4A3BH

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3bH00
1XMOQ 5C0XJ 2JA8H 2N78A 1VQEA 2YU9H 1VQPA 1VQ5A 1CSQA 4DR3Q 1Q86C 1M90C 3S1MH 2ES2A 3GTLH 3K8AA 1PH2A 5BR8Q 5M3MG 4APVA 1CKOA 1K0RA 4GS3A 1JB7A 3PF5A 1LUZA 1IXRA 2UXBQ 5M5WH 1Q81C 5JJIA 4HJ9A 4YCVA 1BBWA 1OXSC 2JA9A 4UP8A 1KRSA 2IT1A 4KLKA 1KIXA 1VQ8A 1IBKQ 4YY3Q 5C4XG 1AH9A 2RCNA 4KHZA 3CW2C 3RNUA 3S2DH 3PIPA 2ZJRA 4HJAA 3D0FA 3J80c 1UE6A 2R7DA 2V1CC 4JBWA 3T1YL 2HHHL 4B3MQ 1XNQL 1M1KC 4LF7L 3CAMA 1KRTA 2VNUD 1PH7A 4LF8Q 4DPGA 4TQUS 3S1NH 5JJLA 1QUQA 4DV5L 2QGQA 5IE8A 3H15A 1Q7YC 2ZTEA 3HOXH 3KOJA 5FLXc 2D0PA 4R1JA 3LGJA 2F4VL 1E1TA 3AFPA 1K83H 1HNZQ 4JI4Q 4OWXB 1V43A 1T9HA 1IBML 1YBYA 1XTDA 1E3PA 4DV0L 3HOUH 4DV6Q 3HOWH 3T1HQ 3CQZH 3HKSA 4KHPQ 1R9TH 3PUVA 2JA7H 4P71A 4X65L 3BZCA 4DUYL 2OWOA 2UUBQ 4MTNA 5IYCH 1NMGA 4DR2L 1CKMA 4RMFA 4JI3L 1OTCA 3K81C 1EIYB 4NXMQ 1XNQQ 3ULLA 1C9OA 1PFSA 1HR0W 4IJHA 2E8GA 4PZ7A 1ASYA 4UP7A 3TRZA 4JI0L 4NXNL 3J81c 1XNRL 2A1AA 3NEMA 5EAYA 1BBUA 1SE8A 4DV2Q 1LTLA 1YI2A 3EN2A 1NTGA 2KHIA 4LWCA 2UUCQ 5BR8L 4X62L 3CC7A 2CQOA 4A3JG 1WCMH 2CWPA 2UXBL 4K0KQ 2B3GA 1QVFA 1X55A 1B70B 5J3BA 4AYBG 4BY1G 1XMOL 4C3IH 5LMUQ 5GQOA 4LFBL 1AE2A 2WAQE 4JI5L 3GO5A 2C35B 1VQDA 3U4VA 4HJ5A 1Y1WH 4A3LH 4DV3L 2R93G 3TREA 2JA5G 3ULPA 4DUZQ 4PZ8A 4DR7Q 1XMQQ 3CCLA 2JK8A 4OONA 1UEBA 4BBSG 1WI5A 1S3OA 3U50C 2WB1E 2NZOA 5IYDG 5GAGC 3AQQA 3STBD 1JE5A 5IY0A 4LF4L 1HR0L 1JJCB 2Z0SA 3KF6A 1Q1EA 4GOPC 4A3EH 1HZBA 3KDFA 2Y0SG 4DUZL 2JQOA 4A93G 1J5EQ 4DV1L 3F2BA 3B6YA 3KFUA 1X9NA 3RLFA 1QZHA 3K7AH 1KHIA 3OYYA 4LF9L 2VY3A 4BBRG 1EYGA 4YHHQ 4UPAA 5M3FH 4BBRH 1PH4A 1VQBA 4OX9L 1VQ9A 5LMNW 4DV7L 4YWMA 2UXDL 1X6OA 1SRUA 4JBMA 5M5YH 2R92G 4JOIC 3CCMA 2VS1A 3RN5A 1VQ7A 1HH2P 4HJ7A 4DV4L 4A3KH 1N8RC 3HOWG 2PQAB 1D8LA 2BH8A 2NZHA 4X62Q 4DV1Q 4A3KG 4POGA 4JI6Q 4IFDG 1EIFA 2LSSA 4JI8L 3GTGH 2D0OA 2Q2TA 3RZOH 1PYSB 4NXNQ 2OTLA 3PF4A 3S2HH 1GVPA 1HZAA 2AMCB 2VW9A 2UU9Q 1TWAH 4IOAA 1L1OB 4A3GG 1X65A 3UDXA 3G71A 3F2CA 1W3SA 5FJ8G 2VQFQ 4BY7H 1H95A 4LF5L 4BY7G 2UUBL 1Q82C 2PQAA 4IO9A 3HKZG 4GNXA 1NJIC 4A3MG 5E7NA 1O7IA 3U4ZA 2Z6KA 4LUVA 2DUDA 3ULJA 4BY1H 5GROA 2WP8J 5LMUL 3TEHB 2I5HA 3CCEA 3S1RH 3G48A 4LFAL 3HOUG 4QGUA 4GN3B 4AIMA 4EX5A 1PH8A 1PH5A 4JI7Q 1K3RA 4R4TA 3RLOA 3GTMH 5K36G 1QUQB 2R93H 4C3JH 3KDFB 4BXXG 2BH2A 4BXXH 1LM0A 2WAQG 1L1OC 2BA1A 1KD1C 2Q2UA 2R7ZG 2VUMH 1G51A 3T1YQ 4B3ML 2JEAI 2Z6KC 3RN2A 4LW1A 4X66Q 1WJJA 2UXCL 2OTJA 4IFDI 1IYJB 5IYDH 2R7FA 3EIVA 1RIPA 3UDFA 4X66L 1PA6A 4YCWA 5IP9G 2UUAQ 1N33L 3S16H 5DLQE 1QVGA 4NXML 2WFWA 1A63A 1MKHA 5C3EH 1BVSA 4A3JH 2OQKA 2F52A 4A75A 1HNWL 3KJOA 2I0QA 4ALPA 3KLWA 1G291 1NE3A 1NBWA 3PO2H 3PO2G 5M3FG 1VQ6A 4QQBX 4A3BG 4DV7Q 3CMEA 4DR3L 4JV5L 1SLJA 5JEAJ 2F4VQ 2NN6G 4JOIA 3J80i 3HOYG 3I4NG 4DR6L 2GN5A 2VZAA 1Y1WG 2A19A 1A62A 1Q12A 3CCSA 3CCUA 1KC8C 2HQLA 4P72A 4YY3L 3E9HA 4JBJA 2JA7G 1EWIA 2PMZE 4GNXB 3HOZH 3KF6B 3PIOA 3J7ZC 1VQMA 4GKJQ 2VQEQ 1VQLA 4DR4Q 3UDGA 4GKJL 4JG2A 4X6AH 4RG1A 2B63H 4QIWE 1IBLQ 3PCOB 2B63G 3HOVH 1VQJA 3PV0A 3HOVG 4TVAB 1U0LA 5C3EG 5C0XG 2F3IA 3M4OH 3L0OA 3E9IA 4B3TL 3I55A 4JI6L 2RHQB 1WYDA 1HJPA 4DR5L 3W1BA 1X3GA 5C44G 4OWTB 3CXCA 3K7UC 4B3SL 1CSPA 3IRBA 4P74A 3H3VH 4LFBQ 4DNIA 5C4JH 3PGZA 4JV5Q 3WWVA 1MJCA 1L0WA 4L5QA 4LUZA 1WFQA 1SN8A 3E0EA 3L2PA 2R6GA 1OXTA 3ERSX 5HGQA 2AHOB 3J81j 1W2BA 3M7NA 3F8TA 1BKBA 4HIKA 5GAHC 2K52A 4NB3A 1HZCA 1E22A 2YYZA 3FHWA 4R4IA 1K73C 4B3SQ 1GM5A 1VQNA 4OO1I 1N34L 1WOCA 2I5MX 2JA5H 1Y14B 3KF8B 4HIDA 3FP9A 2YTXA 5AJ3Q 4JI1Q 3ICEA 4IFDJ 1L1OA 1X3EA 1QZGA 1VQGA 1P16A 2ZTDA 3K80C 1HNXL 4NPSA 1VQAA 4GLVB 3PO3H 5IP9H 3S1QH 4R4CA 4IPHA 1YHQA 2KENA 4ME3A 4YCUA 2N3SA 3I4OA 4X65Q 1K8AC 2ZTCA 1YHAA 1UE5A 1VQIA 4JC0A 4A3FG 3CCJA 3CC2A 2KHJA 1EQQA 5ELOA 1JJ2A 4DV6L 2HIXA 1Z9FA 3PUYA 4DV0Q 4LFAQ 1NY4A 1JMCA 4AYBE 1X3FA 1VS0A 1Q46A 3PUWA 2N49A 3EBEA 1A8VA 3HOXG 4R4OA 2CFMA 3MXNB 2JA6G 1I6HH 5M3MH 2ZM6Q 2JA6H 4A3LG 4XIGS 1TXYA 2KBNA 1IZ6A 2PI2A 1K8GA 3RZDH 3CC4A 2YTVA 4LF8L 1TWGH 4LF7Q 3HOZG 1RL2A 3ER0A 2NVQH 2ZJPA 4KI0A 5IYBH 2UUAL 4DV2L 2H5XA 3CF5A 1V1QA 5FLMG 2LXKA 4UP9A 5FLMH 1XPOA 4A3GH 2HT1A 4JI3Q 1TWHH 3I7FA 2L15A 3A5UA 4A3FH 1I3QH 1CKNB 3CMAA 1TWCH 2ID0A 2JJQA 4OXPA 1EOVA 4H02A 1FGUA 2YV5A 3FKIG 4DUYQ 1S40A 4BA2I 2GVBA 1FJGL 3J81i 2YTYA 4O0AA 4R4QA 3T1HL 4KHPL 3D31A 4PMWA 1I5FA 2ZM6L 4MZ9A 2E2JH 2UXDQ 4GN5A 1WCMG 4GLXA 2CKZB 5GADC 2HIVA 4GN4B 2NN6I 3F1ZA 4YWKA 1FL0A 2QEXA 4DAYB 2MO0A 3GTPH 1G6PA 3HFZB 1DGSA 1EQRA 3GDEA 4PG3A 2NVXH 1Q8KA 1B7YB 4A3IH 2RF4A 4LF6L 3I4MG 2DGYA 4A3IG 4JYAQ 1VQFA 2EIFA 1HZ9A 3CCVA 4DV5Q 2NVYH 1N32L 5IYBG 3I56A 2E5LQ 2E2HH 1JT8A 3CP0A 3BZKA 5IWAQ 4IPDA 1MJEA 1V9PA 1YJWA 2MO1A 2XGTA 1YNXA 2I5LX 1PH6A 4A3DH 4O2DA 5AJ3L 3S15H 3M9BA 3JAMc 3OTOL 1XMQL 1EFWA 3CD6A 4QL5A 5JEAG 1C0AA 3A0JA 5IP7G 4DV3Q 4GOPB 3I2ZA 1N34Q 2PNHA 5GAEC 1VQ4A 2K4KA 1IL2A 3BU2A 4GKKL 1YIJA 4B3RL 1SR3A 2BA0A 3W1GA 4DAMA 3S14H 3GD7A 3M4QA 1XPRA 2GVAA 4GNXC 4LF9Q 1K9MC 3TS0A 1XJVA 3TS2A 3G6EA 4PZ6A 1L2FA 3OW2A 4B3RQ 1J5EL 3KYHC 1YITA 2MQHA 4GKKQ 3ZJYC 4B3TQ 4JBKA 2D62A 1A0IA 2CWAA 4AH6A 4DR5Q 1JJGA 3NBHB 1XNRQ 5H1SE 1UE1A 4DR4L 3DM3A 2VQEL 1YHBA 4POFA 5JJKA 1YVCA 1SFOH 3F2DA 1IBLL 4DR2Q 3Q8DA 1KAWA 2K14A 4L5SA 1D7QA 3AEVA 5IP7H 1OXXK 1YJ9A 4A76A 3PUZA 4JI2L 5IWAL 3FKIH 3NELA 2QA4A 4OWWB 1Y1VH 2AWOA 4WJ3M 4DR1Q 1P8LA 1Q1BA 1VQOA 3UDIA 3GTOH 4JI5Q 3A74A 3BJUA 4WJ4A 2EQSA 2PI2E 1I94Q 1MIUA 1VQCA 4YWLA 1NMFA 2IHEA 4DR6Q 2JA8G 5LMNL 1B8AA 2R92H 4GOPA 4K0KL 3L7ZC 3UE0A 1N36L 2CCZA 1FVIA 4AQYL 1PH3A 3I4MH 2FXQA 1KL9A 3M85A 3S24A 4P73A 2KCTA 4X64L 1FJGQ 2UUCL 3VDYA 2MFIA 4IPGA 1N33Q 1CKNA 4IJLA 1HNWQ 5IYCG 4JI0Q 4A3DG 3CCQA 2MNAA 4LNQA 1IBKL 3OTOQ 5FJ8H 3CPWA 1U5KA 1VQKA 4L5TA 2ATWA 4A3MH 2JEBI 4DK3C 3GTKH 4HJ8A 4IOCA 1TWFH 3M4PA 1PYBA 3W5OA 1LYLA 2K5NA 2K75A 2E5LL 4A3CG 1N32Q 1IBMQ 4AQYQ 3K0XA 1N36Q 1GKHA 2K5HA 1HNZL 3JAMi 4JI4L 3GTQH 1SROA 4JI7L 1KXLA 1VQHA 2AKWB 5C0XI 4LF6Q 1I50H 2K50A 4QJFA 4DKAC 2IY5B 2B29A 2Q2HA 1I94L 1UWVA 1PH1A 4GLAC 2Q2IA 2WB1G 4XTCS 2R7ZH 2UXCQ 1GD7A 3RR5A 1YJNA 1PH9A 3PUXA 3I4NH 3J7A5 3JC66 1C7YA 1X54A 2IHFA 2K5VA 2VUMG 4QY7A 2N8NA 4JCVE 2HHHQ 3CPFA 5ELNA 4JI2Q 3AYHB 1UE7A 2UU9L 1OXVA 3RLNA 1J6QA 2AWNA 1YEZA 1X56A 4LF5Q 1GO3E 1EUJA 2VQFL 3CCRA 3PO3G 4MNOA 4C2MH 2OQ0A 1N9WA 4HIMA 1XPUA 2OCEA 3H3VI 4BA1I 4HIOA 1QVCA 4JI8Q 3UE1A 3PSIA 3KJPA 3H0GH 1VCIA 4JI1L 3SGIA 3MEFA 4EQ5A 4DV4Q 4Y52H 1AE3A 4J15A 3HKZE 4A3EG 1E7ZA 1ASZA 1S72A 4X64Q 2IX0A 4A3BH 2LXJA 2VL6A 2IX1A 3TQYA 3DLLA 2XTIA 3HOYH 4YHHL 3S17H 5LMNQ 2E2IH 1KQSA 2ASBA 1E24A 1YZ6A 1PHJA 4IPCA 4LFCQ 4LUOA 4OX9Q 4FDBA 5HY6A 5IT9c 2A8VA 3U58A 2KCMA 4DR1L 1HR0Q 4L5RC 3M3YH 2NVTH 3G4SA 2ALYB 4UY8C 2Y0SE 2ZJQA 1OXUA 4OO1G 3STBC 4LF4Q 1CUKA 5C4XH 2EXDA 4BBSH 3A5ZB 3H0GG 4P75A 4A4IA 1HNXQ 4DR7L 1Y1VG 3GTJH 1E1OA 1SMXA 5C44H 2JE6I 4A3CH 4Y7NH 5M5XH 4C3HH 2RHSB 3NENA 1PVOA 1PV4A 4DK6C 1Z47A 4LFCL 4A93H 4JYAL 3AFQA
chains in the Genus database with same CATH superfamily
1EEFD 2N78A 3S17B 4CJ1B 1XXGA 1M90C 4G7ZC 1HUMA 2ES2A 3S1MB 4DK1A 1U4MA 5M3MG 4APVA 4JVZA 4ZKBB 3PF5A 2UXBQ 5JJIA 3FRPB 1VQ8A 1D5XC 1IBKQ 2OXPA 1AH9A 4KHZA 3CW2C 4A3KB 3D0FA 2OEOA 2R7DA 3T1YL 3PMFA 3CAMA 1KRTA 1PH7A 5JJLA 1T5XD 3S1NH 1QUQA 4G7OC 1R4QB 5FLXc 2D0PA 2KCCA 4R1JA 2D2CC 2IJ0A 1HNZQ 4OWXB 1II3A 2TMPA 3TP6A 3D4WA 4DV0L 3HOUH 5IIFA 3HKSA 4KHPQ 5FOBB 2DNEA 2OWOA 2UUBQ 3DXJC 5D3DA 5IYCH 1NMGA 5HGTA 3K81C 3ULLA 3M4OB 1HR0W 4CBVA 3OW7A 2E8GA 4PZ7A 4UP7A 1V1PB 5EAYA 1BBUA 4DV2Q 4RHSA 2EYJA 2UUCQ 1NSNS 2NVYB 1QCBD 1E2VA 3FMCA 4KJNA 3P20A 4K0KQ 2B3GA 5M5WB 2DJFC 4C3IG 5I4DA 1M4VA 5LMUQ 4QMGA 2RSNA 4KK7A 2QCPX 3ULPA 4OIKA 1SNMA 2NYZD 1XMQQ 1TS2A 2JK8A 4C3HB 1BBXC 1SYFA 2WB1E 3I70A 2F0QA 4EQPA 1O80A 1JJCB 3KF6A 5C4XB 1Q1EA 3QOLA 1O7LA 1HZBA 4A93G 1PRTD 4TKOB 3RLFA 1QZHA 3OYYA 4BBRG 4J8QA 3EFXD 1VQ9A 5LMNW 3AB9A 2UXDL 2F4IA 4IUQA 4ODGA 1EL0A 4A3KH 1N8RC 2PQAB 2NZHA 4RGNA 1YNNC 2VB3X 4NMZA 3GTGH 4JI8L 2B2YC 5ELEA 2IPKD 2DY7A 1A3TA 1PYWD 1GVPA 2VW9A 1H9KA 4IOAA 3NWTA 1L1OB 3UDXA 2L55A 5FJ8G 4BY7G 2LFNA 1EY5A 1IKMA 2MUYA 2B39A 5E7NA 2Z6KA 4C1NI 1B44D 4X3TA 2KVMA 3TEHB 2K32A 2KCNA 3HOUG 1EIHA 4JI7Q 3DWPA 3GTMH 3RLOA 1QUQB 4C3JH 1D6EC 1LM0A 5T1GA 2Q2UA 2VUMH 4A3EB 1JR0D 2Z6KC 3EROA 3R2IA 2CQAA 2NVTB 1G8ZD 1PTOB 1IYJB 3OHXC 5IYDH 4UDUC 2UUAQ 4NXML 4Q5VA 1BVSA 1HNWL 2K03A 2I0QA 2B2VC 3PO2H 1NBWA 4RHRA 1DM0B 3CMEA 2Q8TA 3I72A 3C1FA 2NN6G 4DFAA 1Y8OB 1OO9B 3DEPA 3FKIB 3OWFA 3CCSA 4YIJA 4P72A 1EWIA 1LLRD 2ICIA 1EY6A 3KK7A 3KF6B 3PIOA 1F9PA 4ME5A 1EU3A 3IAYA 1ZXTA 1BQQT 4GKJL 4JG2A 2F0TA 3D4DA 3HOVH 2B63G 1VQJA 3MFGA 4TVAB 2EE1A 3E9IA 3EQLC 3I55A 5BN4A 3IRBA 4LFBQ 3WWVA 3RUZA 3L2PA 3J81j 2AHOB 4HIKA 5GAHC 2JA6B 4R4IA 4IALA 3SEBA 1N34L 2I5MX 4RCNA 3A7AB 4HIDA 1STYA 4FP5D 1Z6HA 3QIAA 2EJFC 1IW7C 2WINB 2RSOA 3H3VC 1X3EA 3FVQA 3M7GA 4NPSA 2PZTA 4GLVB 3NHHA 1BXTA 1YHQA 1MD2D 1K8AC 4A3FG 2A68D 3CCJA 5L37A 2KHJA 1EQQA 1Z9FA 4K14A 5EGTA 1NY4A 1ENFA 5IT9L 3K57A 4AYBE 2B8FA 2N49A 4HTHA 2F0UA 2G9DA 2JA6G 1F9RA 1KTKA 2NVXB 4A3LG 4XIGS 2PI2A 1L0XB 2K05A 4OHJA 2ZXRA 3RZDH 4LF8L 4LK1C 5C3EB 1R4PB 3ER0A 4KI0A 2H5XA 3CF5A 3GTJB 1JOKA 3CU7A 1SYEA 2SEBD 1LV9A 4JPBW 2PMZB 5CMDA 5IGBA 4A3GH 1FD7D 2HCIA 2L15A 3A5UA 1EYDA 1CKNB 1TWCH 3KF8A 4BA2I 1FGUA 2YV5A 3J81i 4KHPL 4R4QA 2KEEA 1ET6A 