4A3BH

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3bH00
1N9WA 1TWGH 4JI5L 1I5FA 3JAMi 1YHQA 2D0PA 2HHHL 2R93H 4YHHL 5GAHC 3K80C 4JI1L 4EQ5A 1PA6A 4DV3L 1CKNB 2AWNA 2LSSA 3AYHB 3F2CA 1HZCA 4YWMA 4DUYL 4GKKL 1HNWQ 2YTXA 4DR6Q 1KAWA 1IBKQ 3PUZA 2R92H 4APVA 2Y0SG 2CWPA 1N34Q 1X56A 2LXKA 1PH2A 4JI5Q 1Q46A 1SN8A 3GTJH 2NZOA 2K4KA 3KYHC 4B3SL 1Q1BA 1PH5A 1UE1A 4NXML 1AH9A 4A3EG 5IP7G 3CMEA 4JC0A 3PO2H 3W1BA 2MNAA 4DUYQ 4GKKQ 4A3BG 4DAYB 1XMQL 2HT1A 4A93G 3BZCA 2B63G 4JI8Q 2EQSA 1E1TA 5H1SE 1PH9A 4MTNA 2OTJA 1YJWA 3HOWG 1RIPA 3PUVA 3J80c 2RCNA 1Q81C 4JBKA 4NXMQ 3HOXG 4DUZL 3HOWH 4WJ4A 1FL0A 3JC66 2WFWA 3HKZE 3HOVG 2B29A 4B3ML 3HOZG 2IX0A 1XMQQ 1G6PA 1CKMA 3CCSA 4RMFA 5M3FG 1GO3E 1TWAH 2K75A 1X3EA 3H15A 4HIDA 1J5EQ 3HOVH 2JK8A 3M3YH 3HOZH 4P74A 5M3FH 2NVXH 4RG1A 5FLXc 1E3PA 1S3OA 5IYCG 4LUZA 4DV2L 2R7FA 4DUZQ 4LFCL 2JA5G 3H0GH 4ALPA 4X65L 2YV5A 4B3MQ 3CW2C 2BH8A 2Z6KC 1EUJA 4JG2A 1NY4A 3T1YQ 1EQQA 2JA5H 3KLWA 5ELOA 1SR3A 1V9PA 4J15A 4R4TA 1EIYB 1E24A 2GN5A 4X64Q 4DV2Q 1HNXL 1EWIA 2JA7G 3ULPA 2VW9A 3H3VH 4LFCQ 1L1OB 5GROA 4X65Q 3A5UA 4AQYQ 4JI2L 3CQZH 2JA6H 1N36L 2JA7H 2JEAI 1KIXA 1KQSA 1LYLA 4GN3B 3S2HH 1JJCB 2CKZB 2K52A 4A3JG 3UE0A 2NN6G 1PFSA 1CUKA 1OXUA 1Y1VH 4PZ7A 1TWHH 1VQOA 3HOYG 4JI2Q 2WP8J 4C3IH 4LF4L 4A3DG 1VQFA 1N36Q 4GNXB 2D0OA 5FJ8G 2MO1A 4IPHA 5C0XG 1WOCA 1OXVA 1JJ2A 3HOYH 4A3DH 1Z47A 3FKIG 1P8LA 1XNRL 1KRSA 2ASBA 4DKAC 3PSIA 4OX9L 1VQBA 3CD6A 2L15A 4A3CH 2ZM6L 3ER0A 4IFDG 2NVQH 1UE5A 3NBHB 4YWKA 2OQKA 3B6YA 4C2MH 4GNXA 2BA1A 1D8LA 1TWFH 4OX9Q 1VQEA 3AQQA 4C3HH 1KHIA 2ZM6Q 1EFWA 3KDFB 1B8AA 3E9HA 2E2IH 1BVSA 4JI6L 3TS2A 4YY3Q 2VS1A 3I2ZA 5LMUL 2KBNA 1JMCA 4BY7G 1LUZA 4NPSA 2KHJA 2XGTA 3CAMA 1A62A 1XNQL 4QIWE 3GTQH 3NELA 5M3MG 3U4VA 2AKWB 4JI6Q 4B3TQ 4GLAC 3F8TA 5LMUQ 4LF5Q 4IOCA 1PYBA 1G291 2CFMA 2HIXA 5IWAL 1IBLL 2HQLA 2ATWA 2UXBQ 1K8AC 3K7UC 3W1GA 1HZAA 4DNIA 5C4JH 3RZOH 2K5HA 3NENA 3KF6B 4A75A 1N32L 5JEAJ 4DR5Q 1VCIA 1WI5A 4A3KG 5AJ3L 3CCMA 1IBLQ 4DV6L 2KCMA 3S24A 4L5SA 4FDBA 5HGQA 3GTMH 4GOPC 1XMOL 2E8GA 1NMGA 1B7YB 3BU2A 3UDGA 3M4PA 2DGYA 4BY1G 3S1MH 3PCOB 1XJVA 1QVCA 5AJ3Q 4DV6Q 4BY1H 2PNHA 2OCEA 1Z9FA 2QGQA 2R7DA 3LGJA 4O2DA 4PZ6A 1X65A 4QGUA 1KL9A 1YZ6A 3G71A 1R9TH 1C7YA 1VQJA 2NVTH 1M90C 1JJGA 1VS0A 4IJLA 5M5YH 1IXRA 2YU9H 2ZJRA 3RNUA 1HNWL 4HJAA 1PYSB 1VQHA 1IL2A 1Q82C 1Y14B 2IY5B 5IYDG 1N8RC 1LTLA 2OQ0A 1N34L 1N33L 4HJ7A 4BBSH 2ALYB 2RF4A 3RZDH 3AFQA 1GKHA 3GDEA 5C3EG 1VQ4A 1PH4A 4L5RC 3M7NA 3PGZA 3VDYA 3F2BA 4XTCS 2AWOA 2N8NA 5JJLA 4JI8L 1N33Q 5IE8A 4X62Q 1X9NA 3KJPA 3RR5A 1VQNA 1HZ9A 4GS3A 4JV5L 3PF4A 2A8VA 1L2FA 3HFZB 1K9MC 1I50H 3ERSX 1IBML 3L2PA 4A3EH 1X6OA 2FXQA 4AIMA 3WWVA 3J80i 5IP7H 1A8VA 3STBC 4POFA 2I5HA 5IY0A 4R4OA 2Q2HA 1J5EL 4LF6L 3GTOH 2WB1G 4A3BH 4BA2I 5LMNW 4JV5Q 5C4XG 4A93H 5JJKA 2B63H 4OWTB 5M5WH 3A5ZB 2WAQE 4A3GG 1JE5A 1IBMQ 4WJ3M 3JAMc 3TREA 1MIUA 2MO0A 3S17H 4HJ9A 3HOXH 3CCEA 3T1YL 4DR2Q 4LF6Q 2N3SA 1VQ7A 1K8GA 1VQLA 1VQ9A 1WCMG 1YEZA 4X64L 1VQIA 4KHPQ 3CF5A 4DV5Q 1QZHA 2VY3A 3G6EA 4LW1A 4X66L 1JT8A 1E1OA 2ZJPA 4AQYL 3CCLA 5IYCH 3K0XA 1PH3A 1HR0W 1EYGA 1J6QA 3CP0A 1L1OC 5IT9c 1GM5A 4LFBQ 4MZ9A 3GO5A 3RN2A 1KRTA 4DR4L 2ZJQA 4QQBX 3M9BA 1BBWA 1NE3A 3EBEA 3ZJYC 3S1QH 4DR3Q 2NZHA 5C0XJ 3MXNB 4X66Q 5GADC 3M85A 2UUBQ 1K3RA 4KI0A 3UDFA 1N32Q 2RHSB 2RHQB 2I5MX 4LUOA 4JI0Q 3RLNA 4BXXG 4GNXC 4DR4Q 3I7FA 4YCWA 3PO3G 4OWXB 4IFDJ 4BXXH 4A3JH 2KENA 3U50C 3PO3H 2GVAA 1UE6A 1K83H 3I56A 4PMWA 1X3GA 4MNOA 3UDXA 4GLXA 1ASZA 1SROA 3CCVA 5IP9G 4LWCA 5FJ8H 3EN2A 3S14H 4A3LG 1Y1WG 4KHZA 4DV4L 1O7IA 5IP9H 1VQKA 3CC7A 2ES2A 2Y0SE 3FKIH 3CC2A 1FJGL 2LXJA 3S15H 4A3LH 3J7A5 4A3IG 4A3FG 3L7ZC 1UE7A 3AFPA 4YY3L 2EIFA 4A3IH 3TS0A 1BKBA 3CCJA 4AYBG 4DV4Q 1VQ8A 4KLKA 2E5LL 1HR0Q 1FJGQ 2PQAA 2AMCB 4Y7NH 2PMZE 3U58A 2Z6KA 1YHBA 3J81c 1YITA 4B3TL 4Y52H 4JOIC 3I4OA 4LF5L 1A63A 1T9HA 1KC8C 4JYAQ 5ELNA 2UXCL 2UXBL 2E5LQ 2OTLA 1MKHA 2HIVA 4BY7H 5JJIA 4UY8C 1K73C 3PUWA 4DR5L 3RLFA 2OWOA 2V1CC 5C44G 1NMFA 1D7QA 5M3MH 4NB3A 3J7ZC 3GTKH 5C44H 5BR8L 2UXCQ 1QVGA 1PH8A 1AE3A 2UUCQ 2YTVA 5IYBG 4K0KQ 1HZBA 2I5LX 4H02A 4NXNQ 4QJFA 1HH2P 2R6GA 2VQEQ 2UXDQ 4GLVB 3ULLA 1SMXA 4ME3A 3H3VI 2R7ZG 4TQUS 1MJCA 4UP8A 3I4NG 4DR7Q 3K7AH 5BR8Q 4DV0Q 4A3KH 1C0AA 2VQFL 1KD1C 3I4NH 2GVBA 4OXPA 4JI7L 3HOUG 4IPDA 2CQOA 1HNZQ 4LNQA 3KJOA 4QY7A 3HOUH 1VQAA 2ZTEA 2Z0SA 1WJJA 5EAYA 2E2JH 2VQFQ 2QA4A 2N49A 3CPWA 3K8AA 1G51A 4JI7Q 1DGSA 1M1KC 1IZ6A 2VUMG 1OXTA 3A74A 3ICEA 3OYYA 3CCQA 2XTIA 3OTOQ 3PF5A 1OXXK 4B3RL 4X62L 4IFDI 4PG3A 1YBYA 1YJNA 1CSQA 1I94L 4LF7L 5IYDH 3CPFA 5E7NA 4P71A 3CCRA 2ZTCA 4JBWA 2A19A 3I4MG 1TWCH 1NJIC 3F1ZA 1OTCA 4DAMA 4IOAA 1X3FA 3PV0A 1C9OA 1E7ZA 4L5TA 4B3RQ 5C3EH 2F3IA 2F4VQ 5GAGC 1EIFA 3GD7A 2VNUD 1I94Q 4GKJL 1Q12A 4LF7Q 2YTYA 2PI2E 4GN5A 3S16H 2MFIA 4BA1I 4LF8L 1GD7A 1HJPA 1MJEA 1VQ5A 3KFUA 2F52A 3TRZA 1I3QH 4JI3L 4DV7L 3K81C 1W3SA 4DR2L 2R93G 1P16A 2A1AA 4HJ8A 4GOPA 2Q2UA 1FVIA 4UP7A 5K36G 4GKJQ 4AH6A 1VQMA 2IT1A 4A3MG 4KHPL 4A4IA 2B3GA 3PUXA 4L5QA 5HY6A 5C4XH 4DV5L 1PH7A 4LF8Q 2R92G 2DUDA 4A3MH 1W2BA 4A3GH 4DV7Q 4JI3Q 4LFBL 3PIPA 4GN4B 5GQOA 4JBJA 3DLLA 1PH1A 2HHHQ 3PO2G 4YHHQ 4LF9L 1Q8KA 1PHJA 4JI1Q 5FLMG 4DR3L 4DV3Q 2UUBL 1WCMH 1CKNA 1WFQA 2K50A 5FLMH 2I0QA 2QEXA 2BA0A 1QUQB 4TVAB 3U4ZA 1YNXA 3D0FA 4JI0L 1WYDA 2YYZA 4YCVA 1PVOA 4B3SQ 4LF9Q 1H95A 3D31A 2IHFA 1K0RA 4IJHA 1CKOA 3CXCA 4IPGA 1YHAA 1YVCA 1U0LA 2ZTDA 2PI2A 3TEHB 5LMNL 1QZGA 1U5KA 2N78A 4OO1I 3S2DH 1QUQA 3CC4A 1NTGA 3E0EA 2K5NA 1JB7A 3G48A 2C35B 2IHEA 3H0GG 1SRUA 1KXLA 3T1HL 4UPAA 2MQHA 1FGUA 5LMNQ 1VQGA 2CCZA 3F2DA 1A0IA 3BZKA 3EIVA 4UP9A 3GTPH 4HIOA 4JI4L 3J81j 1Q7YC 2JA6G 2PQAB 3ULJA 3PIOA 4R1JA 1HR0L 3G4SA 3T1HQ 3FHWA 1Y1WH 3SGIA 1OXSC 1SLJA 5J3BA 4A76A 3RN5A 2VZAA 2Q2IA 1Y1VG 4OONA 4R4CA 1XPOA 4A3FH 3S1NH 4JI4Q 2JE6I 4JYAL 4HIKA 3CMAA 3J81i 4X6AH 2AHOB 4R4IA 1X54A 1HNXQ 4EX5A 1B70B 1XPUA 2WB1E 1VQ6A 1L1OA 4P73A 1TXYA 1I6HH 4A3CG 3I55A 3BJUA 2UUCL 4K0KL 4DK6C 4NXNL 2KCTA 4LF4Q 2VQEL 2UUAL 2NVYH 3IRBA 4O0AA 1PV4A 2UXDL 2Q2TA 5GAEC 4BBRG 3MEFA 1V43A 4DR7L 5M5XH 1XNRQ 3STBD 1V1QA 4DV0L 1IYJB 3GTLH 1X55A 4BBRH 4YCUA 3KF8B 3A0JA 2UUAQ 2IX1A 5IYBH 4HJ5A 1HNZL 3W5OA 3M4OH 2H5XA 1AE2A 1YIJA 1CSPA 2JA8G 4IPCA 4BBSG 3NEMA 1BBUA 1UEBA 4DR1L 2R7ZH 2KHIA 4DV1L 2VL6A 2JA8H 4C3JH 1XPRA 1NBWA 3RLOA 3KDFA 1EOVA 2NN6I 3OW2A 2UU9L 4PZ8A 4POGA 3HKSA 4OWWB 1Q1EA 4DPGA 3Q8DA 3TQYA 3OTOL 4DK3C 2E2HH 2WAQG 4YWLA 4DR1Q 3AEVA 4LFAL 4DV1Q 1GVPA 1XNQQ 1EQRA 2EXDA 1VQCA 3HKZG 4XIGS 2BH2A 2D62A 5C0XI 3PUYA 2K14A 3KOJA 4JOIA 4HIMA 5DLQE 2UU9Q 3L0OA 1YJ9A 2VUMH 2ID0A 5IWAQ 4R4QA 4LUVA 3UDIA 3FP9A 3CCUA 1SFOH 4LFAQ 3M4QA 1Q86C 2F4VL 1L0WA 1PH6A 1XTDA 4JCVE 4P75A 1ASYA 1SE8A 1VQDA 1VQPA 3KF6A 4AYBE 2JEBI 2JJQA 2JQOA 5JEAG 3DM3A 1RL2A 4IO9A 4GOPB 4JBMA 3I4MH 1YI2A 3E9IA 3UE1A 2CWAA 1XMOQ 4P72A 4OO1G 1E22A 4QL5A 2K5VA 3S1RH 2JA9A 3GTGH 1UWVA 4DR6L 1IBKL 1LM0A 1QVFA 1S72A 1S40A
chains in the Genus database with same CATH superfamily
3JAMi 4A3IB 1V1OA 2R93H 4YHHL 5GAHC 4HMIA 3K80C 3OPOA 4EQ5A 4DV3L 2LSSA 3AYHB 4ILWA 4YWMA 1HNWQ 4DUYL 3HG9A 1KAWA 4Y7NB 5C3WA 1BR9A 1M8AA 2CVRA 3LWUA 2R92H 3H94A 1SN8A 1F9PA 1STBA 1F77A 1Q1BA 1PH5A 5TSSA 1UE1A 1AH9A 2F0UA 1F9RA 4JC0A 4DUYQ 3KBGA 4DAYB 1B3AA 3M7GA 3TP5A 2EQSA 1PH9A 1YJWA 2XN9C 2RCNA 5M5XB 3HOXG 2O4XA 1FL0A 3JC66 4J6HA 4ULLA 3RD4A 2O5JC 2B29A 1A3UA 3CCSA 4RMFA 1TWAH 2K75A 2B2UA 2N55A 4RG1A 5FLXc 5IYCG 4A3KB 1SEBD 1DCZA 3DM1A 4LFCL 2JA5G 3H0GH 4X65L 3D3RA 1EUJA 2JA5H 2RSOA 1V9PA 4J15A 4R4TA 3IFDA 3NBIA 4OIKA 2VW9A 3H3VH 4LFCQ 4X65Q 4JI2L 1KIXA 2RCFA 1LYLA 2MHVA 2K52A 1ICFB 2NN6G 3D8GA 1DD2A 2IW3A 3QJYA 1B2TA 3HOYG 4JI2Q 4LF4L 2RDGA 2D0OA 5C0XG 2F0LA 5KGUA 3HOYH 1KLGD 1JICA 2F03A 3PSIA 4OX9L 1PTOB 5JJZA 1CK1A 4YWKA 4FXDA 3ZYYX 3B6YA 4GNXA 2BA1A 4OL7A 4OX9Q 1VQEA 3AQQA 4KKTA 4QMGA 3UI2A 1EFWA 2E2IH 1BVSA 1JWUD 2D9UA 4IUUA 2KBNA 5C3XA 4KKUA 4G7ZC 1EU4A 3G6JB 1OO9B 4MIUA 2P5ZX 3NELA 5M3MG 5CC4A 1LLRD 4G4KA 2HDLA 4IOCA 3PO2B 2HIXA 4DXGA 2E74C 3GTQB 5FO7B 1K8AC 2I07B 4DNIA 2NTSA 4X3SA 3TZUA 2DJGC 1QWYA 1VMPA 4A3KG 3MFGA 2LS01 3BS1A 3SXHA 3LNNA 5HGQA 3P75A 1LTBD 4GOPC 2E8GA 1NMGA 1B7YB 3S1MH 5CV8A 5M9OA 4RCNA 2PNHA 3V96A 3LGJA 1V8QA 3GTPB 2NZ1D 5CBAE 5KNDA 4JW0A 1M90C 1BCPC 5M5YH 2F1MA 2ZJRA 1RJTA 3RNUA 1IYVA 1GUOA 3Q0AA 1N33L 3GQBA 2DY8A 4HJ7A 1B50A 3ITPA 1A2TA 2EJMA 4N9PA 1GKHA 5C3EG 5I6WA 3M7NA 5CV5A 2AWOA 3PIP3 4JI8L 1N33Q 3KJPA 1VQNA 4GS3A 2A8VA 2F0SA 1K9MC 1IBML 2F0FA 4N9TA 1B4OA 5IP7H 3WWVA 4POFA 1Q3LA 2I5HA 4OHJA 5IY0A 2SNSA 4R4OA 4LF6L 3GTOH 1DM0B 4A93H 2B63H 5CBEE 5M5WH 1IBMQ 3TREA 2TMPA 2MJ8A 1ZXTA 4KJOA 3T1YL 4LF6Q 1SYEA 2A68D 4KHPQ 2VY3A 3G6EA 3OWFA 4X66L 2JA8B 1EYGA 4C3JB 5IT9c 1L1OC 1GM5A 5ELBA 4MZ9A 4KY5A 3RN2A 4DR4L 1QG7A 3M9BA 2NUCA 3S1QH 4X66Q 3UDFA 4LUOA 1U9RA 1VF7A 4G7HC 4DR4Q 4IUVA 4RKLA 2B2YC 2K5DA 1CZWA 4GLXA 1X3GA 2KHSA 2RBMA 4ZKBB 4IN3A 4A3LG 4KHZA 4QUCA 3FKIH 4A3LH 2LXJA 5ISRA 1XTCD 4UDUC 3WOEA 2AQ1B 3MA2B 1K8MA 3TS0A 3GTGB 2LKVA 1VQ8A 1PYWD 1HR0Q 4CGYB 2AMCB 1SMYC 3J81c 2MPMA 4B3TL 3SK5A 5HURA 2RA4A 4UY8C 2QKIC 5EQ0A 3KLRA 1LV9A 4IQZA 1NMFA 1JOQA 3EJIA 1QVGA 1SJHD 2UUCQ 2I5LX 4J8QA 1HH2P 2R6GA 5BN5A 2L9HA 2UXDQ 1SMXA 1M4VA 3HOWB 1MJCA 1KD1C 4OXPA 4KN7C 3M3YB 3I8ZA 2F0NA 3HS0C 1HNZQ 4QIWB 3KF8A 2NVXB 2Q8IB 4LNQA 2E75C 