3TRE A;  1AEX A;  2CW7 A;  3MZ5 A;  4OX9 Q;  2ENB A;  2VPS A;  4A4I A;  4PZ8 A;  4KD3 A;  3L4J A;  2GN5 A;  4ED1 A;  2MCT A;  5C3E H;  4UHV A;  1PTO B;  3T16 A;  1I7L A;  2JSO A;  1ZEQ X;  3GTL H;  4LF7 L;  3GIK A;  4DR2 H;  2RHS B;  1DIK A;  1KLG D;  3JZI A;  2FIN B;  2ASL A;  5IWA L;  5TSS A;  4EYI B;  5GAD C;  4YR2 A;  4N9P A;  3NBI A;  3TEH B;  3I2Z A;  2DJF C;  1PXU A;  3DWQ A;  4NLG A;  4GKJ L;  2EYJ A;  5DQG A;  3NP8 A;  1VQ6 A;  3OW7 A;  3GTQ B;  2XRS D;  1V4Y A;  3I4O A;  3MXN B;  1I5F A;  2Z6K C;  4KKU A;  4BY7 B;  4LW1 A;  2FFK B;  4GOP A;  4OO1 H;  3GTK H;  3BQ2 A;  4JI8 Q;  4DNI A;  5I2X A;  1EZ6 A;  1GUO A;  1A9X A;  3GTK A;  4LFB L;  4LSX A;  2WV6 D;  2UXB H;  2P5Z X;  2K05 A;  3GV6 A;  3G48 A;  3OIQ A;  3GTP A;  2UUC L;  4NPS A;  1OXU A;  1F9Q A;  5M5X H;  4IRD A;  4JI0 H;  4C3H B;  5FOB B;  1T5X D;  4IPG A;  5BPF A;  2AWO A;  3I4L A;  4MTE A;  2PYK A;  1S10 A;  3TN2 A;  4APM A;  5FPO A;  2HHH H;  4KKT A;  4WJ3 M;  4DV0 H;  1BVS A;  3VPD A;  4A2A A;  3S14 B;  1HTL D;  4EVO A;  1VQK A;  2FK1 A;  1K0R A;  1TWG H;  1IL2 A;  2JA7 H;  1QE6 A;  1IBK H;  1QUQ A;  1BCP F;  4RWS C;  5D65 A;  1PH9 A;  2IMW P;  5KFC A;  1JIC A;  3IFD A;  4R4O A;  2W9B B;  1EY5 A;  2WKC A;  2F0G A;  4C2M B;  1SFO B;  1H9R A;  3U4V A;  4IOC A;  1QIL A;  1Q81 C;  4ECR A;  1QCB D;  2FK2 A;  1VQ5 A;  3BJY A;  1XTD A;  5LMN Q;  1HPC A;  1Q3L A;  1SEB D;  3Q0A A;  1VQG A;  1Y14 B;  1VQ7 A;  2E2I B;  2KOL A;  3A54 A;  4BA1 I;  2HHH L;  1U0L A;  4RKL A;  2JA7 A;  2MP1 A;  4PMC A;  5L1L A;  4I7H A;  1A3V A;  2A5H A;  3G4S A;  2XGT A;  2M00 A;  2JEA I;  3OWE B;  1S5E D;  1YNN C;  5JOB A;  1N32 Q;  2R7K A;  5C1O A;  1KC7 A;  2NYZ D;  4FF3 A;  1I4R A;  1OXX K;  2O5J C;  4YR0 A;  5CB4 F;  4Y52 H;  1GOZ A;  2VZA A;  3QZ8 A;  3KFU A;  4OIJ A;  4J9N A;  2IWH A;  2R87 A;  5LOV F;  3PIO 3;  1GGO A;  3TP7 A;  1VQH A;  3VMM A;  4RZQ A;  3MFI A;  1A0I A;  3JAM i;  1NTG A;  2NTS A;  3W2D A;  1WSC A;  4R8I A;  5DG7 A;  5KFA A;  1EQQ A;  2EVB A;  2F0L A;  2UXD H;  4ZQ3 A;  1PYS B;  2YTX A;  4JI2 Q;  5L9X A;  4F7X A;  1WTH A;  1JOQ A;  1TWG B;  3PUY A;  3N6R A;  1CS0 A;  2O03 A;  2ZDQ A;  3EYY A;  2LMC B;  4DR6 H;  4EEQ A;  1TWH H;  1PHJ A;  3PO2 G;  3VPC A;  