2QF7A 2MHVA 4P2CB 3IKJA 2O4XA 3F1ZA 2QEXA 1FL0A 4FYDA 3O13A 1G6PA 1U4PA 1EQRA 5M9OA 4JYAQ 4A3IG 2EIFA 1SYCA 1N32L 5IYBG 4FF2A 3BZKA 2EYPA 1CHQD 1TWAB 2DN8A 2L9HA 3S2HB 4K5VA 3L3OC 4A3DH 1PH6A 1DOMA 3KLSA 4CGYB 3S15H 1XMQL 4K5WA 3NUCA 5JEAG 2JA7B 1LT5D 1VQ4A 3BU2A 1YIJA 3D4RA 5C3WA 4B3RL 2VB2X 5I9PA 4DAMA 1PRTF 2PW5A 1XPRA 3TS0A 4IZ8A 5C3XA 3VYUA 4PZ6A 2MQHA 5IGEA 4JBKA 2NZ1D 1V8QA 3SDZA 1E0BA 1SMYD 3D6CA 4AH6A 4DR5Q 1WVLA 4L8JA 5H1SE 3WOEA 4TSSA 4DR4L 1SSOA 3E0JA 1JICA 1YVCA 4ZKCB 4ULLA 1IBLL 4DR2Q 4L5SA 1D7QA 1JWMD 3AEVA 4A76A 3PUZA 5DM63 2AWOA 1HQMC 5DEHA 5M3MB 1P8LA 3NWSA 3MTSA 1WD0A 2EQSA 1SAPA 2G5DA 2PI2E 1I94Q 2NBFA 1LTTD 3VR2A 3K5LA 2JA8G 5LMNL 1B8AA 2R92H 4K0KL 5I2XA 4AQYL 2FXQA 4R8NA 3S24A 5JVH3 2E2JB 2KCTA 4X64L 4H0LC 1CKNA 1HNWQ 1VF7A 3BVGA 4BBSB 1KLGD 4A3DG 1FNUA 2RA4A 5C5MA 4C56C 2C5CA 1Z7TA 3QG1A 4DK3C 3GTKH 4HJ8A 1TWFH 1LYLA 1IBMQ 4AQYQ 1B53A 1BCPB 1VQHA 2AKWB 3T13A 4DKAC 1G2TA 1PH1A 3VR6A 3PQIA 2WB1G 1GD7A 3RR5A 1YJNA 1QNKA 2MGSA 3GV6A 3J7A5 3JC66 1X54A 3MVVA 2SNMA 4QY7A 3ND8A 5ELNA 3MXUA 1BR9A 3ZYYX 1I4PA 1X56A 4LF5Q 2H4OA 4MNOA 4HIMA 4QCLA 1NUCA 2OCEA 1GUTA 1QVCA 4JI8Q 1HHVA 4RGOS 3SGIA 5M5YB 4Y52H 3VYTA 4A3EG 3I73A 3K6OA 3TP7A 4A3BH 2IX1A 2YU9B 2K7VA 3TQYA 3SHLA 1WTPA 4FXDA 4IPCA 3U58A 1MSHA 1HR0Q 4CHTB 3G4SA 2ALYB 2K28A 1H9SA 1OXUA 2PYKA 1NAPA 2EXDA 4BBSH 4J1MA 1HNXQ 4DR7L 4CKCA 3N6RA 1EOTA 1WTXA 4EQOA 1KDBA 3WOFA 2SDFA 1IKLA 4DK6C 1ZYRC 1Z47A 5IGGA 2O5JC 1FYCA 1XMOQ 2JA8H 4DGZA 3NTKA 3D3RA 4XDXA 1Q86C 1SXTA 3K8AA 2LMCB 1PH2A 1A6XA 4F7XA 1K0RA 1Y1VB 1LO5D 4GS3A 1LUZA 4HSPA 1Q81C 3H0GB 1WTQA 4A93B 1BBWA 1KRSA 2IT1A 4IUPA 2F0MA 4QB4A 3RNUA 5CV6A 3S2DH 1XTCD 1K28A 3PIPA 5IODA 1UE6A 3J80c 3HOWB 1RODA 4JBWA 2HHHL 1M1KC 1Y8NB 2QDBA 4LF8Q 2ENBA 2F0LA 2ZXOA 5IE8A 3H15A 1Q7YC 2ZTEA 1I50B 3K7AB 3MAQA 3LGJA 3MEHA 2F4VL 5FLXE 1E1TA 1K83H 1T5EA 4JI4Q 2PO4A 1K83B 3EA6A 1E3PA 2BOSA 3HOWH 3T1HQ 3OIQA 3CQZH 2IX3A 3SK8A 3PUVA 4P71A 1O7ZA 3BZCA 3I8ZA 4CJ2C 4DUYL 3HGBA 1CKMA 5FO7B 1OTCA 1EIYB 2B2VA 2XSCA 3VR5A 1XNQQ 1IYVA 2TSSA 3NBIA 3V96A 1MBYA 4HR7B 3NXWA 4IJHA 4MHEA 1ASYA 3TRZA 4JI0L 2A1AA 3NEMA 1SE8A 5C0XH 4RFBA 4LWCA 1M8AA 3GTGB 2LS01 2G9HD 1RKNA 4MIUA 4A3JG 1JB3A 2CWPA 5CR3A 5KNCA 4NP5A 1X55A 5J3BA 4AYBG 2A74C 1QB5D 4C3IH 5GQOA 1F9SA 3NSWA 4LFBL 3DM1A 2WAQE 3VA5A 2C35B 4ZYSA 1TWCB 3OWEB 4IUVA 4XYQA 5E4XA 3TREA 4IURA 4KJOA 3CCLA 4OONA 4BBSG 1TIID 1D5MC 2B2UC 1ML0D 2WKDA 1JE5A 5IY0A 4LF4L 1HR0L 2Z0SA 1LTRD 3KUPA 1B3AA 5D3IB 1TWGB 4GOPC 1A3UA 3ONAB 2JQOA 1J5EQ 5I6WA 3SE0A 4LF9L 5A2QE 5BN3A 4YHHQ 4BBRH 1PMRA 1STAA 4OGQC 4YWMA 4V0BA 4JBMA 3SXHA 4G7HC 5EKIA 2F3WA 4JOIC 3CCMA 4K2KA 4A3KG 1D8LA 1LTBD 3E5SA 3OMCA 2DY8A 4HMJA 4KKSA 2Q2TA 4DF7A 3RZOH 3I3CA 3SR1A 4NXNQ 3T56B 3NTIA 5A35A 2D5DA 1IW7D 4LF5L 1SFOB 1PTOF 2UUBL 2RCFA 4IO9A 4C2MB 4GNXA 4A3MG 1EY0A 4LUVA 1BCPC 3ULJA 1AZPA 2A68C 2EY6A 1WTVA 2B8GA 5GROA 5FKAC 3CCEA 4QGUA 1PZID 4GN3B 1YNJD 4EX5A 3K5OA 1PH8A 4R4TA 5K36G 1BCPF 3NQTA 4BXXG 2F0GA 1YNJC 3S1NB 2BA1A 2KECA 2F0OA 4FF4A 4B3ML 4LW1A 2UXCL 2SOBA 4ZCKA 2R7FA 3UDFA 3VYRA 1QVGA 1A63A 4A3JH 2OQKA 2M00A 4A75A 5CYUA 1BO0A 4ALPA 3KLWA 1A3VA 2F0WA 1DZ1A 3PO2G 4DV7Q 4DR3L 4JV5L 1SLJA 5J1ZA 3HOYG 3J80i 3I4NG 4DR6L 1Q12A 1JC7A 3QO2A 1VQMA 2VQEQ 4RGMA 4DR4Q 1HA5A 1I4RA 1IBLQ 1MSGA 3NTHA 3HOVG 2VUMB 1U0LA 3L0OA 1GHJA 1HJPA 4DR5L 2K5WA 3W1BA 2FFKB 2EPBA 1X3GA 5C44G 2HCCA 4B3SL 2A73B 2K01A 1CSPA 2O5IC 1CQVA 2L4NA 3H3VH 1C4QA 4LUZA 1QWYA 3E0EA 3RZDB 5HGQA 4WJWA 1DCZA 2WV6D 3U9SA 3TP8A 4DNRB 2HQEA 1E22A 3HOXB 4B3SQ 1GM5A 2O2LD 1WOCA 3LWUA 4KV6A 3QR8A 1JCKB 2NTTA 3KF8B 3FP9A 1JE4A 1YNND 4JI1Q 2KQ3A 3ICEA 1L1OA 2A6HC 1QZGA 1P16A 2ZTDA 2A69D 3PO3H 3S1QH 2M9VA 2B2TC 5G3LD 4YCUA 4X65Q 4JC0A 1YHAA 1JJ2A 2HIXA 3PUYA 1SNCA 4LFAQ 2PZUA 3TN2A 1CM9A 2EXZA 1Q46A 1F2YA 3PUWA 3EBEA 4NW2A 4BBRB 4R4OA 1RHPA 1HQRD 3MXNB 2JA6H 1IYUA 1SNDA 1IZ6A 4EVOA 3CC4A 3D8GA 4HMIA 5DNFA 1TWGH 3BVMA 3IFTA 3GP7A 5ISRA 3HOZG 1VF5C 2NVQH 5IYBH 4WFN3 3MFYA 5FLMG 2HT1A 2MPMA 1SE3A 3I7FA 1U9RA 2F0PA 1I3QH 1X32A 2JJQA 4H02A 5AFWA 1FJGL 1I5FA 5CV9A 4MZ9A 2E2JH 4C3IB 4KHVA 2F0JA 5GADC 2HIVA 1DJRD 2NN6I 4GN4B 4YWKA 4DAYB 2E2IB 4LF6L 2NVXH 3I4MG 1B7YB 1A15A 1G6ZA 1PRTB 2DGYA 1VQFA 4C3JG 1HZ9A 3BG3A 3S1QB 1HTLD 3I56A 2E5LQ 1LACA 1SNQA 4C1NK 3FPPA 4F8MA 3CP0A 1WTRA 4OELB 3NK9A 4O2DA 2L0CA 1I4XA 3OTOL 3CD6A 1EFWA 2XNAC 3S16B 2F0KA 1RTOA 2C9OA 1C0AA 2F1MA 5C5LA 4DV3Q 4K8JA 2A5HA 4H44C 1IL2A 4GKKL 2EJGC 3G6JB 1SR3A 2QDLA 5EPKA 3W1GA 2SNSA 3S14H 3M4QA 3TDQA 2MP1A 4KD4A 4CDDC 3TS2A 3KYHC 4GKKQ 2LKVA 5EKKA 3ZJYC 5NUCA 4KTAA 1A0IA 1TU2B 4E6IA 2K5QA 1UE1A 1PDQA 3HKZB 3ITPA 4XT3B 5JOBA 1YHBA 3S15B 4ZUIA 1U4RA 5IP7H 1OXXK 2HUGA 3K5NA 1LT3D 4HN7A 3NELA 1Y1VH 1VQOA 2RVLA 3UDIA 4JI5Q 3A74A 4N9PA 1SYDA 1VQCA 4YWLA 1B3QA 2IHEA 3GTPB 4GOPA 1FVIA 3V05A 1FJGQ 3W3AA 3VDYA 4XXEA 4IPGA 3A8IE 1Q90A 3NBHA 1KDAA 2F0NA 1GUGA 1EYAA 2MNAA 3CCQA 4LNQA 3NP8A 1IBKL 3HRZC 5K5PA 3CPWA 4GZYC 1D1IA 2ATWA 3CQZB 1TS3A 4H7BA 3M4PA 1STGA 5EJWA 3W5OA 2K5NA 4A3CG 2E5LL 3OSOA 1SROA 2Z9HA 2ZXPA 5C0XI 2IY5B 1I6HB 1I50H 4QJFA 2L5TA 1L0YB 3S14B 1DOLA 2Q2IA 3GQBA 2NN6H 1PH9A 1EY7A 2IHFA 2K5VA 1JORA 2N8NA 1B9NA 4JI2Q 5A2QL 5CV4A 1OXVA 1J6QA 2F0EA 3R8BA 1IHZA 1KABA 4C2MH 1CA6A 1N9WA 3H3VI 1AW7A 2KOLA 5ELFA 3KJPA 4JI1L 4EGVA 3MEFA 1CTMA 1Q3LA 1S72A 2NWGA 2V4DA 2F0VA 4F88A 3ERQA 2VL6A 3P75A 4M8AA 4YHHL 3TZDA 3J80L 2E2IH 3DWAA 1I4HA 4A3JB 4LFCQ 1S5CD 1AP0A 1TS5A 3J7YW 3CRLC 4FDBA 5C4JB 2KCMA 4DR1L 4L5RC 2Y0SE 2ZJQA 1FNWA 1SE4A 3K5MA 2CH4W 2A6HD 4A3GB 3A5ZB 3H0GG 4KN7C 1Y1VG 2AQ1B 4OL7A 1ESRA 3GTJH 1E1OA 1DD2A 2JE6I 2BE5D 4A3CH 4O42A 4C3HH 1K0SA 4K6DA 3DEOA 4R9WA 3J7AF 4LFCL 4YY3Q 3C46A 1A2UA 3AFQA 5C0XJ 1TKWB 4TRDA 2CVRA 4DAYA 2YU9H 1VQPA 4XQJA 4K8IA 3FDTA 3S1MH 3GTLH 2VXWA 4G57A 1CKOA 2AQ2B 3NPPA 3L9AX 4HJ9A 4YCVA 2JA9A 1OXSC 1KIXA 2R7ZH 3RZOB 4KLKA 5C4XG 1BNZA 2EY2A 4QUFA 1PTOH 2ICEC 1KNEA 2V1CC 4K2LA 3K0YA 3SK6A 5IOCA 1WTOA 1XNQL 4LF7L 4DPGA 2QGQA 2L12A 4KY7A 2RKSA 3HOXH 3G7LA 1IBML 3BS1A 1B2TA 1CFMA 3IL8A 1TWFB 1ICWA 2JA7H 1CK1A 4X65L 4MTNA 3EJIA 2HDMA 4NXNL 1XNRL 4ILWA 1ILQA 3EN2A 3S2DB 3AMUA 2EDGA 2F3VA 3T53B 5BR8L 4X62L 3CC7A 1WCMH 4CJ0B 4DU9A 5I2YA 4RKLA 5JPMC 2E75C 1B70B 1GUOA 1WTWA 1WCMB 5M5XB 1PZKD 1AE2A 1ILPA 2JSOA 2IW3A 4AYBB 5KGUA 4HJ5A 2CW0D 3PO2B 4DV3L 2R93G 2JA5G 4DUZQ 4L63B 1KDCA 4PZ8A 4I65A 2KJXA 2GA4B 1ONLA 3U50C 3BDOA 5IYDG 2X6GA 3DMUA 1QOHA 4A3EH 3S9WA 1LTSD 4DUZL 3B6YA 1SBBB 1F77A 2VY3A 1EYGA 4IQZA 4OX9L 4UPAA 5E4WC 3NE5B 2XVSA 4DV7L 3C2PA 1X6OA 1CZGA 3T4AC 1U4LA 3P7JA 5M5YH 2WKCA 2R92G 3RN5A 2VS1A 4OO1G 1KLUD 5JJZA 2BH8A 5JAVA 4DV1Q 4POGA 5FO9B 2LSSA 1AN8A 5CV5A 1SDFA 5FK9C 3FPUB 2OTLA 2AMCB 4X3SA 2UU9Q 3F2CA 1H95A 2VQFQ 1Q82C 3GTLB 5CV7A 1NJIC 1O7IA 1RJTA 3U4ZA 1R9TB 2EYMA 2JP1A 4QUCA 1C48A 1DOKA 2DUDA 3Q22A 4X3UA 1EEID 1HTPA 5LMUL 2PCFB 2F0DA 4AIMA 1PH5A 2FHTA 2R93H 4DA2A 2BH2A 2WACA 1MGSA 4KD3A 4BXXH 1L1OC 4F87A 1S5ED 1G51A 1GUNA 4U673 3T1YQ 3RN2A 1CT1D 4KY5A 4X66Q 2OTJA 2UXCQ 3EIVA 1RIPA 4YCWA 5IP9G 2NVQB 5DLQE 1I6VC 2WFWA 2EYLA 1MKHA 4V190 2F52A 2X69A 4RH6A 1PTOD 3KJOA 1FGBD 1VMPA 5EKLA 1G291 1NE3A 5C6AA 2F0HA 4QQBX 4A3BG 2D9UA 5JEAJ 2F4VQ 1EY9A 3I4MB 2GN5A 2AUKA 1A62A 3CCUA 3J80E 2PMZE 5LHY1 3JAML 4FF1A 1CHPD 3PO3B 4GKJQ 3BVZA 3SVMA 1VQLA 4S3SA 2XWJB 3PV0A 3M4OH 5C0XG 5C3EG 1UEAB 4B3TL 3D6WA 5G3LF 4FXKC 4C3JB 3M3YB 4OWTB 3CXCA 4M1UB 1SNPA 5I9OA 2EYOA 4DNIA 4JV5Q 4L5QA 1SN8A 1W2BA 2K52A 4NB3A 3GTKB 1EQTA 3FHWA 1K73C 5CBAE 4RKBA 4DNTB 1S5FD 3VR3A 2YTXA 5HURA 5AJ3Q 4KKTA 3R3OA 1VQAA 1XWEA 5IP9H 4IUTA 4R4CA 5JEAH 4ME3A 5CC4A 1AZQA 3I4OA 2I46A 5EBDA 2ZTCA 1VQIA 1RCVD 1ET9A 3CC2A 3CHBD 1JMCA 1A8VA 3M4YA 2EYHA 5M3MH 2QEJC 1KAAA 2RDHA 4PV1C 3T16A 4A3FB 4K5XA 1NCVA 1SYGA 4HAEA 3HP3A 4LF7Q 1RL2A 4Y7NB 1JQYD 2ZJPA 2UUAL 1H9SB 3MC0B 1STBA 1V1QA 2LXKA 5FLMH 1XPOA 1K3BC 4KY6A 3MXGA 2CH4A 1ZKOA 4RA8A 1EOVA 4DUYQ 1S40A 3FKIG 1E2WA 2GVBA 4FNFA 4OIJA 1V1OA 3D31A 2KEDA 2ZM6L 3A8JE 3A56A 4GN5A 2CKZB 5KRUA 3U9OA 4NKLA 2MO0A 3OMGA 3GDEA 4PG3A 4PNYA 1Q8KA 2RF4A 1H9JA 2NVYH 4KN4C 3MA2B 2EJMA 1MJEA 1V9PA 3UI2A 1YJWA 3FEWX 2XGTA 3E3XA 2N88A 2XIWA 2K04A 5IP7G 4GOPB 1TVXA 3I2ZA 2F0IA 3HOUB 1BOSA 4XYOA 2K4KA 1EYCA 4Z9CB 2KHSA 2EYFA 4B08A 1QJOA 3TZUA 1F9QA 2GVAA 2XN9C 4DN4M 4LF9Q 1XJVA 1Y69U 3G6EA 3OW2A 1L2FA 1CZWA 4B3RQ 1J5EL 1LT6D 4B3TQ 1TT2A 2E2DC 2EOTA 2CWAA 1HRJA 1JJGA 2Z8LA 3NBHB 2B2YA 2PW7A 4A3MB 3DM3A 3DHQA 2VQEL 1BDOA 5JJKA 4HSVA 3Q8DA 1KAWA 2K14A 1C8CA 2I07B 3EVQA 2RBMA 4JI2L 3FKIH 2QA4A 4OWWB 1CQFA 4DR1Q 1Q1BA 3GTOH 3KLRA 1RTNA 4I7AA 1NMFA 2R92B 4MN3A 3L7ZC 4U68A 4HEDA 5T1IA 3IFDA 2MFIA 1N33Q 1F2MA 1EFID 1GOZA 5IYCG 4JI0Q 1STEA 2HD3A 5FJ8H 3V2TA 2IWHA 1ENAA 4IOCA 3P1HA 3S1RB 2K75A 1ESFA 1J8IA 5CGKA 5KIXA 3K0XA 1N36Q 1GKHA 4LAAA 1HNZL 3JAMi 4BY1B 3GTQH 4DAVA 4JI7L 1KXLA 1Y1WB 4LF6Q 3BYTB 4PQXA 1HFNA 1I94L 1EZ8A 2EY1A 4GLAC 1JT8A 4XTCS 3RMHA 3I4NH 1VDZA 2VUMG 3HOVB 2KA7A 1B50A 3LNNA 3AYHB 3RLNA 4IFDH 2Q8RE 2AWNA 2B2WA 1GO3E 4CDEC 2JYOA 2EZVA 3PO3G 2OQ0A 2F03A 4EQNA 4BA1I 3TMEA 3UE1A 3PSIA 3H0GH 1VCIA 1AEXA 1EZ6A 2IL8A 4EQ5A 5JVG3 4X3KA 4J15A 1E7ZA 5J39A 2PQEA 3QB3A 1X3PA 4XT1B 3DLLA 2XTIA 3S17H 4H13C 5LMNQ 2ASBA 1SYBA 4KMUC 1E24A 1YZ6A 4RAUC 2F0FA 2RDGA 5KNBA 5KYIA 2FMCA 2HDLA 2NB0A 3J81L 2J7ZA 2NVTH 4ZQ3A 