4A3BH

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
molecule tags Transcription
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3bH00
1L2FA 4KHZA 4C3IH 4JI4L 1N32L 4BA1I 1PA6A 4A3KG 1WFQA 1ASYA 3T1HL 1FL0A 4H02A 2VQFL 2CQOA 1VQBA 5GQOA 3KDFB 1YNXA 4DR4L 1PH9A 3E9HA 4IPCA 5BR8L 1V9PA 1X9NA 2JA5H 1Q46A 4A3EH 1PVOA 3K8AA 4ME3A 1N34L 3AEVA 4IPHA 1SRUA 1Y1VG 5C0XG 3UE1A 1YJNA 1K9MC 4JI0L 4NXNQ 4JYAL 5C4XG 2R92G 2N3SA 4RMFA 2RCNA 4DR3L 4OX9Q 3S2DH 1IYJB 4DUYQ 2VS1A 2K5HA 4DAYB 3S1MH 2UU9Q 4OWTB 4DR7L 4GKJQ 2EIFA 4DV6Q 4A3DH 2RHSB 2Y0SE 1YHQA 2PQAA 3FKIH 1IBML 1IXRA 5J3BA 1HH2P 1HJPA 4JI8L 1PH3A 4BBSG 1WCMH 4R4QA 2ID0A 2NN6I 1UWVA 3FP9A 3JC66 2WAQE 4A93G 2OTJA 1YBYA 2ALYB 2Y0SG 1HZBA 4IO9A 2CKZB 3BJUA 3CCUA 4PZ7A 4A3MH 1YHAA 3S2HH 4A4IA 4A3GH 4JV5Q 2R93H 2OQKA 2WAQG 2ZJQA 3L7ZC 3I55A 1CKNA 4OWXB 2E5LL 4DR2L 3I4OA 4PZ8A 1CKMA 4IJHA 2CCZA 4OO1G 4HIMA 1Z47A 2K5VA 2N78A 4AIMA 4X62L 1VQLA 1KRTA 3HOVG 4OWWB 2C35B 2JQOA 2GN5A 4X65L 1PH7A 3PO3G 4FDBA 4DR1Q 4LUZA 3K7AH 2VQFQ 1Q1EA 3RZOH 3GTPH 2F4VL 4DR4Q 4HJ5A 1HR0Q 4L5QA 4GOPB 5BR8Q 3UDGA 2UUBL 4JI3Q 4LF4L 1XMOL 3J80c 1JE5A 2LXKA 2MQHA 1BKBA 1VQGA 1YHBA 3J7ZC 4JI0Q 2NVXH 1B7YB 3S14H 3S24A 4DV3L 4B3TL 2QA4A 2JA5G 4DR3Q 4A3CH 5JJIA 1H95A 4C3HH 1K73C 3F1ZA 3PO2H 4GS3A 1TWCH 1I50H 4APVA 1NMGA 1G51A 2N49A 2WFWA 2R6GA 1VQHA 3J80i 4JI1L 1IBMQ 1O7IA 3PV0A 4GKKL 3BZCA 5IT9c 1X56A 3CC7A 3M7NA 5IYCH 2LXJA 3FKIG 4IJLA 1B70B 2ZM6L 2OQ0A 1WYDA 2VY3A 4RG1A 1JJCB 4LFBL 4LF5Q 1WCMG 2E5LQ 4PG3A 4KI0A 1A63A 1KHIA 4X62Q 2VNUD 3J81j 1FVIA 1K8AC 1JMCA 4QJFA 2I5HA 2K50A 4A3MG 5GAEC 1YJWA 2E8GA 4A3GG 4DV7L 2PI2E 3RZDH 4X65Q 3J81c 3KJOA 1PH4A 3HKZE 5IYDH 2XGTA 3I2ZA 1HNZQ 4P72A 1UE7A 1VQPA 4QIWE 2UUBQ 5AJ3L 4LF4Q 2EQSA 1SMXA 3HKZG 1UE6A 4BXXH 3CP0A 3HOXH 3I4MH 1N33L 3WWVA 4GKKQ 1Q7YC 4JBWA 2Z0SA 3RLOA 1I94Q 4DV3Q 2BA1A 3J81i 4DV2L 4B3TQ 1XNQQ 1VQEA 1VQ8A 1VQ6A 4WJ4A 4GN5A 1I6HH 1GKHA 1SR3A 4LNQA 4LUOA 2WB1E 3HOUH 4JBKA 4PZ6A 3U4VA 5IE8A 4JI1Q 1GM5A 1XPRA 4B3ML 4NXML 1Q1BA 3NELA 3CCQA 1K3RA 4A3CG 1N36L 3TRZA 2AWNA 3LGJA 3PO2G 3CPWA 4DPGA 2KHIA 3OW2A 3GTKH 2HQLA 3CD6A 2UXDQ 2RF4A 3CAMA 4TQUS 1PH6A 1PH2A 1SFOH 1PV4A 4HIOA 2Q2UA 3S15H 4R4CA 3ZJYC 4JYAQ 1J5EQ 5IYCG 2BA0A 1P16A 1PH8A 4O2DA 1T9HA 4KHPL 4MNOA 4HJAA 2MNAA 1QZHA 1SN8A 3PUYA 1HNWL 1N8RC 3E9IA 2JA7H 3TEHB 4DK6C 5FLMG 4L5TA 5LMUL 2D0OA 3CPFA 4AQYL 2PQAB 3A5ZB 5JEAJ 4HJ8A 1QVFA 3S1QH 2JK8A 1L1OB 4UPAA 3A5UA 2KBNA 2NN6G 4JBMA 3PUWA 1L0WA 2UXBL 3Q8DA 1JT8A 5C3EH 1VQ4A 1X3GA 4Y7NH 1YJ9A 1N33Q 3PSIA 1VQ9A 1AE3A 4DV2Q 1X3EA 2F3IA 4DAMA 1E1TA 2ZJRA 1EIYB 1VQJA 3GTOH 1CKNB 4DV5Q 1ASZA 4BXXG 2OCEA 2R7DA 4K0KL 1LM0A 1YI2A 3HOXG 3M4OH 1HZCA 2I5MX 3B6YA 1QZGA 2JJQA 2UUAL 3I4MG 4NXMQ 1OXUA 1NBWA 2AWOA 3U50C 4YHHQ 3F2DA 2F52A 4A3FG 1B8AA 1Q8KA 1XMQL 1YITA 3CC2A 3HOUG 4GLVB 3GTJH 1PYBA 1M1KC 3H3VI 3DM3A 3TS2A 1Y14B 4JI2Q 4R4IA 2KHJA 3G48A 1TWFH 2YTYA 4JC0A 5LMNW 3J7A5 5JEAG 4J15A 4P74A 4JG2A 4JI6L 5JJLA 3VDYA 4GLAC 3KF6A 4DV4Q 5M5XH 1V1QA 4JI7Q 5GROA 3PIPA 1A62A 2JA9A 3MXNB 1YEZA 1MJCA 