4FO2 A;  4QJF A;  1B9N A;  1H9M A;  4CKE A;  1HR0 Q;  1K8A C;  2UUA Q;  2PZU A;  1AFP A;  3RUP A;  2NVY H;  1GUG A;  2HIV A;  3J81 L;  1KD1 C;  1OWT A;  1LV9 A;  5DLQ E;  2BDO A;  3KF8 A;  3A74 A;  4J15 A;  2A19 A;  2BOS A;  4A2B A;  2F0D A;  1CK1 A;  2W7O A;  1IYU A;  2RHQ B;  2YZN A;  3LX0 A;  4CKB A;  3OIP A;  3ORR A;  4BWG B;  4DR6 Q;  2B2V C;  2RDI A;  1T36 A;  2Q2I A;  1XJV A;  2PMZ A;  4O3O A;  4IFD J;  4EX5 A;  3BS1 A;  5I6Y A;  2JEG A;  2JA6 H;  4G7Z C;  5LL6 S;  2F03 A;  4B3R Q;  1EZ1 A;  3JRW A;  4LSA A;  1O7L A;  1I4G A;  1S5D D;  2PW7 A;  4ILW A;  3L2P A;  4DR3 H;  3RB6 A;  4DR7 Q;  4J9S A;  4EQO A;  3R3O A;  4ZKB B;  2QKI C;  1TVX A;  3I90 A;  4CDC C;  1LUZ A;  2G5D A;  2XIG A;  1BCP D;  5FLX E;  4O2B F;  2J9G A;  1CQI B;  4B3R H;  2DZD A;  5C5L A;  5IE8 A;  1WD1 A;  2A6E D;  2ZJR A;  5M5Y B;  3CU7 A;  1JR0 D;  4YIJ A;  5K5P A;  4YR3 A;  1SE4 A;  2WAQ G;  1E4E B;  2RGV A;  3A55 A;  4X3S A;  3OTO L;  4G7O C;  3F8N A;  4B3T Q;  4RGN A;  3P7J A;  1W3S A;  3GTJ H;  2NN6 I;  1WCM B; 
#chains in the Genus database with same CATH homology
 4OWT B;  1G51 A;  4QY7 A;  3OW2 A;  4JC0 A;  4YCU A;  3PIO A;  3S1M H;  1BKB A;  1WFQ A;  3U50 C;  4GOP C;  2A1A A;  2F4V Q;  4UP8 A;  2NVQ H;  4DR7 L;  4JYA L;  3KJP A;  1QZG A;  1Q82 C;  3AYH B;  2JA6 G;  2MFI A;  1EWI A;  2LSS A;  2XTI A;  1YEZ A;  4YWK A;  4X66 L;  4TQU S;  4MZ9 A;  4A3L G;  4JBM A;  1YNX A;  1YI2 A;  1VQL A;  4DV5 L;  1EQR A;  2D0P A;  4GKK L;  1FGU A;  2JE6 I;  4JI4 L;  3S2D H;  4A3C G;  4DV1 Q;  4HIO A;  4L5R C;  3F8T A;  4DR1 L;  2VQE L;  3HOW G;  3ER0 A;  3UDG A;  3OTO Q;  1R9T H;  4JI4 Q;  1FJG Q;  3RNU A;  1AE3 A;  1CKM A;  4DV1 L;  1C9O A;  3PF5 A;  3B6Y A;  2LXJ A;  1X3G A;  3RZD H;  1KXL A;  1KRT A;  4A3K G;  1FL0 A;  5LMN L;  4IPC A;  3CCV A;  4A3E G;  4BBR H;  4DUZ L;  5IY0 A;  5AJ3 Q;  1E7Z A;  2B63 G;  1HZC A;  2K50 A;  4A3K H;  4LF4 L;  3HOV H;  4JYA Q;  1IBK L;  4DV2 L;  4LWC A;  4NXM Q;  1CKN A;  4C3I H;  1MJC A;  2K52 A;  5C4X H;  1IBM Q;  4HJA A;  1XNQ L;  3UDI A;  3JAM c;  3FHW A;  3NEN A;  3GTM H;  5JJK A;  3CPW A;  2VW9 A;  3OYY A;  1QZH A;  1N33 Q;  1VQN A;  4AYB G;  1K73 C;  1IBM L;  2Z6K A;  4GNX B;  3D31 A;  4IJH A;  1I6H H;  2Q2H A;  4A3F