2B2WC 5E3FA 4UY8C 2QILA 2CW0C 5ELBA 2P5ZX 3DUZA 1CUKA 1NR2A 1V1PA 1FR3A 4LF4Q 4DXGA 5C4XH 4P75A 3DWQA 2X6LA 4WRDA 4A4IA 3I91A 1VMCA 2K33A 2ZT9C 1SMXA 4DXFA 3GTMB 4NDXA 3E6ZX 1W6KA 3HOZB 1D5ZC 3NENA 1PVOA 3MHBA 2WAQB 1HXYD 4LJZC 3BDLA 1G91A 1VQEA 5LL6S 2PPBC 1VQ5A 1CSQA 4DR3Q 5BR8Q 5J22A 4MTKA 4IUUA 1JB7A 1IXRA 5M5WH 4IFDG 4UP8A 2BCOA 1BF4A 1QILA 5KEEA 2RCNA 3W2DA 1A2TA 2ZJRA 4HJAA 3C1EA 4B3MQ 2VNUD 1NNXA 4TQUS 2FINB 4DV5L 4ZK9B 2R93B 2RQXA 1HA6A 3KOJA 2A6EC 3Q0AA 3AFPA 1TY2A 5F2DA 2DNCA 1HUNA 4N9TA 1V43A 1T9HA 3H09A 1YBYA 1XTDA 3HEJA 3X3MA 4DV6Q 3HS0C 1B9MA 2FMMA 1R9TH 1BUVT 4DK0A 3BZDB 4B9XA 3R93A 1EQVA 4DR2L 3PIO3 4RMFA 4JI3L 4L6TB 4NXMQ 5EBCA 1C9OA 1PFSA 3BDCA 1O7YA 2B63B 3J81c 4WORA 3QWNA 1PFNA 3H94A 1LTLA 1YI2A 1NTGA 2KHIA 2K1BA 5IT9E 1SJHD 1WTHA 2CQOA 5E1FA 2UXBL 2Z4IA 1QVFA 1WD1A 4BY1G 1LT4D 1XMOL 4O1NA 3I4NB 1SJED 4FXGC 4QF4A 4JI5L 3GO5A 1TQOA 1VQDA 3U4VA 4BS9A 5BN5A 1Y1WH 4A3LH 4XQNA 1ICFB 4DR7Q 4FVMA 1UEBA 1WI5A 1S3OA 2JXMB 5D14A 1GXDC 1HFGA 2NZOA 3RD4A 1RDPD 1ZEQX 3AQQA 5GAGC 3STBD 3HZXA 1B4OA 1RF2D 3KDFA 2Y0SG 1IL8A 1MI2A 3QOJA 2WB1B 4DV1L 3F2BA 3KFUA 1X9NA 1STNA 3A7LA 3K7AH 1KHIA 5CORA 5M3FH 1PH4A 1VQBA 1Y8PB 3AU7A 2Z1CA 2FJ2A 1SRUA 3TSSA 1VQ7A 1HH2P 2M2LA 4CDFC 3BYYB 4DV4L 4JK1C 4HJ7A 3HOWG 4OO1H 4X62Q 4JI6Q 1EIFA 2XRSD 2D0OA 3SK4A 4BY7B 1PYSB 4A3DB 2K5DA 3PF4A 3HG9A 3S2HH 1HZAA 4I7ZC 1TWAH 4A3GG 1X65A 3G71A 1W3SA 2KUMA 1RD9D 4BY7H 1JWUD 2E74C 2PQAA 3HKZG 3Q24A 2QW7A 2JA8B 4BY1H 3MXPA 2CHBD 2WP8J 2I5HA 3S1RH 1BCPD 1PFBA 3G48A 4LFAL 4UHVA 1K3RA 1S4ZA 2MJ8A 3KDFB 2WAQG 1KD1C 2R7ZG 1GUSA 1AFPA 2JEAI 2DJGC 1WJJA 1JOOA 4FF3A 1SEBD 1SNOA 4IFDI 4X66L 1PA6A 1N33L 5IGDA 1I4GA 4N8X1 3S16H 1E2ZA 1XYIA 5C3EH 1GJXA 4FO2A 1DXMA 5M3FG 1VQ6A 3A55A 3KBXA 4A3BB 5D65A 4ID6A 1TR5A 1S5BD 3A8KE 3OOCA 4JOIA 2VZAA 1Y1WG 2A19A 1KC8C 2E76C 2WIIB 2L1BA 2HQLA 4XQQA 5DM73 4ABNA 4YY3L 1EU4A 3E9HA 4JBJA 2JA7G 4GNXB 3HOZH 1XX8A 1O78A 3MWYW 3J7ZC 3LWEA 2J4XA 2Z6BA 3CKIB 3R2TA 3UDGA 3NQIA 4X6AH 1I3QB 4RG1A 4QIWE 2B63H 3PCOB 2F3IA 1PRTC 3Q6SA 4K6LA 4JI6L 2B2UA 4RCOA 2RHQB 1WYDA 4PMCA 1DYQA 3K7UC 3N52A 4P74A 1ZYRD 5C4JH 3PGZA 1MJCA 1L0WA 1WFQA 2R6GA 1OXTA 3ERSX 1CA5A 2QKIC 1TY0A 3M7NA 3F8TA 1BKBA 3I90A 1EIGA 3TBIB 3GV3A 3J7AV 1HZCA 2YYZA 4OO1I 2B2TA 3OIPA 1VQNA 2JA5H 2R3ZA 1Y14B 5IGCA 4G4KA 5EPJA 5FLXL 1B1ZA 3C3LA 4IFDJ 1VQGA 3K80C 1HNXL 1LTGD 5TSSA 4IPHA 2KENA 1KNAA 2N3SA 2BE5C 1UE5A 4CKEA 4ZAIA 5ELOA 4DV6L 3CRKC 4DV0Q 1PZJD 2XWBB 1JOQA 1X3FA 1EWHA 1VS0A 3HOXG 2CFMA 1I6HH 2ZM6Q 2H1EA 1K8GA 1TXYA 2KBNA 2YTVA 2PNRC 1ENCA 5C44B 4DV2L 1F2LA 4UP9A 1JWSD 5JPNC 1TWHB 4JI3Q 1TWHH 4A3FH 3CMAA 2ID0A 4OXPA 3X3NA 2PZWA 2K6AA 2YTYA 4O0AA 3T1HL 4Q0FA 4QIWB 1MHWC 4PMWA 2UXDQ 3KLSX 4ZUJA 1WCMG 3A54A 4GLXA 1H9MA 1GUWA 4CKBA 3GTPH 1S5DD 2BDNA 3HFZB 1DGSA 1QE6A 4A3IH 3HOYB 4HCEA 1UNSA 2RDFA 5IGFA 4IUNA 1LTAD 5ELDA 3CCVA 4DV5Q 3K59A 1Q8IA 2J0TD 2E2HH 3VA7A 4UAIA 5IWAQ 2N55A 1F2ZA 4IPDA 5LL6X 2JN4A 2MO1A 3T51B 1YNXA 2I5LX 2E2HB 2AUJD 5AJ3L 3M9BA 3JAMc 1UAPA 4QL5A 3SK5A 3J81E 2EY5A 1D2BA 3A0JA 1N34Q 2PNHA 2XRQD 4IN3A 5GAEC 5C4HA 1EY8A 3H91A 2BA0A 5M3FB 3GD7A 3H6MA 1QG7A 4GNXC 1K9MC 5CBEE 4DAPA 5ELCA 1YITA 1SE2A 1HPCA 3VYSA 2D62A 3K58A 1XNRQ 4RWSC 1K8MA 4POFA 1SFOH 3F2DA 3ND9A 2R7ZB 1YJ9A 5IWAL 4WJ3M 1D1KA 5C4ZA 2AQ3B 3BJUA 4WJ4A 1LTID 1GHKA 1MIUA 2NTSA 4HCSA 4DR6Q 5COYA 2Z4HA 2Y0SB 3UE0A 1N36L 2CCZA 1PH3A 3I4MH 1KL9A 3M85A 4P73A 1X3QA 3WDNA 3GTOB 2LY7A 2UUCL 5KYLA 3VR4A 1EWCA 4IJLA 3LX0A 1H9RA 4N8FA 3JAME 1LABA 2NUCA 1PXUA 3OTOQ 1U5KA 2JA5B 1VQKA 2Q8IB 1QNUA 4L5TA 4A3MH 2JEBI 5EQ0A 1PYBA 3OPOA 4LMQD 4C3HG 5I6YA 1K8OA 1N32Q 5EPLA 3TP5A 2K5HA 3F2UA 5KNDA 1PLFA 2L11A 4JI4L 2K50A 5FO8B 2B29A 2Q2HA 5K36H 1UWVA 3QJYA 2A6ED 3PUXA 1TS4A 1C7YA 1G2SA 2OT2A 4BWGB 2BDOA 2R61A 4JCVE 2EVBA 2HHHQ 3CPFA 2F0SA 4ZRZA 1UE7A 3URYA 2UU9L 1YEZA 1EUJA 2VQFL 3CCRA 1PFMA 4KKUA 1XPUA 3KBGA 1J9OA 1STHA 4HIOA 3PIP3 1EY4A 4DV4Q 1AE3A 1PTOC 1ASZA 3HKZE 4X64Q 2IX0A 3MZ5A 4R8IA 1W6JA 2LXJA 1FNVA 3I4LA 4A3IB 4CDCC 3HOYH 1KQSA 1CI3M 3GTQB 4B9WA 1HCZA 1PHJA 4LUOA 3MXNA 4OX9Q 4J6HA 5HY6A 5IT9c 2A8VA 4OEMB 5DAUA 1UUPA 1I4QA 3M3YH 1DONA 5CV8A 1NR4A 1SMYC 3STBC 3Q23A 2OF1A 2A69C 4ZLTF 5C44H 4Y7NH 4JW0A 4PMBA 5M5XH 2RHSB 4RGTA 1PV4A 4A93H 4JYAL
chains in the Genus database with same CATH topology
1XMOQ 5C0XJ 2JA8H 2N78A 1VQEA 2YU9H 1VQPA 1VQ5A 1CSQA 4DR3Q 1Q86C 1M90C 3S1MH 2ES2A 3GTLH 3K8AA 1PH2A 5BR8Q 5M3MG 4APVA 1CKOA 1K0RA 4GS3A 1JB7A 3PF5A 1LUZA 1IXRA 2UXBQ 5M5WH 1Q81C 5JJIA 4HJ9A 4YCVA 1BBWA 1OXSC 2JA9A 4UP8A 1KRSA 2IT1A 4KLKA 1KIXA 1VQ8A 1IBKQ 4YY3Q 5C4XG 1AH9A 2RCNA 4KHZA 3CW2C 3RNUA 3S2DH 3PIPA 2ZJRA 4HJAA 3D0FA 3J80c 1UE6A 2R7DA 2V1CC 4JBWA 3T1YL 2HHHL 4B3MQ 1XNQL 1M1KC 4LF7L 3CAMA 1KRTA 2VNUD 1PH7A 4LF8Q 4DPGA 4TQUS 3S1NH 5JJLA 1QUQA 4DV5L 2QGQA 5IE8A 3H15A 1Q7YC 2ZTEA 3HOXH 3KOJA 5FLXc 2D0PA 4R1JA 3LGJA 2F4VL 1E1TA 3AFPA 1K83H 1HNZQ 4JI4Q 4OWXB 1V43A 1T9HA 1IBML 1YBYA 1XTDA 1E3PA 4DV0L 3HOUH 4DV6Q 3HOWH 3T1HQ 3CQZH 3HKSA 4KHPQ 1R9TH 3PUVA 2JA7H 4P71A 4X65L 3BZCA 4DUYL 2OWOA 2UUBQ 4MTNA 5IYCH 1NMGA 4DR2L 1CKMA 4RMFA 4JI3L 1OTCA 3K81C 1EIYB 4NXMQ 1XNQQ 3ULLA 1C9OA 1PFSA 1HR0W 4IJHA 2E8GA 4PZ7A 1ASYA 4UP7A 3TRZA 4JI0L 4NXNL 3J81c 1XNRL 2A1AA 3NEMA 5EAYA 1BBUA 1SE8A 4DV2Q 1LTLA 1YI2A 3EN2A 1NTGA 2KHIA 4LWCA 2UUCQ 5BR8L 4X62L 3CC7A 2CQOA 4A3JG 1WCMH 2CWPA 2UXBL 4K0KQ 2B3GA 1QVFA 1X55A 1B70B 5J3BA 4AYBG 4BY1G 1XMOL 4C3IH 5LMUQ 5GQOA 4LFBL 1AE2A 2WAQE 4JI5L 3GO5A 2C35B 1VQDA 3U4VA 4HJ5A 1Y1WH 4A3LH 4DV3L 2R93G 3TREA 2JA5G 3ULPA 4DUZQ 4PZ8A 4DR7Q 1XMQQ 3CCLA 2JK8A 4OONA 1UEBA 4BBSG 1WI5A 1S3OA 3U50C 2WB1E 2NZOA 5IYDG 5GAGC 3AQQA 3STBD 1JE5A 5IY0A 4LF4L 1HR0L 1JJCB 2Z0SA 3KF6A 1Q1EA 4GOPC 4A3EH 1HZBA 3KDFA 2Y0SG 4DUZL 2JQOA 4A93G 1J5EQ 4DV1L 3F2BA 3B6YA 3KFUA 1X9NA 3RLFA 1QZHA 3K7AH 1KHIA 3OYYA 4LF9L 2VY3A 4BBRG 1EYGA 4YHHQ 4UPAA 5M3FH 4BBRH 1PH4A 1VQBA 4OX9L 1VQ9A 5LMNW 4DV7L 4YWMA 2UXDL 1X6OA 1SRUA 4JBMA 5M5YH 2R92G 4JOIC 3CCMA 2VS1A 3RN5A 1VQ7A 1HH2P 4HJ7A 4DV4L 4A3KH 1N8RC 3HOWG 2PQAB 1D8LA 2BH8A 2NZHA 4X62Q 4DV1Q 4A3KG 4POGA 4JI6Q 4IFDG 1EIFA 2LSSA 4JI8L 3GTGH 2D0OA 2Q2TA 3RZOH 1PYSB 4NXNQ 2OTLA 3PF4A 3S2HH 1GVPA 1HZAA 2AMCB 2VW9A 2UU9Q 1TWAH 4IOAA 1L1OB 4A3GG 1X65A 3UDXA 3G71A 3F2CA 1W3SA 5FJ8G 2VQFQ 4BY7H 1H95A 4LF5L 4BY7G 2UUBL 1Q82C 2PQAA 4IO9A 3HKZG 4GNXA 1NJIC 4A3MG 5E7NA 1O7IA 3U4ZA 2Z6KA 4LUVA 2DUDA 3ULJA 4BY1H 5GROA 2WP8J 5LMUL 3TEHB 2I5HA 3CCEA 3S1RH 3G48A 4LFAL 3HOUG 4QGUA 4GN3B 4AIMA 4EX5A 1PH8A 1PH5A 4JI7Q 1K3RA 4R4TA 3RLOA 3GTMH 5K36G 1QUQB 2R93H 4C3JH 3KDFB 4BXXG 2BH2A 4BXXH 1LM0A 2WAQG 1L1OC 2BA1A 1KD1C 2Q2UA 2R7ZG 2VUMH 1G51A 3T1YQ 4B3ML 2JEAI 2Z6KC 3RN2A 4LW1A 4X66Q 1WJJA 2UXCL 2OTJA 4IFDI 1IYJB 5IYDH 2R7FA 3EIVA 1RIPA 3UDFA 4X66L 1PA6A 4YCWA 5IP9G 2UUAQ 1N33L 3S16H 5DLQE 1QVGA 4NXML 2WFWA 1A63A 1MKHA 5C3EH 1BVSA 4A3JH 2OQKA 2F52A 4A75A 1HNWL 3KJOA 2I0QA 4ALPA 3KLWA 1G291 1NE3A 1NBWA 3PO2H 3PO2G 5M3FG 1VQ6A 4QQBX 4A3BG 4DV7Q 3CMEA 4DR3L 4JV5L 1SLJA 5JEAJ 2F4VQ 2NN6G 4JOIA 3J80i 3HOYG 3I4NG 4DR6L 2GN5A 2VZAA 1Y1WG 2A19A 1A62A 1Q12A 3CCSA 3CCUA 1KC8C 2HQLA 4P72A 4YY3L 3E9HA 4JBJA 2JA7G 1EWIA 2PMZE 4GNXB 3HOZH 3KF6B 3PIOA 3J7ZC 1VQMA 4GKJQ 2VQEQ 1VQLA 4DR4Q 3UDGA 4GKJL 4JG2A 4X6AH 4RG1A 2B63H 4QIWE 1IBLQ 3PCOB 2B63G 3HOVH 1VQJA 3PV0A 3HOVG 4TVAB 1U0LA 5C3EG 5C0XG 2F3IA 3M4OH 3L0OA 3E9IA 4B3TL 3I55A 4JI6L 2RHQB 1WYDA 1HJPA 4DR5L 3W1BA 1X3GA 5C44G 4OWTB 3CXCA 3K7UC 4B3SL 1CSPA 3IRBA 4P74A 3H3VH 4LFBQ 4DNIA 5C4JH 3PGZA 4JV5Q 3WWVA 1MJCA 1L0WA 4L5QA 4LUZA 1WFQA 1SN8A 3E0EA 3L2PA 2R6GA 1OXTA 3ERSX 5HGQA 2AHOB 3J81j 1W2BA 3M7NA 3F8TA 1BKBA 4HIKA 5GAHC 2K52A 4NB3A 1HZCA 1E22A 2YYZA 3FHWA 4R4IA 1K73C 4B3SQ 1GM5A 1VQNA 4OO1I 1N34L 1WOCA 2I5MX 2JA5H 1Y14B 3KF8B 4HIDA 3FP9A 2YTXA 5AJ3Q 4JI1Q 3ICEA 4IFDJ 1L1OA 1X3EA 1QZGA 1VQGA 1P16A 2ZTDA 3K80C 1HNXL 4NPSA 1VQAA 4GLVB 3PO3H 5IP9H 3S1QH 4R4CA 4IPHA 1YHQA 2KENA 4ME3A 4YCUA 2N3SA 3I4OA 4X65Q 1K8AC 2ZTCA 1YHAA 1UE5A 1VQIA 4JC0A 4A3FG 3CCJA 3CC2A 2KHJA 1EQQA 5ELOA 1JJ2A 4DV6L 2HIXA 1Z9FA 3PUYA 4DV0Q 4LFAQ 1NY4A 1JMCA 4AYBE 1X3FA 1VS0A 1Q46A 3PUWA 2N49A 3EBEA 1A8VA 3HOXG 4R4OA 2CFMA 3MXNB 2JA6G 1I6HH 5M3MH 2ZM6Q 2JA6H 4A3LG 4XIGS 1TXYA 2KBNA 1IZ6A 2PI2A 1K8GA 3RZDH 3CC4A 2YTVA 4LF8L 1TWGH 4LF7Q 3HOZG 1RL2A 3ER0A 2NVQH 2ZJPA 4KI0A 5IYBH 2UUAL 4DV2L 2H5XA 3CF5A 1V1QA 5FLMG 2LXKA 4UP9A 5FLMH 1XPOA 4A3GH 2HT1A 4JI3Q 1TWHH 3I7FA 2L15A 3A5UA 4A3FH 1I3QH 1CKNB 3CMAA 1TWCH 2ID0A 2JJQA 4OXPA 1EOVA 4H02A 1FGUA 2YV5A 3FKIG 4DUYQ 1S40A 4BA2I 2GVBA 1FJGL 3J81i 2YTYA 4O0AA 4R4QA 3T1HL 4KHPL 3D31A 4PMWA 1I5FA 2ZM6L 4MZ9A 2E2JH 2UXDQ 4GN5A 1WCMG 4GLXA 2CKZB 5GADC 2HIVA 4GN4B 2NN6I 3F1ZA 4YWKA 1FL0A 2QEXA 4DAYB 2MO0A 3GTPH 1G6PA 3HFZB 1DGSA 1EQRA 3GDEA 4PG3A 2NVXH 1Q8KA 1B7YB 4A3IH 2RF4A 4LF6L 3I4MG 2DGYA 4A3IG 4JYAQ 1VQFA 2EIFA 1HZ9A 3CCVA 4DV5Q 2NVYH 1N32L 5IYBG 3I56A 2E5LQ 2E2HH 1JT8A 3CP0A 3BZKA 5IWAQ 4IPDA 1MJEA 1V9PA 1YJWA 2MO1A 2XGTA 1YNXA 2I5LX 1PH6A 4A3DH 4O2DA 5AJ3L 3S15H 3M9BA 3JAMc 3OTOL 1XMQL 1EFWA 3CD6A 4QL5A 5JEAG 1C0AA 3A0JA 5IP7G 4DV3Q 4GOPB 3I2ZA 1N34Q 2PNHA 5GAEC 1VQ4A 2K4KA 1IL2A 3BU2A 4GKKL 1YIJA 4B3RL 1SR3A 2BA0A 3W1GA 4DAMA 3S14H 3GD7A 3M4QA 1XPRA 2GVAA 4GNXC 4LF9Q 1K9MC 3TS0A 1XJVA 3TS2A 3G6EA 4PZ6A 1L2FA 3OW2A 4B3RQ 1J5EL 3KYHC 1YITA 