2M9VA 3DEPA 3N52A 4N8FA 3K8AA 5T1IA 1PDQA 3CRLC 4NMZA 2DNCA 1HTPA 1LTGD 3A74A 4PQXA 5ELCA 5I2YA 3O13A 2JA6B 4K2LA 1OXXK 3CQZB 1RDPD 4X62L 4IFDI 2KCCA 1J9OA 1ILQA 2OXPA 4P71A 5E7NA 1Y1VB 2ZTCA 4JBWA 2PZWA 1NAPA 3F1ZA 4C3IB 2EYPA 3SK4A 4F7XA 4ZUJA 2F3IA 5GAGC 1EIFA 4RH6A 4XQQA 4A3DB 4GKJL 1BBXC 2PI2E 2MFIA 3K58A 5IGDA 1IW7C 4B08A 2F52A 2NVQB 4HJ8A 4K2KA 4UP7A 4GKJQ 3D4DA 4AH6A 1VF5C 2IT1A 4A4IA 1TWFB 1PH7A 5CYUA 1KAAA 1AZPA 1DOMA 3ND8A 4X3UA 4A3GH 1T5XD 3J7AF 4LFBL 4JK1C 3K5MA 3E6ZX 1PH1A 1EQVA 2HHHQ 3KK7A 3CHBD 4DAVA 2UUBL 2R61A 1EQTA 3MTSA 2I0QA 2BA0A 3BYYB 3EA6A 2F0VA 4B3SQ 1H95A 1FNVA 1K0RA 5C4JB 4IPGA 2A74C 1YHAA 2ZTDA 2PI2A 1DXMA 5D65A 4OO1I 1SNDA 1QUQA 4DAYA 2F0GA 1KXLA 1A2UA 1UAPA 4RFBA 5LHY1 3F2DA 4RHRA 4UP9A 2K5QA 2EYHA 4HIOA 3K59A 4MTKA 2JA6G 2X6LA 2XWBB 3MWYW 4B9XA 1ICWA 4MHEA 3SGIA 2NVTB 3HP3A 4A76A 1Y1VG 4R4CA 1RHPA 4JYAL 2JE6I 1B9NA 1MI2A 3AMUA 3J81i 1LT3D 4X6AH 2FHTA 4BBSB 1VQ6A 1T5EA 3RZDB 4NXNL 2KCTA 4WORA 3S16B 1I50B 4BBRG 4ID6A 5D14A 1HCZA 3OWEB 3GTLH 4BBRH 1QOHA 2AQ2B 4DK1A 4NP5A 3A0JA 1FYCA 1TY2A 1XX8A 2A69C 4C1NK 1TT2A 4DR1L 2KHIA 1WTRA 1PFNA 2Z4HA 1XPRA 1K0SA 3HKSA 1Q1EA 2E2HH 1JWMD 3AEVA 4DR1Q 1Y8PB 1XXGA 2EXDA 3MXGA 3PUYA 2OT2A 5DLQE 1DJRD 3L0OA 4CDFC 4R4QA 1E2ZA 5JVH3 3FP9A 1E0BA 2F4VL 1SE8A 5I2XA 1VQDA 1MSGA 1STEA 1R4PB 4A3JB 5HGTA 4TKOB 2AUJD 2G9HD 2QF7A 3PO3B 1NNXA 3D6CA 3IL8A 4GOPB 3A8KE 3FPUB 3UE1A 2CWAA 4OO1G 3W2DA 1EWHA 5IGBA 1W6JA 2JA9A 2BE5D 3K6OA 4WFN3 1HA5A 1IBKL 4BBSG 1S72A 1S40A 1VQLA 1YHQA 1BCPB 5IOCA 5A2QE 5K36H 1CKNB 3F2CA 1FR3A 3W3AA 2CW0D 2OF1A 1IBKQ 1MGSA 1D1KA 1PH2A 1Q46A 1CTMA 3KYHC 2EYLA 3N6RA 3JAME 5COYA 3CMEA 4HAEA 1LABA 2FMCA 1XMQL 1S5FD 3BZCA 1U4PA 5H1SE 1Z7TA 4FF2A 3PUVA 2QILA 2Q8TA 2L12A 3J80c 5C44B 3T51B 4WJ4A 1HUNA 4FF4A 2WFWA 3HOZG 1XMQQ 1GO3E 3T4AC 4QF4A 1X3EA 1SNCA 5LL6S 1J5EQ 3HOZH 2JK8A 4DV2L 5JPNC 5J22A 1LTID 3CW2C 1HA6A 4DK0A 3HOUB 2QW7A 4X64Q 4DV2Q 1HNXL 1L1OB 3A5UA 2JEAI 1N36L 3S2HH 1KQSA 1RCVD 4A3JG 4R8NA 2EOTA 4P2CB 2D2CC 2VUMB 1EYAA 1CM9A 4ZRZA 1PLFA 4PZ7A 2EY5A 2BCOA 1VQOA 1RTNA 1VQFA 1SNOA 3BDLA 1N36Q 1FD7D 4IPHA 1JJ2A 1D2BA 1STNA 1HTLD 4RCOA 1Z47A 1KRSA 2ASBA 2A6EC 2HDMA 4A3CH 2JXMB 2ZM6L 3ER0A 1CFMA 3FEWX 1KDAA 4C2MH 4LK1C 5FO8B 1I3QB 3TN2A 1LACA 1DONA 2ZM6Q 5EBCA 2R93B 2ICEC 1XYIA 5LMUL 2VS1A 3I2ZA 3IFTA 4NPSA 1TU2B 2KHJA 3CAMA 5BN4A 1XNQL 1KNAA 4QIWE 1WTQA 3U4VA 4KMUC 1CI3M 4GLAC 5LMUQ 1QILA 4RKBA 1G291 2CFMA 2R3ZA 3MXPA 5IWAL 3K7UC 1HZAA 3QO2A 1HQMC 2K5HA 1V1PB 3MVVA 4CJ0B 3C46A 3H09A 4DR5Q 1VCIA 1WI5A 1D1IA 3URYA 2EY1A 2SDFA 4EQNA 4DV6L 2KCMA 3S24A 4L5SA 1H9MA 3GTMH 2L5TA 2HQEA 3BU2A 1JE4A 1XJVA 1QVCA 3H0GB 4DV6Q 2PZUA 2QGQA 4O2DA 4PZ6A 1C7YA 1KL9A 1R9TH 1VS0A 2RDFA 1IXRA 2YU9H 2LMCB 1HNWL 4HJAA 5IGCA 1Y1WB 1Q82C 2CHBD 2IY5B 5IYDG 1YNJD 1LTLA 2OQ0A 5C5MA 2XRSD 4A3FB 1MHWC 3AFQA 3S9WA 1VQ4A 1DYQA 4L5RC 1DOKA 2DY7A 2J0TD 4HSPA 5IE8A 3RUZA 1I6HB 1F2LA 3HFZB 5L37A 5KNBA 2MP1A 2SNMA 2RDHA 3J80i 1VMCA 5C6AA 3LWEA 1YNNC 1TR5A 4WRDA 5C4XG 1EIHA 3K5NA 1F2MA 1C8CA 2MO0A 3S17H 3HOXH 3CCEA 1ML0D 5J39A 3M4OB 1VQ7A 1JORA 2HCIA 4BS9A 1VQIA 1KDBA 2B8GA 4LW1A 3SE0A 3VYTA 1E1OA 3CCLA 5IYCH 3K0XA 1TS3A 2ZJQA 1BBWA 1NE3A 3EBEA 4E6IA 3I3CA 4DR3Q 5C0XJ 5GADC 1K3RA 4L6TB 5EKKA 4RGMA 1N32Q 4JI0Q 2RHQB 4GNXC 4XQNA 4U673 3MC0B 2KENA 2NN6H 1PTOF 1MSHA 3BZDB 3MXNA 4DGZA 4PMWA 1HXYD 1D5MC 3CCVA 3P7JA 5C0XH 4LWCA 3S14H 3EN2A 4K5VA 1Y1WG 4R9WA 3CC7A 4RGTA 3S15H 4DA2A 3J7A5 4A3IG 4A3FG 3S1RB 1I4RA 4KHVA 4A3IH 1STHA 5T1GA 1NSNS 1TWGB 3I72A 1S5DD 4Y7NH 5EPKA 2L4NA 3I4OA 2WKCA 1T9HA 1JCKB 4HN7A 3C2PA 1SNPA 5ELNA 1MKHA 5JJIA 3GTJB 1SXTA 1TQOA 4DAPA 2ZT9C 1LTRD 5M3MH 3I4LA 3GTKH 5BR8L 3BVZA 1I4XA 5IYBG 5KNCA 3LX0A 1AW7A 2VQEQ 3T13A 2PO4A 2B2VA 3ULLA 4ME3A 4PNYA 4DR7Q 5BR8Q 4A3KH 3T53B 3HOVB 2K01A 4IPDA 4XQJA 1H9JA 1TS2A 5M3FB 4DN4M 3KJOA 1FGBD 2ZTEA 1CHPD 5EAYA 2QA4A 3CPWA 1OXTA 1ZKOA 3CCQA 1NR2A 2B2WC 4RGOS 4KN4C 2JA7B 2JYOA 4K6LA 2SOBA 4PG3A 1YBYA 1CSQA 3CPFA 4L63B 3MAQA 2A19A 2ZXPA 1UUPA 1WTXA 1EYDA 1TWHB 1OTCA 3MXUA 3IAYA 2F0MA 4L5TA 2PW7A 5C3EH 3GD7A 1Q12A 4BA1I 1GD7A 1MJEA 4DXFA 1VQ5A 3FKIB 3TRZA 4DV7L 4GZYC 2F0KA 4GOPA 5CV6A 2GA4B 2M2LA 4KHPL 2A5HA 4C3HB 2DUDA 4V190 4DV7Q 1F2ZA 3K57A 4GN4B 2IPKD 4JBJA 5EGTA 3PO2G 4JI1Q 5FLMG 2L11A 1D6EC 1SNQA 4FF3A 1CKNA 1WFQA 5FLMH 2QEXA 3GTQH 3Q23A 2KEEA 3D6WA 4DNRB 5I9PA 3E3XA 3TZDA 2IHFA 1FNUA 4KD4A 3RZOB 4IURA 5IT9E 4DU9A 1NCVA 4F8MA 3CC4A 4ZKCB 2C35B 2IHEA 3P20A 1O80A 3BDOA 2EE1A 1FGUA 2MQHA 1QNUA 3GTPH 3NTIA 1S4ZA 2ZXOA 4ZYSA 3ONAB 4BY1B 3ULJA 1HR0L 1SFOB 3G4SA 2EVBA 3DWQA 2Q2IA 2G5DA 1XPOA 4HSVA 5EKLA 4ZCKA 4HIKA 3R3OA 4O1NA 4EX5A 1XPUA 5KRUA 1L1OA 3U9SA 4P73A 4ABNA 5CGKA 4CHTB 3I55A 3BJUA 3SEBA 2UUCL 4DK6C 5IIFA 1H9SB 3KLSX 3C1EA 1EY9A 3J81E 2Y0SB 1PV4A 2UXDL 2F0JA 5GAEC 4CDCC 5KIXA 1XNRQ 3STBD 4A3EB 2B2YA 1X55A 1E2WA 4A3BB 2IX1A 1HNZL 3W5OA 2MUYA 2PMZB 2JA8G 1LT6D 4IPCA 1ZYRD 4C3JG 2A68C 2JA8H 1I4HA 3VR5A 4C3JH 1IKLA 1EOVA 1O7LA 3G7LA 4F88A 2EPBA 4ZUIA 3CRKC 4DK3C 4XXEA 1SYGA 3H3VC 1GVPA 3FMCA 1G6ZA 1ZEQX 4XIGS 2BH2A 2D62A 2PNRC 5ELDA 3KOJA 4HIMA 1B3QA 2F0DA 4F87A 1DZ1A 2ID0A 4CKBA 4J1MA 5JVG3 1PH6A 4JCVE 1RKNA 2VB2X 1H9KA 3TSSA 3R2IA 1PTOD 1I4PA 2JQOA 5JEAG 3DM3A 1K83B 5JEAH 4Q5VA 2ICIA 1XMOQ 1E22A 3SDZA 5EJWA 1Y8OB 3GTGH 2N88A 1UWVA 5AFWA 4DR6L 4XDXA 1N9WA 3NWSA 2CH4A 2HHHL 4CJ1B 3SK8A 4FXKC 2AWNA 1PA6A 1ENFA 2XSCA 4DR6Q 2B39A 4CBVA 1I4GA 1TIID 1IYUA 2Y0SG 1N34Q 2LXKA 2HUGA 2NZOA 3NTKA 4B3SL 1EU3A 4A3EG 1GUNA 4BY7B 1GJXA 2MNAA 4A3BG 5E3FA 1I4QA 1E1TA 4IUTA 4PV1C 1RIPA 3HOWG 1Q81C 4JBKA 3OMGA 1HPCA 3HOWH 3A8IE 1WVLA 2XWJB 4M8AA 1G6PA 1CKMA 2PZTA 3M3YH 3H15A 2A6HC 1B53A 4P74A 2WACA 3K7AB 2NVXH 1E3PA 5DNFA 1CA5A 4DF7A 2R7FA 3I4NB 4ALPA 4XT3B 3SK6A 2YV5A 2BH8A 2Z6KC 4JG2A 4KTAA 1EQQA 3VA7A 3HGBA 1MBYA 4NDXA 1E24A 2GN5A 1A3VA 1EIYB 1SJED 1EWIA 3ULPA 2E2JB 3X3MA 5GROA 4AQYQ 2QDBA 1X3PA 2JA6H 3CQZH 4GN3B 1PRTC 1JJCB 1F9SA 4K5WA 4NW2A 3UE0A 1PFSA 2HD3A 1CUKA 4C3IG 1Y1VH 2K7VA 2B8FA 1SAPA 3HEJA 4C3IH 2WP8J 4A3DG 3DHQA 4GNXB 1HUMA 4TSSA 5FJ8G 1EWCA 4A3DH 1TWCB 2NYZD 4DKAC 1VQBA 2L15A 1D5ZC 3VR6A 1E2VA 4IFDG 1QJOA 1WTHA 2NVQH 1AP0A 3I73A 2OQKA 4IFDH 4H44C 1D8LA 1TWFH 1GXDC 4NKLA 1KHIA 1CA6A 1BOSA 2EJFC 1B8AA 2H1EA 3E9HA 5DAUA 1WTOA 4YY3Q 2WB1B 4BY7G 4A3MB 2PYKA 3AU7A 1GOZA 4IUQA 3TMEA 3QWNA 3F2UA 4LF5Q 1WCMB 1ONLA 2HQLA 2ATWA 1A15A 1DOLA 3OW7A 1EZ6A 2UXBQ 2K04A 4FXGC 5C4JH 3NENA 3KF6B 4A75A 1C48A 3E0JA 5AJ3L 4PMBA 5CV4A 4FDBA 2E2DC 3S2DB 2M00A 3UDGA 2KVMA 1LTAD 2BDNA 2F3WA 5AJ3Q 2OCEA 2R7DA 4WJ3M 1X65A 1BCPF 3G71A 1YZ6A 2NVTH 1PZJD 1JJGA 4OO1H 1II3A 2PW5A 1ENCA 1VQHA 1IL2A 1GHKA 3QOJA 3T16A 5D3IB 5FO9B 3K5LA 4BBSH 3S1NB 2ALYB 2RF4A 1LTTD 5EBDA 3RZDH 1ILPA 3GDEA 1PH4A 3D4WA 5JJLA 1X9NA 3RR5A 1HZ9A 2A6ED 3PF4A 2F0PA 4K5XA 2B2TA 1I50H 3L2PA 2FXQA 3DXJC 3NHHA 2NVYB 3KUPA 3NSWA 1EL0A 1J5EL 2Q2HA 4C2MB 2WB1G 3L9AX 1JWSD 4OWTB 2G9DA 2FMMA 3OHXC 5CORA 1JE5A 3JAMc 1MIUA 4ME5A 3TP8A 4DR2Q 2F0QA 2N3SA 3PMFA 4OGQC 3J80E 1K8GA 1TS4A 1WCMG 4X64L 3VYSA 4DV5Q 1QZHA 3TP6A 2R7ZB 1JT8A 2IX3A 3VR3A 1G8ZD 1PH3A 1HR0W 3CP0A 5BN3A 1KRTA 4QQBX 2SEBD 1PFMA 2VXWA 3ZJYC 3A8JE 2NWGA 2NZHA 3M85A 1U4MA 4KI0A 5K5PA 2RHSB 2I5MX 4G57A 3HKZB 4BXXG 3I7FA 4YCWA 5C5LA 1O7YA 4OWXB 3PO3G 4BXXH 4A3JH 4FYDA 1W6KA 3U50C 3GTMB 3PO3H 3K5OA 1UE6A 4MNOA 3WOFA 5A2QL 1GUTA 4H13C 5IP9G 1ESRA 4Z9CB 1AN8A 1SNMA 1O7IA 3I4MB 5IP9H 2ES2A 2Y0SE 1FJGL 4X3KA 2BE5C 1X32A 3L7ZC 1EY7A 3JAML 1KDCA 1PZKD 3CCJA 2BOSA 1G91A 2F0OA 4KLKA 2E5LL 1QB5D 1F2YA 1FJGQ 1SBBB 1F9QA 2CW0C 2PMZE 3U58A 1YITA 1YHBA 4JVZA 4Y52H 4JOIC 1A63A 2X69A 1BUVT 2R92B 2E5LQ 2OTLA 2J7ZA 4UAIA 1K73C 4DR5L 3RLFA 1D7QA 5C44G 5F2DA 3QOLA 2BDOA 1A6XA 4XYOA 3GV3A 3WDNA 5JPMC 5C44H 3J7ZC 3MHBA 1PH8A 2IL8A 4K0KQ 3A7AB 2LFNA 4H02A 1WTPA 4QJFA 5DEHA 3VA5A 1BO0A 2ENBA 2FJ2A 4EVOA 5KYIA 3H3VI 2R7ZG 4TQUS 3R93A 3NE5B 3DEOA 4DV0Q 1C0AA 2GVBA 1TWAB 3HOUG 2CQOA 4M1UB 4QY7A 5C4ZA 3HOUH 5DM73 1WJJA 3T56B 2JA5B 2KA7A 1IZ6A 1EEID 3A7LA 2VUMG 3K0YA 3ICEA 1FNWA 3OYYA 1SE2A 1NR4A 4JPBW 3P1HA 4I7AA 3OTOQ 3L3OC 4C56C 3C3LA 1YJNA 1H9RA 2IJ0A 4LF7L 5IYDH 1QCBD 3CCRA 1HRJA 3I4MG 4IOAA 4DAMA 2RSNA 1S5BD 1J8IA 5E1FA 4FNFA 3HOYB 2VNUD 1EYCA 4LF7Q 2B2UC 4GN5A 2J4XA 1XWEA 3KFUA 1Y69U 1I3QH 2WKDA 1D5XC 3K81C 2R93G 2EY2A 2A1AA 1FVIA 2R92G 1KLUD 2B3GA 4L5QA 5HY6A 2K33A 5C4XH 2IWHA 2AUKA 1EEFD 1PFBA 1W2BA 2E2IB 5I9OA 2EY6A 4U68A 3DLLA 4YHHQ 4LF9L 1Q8KA 4KK7A 5I6YA 1PHJA 2KECA 2PCFB 4DV3Q 4PMCA 4DR3L 2E76C 1CQVA 5A35A 2K50A 1N32L 4JI0L 1NUCA 1QUQB 4TVAB 3HZXA 1WYDA 2YYZA 4YCVA 3QR8A 5M3MB 5FLXE 4LF9Q 3GTKB 2XIWA 4IJHA 1CKOA 1LTSD 1AFPA 2WAQB 1JR0D 5LMNL 3QIAA 1TVXA 1U5KA 2N78A 1PXUA 2K5NA 4LJZC 3G48A 3GP7A 4KY7A 2CQAA 3H0GG 5E4WC 1EY5A 3T1HL 4H7BA 2CCZA 1G2TA 5LMNQ 1VQGA 3BZKA 3EIVA 1JOOA 3X3NA 3S1MB 3EROA 5CR3A 3J81j 4OIJA 2X6GA 1JQYD 3FPPA 2FINB 2PQAB 2FFKB 5CV9A 4H0LC 3MFYA 3T1HQ 1RODA 1ET9A 1Y1WH 1BCPD 1PRTF 1SLJA 4O42A 4EGVA 2VZAA 5M5YB 4RHSA 1YNJC 1S5CD 4A3FH 1HHVA 4K8JA 4R4IA 1X54A 1PRTB 2WB1E 1TKWB 3BVMA 2B2VC 1I6HH 2K05A 5FOBB 5C3EB 1TS5A 1SYFA 2KCNA 2VQEL 2UUAL 4LF4Q 4O0AA 1WTVA 2QCPX 1GHJA 1X3QA 4DR7L 5M5XH 3I70A 1KTKA 4YCUA 3GTOB 2UUAQ 5FLXL 5IYBH 3NUCA 4A93B 2B63B 5M5WB 3M4OH 1YIJA 4L8JA 5I4DA 2D5DA 1BBUA 1UEBA 3DWPA 3NEMA 2VL6A 1UEAB 3CU7A 2TSSA 