G;  4DR1 Q;  1L1O B;  2BH8 A;  2JA8 H;  2Q2T A;  3CCM A;  3H3V H;  4A3L H;  2K75 A;  1MIU A;  4MNO A;  2VNU D;  4TVA B;  5IWA Q;  3K80 C;  4YCV A;  1XMQ Q;  1J5E L;  4JI5 Q;  3GTO H;  1HZA A;  4X65 Q;  1RIP A;  2RCN A;  3UE1 A;  5LMU Q;  3CCU A;  3RR5 A;  4HIK A;  1XPO A;  2E5L Q;  3KF6 A;  2ZTD A;  4DV5 Q;  3S14 H;  5IYB G;  4LNQ A;  5M5W H;  4A3G G;  3PUX A;  4JI1 Q;  1OTC A;  2KHI A;  1BBW A;  4GNX C;  1PH5 A;  1BBU A;  1GD7 A;  2KCT A;  2N8N A;  2VQF L;  2OWO A;  5K36 G;  5IT9 c;  5HGQ A;  2CCZ A;  3I4N H;  4JBW A;  4JCV E;  4IJL A;  4C3H H;  3CCQ A;  1PH1 A;  4FDB A;  1N8R C;  2DGY A;  1KL9 A;  1Q7Y C;  1Z9F A;  1VQB A;  2IX0 A;  1JT8 A;  1X54 A;  1HJP A;  5GAH C;  4IFD I;  3H0G G;  1G6P A;  2N78 A;  2N49 A;  3HOV G;  4DUY L;  4JBK A;  2BA0 A;  1HNW L;  4GN4 B;  4O2D A;  3WWV A;  1UE1 A;  3A5Z B;  4BY7 H;  1LTL A;  2VUM H;  3CP0 A;  4DR3 L;  2E8G A;  4A3M H;  4DKA C;  1IBL L;  1SLJ A;  1S72 A;  4A93 G;  2WFW A;  1AE2 A;  1NMF A;  4X62 L;  4LF9 Q;  1YHA A;  3STB C;  3ULL A;  2WB1 E;  5FLM H;  1YZ6 A;  1WI5 A;  1QVC A;  3BU2 A;  4LFC Q;  3GTP H;  4XTC S;  5M5Y H;  4LF6 Q;  1NBW A;  4K0K Q;  3U4Z A;  3FKI G;  4PZ7 A;  3STB D;  1EYG A;  2AMC B;  3M9B A;  1EUJ A;  3AFQ A;  1JJC B;  4A3G H;  2VQE Q;  2R6G A;  3G6E A;  3PCO B;  3RZO H;  2D62 A;  4POG A;  2Y0S G;  1I50 H;  1VQD A;  4JV5 L;  4LFA L;  1HZ9 A;  2R93 G;  2JA7 G;  1RL2 A;  4KHZ A;  3ERS X;  1V9P A;  4P73 A;  1CKO A;  3I7F A;  4PZ6 A;  4LFA Q;  4JI2 L;  1X3E A;  1YBY A;  3S1R H;  3S17 H;  3J7A 5;  2I5L X;  4GNX A;  5AJ3 L;  3A5U A;  1XPR A;  1IBL Q;  4JI0 L;  2E2H H;  2IY5 B;  1X65 A;  3UDX A;  2QEX A;  2ZM6 Q;  1E1T A;  2FXQ A;  3T1H L;  1Q8K A;  3FP9 A;  4PMW A;  4R4Q A;  3S16 H;  1VS0 A;  2NZH A;  3M85 A;  1PV4 A;  2HIX A;  3M4P A;  3G71 A;  4KI0 A;  5IP9 H;  5ELN A;  4LF8 Q;  3T1H Q;  5LMU L;  1JE5 A;  4DR4 L;  1T9H A;  2KBN A;  1E22 A;  3MEF A;  1PH6 A;  5FLM G;  4X6A H;  4LF8 L;  1OXS C;  3CD6 A;  2PMZ E;  2JQO A;  3IRB A;  4LFC L;  4BBR G;  2ALY B;  1YIJ A;  4A3I H;  4BY7 G;  2OCE A;  1NY4 A;  3PUV A;  3I4N G;  4JI5 L;  3M3Y H;  2CQO A;  3CAM A;  3M7N A;  1H95 A;  2QA4 A;  5C0X G;  3AQQ A;  5C44 H;  3CCS A;  1JJG A;  1G29 1;  2CWP A;  4DR2 L;  1I3Q H;  4QGU