2MQHA 4GKKQ 3ZJYC 4B3TQ 4JBKA 2D62A 1A0IA 2CWAA 4AH6A 4DR5Q 1JJGA 3NBHB 1XNRQ 5H1SE 1UE1A 4DR4L 3DM3A 2VQEL 1YHBA 4POFA 5JJKA 1YVCA 1SFOH 3F2DA 1IBLL 4DR2Q 3Q8DA 1KAWA 2K14A 4L5SA 1D7QA 3AEVA 5IP7H 1OXXK 1YJ9A 4A76A 3PUZA 4JI2L 5IWAL 3FKIH 3NELA 2QA4A 4OWWB 1Y1VH 2AWOA 4WJ3M 4DR1Q 1P8LA 1Q1BA 1VQOA 3UDIA 3GTOH 4JI5Q 3A74A 3BJUA 4WJ4A 2EQSA 2PI2E 1I94Q 1MIUA 1VQCA 4YWLA 1NMFA 2IHEA 4DR6Q 2JA8G 5LMNL 1B8AA 2R92H 4GOPA 4K0KL 3L7ZC 3UE0A 1N36L 2CCZA 1FVIA 4AQYL 1PH3A 3I4MH 2FXQA 1KL9A 3M85A 3S24A 4P73A 2KCTA 4X64L 1FJGQ 2UUCL 3VDYA 2MFIA 4IPGA 1N33Q 1CKNA 4IJLA 1HNWQ 5IYCG 4JI0Q 4A3DG 3CCQA 2MNAA 4LNQA 1IBKL 3OTOQ 5FJ8H 3CPWA 1U5KA 1VQKA 4L5TA 2ATWA 4A3MH 2JEBI 4DK3C 3GTKH 4HJ8A 4IOCA 1TWFH 3M4PA 1PYBA 3W5OA 1LYLA 2K5NA 2K75A 2E5LL 4A3CG 1N32Q 1IBMQ 4AQYQ 3K0XA 1N36Q 1GKHA 2K5HA 1HNZL 3JAMi 4JI4L 3GTQH 1SROA 4JI7L 1KXLA 1VQHA 2AKWB 5C0XI 4LF6Q 1I50H 2K50A 4QJFA 4DKAC 2IY5B 2B29A 2Q2HA 1I94L 1UWVA 1PH1A 4GLAC 2Q2IA 2WB1G 4XTCS 2R7ZH 2UXCQ 1GD7A 3RR5A 1YJNA 1PH9A 3PUXA 3I4NH 3J7A5 3JC66 1C7YA 1X54A 2IHFA 2K5VA 2VUMG 4QY7A 2N8NA 4JCVE 2HHHQ 3CPFA 5ELNA 4JI2Q 3AYHB 1UE7A 2UU9L 1OXVA 3RLNA 1J6QA 2AWNA 1YEZA 1X56A 4LF5Q 1GO3E 1EUJA 2VQFL 3CCRA 3PO3G 4MNOA 4C2MH 2OQ0A 1N9WA 4HIMA 1XPUA 2OCEA 3H3VI 4BA1I 4HIOA 1QVCA 4JI8Q 3UE1A 3PSIA 3KJPA 3H0GH 1VCIA 4JI1L 3SGIA 3MEFA 4EQ5A 4DV4Q 4Y52H 1AE3A 4J15A 3HKZE 4A3EG 1E7ZA 1ASZA 1S72A 4X64Q 2IX0A 4A3BH 2LXJA 2VL6A 2IX1A 3TQYA 3DLLA 2XTIA 3HOYH 4YHHL 3S17H 5LMNQ 2E2IH 1KQSA 2ASBA 1E24A 1YZ6A 1PHJA 4IPCA 4LFCQ 4LUOA 4OX9Q 4FDBA 5HY6A 5IT9c 2A8VA 3U58A 2KCMA 4DR1L 1HR0Q 4L5RC 3M3YH 2NVTH 3G4SA 2ALYB 4UY8C 2Y0SE 2ZJQA 1OXUA 4OO1G 3STBC 4LF4Q 1CUKA 5C4XH 2EXDA 4BBSH 3A5ZB 3H0GG 4P75A 4A4IA 1HNXQ 4DR7L 1Y1VG 3GTJH 1E1OA 1SMXA 5C44H 2JE6I 4A3CH 4Y7NH 5M5XH 4C3HH 2RHSB 3NENA 1PVOA 1PV4A 4DK6C 1Z47A 4LFCL 4A93H 4JYAL 3AFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMO Q;  5C0X J;  2JA8 H;  2N78 A;  1VQE A;  2YU9 H;  1VQP A;  1VQ5 A;  1CSQ A;  4DR3 Q;  1Q86 C;  1M90 C;  3S1M H;  2ES2 A;  3GTL H;  3K8A A;  1PH2 A;  5BR8 Q;  5M3M G;  4APV A;  1CKO A;  1K0R A;  4GS3 A;  1JB7 A;  3PF5 A;  1LUZ A;  1IXR A;  2UXB Q;  5M5W H;  1Q81 C;  5JJI A;  4HJ9 A;  4YCV A;  1BBW A;  1OXS C;  2JA9 A;  4UP8 A;  1KRS A;  2IT1 A;  4KLK A;  1KIX A;  1VQ8 A;  1IBK Q;  4YY3 Q;  5C4X G;  1AH9 A;  2RCN A;  4KHZ A;  3CW2 C;  3RNU A;  3S2D H;  3PIP A;  2ZJR A;  4HJA A;  3D0F A;  3J80 c;  1UE6 A;  2R7D A;  2V1C C;  4JBW A;  3T1Y L;  2HHH L;  4B3M Q;  1XNQ L;  1M1K C;  4LF7 L;  3CAM A;  1KRT A;  2VNU D;  1PH7 A;  4LF8 Q;  4DPG A;  4TQU S;  3S1N H;  5JJL A;  1QUQ A;  4DV5 L;  2QGQ A;  5IE8 A;  3H15 A;  1Q7Y C;  2ZTE A;  3HOX H;  3KOJ A;  5FLX c;  2D0P A;  4R1J A;  3LGJ A;  2F4V L;  1E1T A;  3AFP A;  1K83 H;  1HNZ Q;  4JI4 Q;  4OWX B;  1V43 A;  1T9H A;  1IBM L;  1YBY A;  1XTD A;  1E3P A;  4DV0 L;  3HOU H;  4DV6 Q;  3HOW H;  3T1H Q;  3CQZ H;  3HKS A;  4KHP Q;  1R9T H;  3PUV A;  2JA7 H;  4P71 A;  4X65 L;  3BZC A;  4DUY L;  2OWO A;  2UUB Q;  4MTN A;  5IYC H;  1NMG A;  4DR2 L;  1CKM A;  4RMF A;  4JI3 L;  1OTC A;  3K81 C;  1EIY B;  4NXM Q;  1XNQ Q;  3ULL A;  1C9O A;  1PFS A;  1HR0 W;  4IJH A;  2E8G A;  4PZ7 A;  1ASY A;  4UP7 A;  3TRZ A;  4JI0 L;  4NXN L;  3J81 c;  1XNR L;  2A1A A;  3NEM A;  5EAY A;  1BBU A;  1SE8 A;  4DV2 Q;  1LTL A;  1YI2 A;  3EN2 A;  1NTG A;  2KHI A;  4LWC A;  2UUC Q;  5BR8 L;  4X62 L;  3CC7 A;  2CQO A;  4A3J G;  1WCM H;  2CWP A;  2UXB L;  4K0K Q;  2B3G A;  1QVF A;  1X55 A;  1B70 B;  5J3B A;  4AYB G;  4BY1 G;  1XMO L;  4C3I H;  5LMU Q;  5GQO A;  4LFB L;  1AE2 A;  2WAQ E;  4JI5 L;  3GO5 A;  2C35 B;  1VQD A;  3U4V A;  4HJ5 A;  1Y1W H;  4A3L H;  4DV3 L;  2R93 G;  3TRE A;  2JA5 G;  3ULP A;  4DUZ Q;  4PZ8 A;  4DR7 Q;  1XMQ Q;  3CCL A;  2JK8 A;  4OON A;  1UEB A;  4BBS G;  1WI5 A;  1S3O A;  3U50 C;  2WB1 E;  2NZO A;  5IYD G;  5GAG C;  3AQQ A;  3STB D;  1JE5 A;  5IY0 A;  4LF4 L;  1HR0 L;  1JJC B;  2Z0S A;  3KF6 A;  1Q1E A;  4GOP C;  4A3E H;  1HZB A;  3KDF A;  2Y0S G;  4DUZ L;  2JQO A;  4A93 G;  1J5E Q;  4DV1 L;  3F2B A;  3B6Y A;  3KFU A;  1X9N A;  3RLF A;  1QZH A;  3K7A H;  1KHI A;  3OYY A;  4LF9 L;  2VY3 A;  4BBR G;  1EYG A;  4YHH Q;  4UPA A;  5M3F H;  4BBR H;  1PH4 A;  1VQB A;  4OX9 L;  1VQ9 A;  5LMN W;  4DV7 L;  4YWM A;  2UXD L;  1X6O A;  1SRU A;  4JBM A;  5M5Y H;  2R92 G;  4JOI C;  3CCM A;  2VS1 A;  3RN5 A;  1VQ7 A;  1HH2 P;  4HJ7 A;  4DV4 L;  4A3K H;  1N8R C;  3HOW G;  2PQA B;  1D8L A;  2BH8 A;  2NZH A;  4X62 Q;  4DV1 Q;  4A3K G;  4POG A;  4JI6 Q;  4IFD G;  1EIF A;  2LSS A;  4JI8 L;  3GTG H;  2D0O A;  2Q2T A;  3RZO H;  1PYS B;  4NXN Q;  2OTL A;  3PF4 A;  3S2H H;  1GVP A;  1HZA A;  2AMC B;  2VW9 A;  2UU9 Q;  1TWA H;  4IOA A;  1L1O B;  4A3G G;  1X65 A;  3UDX A;  3G71 A;  3F2C A;  1W3S A;  5FJ8 G;  2VQF Q;  4BY7 H;  1H95 A;  4LF5 L;  4BY7 G;  2UUB L;  1Q82 C;  2PQA A;  4IO9 A;  3HKZ G;  4GNX A;  1NJI C;  4A3M G;  5E7N A;  1O7I A;  3U4Z A;  2Z6K A;  4LUV A;  2DUD A;  3ULJ A;  4BY1 H;  5GRO A;  2WP8 J;  5LMU L;  3TEH B;  2I5H A;  3CCE A;  3S1R H;  3G48 A;  4LFA L;  3HOU G;  4QGU A;  4GN3 B;  4AIM A;  4EX5 A;  1PH8 A;  1PH5 A;  4JI7 Q;  1K3R A;  4R4T A;  3RLO A;  3GTM H;  5K36 G;  1QUQ B;  2R93 H;  4C3J H;  3KDF B;  4BXX G;  2BH2 A;  4BXX H;  1LM0 A;  2WAQ G;  1L1O C;  2BA1 A;  1KD1 C;  2Q2U A;  2R7Z G;  2VUM H;  1G51 A;  3T1Y Q;  4B3M L;  2JEA I;  2Z6K C;  3RN2 A;  4LW1 A;  4X66 Q;  1WJJ A;  2UXC L;  2OTJ A;  4IFD I;  1IYJ B;  5IYD H;  2R7F A;  3EIV A;  1RIP A;  3UDF A;  4X66 L;  1PA6 A;  4YCW A;  5IP9 G;  2UUA Q;  1N33 L;  3S16 H;  5DLQ E;  1QVG A;  4NXM L;  2WFW A;  1A63 A;  1MKH A;  5C3E H;  1BVS A;  4A3J H;  2OQK A;  2F52 A;  4A75 A;  1HNW L;  3KJO A;  2I0Q A;  4ALP A;  3KLW A;  1G29 1;  1NE3 A;  1NBW A;  3PO2 H;  3PO2 G;  5M3F G;  1VQ6 A;  4QQB X;  4A3B G;  4DV7 Q;  3CME A;  4DR3 L;  4JV5 L;  1SLJ A;  5JEA J;  2F4V Q;  2NN6 G;  4JOI A;  3J80 i;  3HOY G;  3I4N G;  4DR6 L;  2GN5 A;  2VZA A;  1Y1W G;  2A19 A;  1A62 A;  1Q12 A;  3CCS A;  3CCU A;  1KC8 C;  2HQL A;  4P72 A;  4YY3 L;  3E9H A;  4JBJ A;  2JA7 G;  1EWI A;  2PMZ E;  4GNX B;  3HOZ H;  3KF6 B;  3PIO A;  3J7Z C;  1VQM A;  4GKJ Q;  2VQE Q;  1VQL A;  4DR4 Q;  3UDG A;  4GKJ L;  4JG2 A;  4X6A H;  4RG1 A;  2B63 H;  4QIW E;  1IBL Q;  3PCO B;  2B63 G;  3HOV H;  1VQJ A;  3PV0 A;  3HOV G;  4TVA B;  1U0L A;  5C3E G;  5C0X G;  2F3I A;  3M4O H;  3L0O A;  3E9I A;  4B3T L;  3I55 A;  4JI6 L;  2RHQ B;  1WYD A;  1HJP A;  4DR5 L;  3W1B A;  1X3G A;  5C44 G;  4OWT B;  3CXC A;  3K7U C;  4B3S L;  1CSP A;  3IRB A;  4P74 A;  3H3V H;  4LFB Q;  4DNI A;  5C4J H;  3PGZ A;  4JV5 Q;  3WWV A;  1MJC A;  1L0W A;  4L5Q A;  4LUZ A;  1WFQ A;  1SN8 A;  3E0E A;  3L2P A;  2R6G A;  1OXT A;  3ERS X;  5HGQ A;  2AHO B;  3J81 j;  1W2B A;  3M7N A;  3F8T A;  1BKB A;  4HIK A;  5GAH C;  2K52 A;  4NB3 A;  1HZC A;  1E22 A;  2YYZ A;  3FHW A;  4R4I A;  1K73 C;  4B3S Q;  1GM5 A;  1VQN A;  4OO1 I;  1N34 L;  1WOC A;  2I5M X;  2JA5 H;  1Y14 B;  3KF8 B;  4HID A;  3FP9 A;  2YTX A;  5AJ3 Q;  4JI1 Q;  3ICE A;  4IFD J;  1L1O A;  1X3E A;  1QZG A;  1VQG A;  1P16 A;  2ZTD A;  3K80 C;  1HNX L;  4NPS A;  1VQA A;  4GLV B;  3PO3 H;  5IP9 H;  3S1Q H;  4R4C A;  4IPH A;  1YHQ A;  2KEN A;  4ME3 A;  4YCU A;  2N3S A;  3I4O A;  4X65 Q;  1K8A C;  2ZTC A;  1YHA A;  1UE5 A;  1VQI A;  4JC0 A;  4A3F G;  3CCJ A;  3CC2 A;  2KHJ A;  1EQQ A;  5ELO A;  1JJ2 A;  4DV6 L;  2HIX A;  1Z9F A;  3PUY A;  4DV0 Q;  4LFA Q;  1NY4 A;  1JMC A;  4AYB E;  1X3F A;  1VS0 A;  1Q46 A;  3PUW A;  2N49 A;  3EBE A;  1A8V A;  3HOX G;  4R4O A;  2CFM A;  3MXN B;  2JA6 G;  1I6H H;  5M3M H;  2ZM6 Q;  2JA6 H;  4A3L G;  4XIG S;  1TXY A;  2KBN A;  1IZ6 A;  2PI2 A;  1K8G A;  3RZD H;  3CC4 A;  2YTV A;  4LF8 L;  1TWG H;  4LF7 Q;  3HOZ G;  1RL2 A;  3ER0 A;  2NVQ H;  2ZJP A;  4KI0 A;  5IYB H;  2UUA L;  4DV2 L;  2H5X A;  3CF5 A;  1V1Q A;  5FLM G;  2LXK A;  4UP9 A;  5FLM H;  1XPO A;  4A3G H;  2HT1 A;  4JI3 Q;  1TWH H;  3I7F A;  2L15 A;  3A5U A;  4A3F H;  1I3Q H;  1CKN B;  3CMA A;  1TWC H;  2ID0 A;  2JJQ A;  4OXP A;  1EOV A;  4H02 A;  1FGU A;  2YV5 A;  3FKI G;  4DUY Q;  1S40 A;  4BA2 I;  2GVB A;  1FJG L;  3J81 i;  2YTY A;  4O0A A;  4R4Q A;  3T1H L;  4KHP L;  3D31 A;  4PMW A;  1I5F A;  2ZM6 L;  4MZ9 A;  2E2J H;  2UXD Q;  4GN5 A;  1WCM G;  4GLX A;  2CKZ B;  5GAD C;  2HIV A;  4GN4 B;  2NN6 I;  3F1Z A;  4YWK A;  1FL0 A;  2QEX A;  4DAY B;  2MO0 A;  3GTP H;  1G6P A;  3HFZ B;  1DGS A;  1EQR A;  3GDE A;  4PG3 A;  2NVX H;  1Q8K A;  1B7Y B;  4A3I H;  2RF4 A;  4LF6 L;  3I4M G;  2DGY A;  4A3I G;  4JYA Q;  1VQF A;  2EIF A;  1HZ9 A;  3CCV A;  4DV5 Q;  2NVY H;  1N32 L;  5IYB G;  3I56 A;  2E5L Q;  2E2H H;  1JT8 A;  3CP0 A;  3BZK A;  5IWA Q;  4IPD A;  1MJE A;  1V9P A;  1YJW A;  2MO1 A;  2XGT A;  1YNX A;  2I5L X;  1PH6 A;  4A3D H;  4O2D A;  5AJ3 L;  3S15 H;  3M9B A;  3JAM c;  3OTO L;  1XMQ L;  1EFW A;  3CD6 A;  4QL5 A;  5JEA G;  1C0A A;  3A0J A;  5IP7 G;  4DV3 Q;  4GOP B;  3I2Z A;  1N34 Q;  2PNH A;  5GAE C;  1VQ4 A;  2K4K A;  1IL2 A;  3BU2 A;  4GKK L;  1YIJ A;  4B3R L;  1SR3 A;  2BA0 A;  3W1G A;  4DAM A;  3S14 H;  3GD7 A;  3M4Q A;  1XPR A;  2GVA A;  4GNX C;  4LF9 Q;  1K9M C;  3TS0 A;  1XJV