2WAQG 4YWLA 3KBXA 4LFAL 1EQRA 2K03A 4IALA 4Q0FA 3H91A 5FK9C 3S1QB 1CQFA 1YJ9A 3OOCA 2JP1A 2KQ3A 3CCUA 3UDIA 4LFAQ 3M4QA 1ASYA 3OIPA 3KF6A 2JEBI 3FDTA 2JJQA 4HTHA 1PTOH 1RL2A 4IO9A 2I46A 1YI2A 4S3SA 1TY0A 1O78A 4P72A 5ELFA 3S1RH 1S5ED 5C4HA 1LT5D 1STYA 1TWGH 4JI5L 1I5FA 3BVGA 2D0PA 2Z8LA 4JI1L 3J7YW 1HQRD 1HZCA 4GKKL 1SMYD 2YTXA 3R2TA 3PUZA 3IKJA 2WIIB 2JN4A 4APVA 2CWPA 4JI5Q 1X56A 1QE6A 3GTJH 2K4KA 3NPPA 4NXML 5IP7G 2B2WA 3PO2H 3W1BA 5IGGA 4GKKQ 1KABA 2HT1A 4K14A 4A93G 2B63G 3C1FA 4JI8Q 2OTJA 4MTNA 1SDFA 4NXMQ 4DUZL 3M4YA 3KLSA 3DMUA 3HKZE 3HOVG 1B1ZA 1MD2D 4B3ML 2IX0A 4I65A 5M3FG 4HIDA 3HOVH 1BDOA 5E4XA 3VYUA 5M3FH 5EKIA 1S3OA 2ZXRA 1SYCA 4LUZA 5J1ZA 4DUZQ 4B3MQ 1KNEA 3T1YQ 1NY4A 3KLWA 5ELOA 1SR3A 2EYFA 1JC7A 3BDCA 2JA7G 3TBIB 3PIO3 2EXZA 3RMHA 3A56A 3BYTB 4CKEA 2JA7H 2A73B 1JOKA 2MGSA 2CKZB 2RVLA 5FKAC 1OXUA 4RA8A 4TRDA 1TWHH 3OMCA 1B44D 2QEJC 2MO1A 2Z1CA 1WOCA 1OXVA 3FKIG 1P8LA 1XNRL 3CD6A 2XVSA 4BWGB 1K3BC 1BNZA 2PPBC 1UE5A 3NBHB 4G7OC 1IW7D 4C3HG 4C3HH 3KDFB 4RWSC 4JI6L 3TS2A 1JMCA 1LUZA 4B9WA 5IT9L 2XGTA 2Q8RE 4A3GB 1A62A 4XYQA 2Z6BA 5EPLA 1LO5D 2AKWB 4ZK9B 1PMRA 1STAA 4RGNA 3F8TA 4B3TQ 4JI6Q 2NB0A 4EQOA 1PYBA 1VDZA 1IBLL 4HMJA 5CMDA 3W1GA 2F4IA 1CT1D 3RZOH 5JEAJ 5IGFA 5ELEA 1IBLQ 3CCMA 3AB9A 3A54A 4QCLA 4KD3A 1XMOL 2A6HD 1V1PA 3M4PA 2DGYA 4BY1G 3PCOB 4BY1H 4ZAIA 4LMQD 1R4QB 1Z9FA 1SFOH 3SR1A 2WINB 4QGUA 1VQJA 4IJLA 5G3LF 1EY4A 4C1NI 1LT4D 1PYSB 3J81L 2O5IC 2EDGA 1Y14B 1PRTD 4LAAA 3I91A 5KEEA 1N8RC 2PQEA 1N34L 1IKMA 1SE4A 3QB3A 4QUFA 3GV6A 2K6AA 3PGZA 4AYBB 1Z6HA 3VDYA 3F2BA 4X3TA 4XTCS 2N8NA 2QDLA 4X62Q 4JV5L 1L2FA 3V2TA 3ERSX 1Q90A 1X6OA 4AIMA 4A3EH 1O7ZA 1A8VA 3STBC 3FVQA 2V4DA 4A3BH 2H4OA 4BA2I 4JV5Q 5LMNW 2F0TA 5JJKA 3A5ZB 2WAQE 4A3GG 2K1BA 2Z9HA 3GTLB 2F0IA 4KJNA 4BBRB 4I7ZC 1BXTA 4HJ9A 1ZYRC 2A69D 1VQ9A 1YEZA 3CF5A 1HFGA 3E5SA 2ZJPA 4AQYL 3DUZA 1J6QA 4LFBQ 3GO5A 2F0EA 1RTOA 2E2HB 2C5CA 1K28A 2UUBQ 3MXNB 3Q24A 1I6VC 3RLNA 5KYLA 4IUNA 2KEDA 4IFDJ 2GVAA 1PTOC 2L1BA 1K83H 3NXWA 3UDXA 3I56A 3VR4A 1G2SA 3QG1A 2EYMA 4FO2A 1ASZA 1SROA 4FVMA 5FJ8H 4DV4L 2O2LD 1VQKA 3CC2A 2XRQD 3R8BA 1UE7A 3AFPA 4YY3L 2EIFA 1BKBA 1U4RA 2F0WA 4AYBG 4DV4Q 2PQAA 2Z6KA 4LF5L 2K5WA 1KC8C 4JYAQ 4MN3A 2DNEA 3TDQA 2UXCL 4UHVA 2UXBL 3A55A 2HIVA 4HCSA 4BY7H 1EFID 1EY6A 3PUWA 2OWOA 2V1CC 1RF2D 1SYBA 4NB3A 1PZID 1EY8A 2UXCQ 1AE3A 2YTVA 1HZBA 4ZLTF 4NXNQ 5D3DA 1EIGA 5DM63 4KV6A 4GLVB 1U4LA 4UP8A 3I4NG 3K7AH 3DWAA 2VQFL 3I4NH 4JI7L 2K32A 3HOZB 1GUWA 1JB3A 1VQAA 2Z0SA 4HR7B 2E2JH 2L0CA 2VQFQ 2N49A 4JI7Q 1G51A 1DGSA 1M1KC 1B9MA 2B2TC 1RD9D 3NK9A 4K8IA 1ENAA 2XTIA 3PF5A 4B3RL 1A3TA 1L0YB 3S2HB 2OEOA 2DJFC 5EPJA 1I94L 4K6DA 3D4RA 2L55A 1UNSA 1TWCH 1NJIC 3PV0A 1X3FA 1C9OA 1E7ZA 2WV6D 3EQLC 4QB4A 3NQTA 4B3RQ 2F4VQ 1I94Q 1BF4A 2YTYA 3S16H 3NQIA 4LF8L 1HJPA 2NBFA 1Q8IA 5CV7A 4JI3L 3Q6SA 1W3SA 4DR2L 1P16A 2Q2UA 5K36G 4KY6A 1SSOA 1VQMA 4A3MG 3BG3A 4DV5L 4LF8Q 3PUXA 4A3MH 4JI3Q 2VB3X 3CKIB 3PIPA 5GQOA 4RAUC 1CZGA 2Z4IA 1K8OA 4YIJA 1WCMH 4KKSA 4N8X1 3U4ZA 1YNXA 3D0FA 3HRZC 1PVOA 3V05A 3D31A 3CXCA 1SYDA 3Q22A 2JSOA 2EYOA 1QNKA 1YVCA 1U0LA 3TEHB 2F0HA 1QZGA 3S2DH 1NTGA 3E0EA 1JB7A 2XNAC 3ND9A 1SRUA 3H6MA 5IODA 4UPAA 3NTHA 1A0IA 4JI4L 1ET6A 4CKCA 1Q7YC 1IL8A 3SVMA 3MEHA 1EZ8A 3PIOA 1STGA 3I90A 4R1JA 1SE3A 3FHWA 1OXSC 4WJWA 4DFAA 5J3BA 1R9TB 2AQ3B 3RN5A 1CHQD 5LL6X 4FF1A 5G3LD 4OONA 2YU9B 2RQXA 3S1NH 4JI4Q 5IGEA 3CMAA 2HCCA 5NUCA 2AHOB 1HNXQ 4EQPA 2DN8A 1B70B 3SHLA 4R8IA 2K28A 3NP8A 2KOLA 1TXYA 4DNTB 3OSOA 4A3CG 3ERQA 3J7AV 4K0KL 4OEMB 2RKSA 4OELB 3J80L 3TP7A 2NVYH 3IRBA 2Q2TA 1QVFA 3MEFA 1V43A 2C9OA 1C4QA 4V0BA 1V1QA 3EFXD 4DV0L 1IYJB 1YNND 3KF8B 4IZ8A 1EY0A 1H9SA 3PQIA 1GUSA 4ZQ3A 4HJ5A 4IUPA 2KUMA 1AZQA 3NBHA 3FRPB 2H5XA 1AE2A 5C4XB 1CSPA 1Y8NB 1GUGA 3S17B 3HOXB 2R7ZH 4DV1L 2KJXA 1BQQT 4ODGA 1NBWA 3RLOA 3KDFA 4POGA 2NN6I 3OW2A 1EOTA 4PZ8A 2UU9L 4OWWB 4DPGA 1WTWA 1IHZA 3Q8DA 3TQYA 3OTOL 2EYJA 2LY7A 4FP5D 1XNQQ 4DV1Q 1VQCA 3HKZG 5C0XI 2K14A 3VYRA 4JOIA 4HEDA 2EJGC 2UU9Q 2VUMH 4CDDC 5JAVA 5IWAQ 4LUVA 3MZ5A 2EZVA 1HFNA 1Q86C 1L0WA 1XTDA 4P75A 1AEXA 4HCEA 1VQPA 4AYBE 3EVQA 1L0XB 4XT1B 4CJ2C 3U9OA 4JBMA 3I4MH 1ESFA 3E9IA 5JOBA 3OIQA 1WD1A 4QL5A 3S14B 2K5VA 2CH4W 2F3VA 3VR2A 4CDEC 3S15B 2NTTA 1WD0A 1LM0A 3NWTA
chains in the Genus database with same CATH topology
1N9WA 1TWGH 4JI5L 1I5FA 3JAMi 1YHQA 2D0PA 2HHHL 2R93H 4YHHL 5GAHC 3K80C 4JI1L 4EQ5A 1PA6A 4DV3L 1CKNB 2AWNA 2LSSA 3AYHB 3F2CA 1HZCA 4YWMA 4DUYL 4GKKL 1HNWQ 2YTXA 4DR6Q 1KAWA 1IBKQ 3PUZA 2R92H 4APVA 2Y0SG 2CWPA 1N34Q 1X56A 2LXKA 1PH2A 4JI5Q 1Q46A 1SN8A 3GTJH 2NZOA 2K4KA 3KYHC 4B3SL 1Q1BA 1PH5A 1UE1A 4NXML 1AH9A 4A3EG 5IP7G 3CMEA 4JC0A 3PO2H 3W1BA 2MNAA 4DUYQ 4GKKQ 4A3BG 4DAYB 1XMQL 2HT1A 4A93G 3BZCA 2B63G 4JI8Q 2EQSA 1E1TA 5H1SE 1PH9A 4MTNA 2OTJA 1YJWA 3HOWG 1RIPA 3PUVA 3J80c 2RCNA 1Q81C 4JBKA 4NXMQ 3HOXG 4DUZL 3HOWH 4WJ4A 1FL0A 3JC66 2WFWA 3HKZE 3HOVG 2B29A 4B3ML 3HOZG 2IX0A 1XMQQ 1G6PA 1CKMA 3CCSA 4RMFA 5M3FG 1GO3E 1TWAH 2K75A 1X3EA 3H15A 4HIDA 1J5EQ 3HOVH 2JK8A 3M3YH 3HOZH 4P74A 5M3FH 2NVXH 4RG1A 5FLXc 1E3PA 1S3OA 5IYCG 4LUZA 4DV2L 2R7FA 4DUZQ 4LFCL 2JA5G 3H0GH 4ALPA 4X65L 2YV5A 4B3MQ 3CW2C 2BH8A 2Z6KC 1EUJA 4JG2A 1NY4A 3T1YQ 1EQQA 2JA5H 3KLWA 5ELOA 1SR3A 1V9PA 4J15A 4R4TA 1EIYB 1E24A 2GN5A 4X64Q 4DV2Q 1HNXL 1EWIA 2JA7G 3ULPA 2VW9A 3H3VH 4LFCQ 1L1OB 5GROA 4X65Q 3A5UA 4AQYQ 4JI2L 3CQZH 2JA6H 1N36L 2JA7H 2JEAI 1KIXA 1KQSA 1LYLA 4GN3B 3S2HH 1JJCB 2CKZB 2K52A 4A3JG 3UE0A 2NN6G 1PFSA 1CUKA 1OXUA 1Y1VH 4PZ7A 1TWHH 1VQOA 3HOYG 4JI2Q 2WP8J 4C3IH 4LF4L 4A3DG 1VQFA 1N36Q 4GNXB 2D0OA 5FJ8G 2MO1A 4IPHA 5C0XG 1WOCA 1OXVA 1JJ2A 3HOYH 4A3DH 1Z47A 3FKIG 1P8LA 1XNRL 1KRSA 2ASBA 4DKAC 3PSIA 4OX9L 1VQBA 3CD6A 2L15A 4A3CH 2ZM6L 3ER0A 4IFDG 2NVQH 1UE5A 3NBHB 4YWKA 2OQKA 3B6YA 4C2MH 4GNXA 2BA1A 1D8LA 1TWFH 4OX9Q 1VQEA 3AQQA 4C3HH 1KHIA 2ZM6Q 1EFWA 3KDFB 1B8AA 3E9HA 2E2IH 1BVSA 4JI6L 3TS2A 4YY3Q 2VS1A 3I2ZA 5LMUL 2KBNA 1JMCA 4BY7G 1LUZA 4NPSA 2KHJA 2XGTA 3CAMA 1A62A 1XNQL 4QIWE 3GTQH 3NELA 5M3MG 3U4VA 2AKWB 4JI6Q 4B3TQ 4GLAC 3F8TA 5LMUQ 4LF5Q 4IOCA 1PYBA 1G291 2CFMA 2HIXA 5IWAL 1IBLL 2HQLA 2ATWA 2UXBQ 1K8AC 3K7UC 3W1GA 1HZAA 4DNIA 5C4JH 3RZOH 2K5HA 3NENA 3KF6B 4A75A 1N32L 5JEAJ 4DR5Q 1VCIA 1WI5A 4A3KG 5AJ3L 3CCMA 1IBLQ 4DV6L 2KCMA 3S24A 4L5SA 4FDBA 5HGQA 3GTMH 4GOPC 1XMOL 2E8GA 1NMGA 1B7YB 3BU2A 3UDGA 3M4PA 2DGYA 4BY1G 3S1MH 3PCOB 1XJVA 1QVCA 5AJ3Q 4DV6Q 4BY1H 2PNHA 2OCEA 1Z9FA 2QGQA 2R7DA 3LGJA 4O2DA 4PZ6A 1X65A 4QGUA 1KL9A 1YZ6A 3G71A 1R9TH 1C7YA 1VQJA 2NVTH 1M90C 1JJGA 1VS0A 4IJLA 5M5YH 1IXRA 2YU9H 2ZJRA 3RNUA 1HNWL 4HJAA 1PYSB 1VQHA 1IL2A 1Q82C 1Y14B 2IY5B 5IYDG 1N8RC 1LTLA 2OQ0A 1N34L 1N33L 4HJ7A 4BBSH 2ALYB 2RF4A 3RZDH 3AFQA 1GKHA 3GDEA 5C3EG 1VQ4A 1PH4A 4L5RC 3M7NA 3PGZA 3VDYA 3F2BA 4XTCS 2AWOA 2N8NA 5JJLA 4JI8L 1N33Q 5IE8A 4X62Q 1X9NA 3KJPA 3RR5A 1VQNA 1HZ9A 4GS3A 4JV5L 3PF4A 2A8VA 1L2FA 3HFZB 1K9MC 1I50H 3ERSX 1IBML 3L2PA 4A3EH 1X6OA 2FXQA 4AIMA 3WWVA 3J80i 5IP7H 1A8VA 3STBC 4POFA 2I5HA 5IY0A 4R4OA 2Q2HA 1J5EL 4LF6L 3GTOH 2WB1G 4A3BH 4BA2I 5LMNW 4JV5Q 5C4XG 4A93H 5JJKA 2B63H 4OWTB 5M5WH 3A5ZB 2WAQE 4A3GG 1JE5A 1IBMQ 4WJ3M 3JAMc 3TREA 1MIUA 2MO0A 3S17H 4HJ9A 3HOXH 3CCEA 3T1YL 4DR2Q 4LF6Q 2N3SA 1VQ7A 1K8GA 1VQLA 1VQ9A 1WCMG 1YEZA 4X64L 1VQIA 4KHPQ 3CF5A 4DV5Q 1QZHA 2VY3A 3G6EA 4LW1A 4X66L 1JT8A 1E1OA 2ZJPA 4AQYL 3CCLA 5IYCH 3K0XA 1PH3A 1HR0W 1EYGA 1J6QA 3CP0A 1L1OC 5IT9c 1GM5A 4LFBQ 4MZ9A 3GO5A 3RN2A 1KRTA 4DR4L 2ZJQA 4QQBX 3M9BA 1BBWA 1NE3A 3EBEA 3ZJYC 3S1QH 4DR3Q 2NZHA 5C0XJ 3MXNB 4X66Q 5GADC 3M85A 2UUBQ 1K3RA 4KI0A 3UDFA 1N32Q 2RHSB 2RHQB 2I5MX 4LUOA 4JI0Q 3RLNA 4BXXG 4GNXC 4DR4Q 3I7FA 4YCWA 3PO3G 4OWXB 4IFDJ 4BXXH 4A3JH 2KENA 3U50C 3PO3H 2GVAA 1UE6A 1K83H 3I56A 4PMWA 1X3GA 4MNOA 3UDXA 4GLXA 1ASZA 1SROA 3CCVA 5IP9G 4LWCA 5FJ8H 3EN2A 3S14H 4A3LG 1Y1WG 4KHZA 4DV4L 1O7IA 5IP9H 1VQKA 3CC7A 2ES2A 2Y0SE 3FKIH 3CC2A 1FJGL 2LXJA 3S15H 4A3LH 3J7A5 4A3IG 4A3FG 3L7ZC 1UE7A 3AFPA 4YY3L 2EIFA 4A3IH 3TS0A 1BKBA 3CCJA 4AYBG 4DV4Q 1VQ8A 4KLKA 2E5LL 1HR0Q 1FJGQ 2PQAA 2AMCB 4Y7NH 2PMZE 3U58A 2Z6KA 1YHBA 3J81c 1YITA 4B3TL 4Y52H 4JOIC 3I4OA 4LF5L 1A63A 1T9HA 1KC8C 4JYAQ 5ELNA 2UXCL 2UXBL 2E5LQ 2OTLA 1MKHA 2HIVA 4BY7H 5JJIA 4UY8C 1K73C 3PUWA 4DR5L 3RLFA 2OWOA 2V1CC 5C44G 1NMFA 1D7QA 5M3MH 4NB3A 3J7ZC 3GTKH 5C44H 5BR8L 2UXCQ 1QVGA 1PH8A 1AE3A 2UUCQ 2YTVA 5IYBG 4K0KQ 1HZBA 2I5LX 4H02A 4NXNQ 4QJFA 1HH2P 2R6GA 2VQEQ 2UXDQ 4GLVB 3ULLA 1SMXA 4ME3A 3H3VI 2R7ZG 4TQUS 1MJCA 4UP8A 3I4NG 4DR7Q 3K7AH 5BR8Q 4DV0Q 4A3KH 1C0AA 2VQFL 1KD1C 3I4NH 2GVBA 4OXPA 4JI7L 3HOUG 4IPDA 2CQOA 1HNZQ 4LNQA 3KJOA 4QY7A 3HOUH 1VQAA 2ZTEA 2Z0SA 1WJJA 5EAYA 2E2JH 2VQFQ 2QA4A 2N49A 3CPWA 3K8AA 1G51A 4JI7Q 1DGSA 1M1KC 1IZ6A 2VUMG 1OXTA 3A74A 3ICEA 3OYYA 3CCQA 2XTIA 3OTOQ 3PF5A 1OXXK 4B3RL 4X62L 4IFDI 4PG3A 1YBYA 1YJNA 1CSQA 1I94L 4LF7L 5IYDH 3CPFA 5E7NA 4P71A 3CCRA 2ZTCA 4JBWA 2A19A 3I4MG 1TWCH 1NJIC 3F1ZA 1OTCA 4DAMA 4IOAA 1X3FA 3PV0A 1C9OA 1E7ZA 4L5TA 4B3RQ 5C3EH 2F3IA 2F4VQ 5GAGC 1EIFA 3GD7A 2VNUD 1I94Q 4GKJL 1Q12A 4LF7Q 2YTYA 2PI2E 4GN5A 3S16H 2MFIA 4BA1I 4LF8L 1GD7A 1HJPA 1MJEA 1VQ5A 3KFUA 2F52A 3TRZA 1I3QH 4JI3L 4DV7L 3K81C 1W3SA 4DR2L 2R93G 1P16A 2A1AA 4HJ8A 4GOPA 2Q2UA 1FVIA 4UP7A 5K36G 4GKJQ 4AH6A 1VQMA 2IT1A 4A3MG 4KHPL 4A4IA 2B3GA 3PUXA 4L5QA 5HY6A 5C4XH 4DV5L 