3PUVA 1OXSC 3JAMc 5LMUQ 3GTMH 4AQYQ 1Y1WH 1VQIA 4JI4Q 3I4NH 4LWCA 1N32Q 1X55A 3CCSA 4BA2I 2YV5A 3KOJA 3T1HQ 3BU2A 2B63H 2HIVA 2K75A 4DR5L 2JA7G 4QL5A 1VQDA 2JEBI 3G71A 3KDFA 2CWAA 1N34Q 3EN2A 4YCVA 4IFDI 1DGSA 3F8TA 5DLQE 3JAMi 2AHOB 5C3EG 5IP7H 1IBKL 4BY7H 3E0EA 1EQQA 1MIUA 1K0RA 1U0LA 3CXCA 1X3FA 1VCIA 4A3EG 2UXCL 1LYLA 1UEBA 1X65A 1BBUA 4DR7Q 3AFQA 2ATWA 4LF8L 4A3BH 4YWKA 1QUQB 1E3PA 5C44H 5IYBH 4JI8Q 4P71A 4B3RL 4YCWA 2VUMH 5K36G 2Q2TA 1E7ZA 3RR5A 3PIOA 2HHHL 2BH8A 1S40A 1NTGA 4JI6Q 4LW1A 4A3DG 2YYZA 2Q2HA 1HNXL 1TXYA 3CQZH 4POFA 3T1YL 3HOYH 2B29A 1D7QA 4JOIC 4DR2Q 4JCVE 4LF7L 4MTNA 1BBWA 1LUZA 4TVAB 4GNXB 1OTCA 3H3VH 3CCMA 3ULLA 4LFCL 4LFAL 1CKOA 1GO3E 2R93G 1IBLL 3A0JA 4DR6L 4DR5Q 2F4VQ 4IPDA 1XNRL 2JE6I 1HZ9A 1EFWA 3GDEA 1IL2A 1Y1WG 1XMOQ 1HR0W 3I4NG 1EWIA 2RHQB 2YTVA 4GLXA 4A3IH 4BY1H 3K7UC 4LUVA 3G4SA 2CFMA 1WI5A 4EQ5A 4UP7A 4YY3L 4BBRH 1YIJA 1IBKQ 2B63G 1CSPA 2VQEL 1PFSA 1WJJA 2NVYH 1OXVA 3PCOB 5LMNL 4GOPC 5M3FH 1KXLA 3M4PA 3S1NH 4QY7A 2XTIA 3M85A 2QEXA 4DV1L 1GD7A 3CC4A 4AYBE 4DV0L 5EAYA 4BY7G 5IP7G 4NPSA 5IYDG 2KCTA 1X54A 1VQ7A 1I3QH 3S16H 2E2HH 4GN3B 4OONA 2ASBA 3GTGH 2E2JH 4AYBG 2HHHQ 4IOAA 3M4QA 1N9WA 2IHEA 2QGQA 1MJEA 4UY8C 2PNHA 2A19A 4A3BG 5IP9H 1SROA 2ZTCA 5C44G 2ZM6Q 4DNIA 5IYBG 3CCVA 3OTOL 3T1YQ 1HNXQ 4YCUA 2IX1A 1M90C 2VUMG 4UP8A 2GVBA 1PH1A 4LF7Q 1FJGL 2ZTDA 3K81C 4QGUA 2A8VA 1E22A 1FGUA 5ELNA 4DV7Q 4L5RC 1KL9A 4NB3A 4DUZL 2IHFA 4DR6Q 3UDFA 3KYHC 2JA8H 4GNXC 4OX9L 1VQKA 4IFDJ 4QQBX 5AJ3Q 4A93H 2VW9A 2UU9L 2UXBQ 2L15A 3GO5A 4L5SA 4JI5L 2CWPA 4AH6A 1C9OA 2VQEQ 5LMNQ 2V1CC 3NBHB 4YWLA 4A3JH 3MEFA 2AMCB 3CCRA 1C7YA 2N8NA 3UE0A 3TS0A 2MFIA 4BY1G 4A3IG 3HOVH 1TWHH 4DV1Q 3G6EA 4POGA 2ES2A 4DV0Q 4BBRG 2IY5B 4HIDA 3W1BA 5H1SE 4IPGA 4PMWA 3KJPA 4A75A 1NJIC 4B3MQ 3PO3H 3W1GA 3H15A 4HIKA 3M3YH 4O0AA 1N36Q 4ALPA 4X64L 2K5NA 2H5XA 2HIXA 3CMEA 2WP8J 3DLLA 2HT1A 1Q86C 1CSQA 4OXPA 2NZOA 4DR1L 3OTOQ 3ULJA 1HR0L 4X66L 3EIVA 1FJGQ 4IFDG 4JI3L 1G6PA 1KC8C 1AH9A 1G291 3OYYA 1A8VA 3L0OA 4R1JA 4P73A 5IP9G 1EUJA 3TQYA 4KHPQ 2K52A 4DUZQ 1HNWQ 1S72A 1TWAH 5IY0A 3PF4A 3STBD 2R7ZH 4P75A 1IZ6A 3I56A 3KLWA 1MKHA 1VS0A 1I5FA 1E24A 3KF8B 3H0GH 1R9TH 2FXQA 3TREA 1W2BA 4JI5Q 1E1OA 3A74A 5IWAL 1L1OA 2R7FA 1PH5A 2BH2A 2JA8G 5FLXc 1NMFA 1L1OC 1NY4A 3SGIA 2A1AA 1PYSB 1KRSA 2EXDA 4K0KQ 4C3JH 1GVPA 1YVCA 1QVGA 4YWMA 2UUAQ 1XPUA 1NE3A 4LF5L 3ULPA 1CUKA 1Q82C 4A3JG 5FJ8H 1JJ2A 2OTLA 4WJ3M 3AQQA 5C0XI 2ZJPA 2DUDA 4X64Q 1YZ6A 1W3SA 1XMQQ 1UE1A 3RNUA 2VL6A 2KENA 1RIPA 2IX0A 4C2MH 1EOVA 2KCMA 1HNZL 4X66Q 4LF9L 3GTLH 1OXXK 3PUZA 3HOWH 4HJ9A 5M5YH 3PUXA 4JOIA 5M5WH 1UE5A 5E7NA 4IOCA 4X6AH 3AYHB 1J6QA 3CCLA 1V43A 4KLKA 1XNQL 2Q2IA 5M3MH 5GAGC 3RLFA 1KD1C 1I94L 4A3LH 3U58A 1C0AA 3RN2A 1K83H 2JA6H 3CMAA 2E2IH 4OO1I 1VQNA 2DGYA 3BZKA 3UDXA 1VQAA 1EYGA 3I7FA 4DK3C 2ZTEA 5IWAQ 2R7ZG 2JEAI 2B3GA 1VQFA 4B3SL 3M9BA 4XIGS 1VQ5A 2I0QA 3IRBA 1BVSA 1D8LA 3ER0A 1XJVA 4JBJA 3AFPA 2VZAA 4GOPA 2UUCL 1Z9FA 5GAHC 3H0GG 2UXDL 2NVTH 5HGQA 3STBC 3K80C 2PI2A 2YTXA 4XTCS 1P8LA 3L2PA 1OXTA 3HOZH 