A;  3CCE A;  4L5T A;  4AQY Q;  5FJ8 H;  1K3R A;  4P75 A;  5IYB H;  3J7Z C;  1Y1W H;  1PH4 A;  3BJU A;  3PUZ A;  4A3E H;  2C35 B;  3CC7 A;  5IYC G;  5IYD H;  2R7F A;  5JEA J;  2A8V A;  2OTJ A;  1E1O A;  1HNZ Q;  3HOY H;  2VL6 A;  4A3J H;  4GS3 A;  2H5X A;  2OQK A;  4JI3 Q;  2JA9 A;  3SGI A;  4B3R L;  5M3F H;  4BA2 I;  1SN8 A;  1UE6 A;  3KF6 B;  1X9N A;  1VQP A;  1SE8 A;  3ULJ A;  1IXR A;  4X64 Q;  3ICE A;  4AH6 A;  2DUD A;  2E2I H;  5E7N A;  4NXN L;  3LGJ A;  1SRO A;  1XMQ L;  3CPF A;  3EIV A;  4MTN A;  4GOP B;  1M90 C;  2JA5 H;  5M3M H;  4QQB X;  4LF7 Q;  2UXD L;  3KYH C;  2KCM A;  3PO3 H;  5ELO A;  3I55 A;  3CXC A;  4B3S Q;  4LF5 L;  2ES2 A;  3PO2 H;  2UUB Q;  3E9H A;  3TQY A;  4DV3 L;  3S1N H;  4A3F H;  2R93 H;  4A3J G;  1SFO H;  4L5S A;  5EAY A;  4A3B G;  1N9W A;  4LUO A;  1Q1B A;  2Z0S A;  3ZJY C;  2NVX H;  4LF5 Q;  1K8G A;  2UUB L;  4KLK A;  4JV5 Q;  4YWM A;  3F2B A;  1VQF A;  1Y1V H;  1B70 B;  4K0K L;  2IHE A;  4DUZ Q;  1I94 L;  4OO1 I;  1SMX A;  2K4K A;  1FVI A;  2ZJP A;  1GM5 A;  1PYB A;  4KHP Q;  3E9I A;  3S24 A;  3CMA A;  2PI2 E;  4YY3 Q;  2IHF A;  3K0X A;  3KLW A;  1B8A A;  1SRU A;  4JI3 L;  5GAE C;  2I5M X;  5LMN W;  1PA6 A;  1X55 A;  5FJ8 G;  3TS0 A;  3HOW H;  1IZ6 A;  4NXM L;  4KHP L;  1XNQ Q;  1PFS A;  3K7A H;  2ZM6 L;  4BXX H;  2UUC Q;  1UEB A;  4GN5 A;  4O0A A;  4DR3 Q;  2MO1 A;  2F3I A;  1K9M C;  3HOZ H;  4ALP A;  4A3I G;  2JJQ A;  1N36 L;  2I0Q A;  3HOU G;  1YJN A;  2R7D A;  3BZC A;  3S1Q H;  2Q2U A;  3I4M G;  2KEN A;  1D7Q A;  4HID A;  2VUM G;  4OWX B;  1TWA H;  4A3C H;  1P16 A;  2VY3 A;  3J81 j;  3PIP A;  3EN2 A;  2UU9 Q;  4JI7 Q;  3KOJ A;  1KRS A;  2JEB I;  1XNR L;  1TWF H;  2HQL A;  4C2M H;  4JI6 L;  3KDF B;  1HR0 L;  2E5L L;  2JA5 G;  3PO3 G;  4DV7 L;  1PVO A;  1B7Y B;  1S3O A;  2YU9 H;  2AHO B;  4OON A;  4OXP A;  2ID0 A;  4JI1 L;  3Q8D A;  2OTL A;  1Z47 A;  4JI6 Q;  4DR4 Q;  4OO1 G;  1X56 A;  4DV7 Q;  4DR2 Q;  2VQF Q;  4AQY L;  3GTG H;  4GLV B;  5IP7 G;  1CKN B;  3CQZ H;  1TWC H;  4YY3 L;  1JMC A;  3F2D A;  3CC2 A;  1YIT A;  1N34 L;  2JA8 G;  5JJI A;  1V43 A;  4IOA A;  1HNZ L;  1VQJ A;  2EIF A;  3TRE A;  1PH8 A;  4P71 A;  3EBE A;  4LFB Q;  1N32 L;  3D0F A;  1X6O A;  4DV2 Q;  4OX9 Q;  1OXT A;  4A4I A;  