1PH7A 4LF8Q 2R92G 2DUDA 4A3MH 1W2BA 4A3GH 4DV7Q 4JI3Q 4LFBL 3PIPA 4GN4B 5GQOA 4JBJA 3DLLA 1PH1A 2HHHQ 3PO2G 4YHHQ 4LF9L 1Q8KA 1PHJA 4JI1Q 5FLMG 4DR3L 4DV3Q 2UUBL 1WCMH 1CKNA 1WFQA 2K50A 5FLMH 2I0QA 2QEXA 2BA0A 1QUQB 4TVAB 3U4ZA 1YNXA 3D0FA 4JI0L 1WYDA 2YYZA 4YCVA 1PVOA 4B3SQ 4LF9Q 1H95A 3D31A 2IHFA 1K0RA 4IJHA 1CKOA 3CXCA 4IPGA 1YHAA 1YVCA 1U0LA 2ZTDA 2PI2A 3TEHB 5LMNL 1QZGA 1U5KA 2N78A 4OO1I 3S2DH 1QUQA 3CC4A 1NTGA 3E0EA 2K5NA 1JB7A 3G48A 2C35B 2IHEA 3H0GG 1SRUA 1KXLA 3T1HL 4UPAA 2MQHA 1FGUA 5LMNQ 1VQGA 2CCZA 3F2DA 1A0IA 3BZKA 3EIVA 4UP9A 3GTPH 4HIOA 4JI4L 3J81j 1Q7YC 2JA6G 2PQAB 3ULJA 3PIOA 4R1JA 1HR0L 3G4SA 3T1HQ 3FHWA 1Y1WH 3SGIA 1OXSC 1SLJA 5J3BA 4A76A 3RN5A 2VZAA 2Q2IA 1Y1VG 4OONA 4R4CA 1XPOA 4A3FH 3S1NH 4JI4Q 2JE6I 4JYAL 4HIKA 3CMAA 3J81i 4X6AH 2AHOB 4R4IA 1X54A 1HNXQ 4EX5A 1B70B 1XPUA 2WB1E 1VQ6A 1L1OA 4P73A 1TXYA 1I6HH 4A3CG 3I55A 3BJUA 2UUCL 4K0KL 4DK6C 4NXNL 2KCTA 4LF4Q 2VQEL 2UUAL 2NVYH 3IRBA 4O0AA 1PV4A 2UXDL 2Q2TA 5GAEC 4BBRG 3MEFA 1V43A 4DR7L 5M5XH 1XNRQ 3STBD 1V1QA 4DV0L 1IYJB 3GTLH 1X55A 4BBRH 4YCUA 3KF8B 3A0JA 2UUAQ 2IX1A 5IYBH 4HJ5A 1HNZL 3W5OA 3M4OH 2H5XA 1AE2A 1YIJA 1CSPA 2JA8G 4IPCA 4BBSG 3NEMA 1BBUA 1UEBA 4DR1L 2R7ZH 2KHIA 4DV1L 2VL6A 2JA8H 4C3JH 1XPRA 1NBWA 3RLOA 3KDFA 1EOVA 2NN6I 3OW2A 2UU9L 4PZ8A 4POGA 3HKSA 4OWWB 1Q1EA 4DPGA 3Q8DA 3TQYA 3OTOL 4DK3C 2E2HH 2WAQG 4YWLA 4DR1Q 3AEVA 4LFAL 4DV1Q 1GVPA 1XNQQ 1EQRA 2EXDA 1VQCA 3HKZG 4XIGS 2BH2A 2D62A 5C0XI 3PUYA 2K14A 3KOJA 4JOIA 4HIMA 5DLQE 2UU9Q 3L0OA 1YJ9A 2VUMH 2ID0A 5IWAQ 4R4QA 4LUVA 3UDIA 3FP9A 3CCUA 1SFOH 4LFAQ 3M4QA 1Q86C 2F4VL 1L0WA 1PH6A 1XTDA 4JCVE 4P75A 1ASYA 1SE8A 1VQDA 1VQPA 3KF6A 4AYBE 2JEBI 2JJQA 2JQOA 5JEAG 3DM3A 1RL2A 4IO9A 4GOPB 4JBMA 3I4MH 1YI2A 3E9IA 3UE1A 2CWAA 1XMOQ 4P72A 4OO1G 1E22A 4QL5A 2K5VA 3S1RH 2JA9A 3GTGH 1UWVA 4DR6L 1IBKL 1LM0A 1QVFA 1S72A 1S40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9W A;  1TWG H;  4JI5 L;  1I5F A;  3JAM i;  1YHQ A;  2D0P A;  2HHH L;  2R93 H;  4YHH L;  5GAH C;  3K80 C;  4JI1 L;  4EQ5 A;  1PA6 A;  4DV3 L;  1CKN B;  2AWN A;  2LSS A;  3AYH B;  3F2C A;  1HZC A;  4YWM A;  4DUY L;  4GKK L;  1HNW Q;  2YTX A;  4DR6 Q;  1KAW A;  1IBK Q;  3PUZ A;  2R92 H;  4APV A;  2Y0S G;  2CWP A;  1N34 Q;  1X56 A;  2LXK A;  1PH2 A;  4JI5 Q;  1Q46 A;  1SN8 A;  3GTJ H;  2NZO A;  2K4K A;  3KYH C;  4B3S L;  1Q1B A;  1PH5 A;  1UE1 A;  4NXM L;  1AH9 A;  4A3E G;  5IP7 G;  3CME A;  4JC0 A;  3PO2 H;  3W1B A;  2MNA A;  4DUY Q;  4GKK Q;  4A3B G;  4DAY B;  1XMQ L;  2HT1 A;  4A93 G;  3BZC A;  2B63 G;  4JI8 Q;  2EQS A;  1E1T A;  5H1S E;  1PH9 A;  4MTN A;  2OTJ A;  1YJW A;  3HOW G;  1RIP A;  3PUV A;  3J80 c;  2RCN A;  1Q81 C;  4JBK A;  4NXM Q;  3HOX G;  4DUZ L;  3HOW H;  4WJ4 A;  1FL0 A;  3JC6 6;  2WFW A;  3HKZ E;  3HOV G;  2B29 A;  4B3M L;  3HOZ G;  2IX0 A;  1XMQ Q;  1G6P A;  1CKM A;  3CCS A;  4RMF A;  5M3F G;  1GO3 E;  1TWA H;  2K75 A;  1X3E A;  3H15 A;  4HID A;  1J5E Q;  3HOV H;  2JK8 A;  3M3Y H;  3HOZ H;  4P74 A;  5M3F H;  2NVX H;  4RG1 A;  5FLX c;  1E3P A;  1S3O A;  5IYC G;  4LUZ A;  4DV2 L;  2R7F A;  4DUZ Q;  4LFC L;  2JA5 G;  3H0G H;  4ALP A;  4X65 L;  2YV5 A;  4B3M Q;  3CW2 C;  2BH8 A;  2Z6K C;  1EUJ A;  4JG2 A;  1NY4 A;  3T1Y Q;  1EQQ A;  2JA5 H;  3KLW A;  5ELO A;  1SR3 A;  1V9P A;  4J15 A;  4R4T A;  1EIY B;  1E24 A;  2GN5 A;  4X64 Q;  4DV2 Q;  1HNX L;  1EWI A;  2JA7 G;  3ULP A;  2VW9 A;  3H3V H;  4LFC Q;  1L1O B;  5GRO A;  4X65 Q;  3A5U A;  4AQY Q;  4JI2 L;  3CQZ H;  2JA6 H;  1N36 L;  2JA7 H;  2JEA I;  1KIX A;  1KQS A;  1LYL A;  4GN3 B;  3S2H H;  1JJC B;  2CKZ B;  2K52 A;  4A3J G;  3UE0 A;  2NN6 G;  1PFS A;  1CUK A;  1OXU A;  1Y1V H;  4PZ7 A;  1TWH H;  1VQO A;  3HOY G;  4JI2 Q;  2WP8 J;  4C3I H;  4LF4 L;  4A3D G;  1VQF A;  1N36 Q;  4GNX B;  2D0O A;  5FJ8 G;  2MO1 A;  4IPH A;  5C0X G;  1WOC A;  1OXV A;  1JJ2 A;  3HOY H;  4A3D H;  1Z47 A;  3FKI G;  1P8L A;  1XNR L;  1KRS A;  2ASB A;  4DKA C;  3PSI A;  4OX9 L;  1VQB A;  3CD6 A;  2L15 A;  4A3C H;  2ZM6 L;  3ER0 A;  4IFD G;  2NVQ H;  1UE5 A;  3NBH B;  4YWK A;  2OQK A;  3B6Y A;  4C2M H;  4GNX A;  2BA1 A;  1D8L A;  1TWF H;  4OX9 Q;  1VQE A;  3AQQ A;  4C3H H;  1KHI A;  2ZM6 Q;  1EFW A;  3KDF B;  1B8A A;  3E9H A;  2E2I H;  1BVS A;  4JI6 L;  3TS2 A;  4YY3 Q;  2VS1 A;  3I2Z A;  5LMU L;  2KBN A;  1JMC A;  4BY7 G;  1LUZ A;  4NPS A;  2KHJ A;  2XGT A;  3CAM A;  1A62 A;  1XNQ L;  4QIW E;  3GTQ H;  3NEL A;  5M3M G;  3U4V A;  2AKW B;  4JI6 Q;  4B3T Q;  4GLA C;  3F8T A;  5LMU Q;  4LF5 Q;  4IOC A;  1PYB A;  1G29 1;  2CFM A;  2HIX A;  5IWA L;  1IBL L;  2HQL A;  2ATW A;  2UXB Q;  1K8A C;  3K7U C;  3W1G A;  1HZA A;  4DNI A;  5C4J H;  3RZO H;  2K5H A;  3NEN A;  3KF6 B;  4A75 A;  1N32 L;  5JEA J;  4DR5 Q;  1VCI A;  1WI5 A;  4A3K G;  5AJ3 L;  3CCM A;  1IBL Q;  4DV6 L;  2KCM A;  3S24 A;  4L5S A;  4FDB A;  5HGQ A;  3GTM H;  4GOP C;  1XMO L;  2E8G A;  1NMG A;  1B7Y B;  3BU2 A;  3UDG A;  3M4P A;  2DGY A;  4BY1 G;  3S1M H;  3PCO B;  1XJV A;  1QVC A;  5AJ3 Q;  4DV6 Q;  4BY1 H;  2PNH A;  2OCE A;  1Z9F A;  2QGQ A;  2R7D A;  3LGJ A;  4O2D A;  4PZ6 A;  1X65 A;  4QGU A;  1KL9 A;  1YZ6 A;  3G71 A;  1R9T H;  1C7Y A;  1VQJ A;  2NVT H;  1M90 C;  1JJG A;  1VS0 A;  4IJL A;  5M5Y H;  1IXR A;  2YU9 H;  2ZJR A;  3RNU A;  1HNW L;  4HJA A;  1PYS B;  1VQH A;  1IL2 A;  1Q82 C;  1Y14 B;  2IY5 B;  5IYD G;  1N8R C;  1LTL A;  2OQ0 A;  1N34 L;  1N33 L;  4HJ7 A;  4BBS H;  2ALY B;  2RF4 A;  3RZD H;  3AFQ A;  1GKH A;  3GDE A;  5C3E G;  1VQ4 A;  1PH4 A;  4L5R C;  3M7N A;  3PGZ A;  3VDY A;  3F2B A;  4XTC S;  2AWO A;  2N8N A;  5JJL A;  4JI8 L;  1N33 Q;  5IE8 A;  4X62 Q;  1X9N A;  3KJP A;  3RR5 A;  1VQN A;  1HZ9 A;  4GS3 A;  4JV5 L;  3PF4 A;  2A8V A;  1L2F A;  3HFZ B;  1K9M C;  1I50 H;  3ERS X;  1IBM L;  3L2P A;  4A3E H;  1X6O A;  2FXQ A;  4AIM A;  3WWV A;  3J80 i;  5IP7 H;  1A8V A;  3STB C;  4POF A;  2I5H A;  5IY0 A;  4R4O A;  2Q2H A;  1J5E L;  4LF6 L;  3GTO H;  2WB1 G;  4A3B H;  4BA2 I;  5LMN W;  4JV5 Q;  5C4X G;  4A93 H;  5JJK A;  2B63 H;  4OWT B;  5M5W H;  3A5Z B;  2WAQ E;  4A3G G;  1JE5 A;  1IBM Q;  4WJ3 M;  3JAM c;  3TRE A;  1MIU A;  2MO0 A;  3S17 H;  4HJ9 A;  3HOX H;  3CCE A;  3T1Y L;  4DR2 Q;  4LF6 Q;  2N3S A;  1VQ7 A;  1K8G A;  1VQL A;  1VQ9 A;  1WCM G;  1YEZ A;  4X64 L;  1VQI A;  4KHP Q;  3CF5 A;  4DV5 Q;  1QZH A;  2VY3 A;  3G6E A;  4LW1 A;  4X66 L;  1JT8 A;  1E1O A;  2ZJP A;  4AQY L;  3CCL A;  5IYC H;  3K0X A;  1PH3 A;  1HR0 W;  1EYG A;  1J6Q A;  3CP0 A;  1L1O C;  5IT9 c;  1GM5 A;  4LFB Q;  4MZ9 A;  3GO5 A;  3RN2 A;  1KRT A;  4DR4 L;  2ZJQ A;  4QQB X;  3M9B A;  1BBW A;  1NE3 A;  3EBE A;  3ZJY C;  3S1Q H;  4DR3 Q;  2NZH A;  5C0X J;  3MXN B;  4X66 Q;  5GAD C;  3M85 A;  2UUB Q;  1K3R A;  4KI0 A;  3UDF A;  1N32 Q;  2RHS B;  2RHQ B;  2I5M X;  4LUO A;  4JI0 Q;  3RLN A;  4BXX G;  4GNX C;  4DR4 Q;  3I7F A;  4YCW A;  3PO3 G;  4OWX B;  4IFD J;  4BXX H;  4A3J H;  2KEN A;  3U50 C;  3PO3 H;  2GVA A;  1UE6 A;  1K83 H;  3I56 A;  4PMW A;  1X3G A;  4MNO A;  3UDX A;  4GLX A;  1ASZ A;  1SRO A;  3CCV A;  5IP9 G;  4LWC A;  5FJ8 H;  3EN2 A;  3S14 H;  4A3L G;  1Y1W G;  4KHZ A;  4DV4 L;  1O7I A;  5IP9 H;  1VQK A;  3CC7 A;  2ES2 A;  2Y0S E;  3FKI H;  3CC2 A;  1FJG L;  2LXJ A;  3S15 H;  4A3L H;  3J7A 5;  4A3I G;  4A3F G;  3L7Z C;  1UE7 A;  3AFP A;  4YY3 L;  2EIF A;  4A3I H;  3TS0 A;  1BKB A;  3CCJ A;  4AYB G;  4DV4 Q;  1VQ8 A;  4KLK A;  2E5L L;  1HR0 Q;  1FJG Q;  2PQA A;  2AMC B;  4Y7N H;  2PMZ E;  3U58 A;  2Z6K A;  1YHB A;  3J81 c;  1YIT A;  4B3T L;  4Y52 H;  4JOI C;  3I4O A;  4LF5 L;  1A63 A;  1T9H A;  1KC8 C;  4JYA Q;  5ELN A;  2UXC L;  2UXB L;  2E5L Q;  2OTL A;  1MKH A;  2HIV A;  4BY7 H;  5JJI A;  4UY8 C;  1K73 C;  3PUW A;  4DR5 L;  3RLF A;  2OWO A;  2V1C C;  5C44 G;  1NMF A;  1D7Q A;  5M3M H;  4NB3 A;  3J7Z C;  3GTK H;  5C44 H;  5BR8 L;  2UXC Q;  1QVG A;  1PH8 A;  1AE3 A;  2UUC Q;  2YTV A;  5IYB G;  4K0K Q;  1HZB A;  2I5L X;  4H02 A;  4NXN Q;  4QJF A;  1HH2 P;  2R6G A;  2VQE Q;  2UXD Q;  4GLV B;  3ULL A;  1SMX A;  4ME3 A;  3H3V I;  2R7Z G;  4TQU S;  1MJC A;  4UP8 A;  3I4N G;  4DR7 Q;  3K7A H;  5BR8 Q;  4DV0 Q;  4A3K H;  1C0A A;  2VQF L;  1KD1 C;  3I4N H;  2GVB A;  4OXP A;  4JI7 L;  3HOU G;  4IPD A;  2CQO A;  1HNZ Q;  4LNQ A;  3KJO A;  4QY7 A;  3HOU H;  1VQA A;  2ZTE A;  2Z0S A;  1WJJ A;  5EAY A;  2E2J H;  2VQF Q;  2QA4 A;  2N49 A;  3CPW A;  3K8A A;  1G51 A;  4JI7 Q;  1DGS A;  1M1K C;  1IZ6 A;  2VUM G;  1OXT A;  3A74 A;  3ICE A;  3OYY A;  3CCQ A;  2XTI A;  3OTO Q;  3PF5 A;  1OXX K;  4B3R L;  4X62 L;  4IFD I;  4PG3 A;  1YBY A;  1YJN A;  1CSQ A;  1I94 L;  4LF7 L;  5IYD H;  3CPF A;  5E7N A;  4P71 A;  3CCR A;  2ZTC A;  4JBW A;  2A19 A;  3I4M G;  1TWC H;  1NJI C;  3F1Z A;  1OTC A;  4DAM A;  4IOA A;  1X3F A;  3PV0 A;  1C9O A;  1E7Z A;  4L5T A;  4B3R Q;  5C3E H;  2F3I A;  2F4V Q;  5GAG C;  1EIF A;  3GD7 A;  2VNU D;  1I94 Q;  4GKJ L;  1Q12 A;  4LF7 Q;  2YTY A;  2PI2 E;  4GN5 A;  3S16 H;  2MFI A;  4BA1 I;  4LF8 L;  1GD7 A;  1HJP A;  1MJE A;  1VQ5 A;  3KFU A;  2F52 A;  3TRZ A;  1I3Q H;  4JI3 L;  4DV7 L;  3K81 C;  1W3S A;  4DR2 L;  2R93 G;  1P16 A;  2A1A A;  4HJ8 A;  4GOP A;  2Q2U A;  1FVI A;  4UP7 A;  5K36 G;  4GKJ Q;  4AH6 A;  1VQM A;  2IT1 