1TWGH 3HFZB 2I5LX 5FLMH 1KAWA 2UXCQ 1J5EL 2NZHA 4UP9A 1VQOA 4LF6L 4LFBQ 4LF8Q 3U4ZA 3UDIA 4A3KH 4EX5A 3CF5A 3S1RH 3K0XA 1SE8A 1X6OA 5FJ8G 4B3RQ 3NENA 4LF9Q 1QUQA 1S3OA 3RLNA 3EBEA 2MO0A 5ELOA 2K4KA 2YU9H 2LSSA 2IT1A 4A76A 2PMZE 1Y1VH 5C4XH 1XPOA 1AE2A 3ERSX 2OWOA 2R92H 4MZ9A 1RL2A 3HOWG 3NEMA 1WOCA 3GD7A 4DKAC 1EQRA 5C4JH 3RN5A 3ICEA 1JJGA 4A3FH 5GADC 4DV5L 3PGZA 1Q81C 4LFAQ 3CCJA 4LFCQ 2K14A 1PHJA 4R4TA 3D0FA 3HOYG 3HKSA 3S17H 4NXNL 4GN4B 4GNXA 4HJ7A 2GVAA 3FHWA 1IBLQ 4BBSH 3CW2C 1XTDA 5M3MG 1SLJA 3GTQH 4A3LG 4YHHL 1XNRQ 2D0PA 1EIFA 2WB1G 5HY6A 1QVCA 1A0IA 4DUYL 4B3SQ 1LTLA 3CCEA 1KIXA 2JA6G 4GKJL 3KFUA 1HZAA 2Z6KA 4DV6L 1JB7A 2UUCQ 4YY3Q 4R4OA 1K8GA 3F2CA 1VQMA 2Z6KC 5C0XJ 2AKWB 4JI2L 3KF6B 3F2BA 3W5OA 1VQCA 1U5KA 3PF5A 2D62A 4DV4L 4LF6Q 2MO1A 1KQSA 4JV5L 3D31A 4JI7L 4Y52H 1Q12A 5M3FG 3HOZG 2NVQH 5JJKA
chains in the Genus database with same CATH superfamily
4KHZA 4FXDA 2O5IC 1TS4A 1TWHB 4A3KG 1H9KA 4DNTB 4IUVA 4IPCA 4KN7C 2KEDA 2HDMA 4A3EH 2HD3A 3JAML 2M2LA 1SJED 2B2WA 5C0XG 1YJNA 1ESRA 4DR3L 2RCNA 2XIWA 2K5HA 4DAYB 1TU2B 2CH4W 1EY6A 1YHQA 1IBML 5J3BA 1WCMH 1UWVA 4Q0FA 4A93G 2OTJA 5E1FA 1YBYA 2ALYB 2Y0SG 4IO9A 1CZWA 2CKZB 3BJUA 4KTAA 3CCUA 4FF4A 2Z8LA 4JV5Q 4RKLA 2R93H 2WAQG 4ULLA 4X3SA 1R9TB 4PV1C 4PZ8A 3HP3A 1PZID 4OWWB 3CHBD 3R2TA 3EQLC 2IWHA 1QNUA 3PO3G 3K7AH 4PNYA 4PQXA 5BR8Q 3UDGA 4JI3Q 3SVMA 1K0SA 1F2YA 4B9XA 5A2QL 4J8QA 5IGDA 1YHBA 3J7ZC 1H95A 5JOBA 4C2MB 2JA5G 5JJIA 3GTLB 1B9NA 2Z1CA 3F1ZA 3PO2H 1DOKA 1TWCH 4APVA 1TY0A 1G51A 2WFWA 2TMPA 4JI1L 3P75A 1F9SA 1NAPA 1M8AA 3BZCA 3J7YW 3CC7A 3M7NA 2E2IB 4XDXA 3FKIG 4IJLA 1B70B 2VY3A 1WTHA 5CV5A 4LF5Q 4PG3A 1QOHA 1MBYA 4L6TB 1FVIA 1K28A 1PYWD 2I5HA 5KIXA 4A3MG 1YJWA 2NN6H 3MC0B 3RZDH 2ZT9C 2XGTA 5M3FB 1PTOC 1HNZQ 5DNFA 4QIWE 3MXGA 4HCEA 1MHWC 3O13A 3HOXH 3ND9A 2B39A 3WWVA 3K5MA 2BA1A 4DV2L 4B3TQ 4L8JA 4WJ4A 3KLSX 3K5OA 5EKKA 3SHLA 3U4VA 1LABA 5IE8A 4NXML 1Y1VB 4A3CG 1N36L 2R92B 1BOSA 1Z6HA 4FF2A 3CPWA 3QG1A 3OW2A 2B8FA 4K2KA 1JOOA 4TSSA 4TQUS 1PH2A 1SAPA 3GTQB 1GUNA 3TBIB 3S15H 4R8NA 5IYCG 2BA0A 5CYUA 1QZHA 2Q8IB 5CV8A 1N8RC 3A8KE 3TEHB 3PIP3 5LMUL 2D0OA 3HOVB 1WD0A 2JK8A 1SE3A 3D4RA 1JT8A 4NP5A 3Q8DA 4Y7NH 1N33Q 1X3EA 4DAMA 4BXXG 1TVXA 5K5PA 3M4OH 3B6YA 1QZGA 1YNND 2AUJD 4MIUA 1NBWA 2AWOA 3U50C 4I65A 4I7ZC 4A3FG 1B8AA 5FLXL 1XMQL 3P1HA 3HOUG 3GTJH 3BDCA 3DM3A 3TS2A 1LLRD 4JI2Q 4R4IA 3FMCA 1LTAD 1TWFH 4JC0A 3J7A5 1B9MA 3S2DB 1K3BC 4J15A 3E5SA 3NWSA 1A62A 2JA9A 1YEZA 3PUVA 1ICWA 1LT4D 1WTVA 3V05A 1B50A 1TKWB 1X55A 2EY2A 2WV6D 4A3GB 4N9PA 2HIVA 4DR5L 2JA7G 1UAPA 1PTOH 2F0MA 1JR0D 2JEBI 1GUOA 2CWAA 3BYYB 1DGSA 1NSNS 3F8TA 1E2ZA 1OO9B 2AHOB 5C3EG 1IBKL 1O78A 5I2YA 1EZ8A 1Y8OB 4CKEA 1VCIA 2KJXA 1X65A 5TSSA 3AFQA 4LF8L 5IYBH 4DAYA 4P71A 3DXJC 4B3RL 2VUMH 5K36G 2Q2TA 1SNOA 2BH8A 5KNCA 4M1UB 1D6EC 4HTHA 4QUFA 3ERQA 2YYZA 1K8OA 3T53B 4K6LA 5LL6X 4FVMA 4TVAB 1CHPD 3CCMA 3GQBA 3ULLA 2EVBA 1I4PA 1SYDA 4IPDA 1XNRL 2JE6I 1W6KA 1IL2A 3GDEA 1ET9A 3TZDA 1HR0W 1MI2A 2Z6BA 1EWIA 2YTVA 4A3IH 4FYDA 1WI5A 4UP7A 4BBRH 