4PZ8 A;  4DV4 Q;  5GAG C;  3HOX G;  3JC6 6;  2GN5 A;  1Q46 A;  3TS2 A;  1VQA A;  1WCM G;  1DGS A;  2PNH A;  2YTV A;  5C3E H;  2MNA A;  2UU9 L;  3HOY G;  3HOZ G;  3GTL H;  1Y1V G;  4LF9 L;  4X66 Q;  4HJ5 A;  2K5V A;  4LF7 L;  2F52 A;  4R1J A;  4B3S L;  2L15 A;  2CWA A;  2RHS B;  1N36 Q;  1NJI C;  5IWA L;  3PUW A;  1L0W A;  5GAD C;  4X64 L;  4DR5 Q;  1MJE A;  3GTQ H;  2PQA A;  3TEH B;  3I2Z A;  5IP9 G;  4NXN Q;  4GKJ L;  1VCI A;  3UE0 A;  4DV6 L;  4BY1 G;  1VQ6 A;  3HOX H;  3I4O A;  3L7Z C;  1I5F A;  2Z6K C;  1N34 Q;  3CCL A;  4LW1 A;  4GOP A;  3GTK H;  3CC4 A;  3HKZ E;  4YCW A;  3A0J A;  4R4I A;  1K83 H;  1Q12 A;  4YWL A;  4IPD A;  4LUZ A;  4JI8 Q;  1CSP A;  4DNI A;  4B3T L;  4LFB L;  4IO9 A;  3W1G A;  3CME A;  5IP7 H;  4OX9 L;  3PF4 A;  2ASB A;  2KHJ A;  1UE5 A;  3G48 A;  4YHH Q;  4ME3 A;  3W5O A;  2UUC L;  4NPS A;  1OXU A;  5M5X H;  3RLF A;  1VQC A;  5IYD G;  3K7U C;  3GDE A;  3KDF A;  4IPG A;  3J80 i;  4IFD G;  4YHH L;  3I4M H;  2AWO A;  3BZK A;  3ULP A;  1HZB A;  3F1Z A;  4UP9 A;  4PG3 A;  3I56 A;  4WJ3 M;  1X3F A;  4EQ5 A;  1A62 A;  1BVS A;  5M3M G;  1C0A A;  3HKZ G;  4QL5 A;  4DV4 L;  1Q86 C;  1VQK A;  1K0R A;  3E0E A;  3J81 c;  2UXB L;  4L5Q A;  1TWG H;  1IL2 A;  2JA7 H;  1E24 A;  1U5K A;  2WAQ E;  1QUQ A;  4R4C A;  4H02 A;  4DV6 Q;  4LF6 L;  1PH9 A;  4X65 L;  3PGZ A;  4R4O A;  2D0O A;  1YVC A;  3VDY A;  1KC8 C;  1EFW A;  1VQ9 A;  3H15 A;  4NB3 A;  1HNX L;  4DR6 L;  3GO5 A;  3U4V A;  2IT1 A;  2WP8 J;  4IOC A;  5FLX c;  5C0X J;  3KJO A;  1Q81 C;  4BY1 H;  1JB7 A;  1Y1W G;  4B3M Q;  4UP7 A;  1C7Y A;  1VQ5 A;  1XTD A;  4RG1 A;  2ZTE A;  5LMN Q;  2VS1 A;  4JOI C;  4C3J H;  4DV0 Q;  4HJ7 A;  1HH2 P;  2OQ0 A;  1VQG A;  1Y14 B;  2MO0 A;  3U58 A;  1YJW A;  4GN3 B;  3T1Y L;  1VQ7 A;  4BA1 I;  5JJL A;  2HHH L;  1U0L A;  1QVF A;  4DAY B;  1TXY A;  3G4S A;  2GVB A;  2XGT A;  2YYZ A;  3PV0 A;  2JEA I;  3H0G H;  1N32 Q;  1VQO A;  3CCR A;  3RLN A;  3KF8 B;  1GKH A;  3TRZ A;  3K81 C;  1EOV A;  4JI7 L;  1Q1E A;  5HY6 A;  1ASZ A;  1VQ8 A;  1OXX K;  2WB1 G;  5C0X I;  1M1K C;  3AEV A;  2HT1 A;  4GKJ Q;  4Y52 H;  2VZA A;  3S15 H;  1J6Q A;  1L1O C;  1NE3 A;  3KFU A;  4IPH A;  5M3F G;  3DM3 A;  1VQM A;  5C44 G;  1E3P A;  2N3S A;  4DK3 C;  