A;  4A3M G;  4KHP L;  4A4I A;  2B3G A;  3PUX A;  4L5Q A;  5HY6 A;  5C4X H;  4DV5 L;  1PH7 A;  4LF8 Q;  2R92 G;  2DUD A;  4A3M H;  1W2B A;  4A3G H;  4DV7 Q;  4JI3 Q;  4LFB L;  3PIP A;  4GN4 B;  5GQO A;  4JBJ A;  3DLL A;  1PH1 A;  2HHH Q;  3PO2 G;  4YHH Q;  4LF9 L;  1Q8K A;  1PHJ A;  4JI1 Q;  5FLM G;  4DR3 L;  4DV3 Q;  2UUB L;  1WCM H;  1CKN A;  1WFQ A;  2K50 A;  5FLM H;  2I0Q A;  2QEX A;  2BA0 A;  1QUQ B;  4TVA B;  3U4Z A;  1YNX A;  3D0F A;  4JI0 L;  1WYD A;  2YYZ A;  4YCV A;  1PVO A;  4B3S Q;  4LF9 Q;  1H95 A;  3D31 A;  2IHF A;  1K0R A;  4IJH A;  1CKO A;  3CXC A;  4IPG A;  1YHA A;  1YVC A;  1U0L A;  2ZTD A;  2PI2 A;  3TEH B;  5LMN L;  1QZG A;  1U5K A;  2N78 A;  4OO1 I;  3S2D H;  1QUQ A;  3CC4 A;  1NTG A;  3E0E A;  2K5N A;  1JB7 A;  3G48 A;  2C35 B;  2IHE A;  3H0G G;  1SRU A;  1KXL A;  3T1H L;  4UPA A;  2MQH A;  1FGU A;  5LMN Q;  1VQG A;  2CCZ A;  3F2D A;  1A0I A;  3BZK A;  3EIV A;  4UP9 A;  3GTP H;  4HIO A;  4JI4 L;  3J81 j;  1Q7Y C;  2JA6 G;  2PQA B;  3ULJ A;  3PIO A;  4R1J A;  1HR0 L;  3G4S A;  3T1H Q;  3FHW A;  1Y1W H;  3SGI A;  1OXS C;  1SLJ A;  5J3B A;  4A76 A;  3RN5 A;  2VZA A;  2Q2I A;  1Y1V G;  4OON A;  4R4C A;  1XPO A;  4A3F H;  3S1N H;  4JI4 Q;  2JE6 I;  4JYA L;  4HIK A;  3CMA A;  3J81 i;  4X6A H;  2AHO B;  4R4I A;  1X54 A;  1HNX Q;  4EX5 A;  1B70 B;  1XPU A;  2WB1 E;  1VQ6 A;  1L1O A;  4P73 A;  1TXY A;  1I6H H;  4A3C G;  3I55 A;  3BJU A;  2UUC L;  4K0K L;  4DK6 C;  4NXN L;  2KCT A;  4LF4 Q;  2VQE L;  2UUA L;  2NVY H;  3IRB A;  4O0A A;  1PV4 A;  2UXD L;  2Q2T A;  5GAE C;  4BBR G;  3MEF A;  1V43 A;  4DR7 L;  5M5X H;  1XNR Q;  3STB D;  1V1Q A;  4DV0 L;  1IYJ B;  3GTL H;  1X55 A;  4BBR H;  4YCU A;  3KF8 B;  3A0J A;  2UUA Q;  2IX1 A;  5IYB H;  4HJ5 A;  1HNZ L;  3W5O A;  3M4O H;  2H5X A;  1AE2 A;  1YIJ A;  1CSP A;  2JA8 G;  4IPC A;  4BBS G;  3NEM A;  1BBU A;  1UEB A;  4DR1 L;  2R7Z H;  2KHI A;  4DV1 L;  2VL6 A;  2JA8 H;  4C3J H;  1XPR A;  1NBW A;  3RLO A;  3KDF A;  1EOV A;  2NN6 I;  3OW2 A;  2UU9 L;  4PZ8 A;  4POG A;  3HKS A;  4OWW B;  1Q1E A;  4DPG A;  3Q8D A;  3TQY A;  3OTO L;  4DK3 C;  2E2H H;  2WAQ G;  4YWL A;  4DR1 Q;  3AEV A;  4LFA L;  4DV1 Q;  1GVP A;  1XNQ Q;  1EQR A;  2EXD A;  1VQC A;  3HKZ G;  4XIG S;  2BH2 A;  2D62 A;  5C0X I;  3PUY A;  2K14 A;  3KOJ A;  4JOI A;  4HIM A;  5DLQ E;  2UU9 Q;  3L0O A;  1YJ9 A;  2VUM H;  2ID0 A;  5IWA Q;  4R4Q A;  4LUV A;  3UDI A;  3FP9 A;  3CCU A;  1SFO H;  4LFA Q;  3M4Q A;  1Q86 C;  2F4V L;  1L0W A;  1PH6 A;  1XTD A;  4JCV E;  4P75 A;  1ASY A;  1SE8 A;  1VQD A;  1VQP A;  3KF6 A;  4AYB E;  2JEB I;  2JJQ A;  2JQO A;  5JEA G;  3DM3 A;  1RL2 A;  4IO9 A;  4GOP B;  4JBM A;  3I4M H;  1YI2 A;  3E9I A;  3UE1 A;  2CWA A;  1XMO Q;  4P72 A;  4OO1 G;  1E22 A;  4QL5 A;  2K5V A;  3S1R H;  2JA9 A;  3GTG H;  1UWV A;  4DR6 L;  1IBK L;  1LM0 A;  1QVF A;  1S72 A;  1S40 A; 
#chains in the Genus database with same CATH topology
 3JAM i;  4A3I B;  1V1O A;  2R93 H;  4YHH L;  5GAH C;  4HMI A;  3K80 C;  3OPO A;  4EQ5 A;  4DV3 L;  2LSS A;  3AYH B;  4ILW A;  4YWM A;  1HNW Q;  4DUY L;  3HG9 A;  1KAW A;  4Y7N B;  5C3W A;  1BR9 A;  1M8A A;  2CVR A;  3LWU A;  2R92 H;  3H94 A;  1SN8 A;  1F9P A;  1STB A;  1F77 A;  1Q1B A;  1PH5 A;  5TSS A;  1UE1 A;  1AH9 A;  2F0U A;  1F9R A;  4JC0 A;  4DUY Q;  3KBG A;  4DAY B;  1B3A A;  3M7G A;  3TP5 A;  2EQS A;  1PH9 A;  1YJW A;  2XN9 C;  2RCN A;  5M5X B;  3HOX G;  2O4X A;  1FL0 A;  3JC6 6;  4J6H A;  4ULL A;  3RD4 A;  2O5J C;  2B29 A;  1A3U A;  3CCS A;  4RMF A;  1TWA H;  2K75 A;  2B2U A;  2N55 A;  4RG1 A;  5FLX c;  5IYC G;  4A3K B;  1SEB D;  1DCZ A;  3DM1 A;  4LFC L;  2JA5 G;  3H0G H;  4X65 L;  3D3R A;  1EUJ A;  2JA5 H;  2RSO A;  1V9P A;  4J15 A;  4R4T A;  3IFD A;  3NBI A;  4OIK A;  2VW9 A;  3H3V H;  4LFC Q;  4X65 Q;  4JI2 L;  1KIX A;  2RCF A;  1LYL A;  2MHV A;  2K52 A;  1ICF B;  2NN6 G;  3D8G A;  1DD2 A;  2IW3 A;  3QJY A;  1B2T A;  3HOY G;  4JI2 Q;  4LF4 L;  2RDG A;  2D0O A;  5C0X G;  2F0L A;  5KGU A;  3HOY H;  1KLG D;  1JIC A;  2F03 A;  3PSI A;  4OX9 L;  1PTO B;  5JJZ A;  1CK1 A;  4YWK A;  4FXD A;  3ZYY X;  3B6Y A;  4GNX A;  2BA1 A;  4OL7 A;  4OX9 Q;  1VQE A;  3AQQ A;  4KKT A;  4QMG A;  3UI2 A;  1EFW A;  2E2I H;  1BVS A;  1JWU D;  2D9U A;  4IUU A;  2KBN A;  5C3X A;  4KKU A;  4G7Z C;  1EU4 A;  3G6J B;  1OO9 B;  4MIU A;  2P5Z X;  3NEL A;  5M3M G;  5CC4 A;  1LLR D;  4G4K A;  2HDL A;  4IOC A;  3PO2 B;  2HIX A;  4DXG A;  2E74 C;  3GTQ B;  5FO7 B;  1K8A C;  2I07 B;  4DNI A;  2NTS A;  4X3S A;  3TZU A;  2DJG C;  1QWY A;  1VMP A;  4A3K G;  3MFG A;  2LS0 1;  3BS1 A;  3SXH A;  3LNN A;  5HGQ A;  3P75 A;  1LTB D;  4GOP C;  2E8G A;  1NMG A;  1B7Y B;  3S1M H;  5CV8 A;  5M9O A;  4RCN A;  2PNH A;  3V96 A;  3LGJ A;  1V8Q A;  3GTP B;  2NZ1 D;  5CBA E;  5KND A;  4JW0 A;  1M90 C;  1BCP C;  5M5Y H;  2F1M A;  2ZJR A;  1RJT A;  3RNU A;  1IYV A;  1GUO A;  3Q0A A;  1N33 L;  3GQB A;  2DY8 A;  4HJ7 A;  1B50 A;  3ITP A;  1A2T A;  2EJM A;  4N9P A;  1GKH A;  5C3E G;  5I6W A;  3M7N A;  5CV5 A;  2AWO A;  3PIP 3;  4JI8 L;  1N33 Q;  3KJP A;  1VQN A;  4GS3 A;  2A8V A;  2F0S A;  1K9M C;  1IBM L;  2F0F A;  4N9T A;  1B4O A;  5IP7 H;  3WWV A;  4POF A;  1Q3L A;  2I5H A;  4OHJ A;  5IY0 A;  2SNS A;  4R4O A;  4LF6 L;  3GTO H;  1DM0 B;  4A93 H;  2B63 H;  5CBE E;  5M5W H;  1IBM Q;  3TRE A;  2TMP A;  2MJ8 A;  1ZXT A;  4KJO A;  3T1Y L;  4LF6 Q;  1SYE A;  2A68 D;  4KHP Q;  2VY3 A;  3G6E A;  3OWF A;  4X66 L;  2JA8 B;  1EYG A;  4C3J B;  5IT9 c;  1L1O C;  1GM5 A;  5ELB A;  4MZ9 A;  4KY5 A;  3RN2 A;  4DR4 L;  1QG7 A;  3M9B A;  2NUC A;  3S1Q H;  4X66 Q;  3UDF A;  4LUO A;  1U9R A;  1VF7 A;  4G7H C;  4DR4 Q;  4IUV A;  4RKL A;  2B2Y C;  2K5D A;  1CZW A;  4GLX A;  1X3G A;  2KHS A;  2RBM A;  4ZKB B;  4IN3 A;  4A3L G;  4KHZ A;  4QUC A;  3FKI H;  4A3L H;  2LXJ A;  5ISR A;  1XTC D;  4UDU C;  3WOE A;  2AQ1 B;  3MA2 B;  1K8M A;  3TS0 A;  3GTG B;  2LKV A;  1VQ8 A;  1PYW D;  1HR0 Q;  4CGY B;  2AMC B;  1SMY C;  3J81 c;  2MPM A;  4B3T L;  3SK5 A;  5HUR A;  2RA4 A;  4UY8 C;  2QKI C;  5EQ0 A;  3KLR A;  1LV9 A;  4IQZ A;  1NMF A;  1JOQ A;  3EJI A;  1QVG A;  1SJH D;  2UUC Q;  2I5L X;  4J8Q A;  1HH2 P;  2R6G A;  5BN5 A;  2L9H A;  2UXD Q;  1SMX A;  1M4V A;  3HOW B;  1MJC A;  1KD1 C;  4OXP A;  4KN7 C;  3M3Y B;  3I8Z A;  2F0N A;  3HS0 C;  1HNZ Q;  4QIW B;  3KF8 A;  2NVX B;  2Q8I B;  4LNQ A;  2E75 C;  2M9V A;  3DEP A;  3N52 A;  4N8F A;  3K8A A;  5T1I A;  1PDQ A;  3CRL C;  4NMZ A;  2DNC A;  1HTP A;  1LTG D;  3A74 A;  4PQX A;  5ELC A;  5I2Y A;  3O13 A;  2JA6 B;  4K2L A;  1OXX K;  3CQZ B;  1RDP D;  4X62 L;  4IFD I;  2KCC A;  1J9O A;  1ILQ A;  2OXP A;  4P71 A;  5E7N A;  1Y1V B;  2ZTC A;  4JBW A;  2PZW A;  1NAP A;  3F1Z A;  4C3I B;  2EYP A;  3SK4 A;  4F7X A;  4ZUJ A;  2F3I A;  5GAG C;  1EIF A;  4RH6 A;  4XQQ A;  4A3D B;  4GKJ L;  1BBX C;  2PI2 E;  2MFI A;  3K58 A;  5IGD A;  1IW7 C;  4B08 A;  2F52 A;  2NVQ B;  4HJ8 A;  4K2K A;  4UP7 A;  4GKJ Q;  3D4D A;  4AH6 A;  1VF5 C;  2IT1 A;  4A4I A;  1TWF B;  1PH7 A;  5CYU A;  1KAA A;  1AZP A;  1DOM A;  3ND8 A;  4X3U A;  4A3G H;  1T5X D;  3J7A F;  4LFB L;  4JK1 C;  3K5M A;  3E6Z X;  1PH1 A;  1EQV A;  2HHH Q;  3KK7 A;  3CHB D;  4DAV A;  2UUB L;  2R61 A;  1EQT A;  3MTS A;  2I0Q A;  2BA0 A;  3BYY B;  3EA6 A;  2F0V A;  4B3S Q;  1H95 A;  1FNV A;  1K0R A;  5C4J B;  4IPG A;  2A74 C;  1YHA A;  2ZTD A;  2PI2 A;  1DXM A;  5D65 A;  4OO1 I;  1SND A;  1QUQ A;  4DAY A;  2F0G A;  1KXL A;  1A2U A;  1UAP A;  4RFB A;  5LHY 1;  3F2D A;  4RHR A;  4UP9 A;  2K5Q A;  2EYH A;  4HIO A;  3K59 A;  4MTK A;  2JA6 G;  2X6L A;  2XWB B;  3MWY W;  4B9X A;  1ICW A;  4MHE A;  3SGI A;  2NVT B;  3HP3 A;  4A76 A;  1Y1V G;  4R4C A;  1RHP A;  4JYA L;  2JE6 I;  1B9N A;  1MI2 A;  3AMU A;  3J81 i;  1LT3 D;  4X6A H;  2FHT A;  4BBS B;  1VQ6 A;  1T5E A;  3RZD B;  4NXN L;  2KCT A;  4WOR A;  3S16 B;  1I50 B;  4BBR G;  4ID6 A;  5D14 A;  1HCZ A;  3OWE B;  3GTL H;  4BBR H;  1QOH A;  2AQ2 B;  4DK1 A;  4NP5 A;  3A0J A;  1FYC A;  1TY2 A;  1XX8 A;  2A69 C;  4C1N K;  1TT2 A;  4DR1 L;  2KHI A;  1WTR A;  1PFN A;  2Z4H A;  1XPR A;  1K0S A;  3HKS A;  1Q1E A;  2E2H H;  1JWM D;  3AEV A;  4DR1 Q;  1Y8P B;  1XXG A;  2EXD A;  3MXG A;  3PUY A;  2OT2 A;  5DLQ E;  1DJR D;  3L0O A;  4CDF C;  4R4Q A;  1E2Z A;  5JVH 3;  3FP9 A;  1E0B A;  2F4V L;  1SE8 A;  5I2X A;  1VQD A;  1MSG A;  1STE A;  1R4P B;  4A3J B;  5HGT A;  4TKO B;  2AUJ D;  2G9H D;  2QF7 A;  3PO3 B;  1NNX A;  3D6C A;  3IL8 A;  4GOP B;  3A8K E;  3FPU B;  3UE1 A;  2CWA A;  4OO1 G;  3W2D A;  1EWH A;  5IGB A;  1W6J A;  2JA9 A;  2BE5 D;  3K6O A;  4WFN 3;  1HA5 A;  1IBK L;  4BBS G;  1S72 A;  1S40 A;  1VQL A;  1YHQ A;  1BCP B;  5IOC A;  5A2Q E;  5K36 H;  1CKN B;  3F2C A;  1FR3 A;  3W3A A;  2CW0 D;  2OF1 A;  1IBK Q;  1MGS A;  1D1K A;  1PH2 A;  1Q46 A;  1CTM A;  3KYH C;  2EYL A;  3N6R A;  3JAM E;  5COY A;  3CME A;  4HAE A;  1LAB A;  2FMC A;  1XMQ L;  1S5F D;  3BZC A;  1U4P A;  5H1S E;  1Z7T A;  4FF2 A;  3PUV A;  2QIL A;  2Q8T A;  2L12 A;  3J80 c;  5C44 B;  3T51 B;  4WJ4 A;  1HUN A;  4FF4 A;  2WFW A;  3HOZ G;  1XMQ Q;  1GO3 E;  3T4A C;  4QF4 A;  1X3E A;  1SNC A;  5LL6 S;  1J5E Q;  3HOZ H;  2JK8 A;  4DV2 L;  5JPN C;  5J22 A;  