A;  3TS2 A;  3G6E A;  4PZ6 A;  1L2F A;  3OW2 A;  4B3R Q;  1J5E L;  3KYH C;  1YIT A;  2MQH A;  4GKK Q;  3ZJY C;  4B3T Q;  4JBK A;  2D62 A;  1A0I A;  2CWA A;  4AH6 A;  4DR5 Q;  1JJG A;  3NBH B;  1XNR Q;  5H1S E;  1UE1 A;  4DR4 L;  3DM3 A;  2VQE L;  1YHB A;  4POF A;  5JJK A;  1YVC A;  1SFO H;  3F2D A;  1IBL L;  4DR2 Q;  3Q8D A;  1KAW A;  2K14 A;  4L5S A;  1D7Q A;  3AEV A;  5IP7 H;  1OXX K;  1YJ9 A;  4A76 A;  3PUZ A;  4JI2 L;  5IWA L;  3FKI H;  3NEL A;  2QA4 A;  4OWW B;  1Y1V H;  2AWO A;  4WJ3 M;  4DR1 Q;  1P8L A;  1Q1B A;  1VQO A;  3UDI A;  3GTO H;  4JI5 Q;  3A74 A;  3BJU A;  4WJ4 A;  2EQS A;  2PI2 E;  1I94 Q;  1MIU A;  1VQC A;  4YWL A;  1NMF A;  2IHE A;  4DR6 Q;  2JA8 G;  5LMN L;  1B8A A;  2R92 H;  4GOP A;  4K0K L;  3L7Z C;  3UE0 A;  1N36 L;  2CCZ A;  1FVI A;  4AQY L;  1PH3 A;  3I4M H;  2FXQ A;  1KL9 A;  3M85 A;  3S24 A;  4P73 A;  2KCT A;  4X64 L;  1FJG Q;  2UUC L;  3VDY A;  2MFI A;  4IPG A;  1N33 Q;  1CKN A;  4IJL A;  1HNW Q;  5IYC G;  4JI0 Q;  4A3D G;  3CCQ A;  2MNA A;  4LNQ A;  1IBK L;  3OTO Q;  5FJ8 H;  3CPW A;  1U5K A;  1VQK A;  4L5T A;  2ATW A;  4A3M H;  2JEB I;  4DK3 C;  3GTK H;  4HJ8 A;  4IOC A;  1TWF H;  3M4P A;  1PYB A;  3W5O A;  1LYL A;  2K5N A;  2K75 A;  2E5L L;  4A3C G;  1N32 Q;  1IBM Q;  4AQY Q;  3K0X A;  1N36 Q;  1GKH A;  2K5H A;  1HNZ L;  3JAM i;  4JI4 L;  3GTQ H;  1SRO A;  4JI7 L;  1KXL A;  1VQH A;  2AKW B;  5C0X I;  4LF6 Q;  1I50 H;  2K50 A;  4QJF A;  4DKA C;  2IY5 B;  2B29 A;  2Q2H A;  1I94 L;  1UWV A;  1PH1 A;  4GLA C;  2Q2I A;  2WB1 G;  4XTC S;  2R7Z H;  2UXC Q;  1GD7 A;  3RR5 A;  1YJN A;  1PH9 A;  3PUX A;  3I4N H;  3J7A 5;  3JC6 6;  1C7Y A;  1X54 A;  2IHF A;  2K5V A;  2VUM G;  4QY7 A;  2N8N A;  4JCV E;  2HHH Q;  3CPF A;  5ELN A;  4JI2 Q;  3AYH B;  1UE7 A;  2UU9 L;  1OXV A;  3RLN A;  1J6Q A;  2AWN A;  1YEZ A;  1X56 A;  4LF5 Q;  1GO3 E;  1EUJ A;  2VQF L;  3CCR A;  3PO3 G;  4MNO A;  4C2M H;  2OQ0 A;  1N9W A;  4HIM A;  1XPU A;  2OCE A;  3H3V I;  4BA1 I;  4HIO A;  1QVC A;  4JI8 Q;  3UE1 A;  3PSI A;  3KJP A;  3H0G H;  1VCI A;  4JI1 L;  3SGI A;  3MEF A;  4EQ5 A;  4DV4 Q;  4Y52 H;  1AE3 A;  4J15 A;  3HKZ E;  4A3E G;  1E7Z A;  1ASZ A;  1S72 A;  4X64 Q;  2IX0 A;  4A3B H;  2LXJ A;  2VL6 A;  2IX1 A;  3TQY A;  3DLL A;  2XTI A;  3HOY H;  4YHH L;  3S17 H;  5LMN Q;  2E2I H;  1KQS A;  2ASB A;  1E24 A;  1YZ6 A;  1PHJ A;  4IPC A;  4LFC Q;  4LUO A;  4OX9 Q;  4FDB A;  5HY6 A;  5IT9 c;  2A8V A;  3U58 A;  2KCM A;  4DR1 L;  1HR0 Q;  4L5R C;  3M3Y H;  2NVT H;  3G4S A;  2ALY B;  4UY8 C;  2Y0S E;  2ZJQ A;  1OXU A;  4OO1 G;  3STB C;  4LF4 Q;  1CUK A;  5C4X H;  2EXD A;  4BBS H;  3A5Z B;  3H0G G;  4P75 A;  4A4I A;  1HNX Q;  4DR7 L;  1Y1V G;  3GTJ H;  1E1O A;  1SMX A;  5C44 H;  2JE6 I;  4A3C H;  4Y7N H;  5M5X H;  4C3H H;  2RHS B;  3NEN A;  1PVO A;  1PV4 A;  4DK6 C;  1Z47 A;  4LFC L;  4A93 H;  4JYA L;  3AFQ A; 
#chains in the Genus database with same CATH topology
 1EEF D;  2N78 A;  3S17 B;  4CJ1 B;  1XXG A;  1M90 C;  4G7Z C;  1HUM A;  2ES2 A;  3S1M B;  4DK1 A;  1U4M A;  5M3M G;  4APV A;  4JVZ A;  4ZKB B;  3PF5 A;  2UXB Q;  5JJI A;  3FRP B;  1VQ8 A;  1D5X C;  1IBK Q;  2OXP A;  1AH9 A;  4KHZ A;  3CW2 C;  4A3K B;  3D0F A;  2OEO A;  2R7D A;  3T1Y L;  3PMF A;  3CAM A;  1KRT A;  1PH7 A;  5JJL A;  1T5X D;  3S1N H;  1QUQ A;  4G7O C;  1R4Q B;  5FLX c;  2D0P A;  2KCC A;  4R1J A;  2D2C C;  2IJ0 A;  1HNZ Q;  4OWX B;  1II3 A;  2TMP A;  3TP6 A;  3D4W A;  4DV0 L;  3HOU H;  5IIF A;  3HKS A;  4KHP Q;  5FOB B;  2DNE A;  2OWO A;  2UUB Q;  3DXJ C;  5D3D A;  5IYC H;  1NMG A;  5HGT A;  3K81 C;  3ULL A;  3M4O B;  1HR0 W;  4CBV A;  3OW7 A;  2E8G A;  4PZ7 A;  4UP7 A;  1V1P B;  5EAY A;  1BBU A;  4DV2 Q;  4RHS A;  2EYJ A;  2UUC Q;  1NSN S;  2NVY B;  1QCB D;  1E2V A;  3FMC A;  4KJN A;  3P20 A;  4K0K Q;  2B3G A;  5M5W B;  2DJF C;  4C3I G;  5I4D A;  1M4V A;  5LMU Q;  4QMG A;  2RSN A;  4KK7 A;  2QCP X;  3ULP A;  4OIK A;  1SNM A;  2NYZ D;  1XMQ Q;  1TS2 A;  2JK8 A;  4C3H B;  1BBX C;  1SYF A;  2WB1 E;  3I70 A;  2F0Q A;  4EQP A;  1O80 A;  1JJC B;  3KF6 A;  5C4X B;  1Q1E A;  3QOL A;  1O7L A;  1HZB A;  4A93 G;  1PRT D;  4TKO B;  3RLF A;  1QZH A;  3OYY A;  4BBR G;  4J8Q A;  3EFX D;  1VQ9 A;  5LMN W;  3AB9 A;  2UXD L;  2F4I A;  4IUQ A;  4ODG A;  1EL0 A;  4A3K H;  1N8R C;  2PQA B;  2NZH A;  4RGN A;  1YNN C;  2VB3 X;  4NMZ A;  3GTG H;  4JI8 L;  2B2Y C;  5ELE A;  2IPK D;  2DY7 A;  1A3T A;  1PYW D;  1GVP A;  2VW9 A;  1H9K A;  4IOA A;  3NWT A;  1L1O B;  3UDX A;  2L55 A;  5FJ8 G;  4BY7 G;  2LFN A;  1EY5 A;  1IKM A;  2MUY A;  2B39 A;  5E7N A;  2Z6K A;  4C1N I;  1B44 D;  4X3T A;  2KVM A;  3TEH B;  2K32 A;  2KCN A;  3HOU G;  1EIH A;  4JI7 Q;  3DWP A;  3GTM H;  3RLO A;  1QUQ B;  4C3J H;  1D6E C;  1LM0 A;  5T1G A;  2Q2U A;  2VUM H;  4A3E B;  1JR0 D;  2Z6K C;  3ERO A;  3R2I A;  2CQA A;  2NVT B;  1G8Z D;  1PTO B;  1IYJ B;  3OHX C;  5IYD H;  4UDU C;  2UUA Q;  4NXM L;  4Q5V A;  1BVS A;  1HNW L;  2K03 A;  2I0Q A;  2B2V C;  3PO2 H;  1NBW A;  4RHR A;  1DM0 B;  3CME A;  2Q8T A;  3I72 A;  3C1F A;  2NN6 G;  4DFA A;  1Y8O B;  1OO9 B;  3DEP A;  3FKI B;  3OWF A;  3CCS A;  4YIJ A;  4P72 A;  1EWI A;  1LLR D;  2ICI A;  1EY6 A;  3KK7 A;  3KF6 B;  3PIO A;  1F9P A;  4ME5 A;  1EU3 A;  3IAY A;  1ZXT A;  1BQQ T;  4GKJ L;  4JG2 A;  2F0T A;  3D4D A;  3HOV H;  2B63 G;  1VQJ A;  3MFG A;  4TVA B;  2EE1 A;  3E9I A;  3EQL C;  3I55 A;  5BN4 A;  3IRB A;  4LFB Q;  3WWV A;  3RUZ A;  3L2P A;  3J81 j;  2AHO B;  4HIK A;  5GAH C;  2JA6 B;  4R4I A;  4IAL A;  3SEB A;  1N34 L;  2I5M X;  4RCN A;  3A7A B;  4HID A;  1STY A;  4FP5 D;  1Z6H A;  3QIA A;  2EJF C;  1IW7 C;  2WIN B;  2RSO A;  3H3V C;  1X3E A;  3FVQ A;  3M7G A;  4NPS A;  2PZT A;  4GLV B;  3NHH A;  1BXT A;  1YHQ A;  1MD2 D;  1K8A C;  4A3F G;  2A68 D;  3CCJ A;  5L37 A;  2KHJ A;  1EQQ A;  1Z9F A;  4K14 A;  5EGT A;  1NY4 A;  1ENF A;  5IT9 L;  3K57 A;  4AYB E;  2B8F A;  2N49 A;  4HTH A;  2F0U A;  2G9D A;  2JA6 G;  1F9R A;  1KTK A;  2NVX B;  4A3L G;  4XIG S;  2PI2 A;  1L0X B;  2K05 A;  4OHJ A;  2ZXR A;  3RZD H;  4LF8 L;  4LK1 C;  5C3E B;  1R4P B;  3ER0 A;  4KI0 A;  2H5X A;  3CF5 A;  3GTJ B;  1JOK A;  3CU7 A;  1SYE A;  2SEB D;  1LV9 A;  4JPB W;  2PMZ B;  5CMD A;  5IGB A;  4A3G H;  1FD7 D;  2HCI A;  2L15 A;  3A5U A;  1EYD A;  1CKN B;  1TWC H;  3KF8 A;  4BA2 I;  1FGU A;  2YV5 A;  3J81 i;  4KHP L;  4R4Q A;  2KEE A;  1ET6 A;  2QF7 A;  2MHV A;  4P2C B;  3IKJ A;  2O4X A;  3F1Z A;  2QEX A;  1FL0 A;  4FYD A;  3O13 A;  1G6P A;  1U4P A;  1EQR A;  5M9O A;  4JYA Q;  4A3I G;  2EIF A;  1SYC A;  1N32 L;  5IYB G;  4FF2 A;  3BZK A;  2EYP A;  1CHQ D;  1TWA B;  2DN8 A;  2L9H A;  3S2H B;  4K5V A;  3L3O C;  4A3D H;  1PH6 A;  1DOM A;  3KLS A;  4CGY B;  3S15 H;  1XMQ L;  4K5W A;  3NUC A;  5JEA G;  2JA7 B;  1LT5 D;  1VQ4 A;  3BU2 A;  1YIJ A;  3D4R A;  5C3W A;  4B3R L;  2VB2 X;  5I9P A;  4DAM A;  1PRT F;  2PW5 A;  1XPR A;  3TS0 A;  4IZ8 A;  5C3X A;  3VYU A;  4PZ6 A;  2MQH A;  5IGE A;  4JBK A;  2NZ1 D;  1V8Q A;  3SDZ A;  1E0B A;  1SMY D;  3D6C A;  4AH6 A;  4DR5 Q;  1WVL A;  4L8J A;  5H1S E;  3WOE A;  4TSS A;  4DR4 L;  1SSO A;  3E0J A;  1JIC A;  1YVC A;  4ZKC B;  4ULL A;  1IBL L;  4DR2 Q;  4L5S A;  1D7Q A;  1JWM D;  3AEV A;  4A76 A;  3PUZ A;  5DM6 3;  2AWO A;  1HQM C;  5DEH A;  5M3M B;  1P8L A;  3NWS A;  3MTS A;  1WD0 A;  2EQS A;  1SAP A;  2G5D A;  2PI2 E;  1I94 Q;  2NBF A;  1LTT D;  3VR2 A;  3K5L A;  2JA8 G;  5LMN L;  1B8A A;  2R92 H;  4K0K L;  5I2X A;  4AQY L;  2FXQ A;  4R8N A;  3S24 A;  5JVH 3;  2E2J B;  2KCT A;  4X64 L;  4H0L C;  1CKN A;  1HNW Q;  1VF7 A;  3BVG A;  4BBS B;  1KLG D;  4A3D G;  1FNU A;  2RA4 A;  5C5M A;  4C56 C;  2C5C A;  1Z7T A;  3QG1 A;  4DK3 C;  3GTK H;  4HJ8 A;  1TWF H;  1LYL A;  1IBM Q;  4AQY Q;  1B53 A;  1BCP B;  1VQH A;  2AKW B;  3T13 A;  4DKA C;  1G2T A;  1PH1 A;  3VR6 A;  3PQI A;  2WB1 G;  1GD7 A;  3RR5 A;  1YJN A;  1QNK A;  2MGS A;  3GV6 A;  3J7A 5;  3JC6 6;  1X54 A;  3MVV A;  2SNM A;  4QY7 A;  3ND8 A;  5ELN A;  3MXU A;  1BR9 A;  3ZYY X;  1I4P A;  1X56 A;  4LF5 Q;  2H4O A;  4MNO A;  4HIM A;  4QCL A;  1NUC A;  2OCE A;  1GUT A;  1QVC A;  4JI8 Q;  1HHV A;  4RGO S;  3SGI A;  5M5Y B;  4Y52 H;  3VYT A;  4A3E G;  3I73 A;  3K6O A;  3TP7 A;  4A3B H;  2IX1 A;  2YU9 B;  2K7V A;  3TQY A;  3SHL A;  1WTP A;  4FXD A;  4IPC A;  3U58 A;  1MSH A;  1HR0 Q;  4CHT B;  3G4S A;  2ALY B;  2K28 A;  1H9S A;  1OXU A;  2PYK A;  1NAP A;  2EXD A;  4BBS H;  4J1M A;  1HNX Q;  4DR7 L;  4CKC A;  3N6R A;  1EOT A;  1WTX A;  4EQO A;  1KDB A;  3WOF A;  2SDF A;  1IKL A;  4DK6 C;  1ZYR C;  1Z47 A;  5IGG A;  2O5J C;  1FYC A;  1XMO Q;  2JA8 H;  4DGZ A;  3NTK A;  3D3R A;  4XDX A;  1Q86 C;  1SXT A;  3K8A A;  2LMC B;  1PH2 A;  1A6X A;  4F7X A;  1K0R A;  1Y1V B;  1LO5 D;  4GS3 A;  1LUZ A;  4HSP A;  1Q81 C;  3H0G B;  1WTQ A;  4A93 B;  1BBW A;  1KRS A;  2IT1 A;  4IUP A;  2F0M A;  4QB4 A;  3RNU A;  5CV6 A;  3S2D H;  1XTC D;  1K28 A;  3PIP A;  5IOD A;  1UE6 A;  3J80 c;  3HOW B;  1ROD A;  4JBW A;  2HHH L;  1M1K C;  1Y8N B;  2QDB A;  4LF8 Q;  2ENB A;  2F0L A;  2ZXO A;  5IE8 A;  3H15 A;  1Q7Y C;  2ZTE A;  1I50 B;  3K7A B;  3MAQ A;  3LGJ A;  3MEH A;  2F4V L;  5FLX E;  1E1T A;  1K83 H;  1T5E A;  4JI4 Q;  2PO4 A;  