2B63G 4LMQD 1PFSA 4GOPC 3DWAA 1U4LA 3NTKA 2QEXA 4DV1L 3RUZA 2LFNA 4DV0L 5IP7G 1KNEA 1I3QH 3HS0C 4C3HG 1FYCA 1GUTA 2ASBA 3GTGH 1BCPD 1DZ1A 1RTNA 1N9WA 2A6HD 3M4QA 1MJEA 2BOSA 1EY8A 4LFBQ 3P20A 1HNXQ 2JN4A 1ILQA 4E6IA 4OIJA 2A8VA 1JB3A 4KKSA 2CH4A 4DV7Q 2ICEC 1KL9A 4DUZL 2K5WA 1MSGA 1WTOA 2F0HA 4A93H 2VW9A 2L15A 3QIAA 5BN5A 4L5SA 5EKIA 2EDGA 1B4OA 2VQEQ 2V1CC 5E4WC 1YNJC 3OMGA 3N6RA 3UE0A 1BBXC 3TS0A 2NTTA 2MFIA 3X3NA 2RQXA 3SK5A 4HIDA 3PO3H 4B3MQ 2CW0C 2RDHA 3W1GA 4HIKA 5KYLA 4ALPA 2K5NA 2HIXA 1IYUA 3U9SA 4V190 2HT1A 1TIID 2NZOA 4DXFA 3OTOQ 3D6WA 4X66L 3EIVA 4JI3L 1KC8C 1AH9A 2K7VA 3OYYA 3LNNA 1JWUD 2PQEA 3DM1A 4TRDA 5CGKA 3MAQA 4KD3A 3I56A 5M5XB 1ML0D 4JVZA 3BZDB 3KF8B 3TREA 1W2BA 3BVGA 5IWAL 2BH2A 1J9OA 2QW7A 5C5MA 3EA6A 2JA8G 1HQMC 2C9OA 5CBEE 1NMFA 1L1OC 2Z4HA 4CKCA 3TP8A 2DJFC 5IODA 3I4NB 4C3JH 4DF7A 3H94A 4YWMA 4LF5L 1CUKA 2EYLA 5C0XI 5IOCA 1W3SA 1HFNA 1HHVA 1H9MA 2HCCA 4TKOB 2KENA 4BY7B 3R3OA 1HNZL 4LF9L 1CK1A 1OXXK 3PUZA 4AYBB 1G8ZD 5C3WA 4JOIA 1UE5A 3CCLA 4A3BB 1X32A 3DEPA 1KD1C 1SDFA 1EYDA 5DM73 2HUGA 3BZKA 3NQIA 5KNDA 5I4DA 2JEAI 4B3SL 4WFN3 1II3A 2F3WA 4JBJA 3AFPA 2VZAA 2RDGA 5D3IB 2YTXA 2QDLA 3L9AX 1P8LA 3L2PA 1OXTA 2PZTA 4WJWA 3HFZB 1KAWA 2NZHA 4BY1B 1KLGD 3U4ZA 4EX5A 1EY5A 4RGNA 3K0XA 2KHSA 2NVYB 5FJ8G 1MSHA 1STEA 2NUCA 2MO0A 3PMFA 2YU9H 3BDLA 3NK9A 4A76A 2PMZE 5C4XH 1AE2A 5G3LF 5I9PA 2OWOA 3S16B 1WTPA 2PYKA 3OOCA 4QUCA 4DKAC 4A3FH 2JSOA 5GADC 1Q81C 3GTKB 2DY7A 4NXNL 4BBSH 2A69D 1SFOB 1PFBA 5HY6A 4DUYL 4H44C 1LTLA 4KD4A 1SJHD 4GKJL 1JB7A 5I9OA 1SNPA 1K8GA 2Z6KC 4JI2L 2JA7B 3F2BA 3FDTA 2K03A 3SDZA 1LTSD 1KQSA 4J1MA 3VYTA 4RAUC 4RHSA 4DFAA 2D5DA 3W2DA 1PDQA 4ZUJA 5M3FG 1IYVA 1CZGA 4C3IH 2CHBD 5EGTA 1PA6A 2LKVA 1WFQA 2E74C 1FL0A 2CQOA 1YNXA 2XRQD 1T5EA 1X9NA 3M3YB 1V9PA 1Q46A 2EYPA 4XYQA 3SR1A 5IIFA 2EY5A 4BWGB 1Y1VG 3IL8A 4JYAL 2L1BA 3EFXD 2I07B 2R92G 1B1ZA 4RMFA 5K36H 2CQAA 2VS1A 1L0XB 4ILWA 1LTRD 2EJMA 2RHSB 2Y0SE 2DNCA 2ID0A 3I73A 2WAQE 2R7ZB 2N88A 3OSOA 2EYMA 3S2HH 1YHAA 1G2SA 2OQKA 3I55A 1CKNA 4IJHA 5HURA 4IQZA 1Z47A 2K5VA 4AIMA 3HOVG 2C35B 1PZKD 1UUPA 1PRTF 3R93A 2JQOA 1SSOA 3OHXC 4Q5VA 3QOJA 2VQFQ 3RZOH 1Q1EA 2A74C 3GTPH 4DR4Q 1HR0Q 4L5QA 1ONLA 2UUBL 4LF4L 1JE5A 1RTOA 2MQHA 3G7LA 1BKBA 1VQGA 4JI0Q 3TP5A 5ELEA 2NVXH 2XWJB 3S24A 3S14H 2QA4A 2RDFA 1STGA 4C3HH 1PRTD 1K73C 1JORA 3HOWB 5M5YB 5M5WB 2N49A 1VQHA 3M7GA 1BXTA 2BE5D 1PRTB 2F0FA 1S5DD 2NBFA 1BUVT 2LXJA 5IGFA 4LFBL 2R61A 4RG1A 2F0OA 2E5LQ 1KNAA 1UEAB 4X62Q 1CFMA 4A3GG 4DV7L 2PI2E 4X65Q 1PH4A 1JWSD 1LT6D 3Q23A 3HG9A 1UE7A 3HOZB 4EGVA 1IW7D 4KY7A 3I4MH 4GKKQ 4JBWA 1I94Q 4DV3Q 4EVOA 3J81i 4FF3A 1VQ8A 4JPBW 2E2JB 5E3FA 1GKHA 1SR3A 2FINB 4LNQA 2WB1E 1I4RA 3WOEA 3QO2A 4KV6A 4B3ML 3CCQA 3NELA 2SOBA 1KAAA 1SYFA 2F0SA 5JEAH 3TRZA 2A5HA 2AWNA 2CVRA 2XSCA 3MFYA 4K5WA 5C4JB 4QF4A 2KHIA 1KLUD 5J39A 2G5DA 2HQLA 3CD6A 2RF4A 3S17B 1VF5C 1PV4A 4HIOA 2JA8B 3NSWA 3TP6A 1DCZA 2IX3A 1P16A 4O2DA 4IALA 4HJAA 1JOKA 4L5TA 4AQYL 2PQAB 3A5ZB 5JEAJ 3VR6A 3VYSA 2KBNA 1L0WA 2IL8A 1VMCA 2F0GA 2B2YA 1I4GA 