1LTI D;  3CW2 C;  1HA6 A;  4DK0 A;  3HOU B;  2QW7 A;  4X64 Q;  4DV2 Q;  1HNX L;  1L1O B;  3A5U A;  2JEA I;  1N36 L;  3S2H H;  1KQS A;  1RCV D;  4A3J G;  4R8N A;  2EOT A;  4P2C B;  2D2C C;  2VUM B;  1EYA A;  1CM9 A;  4ZRZ A;  1PLF A;  4PZ7 A;  2EY5 A;  2BCO A;  1VQO A;  1RTN A;  1VQF A;  1SNO A;  3BDL A;  1N36 Q;  1FD7 D;  4IPH A;  1JJ2 A;  1D2B A;  1STN A;  1HTL D;  4RCO A;  1Z47 A;  1KRS A;  2ASB A;  2A6E C;  2HDM A;  4A3C H;  2JXM B;  2ZM6 L;  3ER0 A;  1CFM A;  3FEW X;  1KDA A;  4C2M H;  4LK1 C;  5FO8 B;  1I3Q B;  3TN2 A;  1LAC A;  1DON A;  2ZM6 Q;  5EBC A;  2R93 B;  2ICE C;  1XYI A;  5LMU L;  2VS1 A;  3I2Z A;  3IFT A;  4NPS A;  1TU2 B;  2KHJ A;  3CAM A;  5BN4 A;  1XNQ L;  1KNA A;  4QIW E;  1WTQ A;  3U4V A;  4KMU C;  1CI3 M;  4GLA C;  5LMU Q;  1QIL A;  4RKB A;  1G29 1;  2CFM A;  2R3Z A;  3MXP A;  5IWA L;  3K7U C;  1HZA A;  3QO2 A;  1HQM C;  2K5H A;  1V1P B;  3MVV A;  4CJ0 B;  3C46 A;  3H09 A;  4DR5 Q;  1VCI A;  1WI5 A;  1D1I A;  3URY A;  2EY1 A;  2SDF A;  4EQN A;  4DV6 L;  2KCM A;  3S24 A;  4L5S A;  1H9M A;  3GTM H;  2L5T A;  2HQE A;  3BU2 A;  1JE4 A;  1XJV A;  1QVC A;  3H0G B;  4DV6 Q;  2PZU A;  2QGQ A;  4O2D A;  4PZ6 A;  1C7Y A;  1KL9 A;  1R9T H;  1VS0 A;  2RDF A;  1IXR A;  2YU9 H;  2LMC B;  1HNW L;  4HJA A;  5IGC A;  1Y1W B;  1Q82 C;  2CHB D;  2IY5 B;  5IYD G;  1YNJ D;  1LTL A;  2OQ0 A;  5C5M A;  2XRS D;  4A3F B;  1MHW C;  3AFQ A;  3S9W A;  1VQ4 A;  1DYQ A;  4L5R C;  1DOK A;  2DY7 A;  2J0T D;  4HSP A;  5IE8 A;  3RUZ A;  1I6H B;  1F2L A;  3HFZ B;  5L37 A;  5KNB A;  2MP1 A;  2SNM A;  2RDH A;  3J80 i;  1VMC A;  5C6A A;  3LWE A;  1YNN C;  1TR5 A;  4WRD A;  5C4X G;  1EIH A;  3K5N A;  1F2M A;  1C8C A;  2MO0 A;  3S17 H;  3HOX H;  3CCE A;  1ML0 D;  5J39 A;  3M4O B;  1VQ7 A;  1JOR A;  2HCI A;  4BS9 A;  1VQI A;  1KDB A;  2B8G A;  4LW1 A;  3SE0 A;  3VYT A;  1E1O A;  3CCL A;  5IYC H;  3K0X A;  1TS3 A;  2ZJQ A;  1BBW A;  1NE3 A;  3EBE A;  4E6I A;  3I3C A;  4DR3 Q;  5C0X J;  5GAD C;  1K3R A;  4L6T B;  5EKK A;  4RGM A;  1N32 Q;  4JI0 Q;  2RHQ B;  4GNX C;  4XQN A;  4U67 3;  3MC0 B;  2KEN A;  2NN6 H;  1PTO F;  1MSH A;  3BZD B;  3MXN A;  4DGZ A;  4PMW A;  1HXY D;  1D5M C;  3CCV A;  3P7J A;  5C0X H;  4LWC A;  3S14 H;  3EN2 A;  4K5V A;  1Y1W G;  4R9W A;  3CC7 A;  4RGT A;  3S15 H;  4DA2 A;  3J7A 5;  4A3I G;  4A3F G;  3S1R B;  1I4R A;  4KHV A;  4A3I H;  1STH A;  5T1G A;  1NSN S;  1TWG B;  3I72 A;  1S5D D;  4Y7N H;  5EPK A;  2L4N A;  3I4O A;  2WKC A;  1T9H A;  1JCK B;  4HN7 A;  3C2P A;  1SNP A;  5ELN A;  1MKH A;  5JJI A;  3GTJ B;  1SXT A;  1TQO A;  4DAP A;  2ZT9 C;  1LTR D;  5M3M H;  3I4L A;  3GTK H;  5BR8 L;  3BVZ A;  1I4X A;  5IYB G;  5KNC A;  3LX0 A;  1AW7 A;  2VQE Q;  3T13 A;  2PO4 A;  2B2V A;  3ULL A;  4ME3 A;  4PNY A;  4DR7 Q;  5BR8 Q;  4A3K H;  3T53 B;  3HOV B;  2K01 A;  4IPD A;  4XQJ A;  1H9J A;  1TS2 A;  5M3F B;  4DN4 M;  3KJO A;  1FGB D;  2ZTE A;  1CHP D;  5EAY A;  2QA4 A;  3CPW A;  1OXT A;  1ZKO A;  3CCQ A;  1NR2 A;  2B2W C;  4RGO S;  4KN4 C;  2JA7 B;  2JYO A;  4K6L A;  2SOB A;  4PG3 A;  1YBY A;  1CSQ A;  3CPF A;  4L63 B;  3MAQ A;  2A19 A;  2ZXP A;  1UUP A;  1WTX A;  1EYD A;  1TWH B;  1OTC A;  3MXU A;  3IAY A;  2F0M A;  4L5T A;  2PW7 A;  5C3E H;  3GD7 A;  1Q12 A;  4BA1 I;  1GD7 A;  1MJE A;  4DXF A;  1VQ5 A;  3FKI B;  3TRZ A;  4DV7 L;  4GZY C;  2F0K A;  4GOP A;  5CV6 A;  2GA4 B;  2M2L A;  4KHP L;  2A5H A;  4C3H B;  2DUD A;  4V19 0;  4DV7 Q;  1F2Z A;  3K57 A;  4GN4 B;  2IPK D;  4JBJ A;  5EGT A;  3PO2 G;  4JI1 Q;  5FLM G;  2L11 A;  1D6E C;  1SNQ A;  4FF3 A;  1CKN A;  1WFQ A;  5FLM H;  2QEX A;  3GTQ H;  3Q23 A;  2KEE A;  3D6W A;  4DNR B;  5I9P A;  3E3X A;  3TZD A;  2IHF A;  1FNU A;  4KD4 A;  3RZO B;  4IUR A;  5IT9 E;  4DU9 A;  1NCV A;  4F8M A;  3CC4 A;  4ZKC B;  2C35 B;  2IHE A;  3P20 A;  1O80 A;  3BDO A;  2EE1 A;  1FGU A;  2MQH A;  1QNU A;  3GTP H;  3NTI A;  1S4Z A;  2ZXO A;  4ZYS A;  3ONA B;  4BY1 B;  3ULJ A;  1HR0 L;  1SFO B;  3G4S A;  2EVB A;  3DWQ A;  2Q2I A;  2G5D A;  1XPO A;  4HSV A;  5EKL A;  4ZCK A;  4HIK A;  3R3O A;  4O1N A;  4EX5 A;  1XPU A;  5KRU A;  1L1O A;  3U9S A;  4P73 A;  4ABN A;  5CGK A;  4CHT B;  3I55 A;  3BJU A;  3SEB A;  2UUC L;  4DK6 C;  5IIF A;  1H9S B;  3KLS X;  3C1E A;  1EY9 A;  3J81 E;  2Y0S B;  1PV4 A;  2UXD L;  2F0J A;  5GAE C;  4CDC C;  5KIX A;  1XNR Q;  3STB D;  4A3E B;  2B2Y A;  1X55 A;  1E2W A;  4A3B B;  2IX1 A;  1HNZ L;  3W5O A;  2MUY A;  2PMZ B;  2JA8 G;  1LT6 D;  4IPC A;  1ZYR D;  4C3J G;  2A68 C;  2JA8 H;  1I4H A;  3VR5 A;  4C3J H;  1IKL A;  1EOV A;  1O7L A;  3G7L A;  4F88 A;  2EPB A;  4ZUI A;  3CRK C;  4DK3 C;  4XXE A;  1SYG A;  3H3V C;  1GVP A;  3FMC A;  1G6Z A;  1ZEQ X;  4XIG S;  2BH2 A;  2D62 A;  2PNR C;  5ELD A;  3KOJ A;  4HIM A;  1B3Q A;  2F0D A;  4F87 A;  1DZ1 A;  2ID0 A;  4CKB A;  4J1M A;  5JVG 3;  1PH6 A;  4JCV E;  1RKN A;  2VB2 X;  1H9K A;  3TSS A;  3R2I A;  1PTO D;  1I4P A;  2JQO A;  5JEA G;  3DM3 A;  1K83 B;  5JEA H;  4Q5V A;  2ICI A;  1XMO Q;  1E22 A;  3SDZ A;  5EJW A;  1Y8O B;  3GTG H;  2N88 A;  1UWV A;  5AFW A;  4DR6 L;  4XDX A;  1N9W A;  3NWS A;  2CH4 A;  2HHH L;  4CJ1 B;  3SK8 A;  4FXK C;  2AWN A;  1PA6 A;  1ENF A;  2XSC A;  4DR6 Q;  2B39 A;  4CBV A;  1I4G A;  1TII D;  1IYU A;  2Y0S G;  1N34 Q;  2LXK A;  2HUG A;  2NZO A;  3NTK A;  4B3S L;  1EU3 A;  4A3E G;  1GUN A;  4BY7 B;  1GJX A;  2MNA A;  4A3B G;  5E3F A;  1I4Q A;  1E1T A;  4IUT A;  4PV1 C;  1RIP A;  3HOW G;  1Q81 C;  4JBK A;  3OMG A;  1HPC A;  3HOW H;  3A8I E;  1WVL A;  2XWJ B;  4M8A A;  1G6P A;  1CKM A;  2PZT A;  3M3Y H;  3H15 A;  2A6H C;  1B53 A;  4P74 A;  2WAC A;  3K7A B;  2NVX H;  1E3P A;  5DNF A;  1CA5 A;  4DF7 A;  2R7F A;  3I4N B;  4ALP A;  4XT3 B;  3SK6 A;  2YV5 A;  2BH8 A;  2Z6K C;  4JG2 A;  4KTA A;  1EQQ A;  3VA7 A;  3HGB A;  1MBY A;  4NDX A;  1E24 A;  2GN5 A;  1A3V A;  1EIY B;  1SJE D;  1EWI A;  3ULP A;  2E2J B;  3X3M A;  5GRO A;  4AQY Q;  2QDB A;  1X3P A;  2JA6 H;  3CQZ H;  4GN3 B;  1PRT C;  1JJC B;  1F9S A;  4K5W A;  4NW2 A;  3UE0 A;  1PFS A;  2HD3 A;  1CUK A;  4C3I G;  1Y1V H;  2K7V A;  2B8F A;  1SAP A;  3HEJ A;  4C3I H;  2WP8 J;  4A3D G;  3DHQ A;  4GNX B;  1HUM A;  4TSS A;  5FJ8 G;  1EWC A;  4A3D H;  1TWC B;  2NYZ D;  4DKA C;  1VQB A;  2L15 A;  1D5Z C;  3VR6 A;  1E2V A;  4IFD G;  1QJO A;  1WTH A;  2NVQ H;  1AP0 A;  3I73 A;  2OQK A;  4IFD H;  4H44 C;  1D8L A;  1TWF H;  1GXD C;  4NKL A;  1KHI A;  1CA6 A;  1BOS A;  2EJF C;  1B8A A;  2H1E A;  3E9H A;  5DAU A;  1WTO A;  4YY3 Q;  2WB1 B;  4BY7 G;  4A3M B;  2PYK A;  3AU7 A;  1GOZ A;  4IUQ A;  3TME A;  3QWN A;  3F2U A;  4LF5 Q;  1WCM B;  1ONL A;  2HQL A;  2ATW A;  1A15 A;  1DOL A;  3OW7 A;  1EZ6 A;  2UXB Q;  2K04 A;  4FXG C;  5C4J H;  3NEN A;  3KF6 B;  4A75 A;  1C48 A;  3E0J A;  5AJ3 L;  4PMB A;  5CV4 A;  4FDB A;  2E2D C;  3S2D B;  2M00 A;  3UDG A;  2KVM A;  1LTA D;  2BDN A;  2F3W A;  5AJ3 Q;  2OCE A;  2R7D A;  4WJ3 M;  1X65 A;  1BCP F;  3G71 A;  1YZ6 A;  2NVT H;  1PZJ D;  1JJG A;  4OO1 H;  1II3 A;  2PW5 A;  1ENC A;  1VQH A;  1IL2 A;  1GHK A;  3QOJ A;  3T16 A;  5D3I B;  5FO9 B;  3K5L A;  4BBS H;  3S1N B;  2ALY B;  2RF4 A;  1LTT D;  5EBD A;  3RZD H;  1ILP A;  3GDE A;  1PH4 A;  3D4W A;  5JJL A;  1X9N A;  3RR5 A;  1HZ9 A;  2A6E D;  3PF4 A;  2F0P A;  4K5X A;  2B2T A;  1I50 H;  3L2P A;  2FXQ A;  3DXJ C;  3NHH A;  2NVY B;  3KUP A;  3NSW A;  1EL0 A;  1J5E L;  2Q2H A;  4C2M B;  2WB1 G;  3L9A X;  1JWS D;  4OWT B;  2G9D A;  2FMM A;  3OHX C;  5COR A;  1JE5 A;  3JAM c;  1MIU A;  4ME5 A;  3TP8 A;  4DR2 Q;  2F0Q A;  2N3S A;  3PMF A;  4OGQ C;  3J80 E;  1K8G A;  1TS4 A;  1WCM G;  4X64 L;  3VYS A;  4DV5 Q;  1QZH A;  3TP6 A;  2R7Z B;  1JT8 A;  2IX3 A;  3VR3 A;  1G8Z D;  1PH3 A;  1HR0 W;  3CP0 A;  5BN3 A;  1KRT A;  4QQB X;  2SEB D;  1PFM A;  2VXW A;  3ZJY C;  3A8J E;  2NWG A;  2NZH A;  3M85 A;  1U4M A;  4KI0 A;  5K5P A;  2RHS B;  2I5M X;  4G57 A;  3HKZ B;  4BXX G;  3I7F A;  4YCW A;  5C5L A;  1O7Y A;  4OWX B;  3PO3 G;  4BXX H;  4A3J H;  4FYD A;  1W6K A;  3U50 C;  3GTM B;  3PO3 H;  3K5O A;  1UE6 A;  4MNO A;  3WOF A;  5A2Q L;  1GUT A;  4H13 C;  5IP9 G;  1ESR A;  4Z9C B;  1AN8 A;  1SNM A;  1O7I A;  3I4M B;  5IP9 H;  2ES2 A;  2Y0S E;  1FJG L;  4X3K A;  2BE5 C;  1X32 A;  3L7Z C;  1EY7 A;  3JAM L;  1KDC A;  1PZK D;  3CCJ A;  2BOS A;  1G91 A;  2F0O A;  4KLK A;  2E5L L;  1QB5 D;  1F2Y A;  1FJG Q;  1SBB B;  1F9Q A;  2CW0 C;  2PMZ E;  3U58 A;  1YIT A;  1YHB A;  4JVZ A;  4Y52 H;  4JOI C;  1A63 A;  2X69 A;  1BUV T;  2R92 B;  2E5L Q;  2OTL A;  2J7Z A;  4UAI A;  1K73 C;  4DR5 L;  3RLF A;  1D7Q A;  5C44 G;  5F2D A;  3QOL A;  2BDO A;  1A6X A;  4XYO A;  3GV3 A;  3WDN A;  5JPM C;  5C44 H;  3J7Z C;  3MHB A;  1PH8 A;  2IL8 A;  4K0K Q;  3A7A B;  2LFN A;  4H02 A;  1WTP A;  4QJF A;  5DEH A;  3VA5 A;  1BO0 A;  2ENB A;  2FJ2 A;  4EVO A;  5KYI A;  3H3V I;  2R7Z G;  4TQU S;  3R93 A;  3NE5 B;  3DEO A;  4DV0 Q;  1C0A A;  2GVB A;  1TWA B;  3HOU G;  2CQO A;  4M1U B;  4QY7 A;  5C4Z A;  3HOU H;  5DM7 3;  1WJJ A;  3T56 B;  2JA5 B;  2KA7 A;  1IZ6 A;  1EEI D;  3A7L A;  2VUM G;  3K0Y A;  3ICE A;  1FNW A;  3OYY A;  1SE2 A;  1NR4 A;  4JPB W;  3P1H A;  4I7A A;  3OTO Q;  3L3O C;  4C56 C;  3C3L A;  1YJN A;  1H9R A;  2IJ0 