1K83 B;  3EA6 A;  1E3P A;  2BOS A;  3HOW H;  3T1H Q;  3OIQ A;  3CQZ H;  2IX3 A;  3SK8 A;  3PUV A;  4P71 A;  1O7Z A;  3BZC A;  3I8Z A;  4CJ2 C;  4DUY L;  3HGB A;  1CKM A;  5FO7 B;  1OTC A;  1EIY B;  2B2V A;  2XSC A;  3VR5 A;  1XNQ Q;  1IYV A;  2TSS A;  3NBI A;  3V96 A;  1MBY A;  4HR7 B;  3NXW A;  4IJH A;  4MHE A;  1ASY A;  3TRZ A;  4JI0 L;  2A1A A;  3NEM A;  1SE8 A;  5C0X H;  4RFB A;  4LWC A;  1M8A A;  3GTG B;  2LS0 1;  2G9H D;  1RKN A;  4MIU A;  4A3J G;  1JB3 A;  2CWP A;  5CR3 A;  5KNC A;  4NP5 A;  1X55 A;  5J3B A;  4AYB G;  2A74 C;  1QB5 D;  4C3I H;  5GQO A;  1F9S A;  3NSW A;  4LFB L;  3DM1 A;  2WAQ E;  3VA5 A;  2C35 B;  4ZYS A;  1TWC B;  3OWE B;  4IUV A;  4XYQ A;  5E4X A;  3TRE A;  4IUR A;  4KJO A;  3CCL A;  4OON A;  4BBS G;  1TII D;  1D5M C;  2B2U C;  1ML0 D;  2WKD A;  1JE5 A;  5IY0 A;  4LF4 L;  1HR0 L;  2Z0S A;  1LTR D;  3KUP A;  1B3A A;  5D3I B;  1TWG B;  4GOP C;  1A3U A;  3ONA B;  2JQO A;  1J5E Q;  5I6W A;  3SE0 A;  4LF9 L;  5A2Q E;  5BN3 A;  4YHH Q;  4BBR H;  1PMR A;  1STA A;  4OGQ C;  4YWM A;  4V0B A;  4JBM A;  3SXH A;  4G7H C;  5EKI A;  2F3W A;  4JOI C;  3CCM A;  4K2K A;  4A3K G;  1D8L A;  1LTB D;  3E5S A;  3OMC A;  2DY8 A;  4HMJ A;  4KKS A;  2Q2T A;  4DF7 A;  3RZO H;  3I3C A;  3SR1 A;  4NXN Q;  3T56 B;  3NTI A;  5A35 A;  2D5D A;  1IW7 D;  4LF5 L;  1SFO B;  1PTO F;  2UUB L;  2RCF A;  4IO9 A;  4C2M B;  4GNX A;  4A3M G;  1EY0 A;  4LUV A;  1BCP C;  3ULJ A;  1AZP A;  2A68 C;  2EY6 A;  1WTV A;  2B8G A;  5GRO A;  5FKA C;  3CCE A;  4QGU A;  1PZI D;  4GN3 B;  1YNJ D;  4EX5 A;  3K5O A;  1PH8 A;  4R4T A;  5K36 G;  1BCP F;  3NQT A;  4BXX G;  2F0G A;  1YNJ C;  3S1N B;  2BA1 A;  2KEC A;  2F0O A;  4FF4 A;  4B3M L;  4LW1 A;  2UXC L;  2SOB A;  4ZCK A;  2R7F A;  3UDF A;  3VYR A;  1QVG A;  1A63 A;  4A3J H;  2OQK A;  2M00 A;  4A75 A;  5CYU A;  1BO0 A;  4ALP A;  3KLW A;  1A3V A;  2F0W A;  1DZ1 A;  3PO2 G;  4DV7 Q;  4DR3 L;  4JV5 L;  1SLJ A;  5J1Z A;  3HOY G;  3J80 i;  3I4N G;  4DR6 L;  1Q12 A;  1JC7 A;  3QO2 A;  1VQM A;  2VQE Q;  4RGM A;  4DR4 Q;  1HA5 A;  1I4R A;  1IBL Q;  1MSG A;  3NTH A;  3HOV G;  2VUM B;  1U0L A;  3L0O A;  1GHJ A;  1HJP A;  4DR5 L;  2K5W A;  3W1B A;  2FFK B;  2EPB A;  1X3G A;  5C44 G;  2HCC A;  4B3S L;  2A73 B;  2K01 A;  1CSP A;  2O5I C;  1CQV A;  2L4N A;  3H3V H;  1C4Q A;  4LUZ A;  1QWY A;  3E0E A;  3RZD B;  5HGQ A;  4WJW A;  1DCZ A;  2WV6 D;  3U9S A;  3TP8 A;  4DNR B;  2HQE A;  1E22 A;  3HOX B;  4B3S Q;  1GM5 A;  2O2L D;  1WOC A;  3LWU A;  4KV6 A;  3QR8 A;  1JCK B;  2NTT A;  3KF8 B;  3FP9 A;  1JE4 A;  1YNN D;  4JI1 Q;  2KQ3 A;  3ICE A;  1L1O A;  2A6H C;  1QZG A;  1P16 A;  2ZTD A;  2A69 D;  3PO3 H;  3S1Q H;  2M9V A;  2B2T C;  5G3L D;  4YCU A;  4X65 Q;  4JC0 A;  1YHA A;  1JJ2 A;  2HIX A;  3PUY A;  1SNC A;  4LFA Q;  2PZU A;  3TN2 A;  1CM9 A;  2EXZ A;  1Q46 A;  1F2Y A;  3PUW A;  3EBE A;  4NW2 A;  4BBR B;  4R4O A;  1RHP A;  1HQR D;  3MXN B;  2JA6 H;  1IYU A;  1SND A;  1IZ6 A;  4EVO A;  3CC4 A;  3D8G A;  4HMI A;  5DNF A;  1TWG H;  3BVM A;  3IFT A;  3GP7 A;  5ISR A;  3HOZ G;  1VF5 C;  2NVQ H;  5IYB H;  4WFN 3;  3MFY A;  5FLM G;  2HT1 A;  2MPM A;  1SE3 A;  3I7F A;  1U9R A;  2F0P A;  1I3Q H;  1X32 A;  2JJQ A;  4H02 A;  5AFW A;  1FJG L;  1I5F A;  5CV9 A;  4MZ9 A;  2E2J H;  4C3I B;  4KHV A;  2F0J A;  5GAD C;  2HIV A;  1DJR D;  2NN6 I;  4GN4 B;  4YWK A;  4DAY B;  2E2I B;  4LF6 L;  2NVX H;  3I4M G;  1B7Y B;  1A15 A;  1G6Z A;  1PRT B;  2DGY A;  1VQF A;  4C3J G;  1HZ9 A;  3BG3 A;  3S1Q B;  1HTL D;  3I56 A;  2E5L Q;  1LAC A;  1SNQ A;  4C1N K;  3FPP A;  4F8M A;  3CP0 A;  1WTR A;  4OEL B;  3NK9 A;  4O2D A;  2L0C A;  1I4X A;  3OTO L;  3CD6 A;  1EFW A;  2XNA C;  3S16 B;  2F0K A;  1RTO A;  2C9O A;  1C0A A;  2F1M A;  5C5L A;  4DV3 Q;  4K8J A;  2A5H A;  4H44 C;  1IL2 A;  4GKK L;  2EJG C;  3G6J B;  1SR3 A;  2QDL A;  5EPK A;  3W1G A;  2SNS A;  3S14 H;  3M4Q A;  3TDQ A;  2MP1 A;  4KD4 A;  4CDD C;  3TS2 A;  3KYH C;  4GKK Q;  2LKV A;  5EKK A;  3ZJY C;  5NUC A;  4KTA A;  1A0I A;  1TU2 B;  4E6I A;  2K5Q A;  1UE1 A;  1PDQ A;  3HKZ B;  3ITP A;  4XT3 B;  5JOB A;  1YHB A;  3S15 B;  4ZUI A;  1U4R A;  5IP7 H;  1OXX K;  2HUG A;  3K5N A;  1LT3 D;  4HN7 A;  3NEL A;  1Y1V H;  1VQO A;  2RVL A;  3UDI A;  4JI5 Q;  3A74 A;  4N9P A;  1SYD A;  1VQC A;  4YWL A;  1B3Q A;  2IHE A;  3GTP B;  4GOP A;  1FVI A;  3V05 A;  1FJG Q;  3W3A A;  3VDY A;  4XXE A;  4IPG A;  3A8I E;  1Q90 A;  3NBH A;  1KDA A;  2F0N A;  1GUG A;  1EYA A;  2MNA A;  3CCQ A;  4LNQ A;  3NP8 A;  1IBK L;  3HRZ C;  5K5P A;  3CPW A;  4GZY C;  1D1I A;  2ATW A;  3CQZ B;  1TS3 A;  4H7B A;  3M4P A;  1STG A;  5EJW A;  3W5O A;  2K5N A;  4A3C G;  2E5L L;  3OSO A;  1SRO A;  2Z9H A;  2ZXP A;  5C0X I;  2IY5 B;  1I6H B;  1I50 H;  4QJF A;  2L5T A;  1L0Y B;  3S14 B;  1DOL A;  2Q2I A;  3GQB A;  2NN6 H;  1PH9 A;  1EY7 A;  2IHF A;  2K5V A;  1JOR A;  2N8N A;  1B9N A;  4JI2 Q;  5A2Q L;  5CV4 A;  1OXV A;  1J6Q A;  2F0E A;  3R8B A;  1IHZ A;  1KAB A;  4C2M H;  1CA6 A;  1N9W A;  3H3V I;  1AW7 A;  2KOL A;  5ELF A;  3KJP A;  4JI1 L;  4EGV A;  3MEF A;  1CTM A;  1Q3L A;  1S72 A;  2NWG A;  2V4D A;  2F0V A;  4F88 A;  3ERQ A;  2VL6 A;  3P75 A;  4M8A A;  4YHH L;  3TZD A;  3J80 L;  2E2I H;  3DWA A;  1I4H A;  4A3J B;  4LFC Q;  1S5C D;  1AP0 A;  1TS5 A;  3J7Y W;  3CRL C;  4FDB A;  5C4J B;  2KCM A;  4DR1 L;  4L5R C;  2Y0S E;  2ZJQ A;  1FNW A;  1SE4 A;  3K5M A;  2CH4 W;  2A6H D;  4A3G B;  3A5Z B;  3H0G G;  4KN7 C;  1Y1V G;  2AQ1 B;  4OL7 A;  1ESR A;  3GTJ H;  1E1O A;  1DD2 A;  2JE6 I;  2BE5 D;  4A3C H;  4O42 A;  4C3H H;  1K0S A;  4K6D A;  3DEO A;  4R9W A;  3J7A F;  4LFC L;  4YY3 Q;  3C46 A;  1A2U A;  3AFQ A;  5C0X J;  1TKW B;  4TRD A;  2CVR A;  4DAY A;  2YU9 H;  1VQP A;  4XQJ A;  4K8I A;  3FDT A;  3S1M H;  3GTL H;  2VXW A;  4G57 A;  1CKO A;  2AQ2 B;  3NPP A;  3L9A X;  4HJ9 A;  4YCV A;  2JA9 A;  1OXS C;  1KIX A;  2R7Z H;  3RZO B;  4KLK A;  5C4X G;  1BNZ A;  2EY2 A;  4QUF A;  1PTO H;  2ICE C;  1KNE A;  2V1C C;  4K2L A;  3K0Y A;  3SK6 A;  5IOC A;  1WTO A;  1XNQ L;  4LF7 L;  4DPG A;  2QGQ A;  2L12 A;  4KY7 A;  2RKS A;  3HOX H;  3G7L A;  1IBM L;  3BS1 A;  1B2T A;  1CFM A;  3IL8 A;  1TWF B;  1ICW A;  2JA7 H;  1CK1 A;  4X65 L;  4MTN A;  3EJI A;  2HDM A;  4NXN L;  1XNR L;  4ILW A;  1ILQ A;  3EN2 A;  3S2D B;  3AMU A;  2EDG A;  2F3V A;  3T53 B;  5BR8 L;  4X62 L;  3CC7 A;  1WCM H;  4CJ0 B;  4DU9 A;  5I2Y A;  4RKL A;  5JPM C;  2E75 C;  1B70 B;  1GUO A;  1WTW A;  1WCM B;  5M5X B;  1PZK D;  1AE2 A;  1ILP A;  2JSO A;  2IW3 A;  4AYB B;  5KGU A;  4HJ5 A;  2CW0 D;  3PO2 B;  4DV3 L;  2R93 G;  2JA5 G;  4DUZ Q;  4L63 B;  1KDC A;  4PZ8 A;  4I65 A;  2KJX A;  2GA4 B;  1ONL A;  3U50 C;  3BDO A;  5IYD G;  2X6G A;  3DMU A;  1QOH A;  4A3E H;  3S9W A;  1LTS D;  4DUZ L;  3B6Y A;  1SBB B;  1F77 A;  2VY3 A;  1EYG A;  4IQZ A;  4OX9 L;  4UPA A;  5E4W C;  3NE5 B;  2XVS A;  4DV7 L;  3C2P A;  1X6O A;  1CZG A;  3T4A C;  1U4L A;  3P7J A;  5M5Y H;  2WKC A;  2R92 G;  3RN5 A;  2VS1 A;  4OO1 G;  1KLU D;  5JJZ A;  2BH8 A;  5JAV A;  4DV1 Q;  4POG A;  5FO9 B;  2LSS A;  1AN8 A;  5CV5 A;  1SDF A;  5FK9 C;  3FPU B;  2OTL A;  2AMC B;  4X3S A;  2UU9 Q;  3F2C A;  1H95 A;  2VQF Q;  1Q82 C;  3GTL B;  5CV7 A;  1NJI C;  1O7I A;  1RJT A;  3U4Z A;  1R9T B;  2EYM A;  2JP1 A;  4QUC A;  1C48 A;  1DOK A;  2DUD A;  3Q22 A;  4X3U A;  1EEI D;  1HTP A;  5LMU L;  2PCF B;  2F0D A;  4AIM A;  1PH5 A;  2FHT A;  2R93 H;  4DA2 A;  2BH2 A;  2WAC A;  1MGS A;  4KD3 A;  4BXX H;  1L1O C;  4F87 A;  1S5E D;  1G51 A;  1GUN A;  4U67 3;  3T1Y Q;  3RN2 A;  1CT1 D;  4KY5 A;  4X66 Q;  2OTJ A;  2UXC Q;  3EIV A;  1RIP A;  4YCW A;  5IP9 G;  2NVQ B;  5DLQ E;  1I6V C;  2WFW A;  2EYL A;  1MKH A;  4V19 0;  2F52 A;  2X69 A;  4RH6 A;  1PTO D;  3KJO A;  1FGB D;  1VMP A;  5EKL A;  1G29 1;  1NE3 A;  5C6A A;  2F0H A;  4QQB X;  4A3B G;  2D9U A;  5JEA J;  2F4V Q;  1EY9 A;  3I4M B;  2GN5 A;  2AUK A;  1A62 A;  3CCU A;  3J80 E;  2PMZ E;  5LHY 1;  3JAM L;  4FF1 A;  1CHP D;  3PO3 B;  4GKJ Q;  3BVZ A;  3SVM A;  1VQL A;  4S3S A;  2XWJ B;  3PV0 A;  3M4O H;  5C0X G;  5C3E G;  1UEA B;  4B3T L;  3D6W A;  5G3L F;  4FXK C;  4C3J B;  3M3Y B;  4OWT B;  3CXC A;  4M1U B;  1SNP A;  5I9O A;  2EYO A;  4DNI A;  4JV5 Q;  4L5Q A;  1SN8 A;  1W2B A;  2K52 A;  4NB3 A;  3GTK B;  1EQT A;  3FHW A;  1K73 C;  5CBA E;  4RKB A;  4DNT B;  1S5F D;  3VR3 A;  2YTX A;  5HUR A;  5AJ3 Q;  4KKT A;  3R3O A;  1VQA A;  1XWE A;  5IP9 H;  4IUT A;  4R4C A;  5JEA H;  4ME3 A;  5CC4 A;  1AZQ A;  3I4O A;  2I46 A;  5EBD A;  2ZTC A;  1VQI A;  1RCV D;  1ET9 A;  3CC2 A;  3CHB D;  1JMC A;  1A8V A;  3M4Y A;  2EYH A;  5M3M H;  2QEJ C;  1KAA A;  2RDH A;  4PV1 C;  3T16 A;  4A3F B;  4K5X A;  1NCV A;  1SYG A;  4HAE A;  3HP3 A;  4LF7 Q;  1RL2 A;  4Y7N B;  1JQY D;  2ZJP A;  2UUA L;  1H9S B;  3MC0 B;  1STB A;  1V1Q A;  2LXK A;  5FLM H;  1XPO A;  1K3B C;  4KY6 A;  3MXG A;  2CH4 A;  1ZKO A;  4RA8 A;  1EOV A;  4DUY Q;  1S40 A;  3FKI G;  1E2W A;  2GVB A;  4FNF A;  4OIJ A;  1V1O A;  3D31 A;  2KED A;  2ZM6 L;  3A8J E;  3A56 A;  4GN5 A;  2CKZ B;  5KRU A;  3U9O A;  4NKL A;  2MO0 A;  3OMG A;  3GDE A;  4PG3 A;  4PNY A;  1Q8K A;  2RF4 A;  1H9J A;  2NVY H;  4KN4 C;  3MA2 B;  2EJM A;  1MJE A;  1V9P