1LTBD 1RKNA 1EIYB 5D65A 1ASZA 3I3CA 1EOTA 2Q8RE 2QILA 2PPBC 4S3SA 3H3VI 3MFGA 4K5VA 5CORA 4JG2A 4JI6L 5JJLA 3VDYA 4GLAC 3C1FA 3FPPA 3MEHA 1V1QA 1V1PA 4JI7Q 3VR4A 5KEEA 3A7AB 4G7ZC 3MXNB 4IUNA 1WCMB 1ENFA 5BN3A 1Y1WH 3A8JE 4JI4Q 2WINB 4LWCA 4MTKA 3CCSA 4BA2I 2K75A 3T16A 2PW5A 2JYOA 1VQDA 1SXTA 5JAVA 1N34Q 4YCVA 3HKZB 1HA6A 1DM0B 4IURA 2N55A 3K7AB 1MIUA 1X3FA 1SE4A 2QKIC 1A15A 2ATWA 2OT2A 5ISRA 5C44H 4JI8Q 3RR5A 4O42A 1EWCA 4ZLTF 1K83B 1X3PA 4LW1A 3PO2B 1Y8NB 1YNNC 1TXYA 3CQZH 3T1YL 4JOIC 2G9HD 2B2TC 3NXWA 4JCVE 4LF7L 1T5XD 3MTSA 1LUZA 2K05A 4IZ8A 1CKOA 1PMRA 1TY2A 1EY4A 2L55A 4DR6L 1C4QA 2B2UA 2MPMA 3A56A 2Q8TA 3I4NG 1QG7A 1I6VC 4LUVA 1GUGA 3RZDB 1YIJA 2KECA 1OXVA 4FO2A 1CT1D 5EPKA 2EE1A 5M3FH 3M4PA 4X3KA 3K5NA 3CC4A 1K8MA 4BY7G 3D6CA 2G9DA 4NPSA 5IYDG 3HOXB 2F0IA 2NZ1D 1VQ7A 1GXDC 2E2HH 4AYBG 3TSSA 2HHHQ 4IOAA 3C1EA 1HCZA 1SEBD 1AFPA 4A3BG 1ICFB 3CCVA 2EJGC 4YCUA 2DN8A 1KDBA 1IHZA 1FJGL 4XQNA 3K81C 4ZQ3A 3I4LA 1MGSA 1NR4A 4XT1B 2BDOA 4ZKCB 3SK4A 3UDFA 3KYHC 1SYBA 3KBGA 3S15B 1NCVA 1B3AA 2WKCA 1STBA 2UXBQ 4JI5L 4AH6A 1C9OA 5LMNQ 2Z4IA 3NBHB 4A3JH 3R8BA 2AMCB 2KQ3A 5I6WA 3CCRA 2RA4A 3HOVH 4BY1G 1HRJA 1IKLA 4OELB 1S5BD 2OF1A 3KJPA 4A75A 2F0TA 4I7AA 4O0AA 4X64L 3URYA 2KOLA 2AQ3B 1CA5A 1CSQA 1ZKOA 4OXPA 1SMYD 4MHEA 4H0LC 3ULJA 1HR0L 4IFDG 1SYEA 2VB3X 2Z9HA 4HN7A 3R2IA 3TQYA 5IP9G 3GTJB 4A3DB 1PTOF 1I4QA 1HNWQ 1BCPC 1TWAH 5IY0A 1JICA 2A6HC 3PF4A 4DA2A 1TWFB 4P75A 5CV7A 1RDPD 5CV6A 1C48A 3T4AC 1MKHA 2F4IA 1I5FA 1FNVA 4K2LA 3MXPA 1NNXA 1E1OA 2R7FA 1TQOA 4O1NA 4CGYB 1NY4A 3SGIA 4RCNA 2A1AA 1KRSA 4K0KQ 1GVPA 3F2UA 3ITPA 3ONAB 1QVGA 2UUAQ 1XPUA 1Q82C 2XNAC 2B2VA 1KDAA 4F88A 4WJ3M 2ZJPA 1PTOB 1X3QA 1UE1A 3RNUA 1WTXA 3J7AV 1EOVA 5CV9A 3GV3A 3E3XA 3A7LA 4HMJA 3T51B 5E7NA 4IOCA 3AYHB 1AW7A 1AZQA 1DOLA 4KLKA 1F9RA 5M3MH 1I94L 2MHVA 2VUMB 4A3LH 2A68D 3NP8A 3U58A 1C0AA 5D3DA 2JA6H 3CMAA 3VR5A 2F0UA 1VQNA 3BG3A 3UDXA 3OWFA 5F2DA 3I7FA 1EEFD 1Y8PB 2R7ZG 2B3GA 2KVMA 1U4RA 3IRBA 1BVSA 1HUNA 2UUCL 3H0GG 2NVTH 5HGQA 4XTCS 1TT2A 3DEOA 4FF1A 1TWGH 2I5LX 2ZXRA 1S5FD 1QE6A 3Q6SA 4A3IB 1DYQA 1S5ED 1XWEA 3UDIA 3CF5A 4A3KH 3S1RH 4BBRB 4EQNA 1WTQA 5C4HA 3EBEA 3W3AA 5LHY1 2K4KA 5C0XH 5NUCA 1RL2A 3GTGB 3HOWG 3NEMA 3GD7A 5C3XA 3ICEA 1EQRA 4C1NI 2K32A 3V96A 2RVLA 3PGZA 3NHHA 3HKSA 2GVAA 1ESFA 1TS3A 2JP1A 2D0PA 1EIFA 2TSSA 1A63A 1A0IA 3G6JB 1BQQT 4YY3Q 4R4OA 3OPOA 5C0XJ 3TN2A 3W5OA 4G7OC 1U5KA 4DAPA 4JK1C 3S1QB 5CMDA 4LF6Q 4JV5L 3KUPA 4JI7L 4Y52H 2SNSA 3HOZG 2NVQH 5JJKA 1L2FA 3LWUA 3GTOB 4JI4L 4BA1I 2QEJC 5I2XA 1ASYA 4HSVA 3DUZA 1CTMA 4H02A 3M4YA 1VQBA 5GQOA 3KDFB 3IFDA 1PH9A 1L0YB 2BDNA 3E9HA 5BR8L 2JA5H 2OXPA 3K8AA 4ME3A 1N34L 2B2YC 3QWNA 4IPHA 1K9MC 3UE1A 3K58A 1HQRD 2B2WC 4OX9Q 1IYJB 1STYA 3S1MH 3E6ZX 2UU9Q 4OWTB 2EIFA 4DV6Q 4C1NK 3FKIH 5EPLA 2F0VA 4JI8L 4R4QA 3JC66 5T1IA 4HR7B 4A3MH 3I8ZA 4A4IA 2A69C 2ZJQA 3L7ZC 3K59A 4OWXB 1CKMA 3D8GA 4OO1G 2J4XA 4HIMA 1LTTD 1VQLA 1KRTA 3C46A 4OIKA 4C3JB 4DR1Q 1HXYD 4LUZA 4HMIA 4GOPB 4WORA 4RGOS 2LXKA 2FJ2A 4CDFC 5IYDH 1R4QB 4B3TL 4A3CH 4DR3Q 