1IYJ B;  2B29 A;  1WYD A;  3RN5 A;  1EIF A;  4BBS H;  1WOC A;  2IX1 A;  1OXV A;  3RLO A;  1VQH A;  5C4J H;  3F2C A;  4HIM A;  1LM0 A;  2K14 A;  4GLX A;  3FKI H;  3H3V I;  1A0I A;  4P74 A;  1NTG A;  4XIG S;  3JAM i;  4Y7N H;  2PQA B;  3NEL A;  2MQH A;  4JG2 A;  2F4V L;  5C4X G;  3HFZ B;  1XMO L;  2ZJQ A;  1D8L A;  1WCM H;  1EQQ A;  4LF4 Q;  1KQS A;  3J81 i;  1PYS B;  2YTX A;  4JI2 Q;  4BXX G;  4JI8 L;  1UE7 A;  2UXC Q;  1L2F A;  2R7Z H;  4A3D G;  2B63 H;  3HOU H;  4A75 A;  3K8A A;  2NN6 G;  2ATW A;  1HNW Q;  3T1Y Q;  2ZTC A;  3RN2 A;  3PUY A;  2QGQ A;  4A76 A;  1GO3 E;  5H1S E;  4UPA A;  1TWH H;  1PHJ A;  3PO2 G;  5C3E G;  2UUA L;  1VQE A;  3W1B A;  4X62 Q;  4QJF A;  3DLL A;  1FJG L;  4DR5 L;  4AYB E;  1LYL A;  2UXD Q;  1A63 A;  2E2J H;  1EIY B;  2AWN A;  4GLA C;  1QVG A;  1A8V A;  2EXD A;  4DAM A;  1K8A C;  1HR0 Q;  2K5N A;  5J3B A;  2NVY H;  2K5H A;  2HIV A;  1KD1 C;  2UUA Q;  4GKK Q;  1HNX Q;  5DLQ E;  4AIM A;  1CUK A;  4R4T A;  1V1Q A;  4LUV A;  5JEA G;  1W2B A;  4DK6 C;  3A74 A;  4J15 A;  2PI2 A;  2A19 A;  1CSQ A;  5GQO A;  2NVT H;  1YHQ A;  1P8L A;  5GRO A;  3UDF A;  4DV0 L;  2RHQ B;  1IBK Q;  3S2H H;  1I94 Q;  4BBS G;  3M4O H;  2YV5 A;  3AFP A;  1KHI A;  1XPU A;  4POF A;  4DR6 Q;  3CW2 C;  2V1C C;  2Q2I A;  4WJ4 A;  1XJV A;  2BA1 A;  4RMF A;  1O7I A;  1L1O A;  4IFD J;  4EX5 A;  1ASY A;  1VQ4 A;  4HJ8 A;  2JA6 H;  5IYC H;  3CCJ A;  4A93 H;  2YTY A;  4B3R Q;  3NEM A;  5BR8 Q;  1GVP A;  4DPG A;  4JI0 Q;  3GD7 A;  1UWV A;  1YHB A;  4P72 A;  1WJJ A;  2R7Z G;  1MKH A;  4A3D H;  1S40 A;  1JJ2 A;  2UXC L;  3L2P A;  2UXB Q;  4DR7 Q;  2HHH Q;  5BR8 L;  3PSI A;  1N33 L;  2R92 H;  3J80 c;  1LUZ A;  4QIW E;  1KIX A;  3M4Q A;  1PH7 A;  1XNR Q;  2RF4 A;  2Y0S E;  4UY8 C;  2I5H A;  4JBJ A;  4A3M G;  3NBH B;  3HKS A;  4DV3 Q;  4APV A;  2R92 G;  5IE8 A;  1PH3 A;  1NMG A;  1J5E Q;  2CKZ B;  2EQS A;  2ZJR A;  1PH2 A;  1KAW A;  3CF5 A;  1HR0 W;  1QUQ B;  1AH9 A;  1VQI A;  2WAQ G;  4B3M L;  3OTO L;  1SR3 A;  4OWW B;  2JK8 A;  2CFM A;  2GVA A;  2B3G A;  2NZO A;  2AKW B;  4B3T Q;  4A3B H;  4HJ9 A;  1XMO Q;  3L0O A;  1YJ9 A;  2LXK A;  4JOI A;  4DUY Q;  1W3S A;  3GTJ H;  2NN6 I;  3MXN B;  2BH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...