A;  4LF7 L;  5IYD H;  1QCB D;  3CCR A;  1HRJ A;  3I4M G;  4IOA A;  4DAM A;  2RSN A;  1S5B D;  1J8I A;  5E1F A;  4FNF A;  3HOY B;  2VNU D;  1EYC A;  4LF7 Q;  2B2U C;  4GN5 A;  2J4X A;  1XWE A;  3KFU A;  1Y69 U;  1I3Q H;  2WKD A;  1D5X C;  3K81 C;  2R93 G;  2EY2 A;  2A1A A;  1FVI A;  2R92 G;  1KLU D;  2B3G A;  4L5Q A;  5HY6 A;  2K33 A;  5C4X H;  2IWH A;  2AUK A;  1EEF D;  1PFB A;  1W2B A;  2E2I B;  5I9O A;  2EY6 A;  4U68 A;  3DLL A;  4YHH Q;  4LF9 L;  1Q8K A;  4KK7 A;  5I6Y A;  1PHJ A;  2KEC A;  2PCF B;  4DV3 Q;  4PMC A;  4DR3 L;  2E76 C;  1CQV A;  5A35 A;  2K50 A;  1N32 L;  4JI0 L;  1NUC A;  1QUQ B;  4TVA B;  3HZX A;  1WYD A;  2YYZ A;  4YCV A;  3QR8 A;  5M3M B;  5FLX E;  4LF9 Q;  3GTK B;  2XIW A;  4IJH A;  1CKO A;  1LTS D;  1AFP A;  2WAQ B;  1JR0 D;  5LMN L;  3QIA A;  1TVX A;  1U5K A;  2N78 A;  1PXU A;  2K5N A;  4LJZ C;  3G48 A;  3GP7 A;  4KY7 A;  2CQA A;  3H0G G;  5E4W C;  1EY5 A;  3T1H L;  4H7B A;  2CCZ A;  1G2T A;  5LMN Q;  1VQG A;  3BZK A;  3EIV A;  1JOO A;  3X3N A;  3S1M B;  3ERO A;  5CR3 A;  3J81 j;  4OIJ A;  2X6G A;  1JQY D;  3FPP A;  2FIN B;  2PQA B;  2FFK B;  5CV9 A;  4H0L C;  3MFY A;  3T1H Q;  1ROD A;  1ET9 A;  1Y1W H;  1BCP D;  1PRT F;  1SLJ A;  4O42 A;  4EGV A;  2VZA A;  5M5Y B;  4RHS A;  1YNJ C;  1S5C D;  4A3F H;  1HHV A;  4K8J A;  4R4I A;  1X54 A;  1PRT B;  2WB1 E;  1TKW B;  3BVM A;  2B2V C;  1I6H H;  2K05 A;  5FOB B;  5C3E B;  1TS5 A;  1SYF A;  2KCN A;  2VQE L;  2UUA L;  4LF4 Q;  4O0A A;  1WTV A;  2QCP X;  1GHJ A;  1X3Q A;  4DR7 L;  5M5X H;  3I70 A;  1KTK A;  4YCU A;  3GTO B;  2UUA Q;  5FLX L;  5IYB H;  3NUC A;  4A93 B;  2B63 B;  5M5W B;  3M4O H;  1YIJ A;  4L8J A;  5I4D A;  2D5D A;  1BBU A;  1UEB A;  3DWP A;  3NEM A;  2VL6 A;  1UEA B;  3CU7 A;  2TSS A;  2WAQ G;  4YWL A;  3KBX A;  4LFA L;  1EQR A;  2K03 A;  4IAL A;  4Q0F A;  3H91 A;  5FK9 C;  3S1Q B;  1CQF A;  1YJ9 A;  3OOC A;  2JP1 A;  2KQ3 A;  3CCU A;  3UDI A;  4LFA Q;  3M4Q A;  1ASY A;  3OIP A;  3KF6 A;  2JEB I;  3FDT A;  2JJQ A;  4HTH A;  1PTO H;  1RL2 A;  4IO9 A;  2I46 A;  1YI2 A;  4S3S A;  1TY0 A;  1O78 A;  4P72 A;  5ELF A;  3S1R H;  1S5E D;  5C4H A;  1LT5 D;  1STY A;  1TWG H;  4JI5 L;  1I5F A;  3BVG A;  2D0P A;  2Z8L A;  4JI1 L;  3J7Y W;  1HQR D;  1HZC A;  4GKK L;  1SMY D;  2YTX A;  3R2T A;  3PUZ A;  3IKJ A;  2WII B;  2JN4 A;  4APV A;  2CWP A;  4JI5 Q;  1X56 A;  1QE6 A;  3GTJ H;  2K4K A;  3NPP A;  4NXM L;  5IP7 G;  2B2W A;  3PO2 H;  3W1B A;  5IGG A;  4GKK Q;  1KAB A;  2HT1 A;  4K14 A;  4A93 G;  2B63 G;  3C1F A;  4JI8 Q;  2OTJ A;  4MTN A;  1SDF A;  4NXM Q;  4DUZ L;  3M4Y A;  3KLS A;  3DMU A;  3HKZ E;  3HOV G;  1B1Z A;  1MD2 D;  4B3M L;  2IX0 A;  4I65 A;  5M3F G;  4HID A;  3HOV H;  1BDO A;  5E4X A;  3VYU A;  5M3F H;  5EKI A;  1S3O A;  2ZXR A;  1SYC A;  4LUZ A;  5J1Z A;  4DUZ Q;  4B3M Q;  1KNE A;  3T1Y Q;  1NY4 A;  3KLW A;  5ELO A;  1SR3 A;  2EYF A;  1JC7 A;  3BDC A;  2JA7 G;  3TBI B;  3PIO 3;  2EXZ A;  3RMH A;  3A56 A;  3BYT B;  4CKE A;  2JA7 H;  2A73 B;  1JOK A;  2MGS A;  2CKZ B;  2RVL A;  5FKA C;  1OXU A;  4RA8 A;  4TRD A;  1TWH H;  3OMC A;  1B44 D;  2QEJ C;  2MO1 A;  2Z1C A;  1WOC A;  1OXV A;  3FKI G;  1P8L A;  1XNR L;  3CD6 A;  2XVS A;  4BWG B;  1K3B C;  1BNZ A;  2PPB C;  1UE5 A;  3NBH B;  4G7O C;  1IW7 D;  4C3H G;  4C3H H;  3KDF B;  4RWS C;  4JI6 L;  3TS2 A;  1JMC A;  1LUZ A;  4B9W A;  5IT9 L;  2XGT A;  2Q8R E;  4A3G B;  1A62 A;  4XYQ A;  2Z6B A;  5EPL A;  1LO5 D;  2AKW B;  4ZK9 B;  1PMR A;  1STA A;  4RGN A;  3F8T A;  4B3T Q;  4JI6 Q;  2NB0 A;  4EQO A;  1PYB A;  1VDZ A;  1IBL L;  4HMJ A;  5CMD A;  3W1G A;  2F4I A;  1CT1 D;  3RZO H;  5JEA J;  5IGF A;  5ELE A;  1IBL Q;  3CCM A;  3AB9 A;  3A54 A;  4QCL A;  4KD3 A;  1XMO L;  2A6H D;  1V1P A;  3M4P A;  2DGY A;  4BY1 G;  3PCO B;  4BY1 H;  4ZAI A;  4LMQ D;  1R4Q B;  1Z9F A;  1SFO H;  3SR1 A;  2WIN B;  4QGU A;  1VQJ A;  4IJL A;  5G3L F;  1EY4 A;  4C1N I;  1LT4 D;  1PYS B;  3J81 L;  2O5I C;  2EDG A;  1Y14 B;  1PRT D;  4LAA A;  3I91 A;  5KEE A;  1N8R C;  2PQE A;  1N34 L;  1IKM A;  1SE4 A;  3QB3 A;  4QUF A;  3GV6 A;  2K6A A;  3PGZ A;  4AYB B;  1Z6H A;  3VDY A;  3F2B A;  4X3T A;  4XTC S;  2N8N A;  2QDL A;  4X62 Q;  4JV5 L;  1L2F A;  3V2T A;  3ERS X;  1Q90 A;  1X6O A;  4AIM A;  4A3E H;  1O7Z A;  1A8V A;  3STB C;  3FVQ A;  2V4D A;  4A3B H;  2H4O A;  4BA2 I;  4JV5 Q;  5LMN W;  2F0T A;  5JJK A;  3A5Z B;  2WAQ E;  4A3G G;  2K1B A;  2Z9H A;  3GTL B;  2F0I A;  4KJN A;  4BBR B;  4I7Z C;  1BXT A;  4HJ9 A;  1ZYR C;  2A69 D;  1VQ9 A;  1YEZ A;  3CF5 A;  1HFG A;  3E5S A;  2ZJP A;  4AQY L;  3DUZ A;  1J6Q A;  4LFB Q;  3GO5 A;  2F0E A;  1RTO A;  2E2H B;  2C5C A;  1K28 A;  2UUB Q;  3MXN B;  3Q24 A;  1I6V C;  3RLN A;  5KYL A;  4IUN A;  2KED A;  4IFD J;  2GVA A;  1PTO C;  2L1B A;  1K83 H;  3NXW A;  3UDX A;  3I56 A;  3VR4 A;  1G2S A;  3QG1 A;  2EYM A;  4FO2 A;  1ASZ A;  1SRO A;  4FVM A;  5FJ8 H;  4DV4 L;  2O2L D;  1VQK A;  3CC2 A;  2XRQ D;  3R8B A;  1UE7 A;  3AFP A;  4YY3 L;  2EIF A;  1BKB A;  1U4R A;  2F0W A;  4AYB G;  4DV4 Q;  2PQA A;  2Z6K A;  4LF5 L;  2K5W A;  1KC8 C;  4JYA Q;  4MN3 A;  2DNE A;  3TDQ A;  2UXC L;  4UHV A;  2UXB L;  3A55 A;  2HIV A;  4HCS A;  4BY7 H;  1EFI D;  1EY6 A;  3PUW A;  2OWO A;  2V1C C;  1RF2 D;  1SYB A;  4NB3 A;  1PZI D;  1EY8 A;  2UXC Q;  1AE3 A;  2YTV A;  1HZB A;  4ZLT F;  4NXN Q;  5D3D A;  1EIG A;  5DM6 3;  4KV6 A;  4GLV B;  1U4L A;  4UP8 A;  3I4N G;  3K7A H;  3DWA A;  2VQF L;  3I4N H;  4JI7 L;  2K32 A;  3HOZ B;  1GUW A;  1JB3 A;  1VQA A;  2Z0S A;  4HR7 B;  2E2J H;  2L0C A;  2VQF Q;  2N49 A;  4JI7 Q;  1G51 A;  1DGS A;  1M1K C;  1B9M A;  2B2T C;  1RD9 D;  3NK9 A;  4K8I A;  1ENA A;  2XTI A;  3PF5 A;  4B3R L;  1A3T A;  1L0Y B;  3S2H B;  2OEO A;  2DJF C;  5EPJ A;  1I94 L;  4K6D A;  3D4R A;  2L55 A;  1UNS A;  1TWC H;  1NJI C;  3PV0 A;  1X3F A;  1C9O A;  1E7Z A;  2WV6 D;  3EQL C;  4QB4 A;  3NQT A;  4B3R Q;  2F4V Q;  1I94 Q;  1BF4 A;  2YTY A;  3S16 H;  3NQI A;  4LF8 L;  1HJP A;  2NBF A;  1Q8I A;  5CV7 A;  4JI3 L;  3Q6S A;  1W3S A;  4DR2 L;  1P16 A;  2Q2U A;  5K36 G;  4KY6 A;  1SSO A;  1VQM A;  4A3M G;  3BG3 A;  4DV5 L;  4LF8 Q;  3PUX A;  4A3M H;  4JI3 Q;  2VB3 X;  3CKI B;  3PIP A;  5GQO A;  4RAU C;  1CZG A;  2Z4I A;  1K8O A;  4YIJ A;  1WCM H;  4KKS A;  4N8X 1;  3U4Z A;  1YNX A;  3D0F A;  3HRZ C;  1PVO A;  3V05 A;  3D31 A;  3CXC A;  1SYD A;  3Q22 A;  2JSO A;  2EYO A;  1QNK A;  1YVC A;  1U0L A;  3TEH B;  2F0H A;  1QZG A;  3S2D H;  1NTG A;  3E0E A;  1JB7 A;  2XNA C;  3ND9 A;  1SRU A;  3H6M A;  5IOD A;  4UPA A;  3NTH A;  1A0I A;  4JI4 L;  1ET6 A;  4CKC A;  1Q7Y C;  1IL8 A;  3SVM A;  3MEH A;  1EZ8 A;  3PIO A;  1STG A;  3I90 A;  4R1J A;  1SE3 A;  3FHW A;  1OXS C;  4WJW A;  4DFA A;  5J3B A;  1R9T B;  2AQ3 B;  3RN5 A;  1CHQ D;  5LL6 X;  4FF1 A;  5G3L D;  4OON A;  2YU9 B;  2RQX A;  3S1N H;  4JI4 Q;  5IGE A;  3CMA A;  2HCC A;  5NUC A;  2AHO B;  1HNX Q;  4EQP A;  2DN8 A;  1B70 B;  3SHL A;  4R8I A;  2K28 A;  3NP8 A;  2KOL A;  1TXY A;  4DNT B;  3OSO A;  4A3C G;  3ERQ A;  3J7A V;  4K0K L;  4OEM B;  2RKS A;  4OEL B;  3J80 L;  3TP7 A;  2NVY H;  3IRB A;  2Q2T A;  1QVF A;  3MEF A;  1V43 A;  2C9O A;  1C4Q A;  4V0B A;  1V1Q A;  3EFX D;  4DV0 L;  1IYJ B;  1YNN D;  3KF8 B;  4IZ8 A;  1EY0 A;  1H9S A;  3PQI A;  1GUS A;  4ZQ3 A;  4HJ5 A;  4IUP A;  2KUM A;  1AZQ A;  3NBH A;  3FRP B;  2H5X A;  1AE2 A;  5C4X B;  1CSP A;  1Y8N B;  1GUG A;  3S17 B;  3HOX B;  2R7Z H;  4DV1 L;  2KJX A;  1BQQ T;  4ODG A;  1NBW A;  3RLO A;  3KDF A;  4POG A;  2NN6 I;  3OW2 A;  1EOT A;  4PZ8 A;  2UU9 L;  4OWW B;  4DPG A;  1WTW A;  1IHZ A;  3Q8D A;  3TQY A;  3OTO L;  2EYJ A;  2LY7 A;  4FP5 D;  1XNQ Q;  4DV1 Q;  1VQC A;  3HKZ G;  5C0X I;  2K14 A;  3VYR A;  4JOI A;  4HED A;  2EJG C;  2UU9 Q;  2VUM H;  4CDD C;  5JAV A;  5IWA Q;  4LUV A;  3MZ5 A;  2EZV A;  1HFN A;  1Q86 C;  1L0W A;  1XTD A;  4P75 A;  1AEX A;  4HCE A;  1VQP A;  4AYB E;  3EVQ A;  1L0X B;  4XT1 B;  4CJ2 C;  3U9O A;  4JBM A;  3I4M H;  1ESF A;  3E9I A;  5JOB A;  3OIQ A;  1WD1 A;  4QL5 A;  3S14 B;  2K5V A;  2CH4 W;  2F3V A;  3VR2 A;  4CDE C;  3S15 B;  2NTT A;  1WD0 A;  1LM0 A;  3NWT A; 
#chains in the Genus database with same CATH homology