A;  3UI2 A;  1YJW A;  3FEW X;  2XGT A;  3E3X A;  2N88 A;  2XIW A;  2K04 A;  5IP7 G;  4GOP B;  1TVX A;  3I2Z A;  2F0I A;  3HOU B;  1BOS A;  4XYO A;  2K4K A;  1EYC A;  4Z9C B;  2KHS A;  2EYF A;  4B08 A;  1QJO A;  3TZU A;  1F9Q A;  2GVA A;  2XN9 C;  4DN4 M;  4LF9 Q;  1XJV A;  1Y69 U;  3G6E A;  3OW2 A;  1L2F A;  1CZW A;  4B3R Q;  1J5E L;  1LT6 D;  4B3T Q;  1TT2 A;  2E2D C;  2EOT A;  2CWA A;  1HRJ A;  1JJG A;  2Z8L A;  3NBH B;  2B2Y A;  2PW7 A;  4A3M B;  3DM3 A;  3DHQ A;  2VQE L;  1BDO A;  5JJK A;  4HSV A;  3Q8D A;  1KAW A;  2K14 A;  1C8C A;  2I07 B;  3EVQ A;  2RBM A;  4JI2 L;  3FKI H;  2QA4 A;  4OWW B;  1CQF A;  4DR1 Q;  1Q1B A;  3GTO H;  3KLR A;  1RTN A;  4I7A A;  1NMF A;  2R92 B;  4MN3 A;  3L7Z C;  4U68 A;  4HED A;  5T1I A;  3IFD A;  2MFI A;  1N33 Q;  1F2M A;  1EFI D;  1GOZ A;  5IYC G;  4JI0 Q;  1STE A;  2HD3 A;  5FJ8 H;  3V2T A;  2IWH A;  1ENA A;  4IOC A;  3P1H A;  3S1R B;  2K75 A;  1ESF A;  1J8I A;  5CGK A;  5KIX A;  3K0X A;  1N36 Q;  1GKH A;  4LAA A;  1HNZ L;  3JAM i;  4BY1 B;  3GTQ H;  4DAV A;  4JI7 L;  1KXL A;  1Y1W B;  4LF6 Q;  3BYT B;  4PQX A;  1HFN A;  1I94 L;  1EZ8 A;  2EY1 A;  4GLA C;  1JT8 A;  4XTC S;  3RMH A;  3I4N H;  1VDZ A;  2VUM G;  3HOV B;  2KA7 A;  1B50 A;  3LNN A;  3AYH B;  3RLN A;  4IFD H;  2Q8R E;  2AWN A;  2B2W A;  1GO3 E;  4CDE C;  2JYO A;  2EZV A;  3PO3 G;  2OQ0 A;  2F03 A;  4EQN A;  4BA1 I;  3TME A;  3UE1 A;  3PSI A;  3H0G H;  1VCI A;  1AEX A;  1EZ6 A;  2IL8 A;  4EQ5 A;  5JVG 3;  4X3K A;  4J15 A;  1E7Z A;  5J39 A;  2PQE A;  3QB3 A;  1X3P A;  4XT1 B;  3DLL A;  2XTI A;  3S17 H;  4H13 C;  5LMN Q;  2ASB A;  1SYB A;  4KMU C;  1E24 A;  1YZ6 A;  4RAU C;  2F0F A;  2RDG A;  5KNB A;  5KYI A;  2FMC A;  2HDL A;  2NB0 A;  3J81 L;  2J7Z A;  2NVT H;  4ZQ3 A;  2B2W C;  5E3F A;  4UY8 C;  2QIL A;  2CW0 C;  5ELB A;  2P5Z X;  3DUZ A;  1CUK A;  1NR2 A;  1V1P A;  1FR3 A;  4LF4 Q;  4DXG A;  5C4X H;  4P75 A;  3DWQ A;  2X6L A;  4WRD A;  4A4I A;  3I91 A;  1VMC A;  2K33 A;  2ZT9 C;  1SMX A;  4DXF A;  3GTM B;  4NDX A;  3E6Z X;  1W6K A;  3HOZ B;  1D5Z C;  3NEN A;  1PVO A;  3MHB A;  2WAQ B;  1HXY D;  4LJZ C;  3BDL A;  1G91 A;  1VQE A;  5LL6 S;  2PPB C;  1VQ5 A;  1CSQ A;  4DR3 Q;  5BR8 Q;  5J22 A;  4MTK A;  4IUU A;  1JB7 A;  1IXR A;  5M5W H;  4IFD G;  4UP8 A;  2BCO A;  1BF4 A;  1QIL A;  5KEE A;  2RCN A;  3W2D A;  1A2T A;  2ZJR A;  4HJA A;  3C1E A;  4B3M Q;  2VNU D;  1NNX A;  4TQU S;  2FIN B;  4DV5 L;  4ZK9 B;  2R93 B;  2RQX A;  1HA6 A;  3KOJ A;  2A6E C;  3Q0A A;  3AFP A;  1TY2 A;  5F2D A;  2DNC A;  1HUN A;  4N9T A;  1V43 A;  1T9H A;  3H09 A;  1YBY A;  1XTD A;  3HEJ A;  3X3M A;  4DV6 Q;  3HS0 C;  1B9M A;  2FMM A;  1R9T H;  1BUV T;  4DK0 A;  3BZD B;  4B9X A;  3R93 A;  1EQV A;  4DR2 L;  3PIO 3;  4RMF A;  4JI3 L;  4L6T B;  4NXM Q;  5EBC A;  1C9O A;  1PFS A;  3BDC A;  1O7Y A;  2B63 B;  3J81 c;  4WOR A;  3QWN A;  1PFN A;  3H94 A;  1LTL A;  1YI2 A;  1NTG A;  2KHI A;  2K1B A;  5IT9 E;  1SJH D;  1WTH A;  2CQO A;  5E1F A;  2UXB L;  2Z4I A;  1QVF A;  1WD1 A;  4BY1 G;  1LT4 D;  1XMO L;  4O1N A;  3I4N B;  1SJE D;  4FXG C;  4QF4 A;  4JI5 L;  3GO5 A;  1TQO A;  1VQD A;  3U4V A;  4BS9 A;  5BN5 A;  1Y1W H;  4A3L H;  4XQN A;  1ICF B;  4DR7 Q;  4FVM A;  1UEB A;  1WI5 A;  1S3O A;  2JXM B;  5D14 A;  1GXD C;  1HFG A;  2NZO A;  3RD4 A;  1RDP D;  1ZEQ X;  3AQQ A;  5GAG C;  3STB D;  3HZX A;  1B4O A;  1RF2 D;  3KDF A;  2Y0S G;  1IL8 A;  1MI2 A;  3QOJ A;  2WB1 B;  4DV1 L;  3F2B A;  3KFU A;  1X9N A;  1STN A;  3A7L A;  3K7A H;  1KHI A;  5COR A;  5M3F H;  1PH4 A;  1VQB A;  1Y8P B;  3AU7 A;  2Z1C A;  2FJ2 A;  1SRU A;  3TSS A;  1VQ7 A;  1HH2 P;  2M2L A;  4CDF C;  3BYY B;  4DV4 L;  4JK1 C;  4HJ7 A;  3HOW G;  4OO1 H;  4X62 Q;  4JI6 Q;  1EIF A;  2XRS D;  2D0O A;  3SK4 A;  4BY7 B;  1PYS B;  4A3D B;  2K5D A;  3PF4 A;  3HG9 A;  3S2H H;  1HZA A;  4I7Z C;  1TWA H;  4A3G G;  1X65 A;  3G71 A;  1W3S A;  2KUM A;  1RD9 D;  4BY7 H;  1JWU D;  2E74 C;  2PQA A;  3HKZ G;  3Q24 A;  2QW7 A;  2JA8 B;  4BY1 H;  3MXP A;  2CHB D;  2WP8 J;  2I5H A;  3S1R H;  1BCP D;  1PFB A;  3G48 A;  4LFA L;  4UHV A;  1K3R A;  1S4Z A;  2MJ8 A;  3KDF B;  2WAQ G;  1KD1 C;  2R7Z G;  1GUS A;  1AFP A;  2JEA I;  2DJG C;  1WJJ A;  1JOO A;  4FF3 A;  1SEB D;  1SNO A;  4IFD I;  4X66 L;  1PA6 A;  1N33 L;  5IGD A;  1I4G A;  4N8X 1;  3S16 H;  1E2Z A;  1XYI A;  5C3E H;  1GJX A;  4FO2 A;  1DXM A;  5M3F G;  1VQ6 A;  3A55 A;  3KBX A;  4A3B B;  5D65 A;  4ID6 A;  1TR5 A;  1S5B D;  3A8K E;  3OOC A;  4JOI A;  2VZA A;  1Y1W G;  2A19 A;  1KC8 C;  2E76 C;  2WII B;  2L1B A;  2HQL A;  4XQQ A;  5DM7 3;  4ABN A;  4YY3 L;  1EU4 A;  3E9H A;  4JBJ A;  2JA7 G;  4GNX B;  3HOZ H;  1XX8 A;  1O78 A;  3MWY W;  3J7Z C;  3LWE A;  2J4X A;  2Z6B A;  3CKI B;  3R2T A;  3UDG A;  3NQI A;  4X6A H;  1I3Q B;  4RG1 A;  4QIW E;  2B63 H;  3PCO B;  2F3I A;  1PRT C;  3Q6S A;  4K6L A;  4JI6 L;  2B2U A;  4RCO A;  2RHQ B;  1WYD A;  4PMC A;  1DYQ A;  3K7U C;  3N52 A;  4P74 A;  1ZYR D;  5C4J H;  3PGZ A;  1MJC A;  1L0W A;  1WFQ A;  2R6G A;  1OXT A;  3ERS X;  1CA5 A;  2QKI C;  1TY0 A;  3M7N A;  3F8T A;  1BKB A;  3I90 A;  1EIG A;  3TBI B;  3GV3 A;  3J7A V;  1HZC A;  2YYZ A;  4OO1 I;  2B2T A;  3OIP A;  1VQN A;  2JA5 H;  2R3Z A;  1Y14 B;  5IGC A;  4G4K A;  5EPJ A;  5FLX L;  1B1Z A;  3C3L A;  4IFD J;  1VQG A;  3K80 C;  1HNX L;  1LTG D;  5TSS A;  4IPH A;  2KEN A;  1KNA A;  2N3S A;  2BE5 C;  1UE5 A;  4CKE A;  4ZAI A;  5ELO A;  4DV6 L;  3CRK C;  4DV0 Q;  1PZJ D;  2XWB B;  1JOQ A;  1X3F A;  1EWH A;  1VS0 A;  3HOX G;  2CFM A;  1I6H H;  2ZM6 Q;  2H1E A;  1K8G A;  1TXY A;  2KBN A;  2YTV A;  2PNR C;  1ENC A;  5C44 B;  4DV2 L;  1F2L A;  4UP9 A;  1JWS D;  5JPN C;  1TWH B;  4JI3 Q;  1TWH H;  4A3F H;  3CMA A;  2ID0 A;  4OXP A;  3X3N A;  2PZW A;  2K6A A;  2YTY A;  4O0A A;  3T1H L;  4Q0F A;  4QIW B;  1MHW C;  4PMW A;  2UXD Q;  3KLS X;  4ZUJ A;  1WCM G;  3A54 A;  4GLX A;  1H9M A;  1GUW A;  4CKB A;  3GTP H;  1S5D D;  2BDN A;  3HFZ B;  1DGS A;  1QE6 A;  4A3I H;  3HOY B;  4HCE A;  1UNS A;  2RDF A;  5IGF A;  4IUN A;  1LTA D;  5ELD A;  3CCV A;  4DV5 Q;  3K59 A;  1Q8I A;  2J0T D;  2E2H H;  3VA7 A;  4UAI A;  5IWA Q;  2N55 A;  1F2Z A;  4IPD A;  5LL6 X;  2JN4 A;  2MO1 A;  3T51 B;  1YNX A;  2I5L X;  2E2H B;  2AUJ D;  5AJ3 L;  3M9B A;  3JAM c;  1UAP A;  4QL5 A;  3SK5 A;  3J81 E;  2EY5 A;  1D2B A;  3A0J A;  1N34 Q;  2PNH A;  2XRQ D;  4IN3 A;  5GAE C;  5C4H A;  1EY8 A;  3H91 A;  2BA0 A;  5M3F B;  3GD7 A;  3H6M A;  1QG7 A;  4GNX C;  1K9M C;  5CBE E;  4DAP A;  5ELC A;  1YIT A;  1SE2 A;  1HPC A;  3VYS A;  2D62 A;  3K58 A;  1XNR Q;  4RWS C;  1K8M A;  4POF A;  1SFO H;  3F2D A;  3ND9 A;  2R7Z B;  1YJ9 A;  5IWA L;  4WJ3 M;  1D1K A;  5C4Z A;  2AQ3 B;  3BJU A;  4WJ4 A;  1LTI D;  1GHK A;  1MIU A;  2NTS A;  4HCS A;  4DR6 Q;  5COY A;  2Z4H A;  2Y0S B;  3UE0 A;  1N36 L;  2CCZ A;  1PH3 A;  3I4M H;  1KL9 A;  3M85 A;  4P73 A;  1X3Q A;  3WDN A;  3GTO B;  2LY7 A;  2UUC L;  5KYL A;  3VR4 A;  1EWC A;  4IJL A;  3LX0 A;  1H9R A;  4N8F A;  3JAM E;  1LAB A;  2NUC A;  1PXU A;  3OTO Q;  1U5K A;  2JA5 B;  1VQK A;  2Q8I B;  1QNU A;  4L5T A;  4A3M H;  2JEB I;  5EQ0 A;  1PYB A;  3OPO A;  4LMQ D;  4C3H G;  5I6Y A;  1K8O A;  1N32 Q;  5EPL A;  3TP5 A;  2K5H A;  3F2U A;  5KND A;  1PLF A;  2L11 A;  4JI4 L;  2K50 A;  5FO8 B;  2B29 A;  2Q2H A;  5K36 H;  1UWV A;  3QJY A;  2A6E D;  3PUX A;  1TS4 A;  1C7Y A;  1G2S A;  2OT2 A;  4BWG B;  2BDO A;  2R61 A;  4JCV E;  2EVB A;  2HHH Q;  3CPF A;  2F0S A;  4ZRZ A;  1UE7 A;  3URY A;  2UU9 L;  1YEZ A;  1EUJ A;  2VQF L;  3CCR A;  1PFM A;  4KKU A;  1XPU A;  3KBG A;  1J9O A;  1STH A;  4HIO A;  3PIP 3;  1EY4 A;  4DV4 Q;  1AE3 A;  1PTO C;  1ASZ A;  3HKZ E;  4X64 Q;  2IX0 A;  3MZ5 A;  4R8I A;  1W6J A;  2LXJ A;  1FNV A;  3I4L A;  4A3I B;  4CDC C;  3HOY H;  1KQS A;  1CI3 M;  3GTQ B;  4B9W A;  1HCZ A;  1PHJ A;  4LUO A;  3MXN A;  4OX9 Q;  4J6H A;  5HY6 A;  5IT9 c;  2A8V A;  4OEM B;  5DAU A;  1UUP A;  1I4Q A;  3M3Y H;  1DON A;  5CV8 A;  1NR4 A;  1SMY C;  3STB C;  3Q23 A;  2OF1 A;  2A69 C;  4ZLT F;  5C44 H;  4Y7N H;  4JW0 A;  4PMB A;  5M5X H;  2RHS B;  4RGT A;  1PV4 A;  4A93 H;  4JYA L; 
#chains in the Genus database with same CATH homology