1SNQA 4GS3A 3I90A 1I50H 3J80i 1LTID 5FO7B 3HOYB 1IBMQ 4F8MA 3PV0A 5IGBA 5IT9c 4ZUIA 1X56A 1A2UA 1CA6A 2WB1B 2F0JA 4CHTB 5ELFA 5IYCH 2ICIA 3DHQA 2NYZD 2OQ0A 1JJCB 2WIIB 1D1IA 1WCMG 1HTPA 1KHIA 3J81j 3D4DA 1K8AC 2XRSD 1YNJD 4QJFA 5GAEC 2L12A 1BNZA 2F1MA 1ZYRD 4B08A 1Y69U 3J81c 5IT9E 2VB2X 4BS9A 3I2ZA 4C56C 2FHTA 1VQPA 1RCVD 1E2VA 1F2ZA 2B2UC 2EQSA 3HKZG 1UE6A 3A8IE 4BXXH 1O7YA 3CP0A 4DN4M 1B3QA 1N33L 1A3UA 2PNRC 1Q7YC 1A3TA 2Z0SA 3RLOA 4CJ0B 1XNQQ 3NTIA 5EBDA 3J81E 1I6HH 4LUOA 3HOUH 4JBKA 4DGZA 2YU9B 1DONA 1BO0A 4JI1Q 1XPRA 5C4XB 1Q1BA 4RKBA 1K3RA 2D2CC 3LGJA 3PO2G 3GTKH 5G3LD 3AB9A 2UXDQ 3CAMA 4LJZC 4RCOA 1PH6A 1SFOH 2Q2UA 1HTLD 5CC4A 2C5CA 3H3VC 2XWBB 1J5EQ 3H6MA 4IUPA 1BDOA 1PXUA 2BE5C 1HNWL 1IL8A 3OIQA 4RGMA 3E9IA 2JA7H 3EROA 4DK6C 5FLMG 1TS2A 4HJ8A 3RMHA 3A5UA 1L1OB 1EEID 2A6ED 2VNUD 2NN6G 3PUWA 1IKMA 5IGCA 5C3EH 1X3GA 1YJ9A 2KUMA 1QILA 4IN3A 1O80A 1VQ9A 2VXWA 1AE3A 4DV2Q 1J8IA 5KNBA 2F3IA 2EOTA 1E1TA 4C3IB 4K0KL 2OCEA 2R7DA 5EJWA 3HOXG 1HZCA 2I5MX 2UUAL 4NXMQ 2HDLA 1QWYA 2RCFA 3SK6A 4YHHQ 3F2DA 1Q8KA 5FK9C 1YITA 3CC2A 1PYBA 4RHRA 3N52A 1Y14B 4N8FA 1EU4A 5KGUA 1G2TA 2YTYA 5LMNW 4HCSA 5JPNC 4RFBA 3H0GB 3PIPA 1ZEQX 2PCFB 4FXGC 3TDQA 5LMUQ 3VA5A 3GTMH 1W6JA 1N32Q 1B2TA 1JOQA 2YV5A 3KOJA 4DNRB 3BU2A 3T1HQ 2B63H 1EIGA 1H9SB 4RA8A 3IFTA 3G71A 3KDFA 3EN2A 4IFDI 3JAMi 5DLQE 1H9RA 5IP7H 2DNEA 3E0EA 3RZOB 4QIWB 3MA2B 1U0LA 3GTPB 3CXCA 4LK1C 1LYLA 2B2VC 1BBUA 4ZYSA 4DR7Q 3PQIA 1M4VA 4YWKA 1QUQB 1EY7A 1WD1A 3S14B 2NVXB 4KN4C 3KF8A 5D14A 3PIOA 1S40A 1NTGA 1JC7A 4G4KA 2V4DA 3E0JA 4A3DG 3P7JA 3FPUB 1HNXL 1D7QA 2B29A 2L0CA 4DR2Q 3VYRA 4MTNA 5FKAC 1BBWA 2O4XA 4GNXB 1OTCA 3H3VH 1KDCA 3H91A 4DR5Q 2F4VQ 1HZ9A 1EFWA 1XMOQ 2H4OA 3GV6A 2RHQB 4GLXA 3A54A 2CFMA 4EQ5A 4YY3L 1IBKQ 2VQEL 1WJJA 3PCOB 1Q3LA 1KXLA 3S1NH 2L11A 4QY7A 5ELDA 4KHVA 2XTIA 2KA7A 2P5ZX 1D1KA 4AYBE 2NB0A 2LY7A 1EYAA 1PLFA 3I4MB 2KCTA 3QJYA 1RHPA 3MZ5A 4OONA 2E2JH 3UI2A 3SEBA 2EY1A 2IHEA 3T56B 3AMUA 2QGQA 5DM63 2ZM6Q 2IX1A 5IYBG 3OTOL 1M90C 2VUMG 1EYCA 1GHJA 1VDZA 2GVBA 1HUMA 4LAAA 1E22A 5ELNA 4P2CB 1QCBD 2ENBA 4NB3A 2IHFA 1A2TA 4FP5D 1HFGA 2SEBD 3KBXA 2JA8H 2EPBA 4OX9L 2EZVA 5AJ3Q 2UU9L 2CWPA 4YWLA 5COYA 1C7YA 1DXMA 4A3IG 1TWHH 4DV1Q 3G6EA 4POGA 2ES2A 4DV0Q 2HQEA 4BBRG 2H1EA 5H1SE 2I46A 1NJIC 4PMBA 4ZKBB 1AZPA 4A3EB 2F0QA 2WP8J 1EU3A 4HSPA 5IGEA 2K01A 3Q22A 4DR1L 1D5XC 1G6PA 1ENAA 2B8GA 4GZYC 2F03A 1VF7A 4KHPQ 2FMMA 3NPPA 4DUZQ 1S72A 3STBD 4JW0A 2RKSA 1IZ6A 1SNMA 1VS0A 2IPKD 1CQVA 1E24A 1DOMA 2F0EA 1R9TH 2R93B 1GHKA 4DXGA 1L1OA 4EQOA 1GJXA 3NE5B 4DK1A 3KLRA 1Y1WB 3I72A 1U4PA 1LO5D 3BYTB 2OTLA 5FJ8H 4H7BA 1FD7D 4KKTA 5IT9L 3V2TA 1MD2D 1RIPA 4C2MH 4N8X1 1V1OA 2KCMA 3GTLH 4X66Q 4G7HC 4HJ9A 1TWCB 4MN3A 3WOFA 4X6AH 2QF7A 1J6QA 5CV4A 5C44B 1V43A 2XN9C 2Q2IA 3J81L 5GAGC 1XNQL 1H9JA 4QB4A 3RN2A 1K83H 2EYJA 3I70A 1SMYC 3NWTA 2E2IH 4OO1I 2KCNA 1VQAA 3CQZB 1EYGA 1B44D 4DK3C 3S9WA 5IWAQ 3M9BA 2K04A 2D9UA 1XJVA 5CBAE 1H9SA 3CRLC 1JWMD 1Z7TA 2UXDL 3MXUA 1JCKB 4XYOA 3H09A 1ZXTA 2UXCQ 5FLMH 1J5EL 1SNDA 5KYIA 4C3JG 1GOZA 