 1N9W A;  1TWG H;  4JI5 L;  1I5F A;  3JAM i;  1YHQ A;  2D0P A;  2HHH L;  2R93 H;  4YHH L;  5GAH C;  3K80 C;  4JI1 L;  4EQ5 A;  1PA6 A;  4DV3 L;  1CKN B;  2AWN A;  2LSS A;  3AYH B;  3F2C A;  1HZC A;  4YWM A;  4DUY L;  4GKK L;  1HNW Q;  2YTX A;  4DR6 Q;  1KAW A;  1IBK Q;  3PUZ A;  2R92 H;  4APV A;  2Y0S G;  2CWP A;  1N34 Q;  1X56 A;  2LXK A;  1PH2 A;  4JI5 Q;  1Q46 A;  1SN8 A;  3GTJ H;  2NZO A;  2K4K A;  3KYH C;  4B3S L;  1Q1B A;  1PH5 A;  1UE1 A;  4NXM L;  1AH9 A;  4A3E G;  5IP7 G;  3CME A;  4JC0 A;  3PO2 H;  3W1B A;  2MNA A;  4DUY Q;  4GKK Q;  4A3B G;  4DAY B;  1XMQ L;  2HT1 A;  4A93 G;  3BZC A;  2B63 G;  4JI8 Q;  2EQS A;  1E1T A;  5H1S E;  1PH9 A;  4MTN A;  2OTJ A;  1YJW A;  3HOW G;  1RIP A;  3PUV A;  3J80 c;  2RCN A;  1Q81 C;  4JBK A;  4NXM Q;  3HOX G;  4DUZ L;  3HOW H;  4WJ4 A;  1FL0 A;  3JC6 6;  2WFW A;  3HKZ E;  3HOV G;  2B29 A;  4B3M L;  3HOZ G;  2IX0 A;  1XMQ Q;  1G6P A;  1CKM A;  3CCS A;  4RMF A;  5M3F G;  1GO3 E;  1TWA H;  2K75 A;  1X3E A;  3H15 A;  4HID A;  1J5E Q;  3HOV H;  2JK8 A;  3M3Y H;  3HOZ H;  4P74 A;  5M3F H;  2NVX H;  4RG1 A;  5FLX c;  1E3P A;  1S3O A;  5IYC G;  4LUZ A;  4DV2 L;  2R7F A;  4DUZ Q;  4LFC L;  2JA5 G;  3H0G H;  4ALP A;  4X65 L;  2YV5 A;  4B3M Q;  3CW2 C;  2BH8 A;  2Z6K C;  1EUJ A;  4JG2 A;  1NY4 A;  3T1Y Q;  1EQQ A;  2JA5 H;  3KLW A;  5ELO A;  1SR3 A;  1V9P A;  4J15 A;  4R4T A;  1EIY B;  1E24 A;  2GN5 A;  4X64 Q;  4DV2 Q;  1HNX L;  1EWI A;  2JA7 G;  3ULP A;  2VW9 A;  3H3V H;  4LFC Q;  1L1O B;  5GRO A;  4X65 Q;  3A5U A;  4AQY Q;  4JI2 L;  3CQZ H;  2JA6 H;  1N36 L;  2JA7 H;  2JEA I;  1KIX A;  1KQS A;  1LYL A;  4GN3 B;  3S2H H;  1JJC B;  2CKZ B;  2K52 A;  4A3J G;  3UE0 A;  2NN6 G;  1PFS A;  1CUK A;  1OXU A;  1Y1V H;  4PZ7 A;  1TWH H;  1VQO A;  3HOY G;  4JI2 Q;  2WP8 J;  4C3I H;  4LF4 L;  4A3D G;  1VQF A;  1N36 Q;  4GNX B;  2D0O A;  5FJ8 G;  2MO1 A;  4IPH A;  5C0X G;  1WOC A;  1OXV A;  1JJ2 A;  3HOY H;  4A3D H;  1Z47 A;  3FKI G;  1P8L A;  1XNR L;  1KRS A;  2ASB A;  4DKA C;  3PSI A;  4OX9 L;  1VQB A;  3CD6 A;  2L15 A;  4A3C H;  2ZM6 L;  3ER0 A;  4IFD G;  2NVQ H;  1UE5 A;  3NBH B;  4YWK A;  2OQK A;  3B6Y A;  4C2M H;  4GNX A;  2BA1 A;  1D8L A;  1TWF H;  4OX9 Q;  1VQE A;  3AQQ A;  4C3H H;  1KHI A;  2ZM6 Q;  1EFW A;  3KDF B;  1B8A A;  3E9H A;  2E2I H;  1BVS A;  4JI6 L;  3TS2 A;  4YY3 Q;  2VS1 A;  3I2Z A;  5LMU L;  2KBN A;  1JMC A;  4BY7 G;  1LUZ A;  4NPS A;  2KHJ A;  2XGT A;  3CAM A;  1A62 A;  1XNQ L;  4QIW E;  3GTQ H;  3NEL A;  5M3M G;  3U4V A;  2AKW B;  4JI6 Q;  4B3T Q;  4GLA C;  3F8T A;  5LMU Q;  4LF5 Q;  4IOC A;  1PYB A;  1G29 1;  2CFM A;  2HIX A;  5IWA L;  1IBL L;  2HQL A;  2ATW A;  2UXB Q;  1K8A C;  3K7U C;  3W1G A;  1HZA A;  4DNI A;  5C4J H;  3RZO H;  2K5H A;  3NEN A;  3KF6 B;  4A75 A;  1N32 L;  5JEA J;  4DR5 Q;  1VCI A;  1WI5 A;  4A3K G;  5AJ3 L;  3CCM A;  1IBL Q;  4DV6 L;  2KCM A;  3S24 A;  4L5S A;  4FDB A;  5HGQ A;  3GTM H;  4GOP C;  1XMO L;  2E8G A;  1NMG A;  1B7Y B;  3BU2 A;  3UDG A;  3M4P A;  2DGY A;  4BY1 G;  3S1M H;  3PCO B;  1XJV A;  1QVC A;  5AJ3 Q;  4DV6 Q;  4BY1 H;  2PNH A;  2OCE A;  1Z9F A;  2QGQ A;  2R7D A;  3LGJ A;  4O2D A;  4PZ6 A;  1X65 A;  4QGU A;  1KL9 A;  1YZ6 A;  3G71 A;  1R9T H;  1C7Y A;  1VQJ A;  2NVT H;  1M90 C;  1JJG A;  1VS0 A;  4IJL A;  5M5Y H;  1IXR A;  2YU9 H;  2ZJR A;  3RNU A;  1HNW L;  4HJA A;  1PYS B;  1VQH A;  1IL2 A;  1Q82 C;  1Y14 B;  2IY5 B;  5IYD G;  1N8R C;  1LTL A;  2OQ0 A;  1N34 L;  1N33 L;  4HJ7 A;  4BBS H;  2ALY B;  2RF4 A;  3RZD H;  3AFQ A;  1GKH A;  3GDE A;  5C3E G;  1VQ4 A;  1PH4 A;  4L5R C;  3M7N A;  3PGZ A;  3VDY A;  3F2B A;  4XTC S;  2AWO A;  2N8N A;  5JJL A;  4JI8 L;  1N33 Q;  5IE8 A;  4X62 Q;  1X9N A;  3KJP A;  3RR5 A;  1VQN A;  1HZ9 A;  4GS3 A;  4JV5 L;  3PF4 A;  2A8V A;  1L2F A;  3HFZ B;  1K9M C;  1I50 H;  3ERS X;  1IBM L;  3L2P A;  4A3E H;  1X6O A;  2FXQ A;  4AIM A;  3WWV A;  3J80 i;  5IP7 H;  1A8V A;  3STB C;  4POF A;  2I5H A;  5IY0 A;  4R4O A;  2Q2H A;  1J5E L;  4LF6 L;  3GTO H;  2WB1 G;  4A3B H;  4BA2 I;  5LMN W;  4JV5 Q;  5C4X G;  4A93 H;  5JJK A;  2B63 H;  4OWT B;  5M5W H;  3A5Z B;  2WAQ E;  4A3G G;  1JE5 A;  1IBM Q;  4WJ3 M;  3JAM c;  3TRE A;  1MIU A;  2MO0 A;  3S17 H;  4HJ9 A;  3HOX H;  3CCE A;  3T1Y L;  4DR2 Q;  4LF6 Q;  2N3S A;  1VQ7 A;  1K8G A;  1VQL A;  1VQ9 A;  1WCM G;  1YEZ A;  4X64 L;  1VQI A;  4KHP Q;  3CF5 A;  4DV5 Q;  1QZH A;  2VY3 A;  3G6E A;  4LW1 A;  4X66 L;  1JT8 A;  1E1O A;  2ZJP A;  4AQY L;  3CCL A;  5IYC H;  3K0X A;  1PH3 A;  1HR0 W;  1EYG A;  1J6Q A;  3CP0 A;  1L1O C;  5IT9 c;  1GM5 A;  4LFB Q;  4MZ9 A;  3GO5 A;  3RN2 A;  1KRT A;  4DR4 L;  2ZJQ A;  4QQB X;  3M9B A;  1BBW A;  1NE3 A;  3EBE A;  3ZJY C;  3S1Q H;  4DR3 Q;  2NZH A;  5C0X J;  3MXN B;  4X66 Q;  5GAD C;  3M85 A;  2UUB Q;  1K3R A;  4KI0 A;  3UDF A;  1N32 Q;  2RHS B;  2RHQ B;  2I5M X;  4LUO A;  4JI0 Q;  3RLN A;  4BXX G;  4GNX C;  4DR4 Q;  3I7F A;  4YCW A;  3PO3 G;  4OWX B;  4IFD J;  4BXX H;  4A3J H;  2KEN A;  3U50 C;  3PO3 H;  2GVA A;  1UE6 A;  1K83 H;  3I56 A;  4PMW A;  1X3G A;  4MNO A;  3UDX A;  4GLX A;  1ASZ A;  1SRO A;  3CCV A;  5IP9 G;  4LWC A;  5FJ8 H;  3EN2 A;  3S14 H;  4A3L G;  1Y1W G;  4KHZ A;  4DV4 L;  1O7I A;  5IP9 H;  1VQK A;  3CC7 A;  2ES2 A;  2Y0S E;  3FKI H;  3CC2 A;  1FJG L;  2LXJ A;  3S15 H;  4A3L H;  3J7A 5;  4A3I G;  4A3F G;  3L7Z C;  1UE7 A;  3AFP A;  4YY3 L;  2EIF A;  4A3I H;  3TS0 A;  1BKB A;  3CCJ A;  4AYB G;  4DV4 Q;  1VQ8 A;  4KLK A;  2E5L L;  1HR0 Q;  1FJG Q;  2PQA A;  2AMC B;  4Y7N H;  2PMZ E;  3U58 A;  2Z6K A;  1YHB A;  3J81 c;  1YIT A;  4B3T L;  4Y52 H;  4JOI C;  3I4O A;  4LF5 L;  1A63 A;  1T9H A;  1KC8 C;  4JYA Q;  5ELN A;  2UXC L;  2UXB L;  2E5L Q;  2OTL A;  1MKH A;  2HIV A;  4BY7 H;  5JJI A;  4UY8 C;  1K73 C;  3PUW A;  4DR5 L;  3RLF A;  2OWO A;  2V1C C;  5C44 G;  1NMF A;  1D7Q A;  5M3M H;  4NB3 A;  3J7Z C;  3GTK H;  5C44 H;  5BR8 L;  2UXC Q;  1QVG A;  1PH8 A;  1AE3 A;  2UUC Q;  2YTV A;  5IYB G;  4K0K Q;  1HZB A;  2I5L X;  4H02 A;  4NXN Q;  4QJF A;  1HH2 P;  2R6G A;  2VQE Q;  2UXD Q;  4GLV B;  3ULL A;  1SMX A;  4ME3 A;  3H3V I;  2R7Z G;  4TQU S;  1MJC A;  4UP8 A;  3I4N G;  4DR7 Q;  3K7A H;  5BR8 Q;  4DV0 Q;  4A3K H;  1C0A A;  2VQF L;  1KD1 C;  3I4N H;  2GVB A;  4OXP A;  4JI7 L;  3HOU G;  4IPD A;  2CQO A;  1HNZ Q;  4LNQ A;  3KJO A;  4QY7 A;  3HOU H;  1VQA A;  2ZTE A;  2Z0S A;  1WJJ A;  5EAY A;  2E2J H;  2VQF Q;  2QA4 A;  2N49 A;  3CPW A;  3K8A A;  1G51 A;  4JI7 Q;  1DGS A;  1M1K C;  1IZ6 A;  2VUM G;  1OXT A;  3A74 A;  3ICE A;  3OYY A;  3CCQ A;  2XTI A;  3OTO Q;  3PF5 A;  1OXX K;  4B3R L;  4X62 L;  4IFD I;  4PG3 A;  1YBY A;  1YJN A;  1CSQ A;  1I94 L;  4LF7 L;  5IYD H;  3CPF A;  5E7N A;  4P71 A;  3CCR A;  2ZTC A;  4JBW A;  2A19 A;  3I4M G;  1TWC H;  1NJI C;  3F1Z A;  1OTC A;  4DAM A;  4IOA A;  1X3F A;  3PV0 A;  1C9O A;  1E7Z A;  4L5T A;  4B3R Q;  5C3E H;  2F3I A;  2F4V Q;  5GAG C;  1EIF A;  3GD7 A;  2VNU D;  1I94 Q;  4GKJ L;  1Q12 A;  4LF7 Q;  2YTY A;  2PI2 E;  4GN5 A;  3S16 H;  2MFI A;  4BA1 I;  4LF8 L;  1GD7 A;  1HJP A;  1MJE A;  1VQ5 A;  3KFU A;  2F52 A;  3TRZ A;  1I3Q H;  4JI3 L;  4DV7 L;  3K81 C;  1W3S A;  4DR2 L;  2R93 G;  1P16 A;  2A1A A;  4HJ8 A;  4GOP A;  2Q2U A;  1FVI A;  4UP7 A;  5K36 G;  4GKJ Q;  4AH6 A;  1VQM A;  2IT1 A;  4A3M G;  4KHP L;  4A4I A;  2B3G A;  3PUX A;  4L5Q A;  5HY6 A;  5C4X H;  4DV5 L;  1PH7 A;  4LF8 Q;  2R92 G;  2DUD A;  4A3M H;  1W2B A;  4A3G H;  4DV7 Q;  4JI3 Q;  4LFB L;  3PIP A;  4GN4 B;  5GQO A;  4JBJ A;  3DLL A;  1PH1 A;  2HHH Q;  3PO2 G;  4YHH Q;  4LF9 L;  1Q8K A;  1PHJ A;  4JI1 Q;  5FLM G;  4DR3 L;  4DV3 Q;  2UUB L;  1WCM H;  1CKN A;  1WFQ A;  2K50 A;  5FLM H;  2I0Q A;  2QEX A;  2BA0 A;  1QUQ B;  4TVA B;  3U4Z A;  1YNX A;  3D0F A;  4JI0 L;  1WYD A;  2YYZ A;  4YCV A;  1PVO A;  4B3S Q;  4LF9 Q;  1H95 A;  3D31 A;  2IHF A;  1K0R A;  4IJH A;  1CKO A;  3CXC A;  4IPG A;  1YHA A;  1YVC A;  1U0L A;  2ZTD A;  2PI2 A;  3TEH B;  5LMN L;  1QZG A;  1U5K A;  2N78 A;  4OO1 I;  3S2D H;  1QUQ A;  3CC4 A;  1NTG A;  3E0E A;  2K5N A;  1JB7 A;  3G48 A;  2C35 B;  2IHE A;  3H0G G;  1SRU A;  1KXL A;  3T1H L;  4UPA A;  2MQH A;  1FGU A;  5LMN Q;  1VQG A;  2CCZ A;  3F2D A;  1A0I A;  3BZK A;  3EIV A;  4UP9 A;  3GTP H;  4HIO A;  4JI4 L;  3J81 j;  1Q7Y C;  2JA6 G;  2PQA B;  3ULJ A;  3PIO A;  4R1J A;  1HR0 L;  3G4S A;  3T1H Q;  3FHW A;  1Y1W H;  3SGI A;  1OXS C;  1SLJ A;  5J3B A;  4A76 A;  3RN5 A;  2VZA A;  2Q2I A;  1Y1V G;  4OON A;  4R4C A;  1XPO A;  4A3F H;  3S1N H;  4JI4 Q;  2JE6 I;  4JYA L;  4HIK A;  3CMA A;  3J81 i;  4X6A H;  2AHO B;  4R4I A;  1X54 A;  1HNX Q;  4EX5 A;  1B70 B;  1XPU A;  2WB1 E;  1VQ6 A;  1L1O A;  4P73 A;  1TXY A;  1I6H H;  4A3C G;  3I55 A;  3BJU A;  2UUC L;  4K0K L;  4DK6 C;  4NXN L;  2KCT A;  4LF4 Q;  2VQE L;  2UUA L;  2NVY H;  3IRB A;  4O0A A;  1PV4 A;  2UXD L;  2Q2T A;  5GAE C;  4BBR G;  3MEF A;  1V43 A;  4DR7 L;  5M5X H;  1XNR Q;  3STB D;  1V1Q A;  4DV0 L;  1IYJ B;  3GTL H;  1X55 A;  4BBR H;  4YCU A;  3KF8 B;  3A0J A;  2UUA Q;  2IX1 A;  5IYB H;  4HJ5 A;  1HNZ L;  3W5O A;  3M4O H;  2H5X A;  1AE2 A;  1YIJ A;  1CSP A;  2JA8 G;  4IPC A;  4BBS G;  3NEM A;  1BBU A;  1UEB A;  4DR1 L;  2R7Z H;  2KHI A;  4DV1 L;  2VL6 A;  2JA8 H;  4C3J H;  1XPR A;  1NBW A;  3RLO A;  3KDF A;  1EOV A;  2NN6 I;  3OW2 A;  2UU9 L;  4PZ8 A;  4POG A;  3HKS A;  4OWW B;  1Q1E A;  4DPG A;  3Q8D A;  3TQY A;  3OTO L;  4DK3 C;  2E2H H;  2WAQ G;  4YWL A;  4DR1 Q;  3AEV A;  4LFA L;  4DV1 Q;  1GVP A;  1XNQ Q;  1EQR A;  2EXD A;  1VQC A;  3HKZ G;  4XIG S;  2BH2 A;  2D62 A;  5C0X I;  3PUY A;  2K14 A;  3KOJ A;  4JOI A;  4HIM A;  5DLQ E;  2UU9 Q;  3L0O A;  1YJ9 A;  2VUM H;  2ID0 A;  5IWA Q;  4R4Q A;  4LUV A;  3UDI A;  3FP9 A;  3CCU A;  1SFO H;  4LFA Q;  3M4Q A;  1Q86 C;  2F4V L;  1L0W A;  1PH6 A;  1XTD A;  4JCV E;  4P75 A;  1ASY A;  1SE8 A;  1VQD A;  1VQP A;  3KF6 A;  4AYB E;  2JEB I;  2JJQ A;  2JQO A;  5JEA G;  3DM3 A;  1RL2 A;  4IO9 A;  4GOP B;  4JBM A;  3I4M H;  1YI2 A;  3E9I A;  3UE1 A;  2CWA A;  1XMO Q;  4P72 A;  4OO1 G;  1E22 A;  4QL5 A;  2K5V A;  3S1R H;  2JA9 A;  3GTG H;  1UWV A;  4DR6 L;  1IBK L;  1LM0 A;  1QVF A;  1S72 A;  1S40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...