 1XMO Q;  5C0X J;  2JA8 H;  2N78 A;  1VQE A;  2YU9 H;  1VQP A;  1VQ5 A;  1CSQ A;  4DR3 Q;  1Q86 C;  1M90 C;  3S1M H;  2ES2 A;  3GTL H;  3K8A A;  1PH2 A;  5BR8 Q;  5M3M G;  4APV A;  1CKO A;  1K0R A;  4GS3 A;  1JB7 A;  3PF5 A;  1LUZ A;  1IXR A;  2UXB Q;  5M5W H;  1Q81 C;  5JJI A;  4HJ9 A;  4YCV A;  1BBW A;  1OXS C;  2JA9 A;  4UP8 A;  1KRS A;  2IT1 A;  4KLK A;  1KIX A;  1VQ8 A;  1IBK Q;  4YY3 Q;  5C4X G;  1AH9 A;  2RCN A;  4KHZ A;  3CW2 C;  3RNU A;  3S2D H;  3PIP A;  2ZJR A;  4HJA A;  3D0F A;  3J80 c;  1UE6 A;  2R7D A;  2V1C C;  4JBW A;  3T1Y L;  2HHH L;  4B3M Q;  1XNQ L;  1M1K C;  4LF7 L;  3CAM A;  1KRT A;  2VNU D;  1PH7 A;  4LF8 Q;  4DPG A;  4TQU S;  3S1N H;  5JJL A;  1QUQ A;  4DV5 L;  2QGQ A;  5IE8 A;  3H15 A;  1Q7Y C;  2ZTE A;  3HOX H;  3KOJ A;  5FLX c;  2D0P A;  4R1J A;  3LGJ A;  2F4V L;  1E1T A;  3AFP A;  1K83 H;  1HNZ Q;  4JI4 Q;  4OWX B;  1V43 A;  1T9H A;  1IBM L;  1YBY A;  1XTD A;  1E3P A;  4DV0 L;  3HOU H;  4DV6 Q;  3HOW H;  3T1H Q;  3CQZ H;  3HKS A;  4KHP Q;  1R9T H;  3PUV A;  2JA7 H;  4P71 A;  4X65 L;  3BZC A;  4DUY L;  2OWO A;  2UUB Q;  4MTN A;  5IYC H;  1NMG A;  4DR2 L;  1CKM A;  4RMF A;  4JI3 L;  1OTC A;  3K81 C;  1EIY B;  4NXM Q;  1XNQ Q;  3ULL A;  1C9O A;  1PFS A;  1HR0 W;  4IJH A;  2E8G A;  4PZ7 A;  1ASY A;  4UP7 A;  3TRZ A;  4JI0 L;  4NXN L;  3J81 c;  1XNR L;  2A1A A;  3NEM A;  5EAY A;  1BBU A;  1SE8 A;  4DV2 Q;  1LTL A;  1YI2 A;  3EN2 A;  1NTG A;  2KHI A;  4LWC A;  2UUC Q;  5BR8 L;  4X62 L;  3CC7 A;  2CQO A;  4A3J G;  1WCM H;  2CWP A;  2UXB L;  4K0K Q;  2B3G A;  1QVF A;  1X55 A;  1B70 B;  5J3B A;  4AYB G;  4BY1 G;  1XMO L;  4C3I H;  5LMU Q;  5GQO A;  4LFB L;  1AE2 A;  2WAQ E;  4JI5 L;  3GO5 A;  2C35 B;  1VQD A;  3U4V A;  4HJ5 A;  1Y1W H;  4A3L H;  4DV3 L;  2R93 G;  3TRE A;  2JA5 G;  3ULP A;  4DUZ Q;  4PZ8 A;  4DR7 Q;  1XMQ Q;  3CCL A;  2JK8 A;  4OON A;  1UEB A;  4BBS G;  1WI5 A;  1S3O A;  3U50 C;  2WB1 E;  2NZO A;  5IYD G;  5GAG C;  3AQQ A;  3STB D;  1JE5 A;  5IY0 A;  4LF4 L;  1HR0 L;  1JJC B;  2Z0S A;  3KF6 A;  1Q1E A;  4GOP C;  4A3E H;  1HZB A;  3KDF A;  2Y0S G;  4DUZ L;  2JQO A;  4A93 G;  1J5E Q;  4DV1 L;  3F2B A;  3B6Y A;  3KFU A;  1X9N A;  3RLF A;  1QZH A;  3K7A H;  1KHI A;  3OYY A;  4LF9 L;  2VY3 A;  4BBR G;  1EYG A;  4YHH Q;  4UPA A;  5M3F H;  4BBR H;  1PH4 A;  1VQB A;  4OX9 L;  1VQ9 A;  5LMN W;  4DV7 L;  4YWM A;  2UXD L;  1X6O A;  1SRU A;  4JBM A;  5M5Y H;  2R92 G;  4JOI C;  3CCM A;  2VS1 A;  3RN5 A;  1VQ7 A;  1HH2 P;  4HJ7 A;  4DV4 L;  4A3K H;  1N8R C;  3HOW G;  2PQA B;  1D8L A;  2BH8 A;  2NZH A;  4X62 Q;  4DV1 Q;  4A3K G;  4POG A;  4JI6 Q;  4IFD G;  1EIF A;  2LSS A;  4JI8 L;  3GTG H;  2D0O A;  2Q2T A;  3RZO H;  1PYS B;  4NXN Q;  2OTL A;  3PF4 A;  3S2H H;  1GVP A;  1HZA A;  2AMC B;  2VW9 A;  2UU9 Q;  1TWA H;  4IOA A;  1L1O B;  4A3G G;  1X65 A;  3UDX A;  3G71 A;  3F2C A;  1W3S A;  5FJ8 G;  2VQF Q;  4BY7 H;  1H95 A;  4LF5 L;  4BY7 G;  2UUB L;  1Q82 C;  2PQA A;  4IO9 A;  3HKZ G;  4GNX A;  1NJI C;  4A3M G;  5E7N A;  1O7I A;  3U4Z A;  2Z6K A;  4LUV A;  2DUD A;  3ULJ A;  4BY1 H;  5GRO A;  2WP8 J;  5LMU L;  3TEH B;  2I5H A;  3CCE A;  3S1R H;  3G48 A;  4LFA L;  3HOU G;  4QGU A;  4GN3 B;  4AIM A;  4EX5 A;  1PH8 A;  1PH5 A;  4JI7 Q;  1K3R A;  4R4T A;  3RLO A;  3GTM H;  5K36 G;  1QUQ B;  2R93 H;  4C3J H;  3KDF B;  4BXX G;  2BH2 A;  4BXX H;  1LM0 A;  2WAQ G;  1L1O C;  2BA1 A;  1KD1 C;  2Q2U A;  2R7Z G;  2VUM H;  1G51 A;  3T1Y Q;  4B3M L;  2JEA I;  2Z6K C;  3RN2 A;  4LW1 A;  4X66 Q;  1WJJ A;  2UXC L;  2OTJ A;  4IFD I;  1IYJ B;  5IYD H;  2R7F A;  3EIV A;  1RIP A;  3UDF A;  4X66 L;  1PA6 A;  4YCW A;  5IP9 G;  2UUA Q;  1N33 L;  3S16 H;  5DLQ E;  1QVG A;  4NXM L;  2WFW A;  1A63 A;  1MKH A;  5C3E H;  1BVS A;  4A3J H;  2OQK A;  2F52 A;  4A75 A;  1HNW L;  3KJO A;  2I0Q A;  4ALP A;  3KLW A;  1G29 1;  1NE3 A;  1NBW A;  3PO2 H;  3PO2 G;  5M3F G;  1VQ6 A;  4QQB X;  4A3B G;  4DV7 Q;  3CME A;  4DR3 L;  4JV5 L;  1SLJ A;  5JEA J;  2F4V Q;  2NN6 G;  4JOI A;  3J80 i;  3HOY G;  3I4N G;  4DR6 L;  2GN5 A;  2VZA A;  1Y1W G;  2A19 A;  1A62 A;  1Q12 A;  3CCS A;  3CCU A;  1KC8 C;  2HQL A;  4P72 A;  4YY3 L;  3E9H A;  4JBJ A;  2JA7 G;  1EWI A;  2PMZ E;  4GNX B;  3HOZ H;  3KF6 B;  3PIO A;  3J7Z C;  1VQM A;  4GKJ Q;  2VQE Q;  1VQL A;  4DR4 Q;  3UDG A;  4GKJ L;  4JG2 A;  4X6A H;  4RG1 A;  2B63 H;  4QIW E;  1IBL Q;  3PCO B;  2B63 G;  3HOV H;  1VQJ A;  3PV0 A;  3HOV G;  4TVA B;  1U0L A;  5C3E G;  5C0X G;  2F3I A;  3M4O H;  3L0O A;  3E9I A;  4B3T L;  3I55 A;  4JI6 L;  2RHQ B;  1WYD A;  1HJP A;  4DR5 L;  3W1B A;  1X3G A;  5C44 G;  4OWT B;  3CXC A;  3K7U C;  4B3S L;  1CSP A;  3IRB A;  4P74 A;  3H3V H;  4LFB Q;  4DNI A;  5C4J H;  3PGZ A;  4JV5 Q;  3WWV A;  1MJC A;  1L0W A;  4L5Q A;  4LUZ A;  1WFQ A;  1SN8 A;  3E0E A;  3L2P A;  2R6G A;  1OXT A;  3ERS X;  5HGQ A;  2AHO B;  3J81 j;  1W2B A;  3M7N A;  3F8T A;  1BKB A;  4HIK A;  5GAH C;  2K52 A;  4NB3 A;  1HZC A;  1E22 A;  2YYZ A;  3FHW A;  4R4I A;  1K73 C;  4B3S Q;  1GM5 A;  1VQN A;  4OO1 I;  1N34 L;  1WOC A;  2I5M X;  2JA5 H;  1Y14 B;  3KF8 B;  4HID A;  3FP9 A;  2YTX A;  5AJ3 Q;  4JI1 Q;  3ICE A;  4IFD J;  1L1O A;  1X3E A;  1QZG A;  1VQG A;  1P16 A;  2ZTD A;  3K80 C;  1HNX L;  4NPS A;  1VQA A;  4GLV B;  3PO3 H;  5IP9 H;  3S1Q H;  4R4C A;  4IPH A;  1YHQ A;  2KEN A;  4ME3 A;  4YCU A;  2N3S A;  3I4O A;  4X65 Q;  1K8A C;  2ZTC A;  1YHA A;  1UE5 A;  1VQI A;  4JC0 A;  4A3F G;  3CCJ A;  3CC2 A;  2KHJ A;  1EQQ A;  5ELO A;  1JJ2 A;  4DV6 L;  2HIX A;  1Z9F A;  3PUY A;  4DV0 Q;  4LFA Q;  1NY4 A;  1JMC A;  4AYB E;  1X3F A;  1VS0 A;  1Q46 A;  3PUW A;  2N49 A;  3EBE A;  1A8V A;  3HOX G;  4R4O A;  2CFM A;  3MXN B;  2JA6 G;  1I6H H;  5M3M H;  2ZM6 Q;  2JA6 H;  4A3L G;  4XIG S;  1TXY A;  2KBN A;  1IZ6 A;  2PI2 A;  1K8G A;  3RZD H;  3CC4 A;  2YTV A;  4LF8 L;  1TWG H;  4LF7 Q;  3HOZ G;  1RL2 A;  3ER0 A;  2NVQ H;  2ZJP A;  4KI0 A;  5IYB H;  2UUA L;  4DV2 L;  2H5X A;  3CF5 A;  1V1Q A;  5FLM G;  2LXK A;  4UP9 A;  5FLM H;  1XPO A;  4A3G H;  2HT1 A;  4JI3 Q;  1TWH H;  3I7F A;  2L15 A;  3A5U A;  4A3F H;  1I3Q H;  1CKN B;  3CMA A;  1TWC H;  2ID0 A;  2JJQ A;  4OXP A;  1EOV A;  4H02 A;  1FGU A;  2YV5 A;  3FKI G;  4DUY Q;  1S40 A;  4BA2 I;  2GVB A;  1FJG L;  3J81 i;  2YTY A;  4O0A A;  4R4Q A;  3T1H L;  4KHP L;  3D31 A;  4PMW A;  1I5F A;  2ZM6 L;  4MZ9 A;  2E2J H;  2UXD Q;  4GN5 A;  1WCM G;  4GLX A;  2CKZ B;  5GAD C;  2HIV A;  4GN4 B;  2NN6 I;  3F1Z A;  4YWK A;  1FL0 A;  2QEX A;  4DAY B;  2MO0 A;  3GTP H;  1G6P A;  3HFZ B;  1DGS A;  1EQR A;  3GDE A;  4PG3 A;  2NVX H;  1Q8K A;  1B7Y B;  4A3I H;  2RF4 A;  4LF6 L;  3I4M G;  2DGY A;  4A3I G;  4JYA Q;  1VQF A;  2EIF A;  1HZ9 A;  3CCV A;  4DV5 Q;  2NVY H;  1N32 L;  5IYB G;  3I56 A;  2E5L Q;  2E2H H;  1JT8 A;  3CP0 A;  3BZK A;  5IWA Q;  4IPD A;  1MJE A;  1V9P A;  1YJW A;  2MO1 A;  2XGT A;  1YNX A;  2I5L X;  1PH6 A;  4A3D H;  4O2D A;  5AJ3 L;  3S15 H;  3M9B A;  3JAM c;  3OTO L;  1XMQ L;  1EFW A;  3CD6 A;  4QL5 A;  5JEA G;  1C0A A;  3A0J A;  5IP7 G;  4DV3 Q;  4GOP B;  3I2Z A;  1N34 Q;  2PNH A;  5GAE C;  1VQ4 A;  2K4K A;  1IL2 A;  3BU2 A;  4GKK L;  1YIJ A;  4B3R L;  1SR3 A;  2BA0 A;  3W1G A;  4DAM A;  3S14 H;  3GD7 A;  3M4Q A;  1XPR A;  2GVA A;  4GNX C;  4LF9 Q;  1K9M C;  3TS0 A;  1XJV A;  3TS2 A;  3G6E A;  4PZ6 A;  1L2F A;  3OW2 A;  4B3R Q;  1J5E L;  3KYH C;  1YIT A;  2MQH A;  4GKK Q;  3ZJY C;  4B3T Q;  4JBK A;  2D62 A;  1A0I A;  2CWA A;  4AH6 A;  4DR5 Q;  1JJG A;  3NBH B;  1XNR Q;  5H1S E;  1UE1 A;  4DR4 L;  3DM3 A;  2VQE L;  1YHB A;  4POF A;  5JJK A;  1YVC A;  1SFO H;  3F2D A;  1IBL L;  4DR2 Q;  3Q8D A;  1KAW A;  2K14 A;  4L5S A;  1D7Q A;  3AEV A;  5IP7 H;  1OXX K;  1YJ9 A;  4A76 A;  3PUZ A;  4JI2 L;  5IWA L;  3FKI H;  3NEL A;  2QA4 A;  4OWW B;  1Y1V H;  2AWO A;  4WJ3 M;  4DR1 Q;  1P8L A;  1Q1B A;  1VQO A;  3UDI A;  3GTO H;  4JI5 Q;  3A74 A;  3BJU A;  4WJ4 A;  2EQS A;  2PI2 E;  1I94 Q;  1MIU A;  1VQC A;  4YWL A;  1NMF A;  2IHE A;  4DR6 Q;  2JA8 G;  5LMN L;  1B8A A;  2R92 H;  4GOP A;  4K0K L;  3L7Z C;  3UE0 A;  1N36 L;  2CCZ A;  1FVI A;  4AQY L;  1PH3 A;  3I4M H;  2FXQ A;  1KL9 A;  3M85 A;  3S24 A;  4P73 A;  2KCT A;  4X64 L;  1FJG Q;  2UUC L;  3VDY A;  2MFI A;  4IPG A;  1N33 Q;  1CKN A;  4IJL A;  1HNW Q;  5IYC G;  4JI0 Q;  4A3D G;  3CCQ A;  2MNA A;  4LNQ A;  1IBK L;  3OTO Q;  5FJ8 H;  3CPW A;  1U5K A;  1VQK A;  4L5T A;  2ATW A;  4A3M H;  2JEB I;  4DK3 C;  3GTK H;  4HJ8 A;  4IOC A;  1TWF H;  3M4P A;  1PYB A;  3W5O A;  1LYL A;  2K5N A;  2K75 A;  2E5L L;  4A3C G;  1N32 Q;  1IBM Q;  4AQY Q;  3K0X A;  1N36 Q;  1GKH A;  2K5H A;  1HNZ L;  3JAM i;  4JI4 L;  3GTQ H;  1SRO A;  4JI7 L;  1KXL A;  1VQH A;  2AKW B;  5C0X I;  4LF6 Q;  1I50 H;  2K50 A;  4QJF A;  4DKA C;  2IY5 B;  2B29 A;  2Q2H A;  1I94 L;  1UWV A;  1PH1 A;  4GLA C;  2Q2I A;  2WB1 G;  4XTC S;  2R7Z H;  2UXC Q;  1GD7 A;  3RR5 A;  1YJN A;  1PH9 A;  3PUX A;  3I4N H;  3J7A 5;  3JC6 6;  1C7Y A;  1X54 A;  2IHF A;  2K5V A;  2VUM G;  4QY7 A;  2N8N A;  4JCV E;  2HHH Q;  3CPF A;  5ELN A;  4JI2 Q;  3AYH B;  1UE7 A;  2UU9 L;  1OXV A;  3RLN A;  1J6Q A;  2AWN A;  1YEZ A;  1X56 A;  4LF5 Q;  1GO3 E;  1EUJ A;  2VQF L;  3CCR A;  3PO3 G;  4MNO A;  4C2M H;  2OQ0 A;  1N9W A;  4HIM A;  1XPU A;  2OCE A;  3H3V I;  4BA1 I;  4HIO A;  1QVC A;  4JI8 Q;  3UE1 A;  3PSI A;  3KJP A;  3H0G H;  1VCI A;  4JI1 L;  3SGI A;  3MEF A;  4EQ5 A;  4DV4 Q;  4Y52 H;  1AE3 A;  4J15 A;  3HKZ E;  4A3E G;  1E7Z A;  1ASZ A;  1S72 A;  4X64 Q;  2IX0 A;  4A3B H;  2LXJ A;  2VL6 A;  2IX1 A;  3TQY A;  3DLL A;  2XTI A;  3HOY H;  4YHH L;  3S17 H;  5LMN Q;  2E2I H;  1KQS A;  2ASB A;  1E24 A;  1YZ6 A;  1PHJ A;  4IPC A;  4LFC Q;  4LUO A;  4OX9 Q;  4FDB A;  5HY6 A;  5IT9 c;  2A8V A;  3U58 A;  2KCM A;  4DR1 L;  1HR0 Q;  4L5R C;  3M3Y H;  2NVT H;  3G4S A;  2ALY B;  4UY8 C;  2Y0S E;  2ZJQ A;  1OXU A;  4OO1 G;  3STB C;  4LF4 Q;  1CUK A;  5C4X H;  2EXD A;  4BBS H;  3A5Z B;  3H0G G;  4P75 A;  4A4I A;  1HNX Q;  4DR7 L;  1Y1V G;  3GTJ H;  1E1O A;  1SMX A;  5C44 H;  2JE6 I;  4A3C H;  4Y7N H;  5M5X H;  4C3H H;  2RHS B;  3NEN A;  1PVO A;  1PV4 A;  4DK6 C;  1Z47 A;  4LFC L;  4A93 H;  4JYA L;  3AFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...