2X69A 1X6OA 2R3ZA 3NENA 4LF9Q 3U9OA 1QUQA 1S3OA 3A55A 4KMUC 2L4NA 1TS5A 1F9PA 5ELOA 2LSSA 2IT1A 5J22A 1Y1VH 1BF4A 1FNWA 2R92H 2E2HB 3C2PA 1A3VA 1WOCA 2K5DA 2F0KA 1Q8IA 4LFAQ 4LFCQ 2K14A 1PHJA 4R4TA 3D0FA 3HOYG 1FNUA 4GNXA 1IBLQ 4HJ7A 1FR3A 1XTDA 2X6GA 3SK8A 1SLJA 1TR5A 3GTQH 4YHHL 2WB1G 5L37A 2M00A 1QVCA 4B3SQ 1KIXA 3KFUA 2Z6KA 3IAYA 3FEWX 1R4PB 1EQTA 1VQMA 4ZCKA 2A68C 4KKUA 2AKWB 1SYGA 3KF6B 1XYIA 2KCCA 2NWGA 5AFWA 2MP1A 4N9TA 4FNFA 2MO1A 1U4MA 1Q12A 4Y7NB 2WKDA 4A3JB 1PFMA 5EKLA 3NTHA 1N32L 1LACA 3M4OB 3CU7A 3T1HL 3L3OC 2VQFL 4DR4L 1STNA 3CKIB 3HRZC 4XQJA 3TMEA 1SE2A 2PZUA 1PVOA 5M9OA 3AEVA 3OW7A 1SRUA 4NXNQ 4JI0L 5C4XG 2RSNA 2N3SA 3S2DH 1F2MA 4DUYQ 4XXEA 3GP7A 4GKJQ 2EYHA 4DR7L 1EY9A 4A3DH 2PQAA 1IXRA 4BBSG 1HH2P 1HJPA 1PH3A 2NN6I 1TWAB 3FP9A 4RH6A 2IW3A 1HZBA 1PTOD 4PZ7A 3I91A 3PIO3 4A3GH 2E5LL 1XTCD 4DR2L 4KJNA 3I4OA 2CCZA 4X62L 2N78A 2K6AA 4NDXA 2GN5A 2PO4A 4X65L 1PH7A 4FDBA 5JPMC 2F4VL 4HJ5A 4C3IG 1XMOL 3J80c 5EBCA 1WTWA 4ABNA 1O7LA 4GKKL 4JYAQ 1B7YB 1F2LA 1EQVA 4DV3L 3VA7A 3MXNA 1CM9A 2PMZB 2XVSA 1NMGA 1F9QA 2R6GA 1JQYD 4U673 3J80E 1O7IA 5M3MB 2K33A 3FVQA 2JA6B 2ZM6L 2J7ZA 2F0NA 1WYDA 3OWEB 3D4WA 2RBMA 5FO9B 1ENCA 4KI0A 1PZJD 1VMPA 1JMCA 2K50A 2QCPX 2E8GA 3KJOA 2F0PA 2NVTB 3HKZE 4P72A 2EJFC 1TWGB 2UUBQ 4LF4Q 5AJ3L 1A6XA 3VR3A 1SMXA 1BCPF 4K14A 4F87A 4A3KB 2MUYA 2A73B 3S1RB 4RWSC 4X3UA 1I3QB 1VQ6A 5IGGA 1VQEA 1RD9D 2O5JC 5LL6S 5HGTA 4GN5A 3ZYYX 1QB5D 2PZWA 4HAEA 2K5QA 4DU9A 2K1BA 4OGQC 4PZ6A 5FO8B 1GM5A 4F7XA 2E75C 2EY6A 4UAIA 3QR8A 4G57A 5J1ZA 4DPGA 1E0BA 1RJTA 1BCPB 3X3MA 4H13C 1SBBB 4R4CA 3ZJYC 4CBVA 4A93B 2Y0SB 3BDOA 1PH8A 2OEOA 1T9HA 4KHPL 3BVMA 4MNOA 2MNAA 1SN8A 3RD4A 3PUYA 2WAQB 2O2LD 5DEHA 4KY5A 3K57A 3CPFA 1QVFA 3S1QH 4UPAA 4JBMA 1VQ4A 3PO3B 3PSIA 2WACA 2NVQB 1ZYRC 2ZJRA 2F3VA 1VQJA 4CDCC 1CKNB 4DV5Q 3GTOH 2FFKB 1LM0A 1YI2A 3NUCA 1G91A 1CQFA 3I4MG 4NW2A 2JJQA 2E2DC 1D5MC 1OXUA 2JA5B 2F52A 5C4ZA 4CJ1B 3KLSA 3DMUA 4GLVB 3LX0A 1M1KC 2KHJA 3G48A 4M8AA 4U68A 5JEAG 4P74A 4DAVA 5CR3A 2K28A 3KF6A 3NBHA 5M5XH 4DV4Q 3S1MB 4IUTA 5GROA 3FKIB 4NKLA 1MJCA 1OXSC 3JAMc 2LS01 4AQYQ 1VQIA 3I4NH 5E4XA 1V8QA 4RGTA 4A3MB 3Q24A 5DAUA 1EZ6A 3EJIA 4DK0A 4QL5A 5ELCA 4EQPA 2EYOA 4BY7H 1BR9A 3JAME 1EQQA 1K0RA 5BN4A 2A6EC 4A3EG 2UXCL 4HEDA 1UEBA 4K6DA 2DY8A 1RF2D 3DWQA 4A3BH 1E3PA 4FXKC 4YCWA 3K0YA 1E7ZA 2HHHL 1E2WA 3HGBA 4JI6Q 4CDDC 4PMCA 3HEJA 1I50B 5EQ0A 3Q0AA 2Q2HA 2B2TA 4POFA 1AEXA 3BS1A 1HPCA 3HOYH 2ZXPA 1QJOA 3BVZA 1GUWA 1WTRA 3QB3A 3K5LA 2AQ1B 3MVVA 4LFCL 4LFAL 2R93G 1GO3E 1WVLA 1IBLL 3A0JA 2QDBA 1O7ZA 2CW0D 4ID6A 1Y1WG 1EIHA 1EY0A 2UXBL 4BY1H 3K7UC 2PW7A 3G4SA 3OMCA 4UHVA 4V0BA 1CSPA 1CI3M 3D3RA 2NVYH 3TP7A 5A2QE 5LMNL 3DWPA 3M85A 2LMCB 1GD7A 5JVG3 5EAYA 4OL7A 1EL0A 1S5CD 1FGBD 1X54A 3S16H 1AN8A 4GN3B 4IFDH 5A35A 1I6HB 4A3FB 4UY8C 2PNHA 2A19A 5IP9H 3HOUB 1SROA 2ZTCA 5C44G 4DNIA 1LT3D 3T1YQ 1PRTC 4BBSB 4J6HA 4UP8A 4K8IA 1PH1A 4LF7Q 2ZTDA 3FRPB 4QGUA 1FGUA 4L5RC 3SE0A 2EXZA 4DR6Q 4GNXC 1VQKA 4IFDJ 4QQBX 2JXMB 1ET6A 4CJ2C 5JJZA 1LTGD 3GO5A 2F0WA 1XXGA 5FOBB 1F77A 4NMZA 3MEFA 1D5ZC 1V1PB 2N8NA 1I4HA 2HCIA 3MWYW 1KTKA 4ME5A 3WDNA 2IY5B 5C3EB 3W1BA 4IPGA 2SDFA 4PMWA 3MHBA 3H15A 3M3YH 1IW7C 1N36Q 1KABA 3CMEA 2H5XA 3DLLA 4WRDA 2EYFA 1Q86C 2F0LA 1DJRD 4OHJA 4B9WA 1EFID 1FJGQ 4IUUA 1Q90A 2NTSA 2AUKA 2RSOA 1G291 2M9VA 5C5LA 1A8VA 3L0OA 4R1JA 4P73A 1EUJA 2K52A 4ZAIA 3NQTA 1CHQD 2R7ZH 1C8CA 3KLWA 5C6AA 1STHA 2BCOA 3S2HB 2J0TD 1AP0A 1B53A 1SNCA 3J80L 4JI5Q 3H0GH 2FXQA 3A74A 1PH5A 3SXHA 5FLXc 4YIJA 1NR2A 4L63B 3VYUA 1PYSB 3LWEA 3GTMB 1ILPA 2EXDA 4ZRZA 1YVCA 3KK7A 1NE3A 2B63B 3ULPA 1JJ2A 4A3JG 3AQQA 2DUDA 4X64Q 1YZ6A 1XMQQ 5I6YA 3C3LA 2IJ0A 2VL6A 5FLXE 5ELBA 2IX0A 2E76C 5JVH3 4C3HB 3HOWH 1QNKA 3K6OA 5M5YH 3PUXA 5M5WH 1EWHA 1U9RA 2AQ2B 4KK7A 4K5XA 3RLFA 1SYCA 1HA5A 4X3TA 2DGYA 2ZXOA 3J7AF 1UNSA 1S4ZA 4CDEC 2ZTEA 1DD2A 2F0DA 1JE4A 1VQFA 2I0QA 4XIGS 1VQ5A 1D8LA 3ER0A 4GOPA 1Z9FA 5GAHC 4KY6A 3STBC 3K80C 2PI2A 3AU7A 1GUSA 3VR2A 1NUCA 3HOZH 4UP9A 2MGSA 1VQOA 4LF6L 4LF8Q 3IKJA 3QOLA 1XX8A 1STAA 1SE8A 2DJGC 1G6ZA 3EVQA 1LT5D 4R9WA 4B3RQ 5KRUA 3S1NB 3RLNA 4OEMB 1RODA 2X6LA 1PFNA 1XPOA 4XT3B 3ERSX 2SNMA 4MZ9A 1LV9A 1I4XA 3RN5A 1JJGA 5C4JH 4QMGA 4DV5L 3CCJA 3CRKC 4IUQA 3ND8A 3S17H 4GN4B 3FHWA 3OIPA 3CW2C 5M3MG 4ODGA 4QCLA 4A3LG 1XNRQ 2L9HA 3CCEA 2JA6G 4R8IA 1HZAA 4DV6L 2UUCQ 3F2CA 4XQQA 4ZK9B 4K8JA 4Z9CB 2KEEA 1VQCA 4OO1H 3HZXA 5EPJA 3PF5A 2GA4B 4CKBA 2D62A 4DV4L 2MJ8A 2L5TA 4KJOA 4UDUC 2FMCA 3D31A 5T1GA 1D2BA 3NBIA 3T13A 3TZUA
chains in the Genus database with same CATH topology
1L2FA 4KHZA 4C3IH 4JI4L 1N32L 4BA1I 1PA6A 4A3KG 1WFQA 1ASYA 3T1HL 1FL0A 4H02A 2VQFL 2CQOA 1VQBA 5GQOA 3KDFB 1YNXA 4DR4L 1PH9A 3E9HA 4IPCA 5BR8L 1V9PA 1X9NA 2JA5H 1Q46A 4A3EH 1PVOA 3K8AA 4ME3A 1N34L 3AEVA 4IPHA 1SRUA 1Y1VG 5C0XG 3UE1A 1YJNA 1K9MC 4JI0L 4NXNQ 4JYAL 5C4XG 2R92G 2N3SA 4RMFA 2RCNA 4DR3L 4OX9Q 3S2DH 1IYJB 4DUYQ 2VS1A 2K5HA 4DAYB 3S1MH 2UU9Q 4OWTB 4DR7L 4GKJQ 2EIFA 4DV6Q 4A3DH 2RHSB 2Y0SE 1YHQA 2PQAA 3FKIH 1IBML 1IXRA 5J3BA 1HH2P 1HJPA 4JI8L 1PH3A 4BBSG 1WCMH 4R4QA 2ID0A 2NN6I 1UWVA 3FP9A 3JC66 2WAQE 4A93G 2OTJA 1YBYA 2ALYB 2Y0SG 1HZBA 4IO9A 2CKZB 3BJUA 3CCUA 4PZ7A 4A3MH 1YHAA 3S2HH 4A4IA 4A3GH 4JV5Q 2R93H 2OQKA 2WAQG 2ZJQA 3L7ZC 3I55A 1CKNA 4OWXB 2E5LL 4DR2L 3I4OA 4PZ8A 1CKMA 4IJHA 2CCZA 4OO1G 4HIMA 1Z47A 2K5VA 2N78A 4AIMA 4X62L 1VQLA 1KRTA 3HOVG 4OWWB 2C35B 2JQOA 2GN5A 4X65L 1PH7A 3PO3G 4FDBA 4DR1Q 4LUZA 3K7AH 2VQFQ 1Q1EA 3RZOH 3GTPH 2F4VL 4DR4Q 4HJ5A 1HR0Q 4L5QA 4GOPB 5BR8Q 3UDGA 2UUBL 4JI3Q 4LF4L 1XMOL 3J80c 1JE5A 2LXKA 2MQHA 1BKBA 1VQGA 1YHBA 3J7ZC 4JI0Q 2NVXH 1B7YB 3S14H 3S24A 4DV3L 4B3TL 2QA4A 2JA5G 4DR3Q 4A3CH 5JJIA 1H95A 4C3HH 1K73C 3F1ZA 3PO2H 4GS3A 1TWCH 1I50H 4APVA 1NMGA 1G51A 2N49A 2WFWA 2R6GA 1VQHA 3J80i 4JI1L 1IBMQ 1O7IA 3PV0A 4GKKL 3BZCA 5IT9c 1X56A 3CC7A 3M7NA 5IYCH 2LXJA 3FKIG 4IJLA 1B70B 2ZM6L 2OQ0A 1WYDA 2VY3A 4RG1A 1JJCB 4LFBL 4LF5Q 1WCMG 2E5LQ 4PG3A 4KI0A 1A63A 1KHIA 4X62Q 2VNUD 3J81j 1FVIA 1K8AC 1JMCA 4QJFA 2I5HA 2K50A 4A3MG 5GAEC 1YJWA 2E8GA 4A3GG 4DV7L 2PI2E 3RZDH 4X65Q 3J81c 3KJOA 1PH4A 3HKZE 5IYDH 2XGTA 3I2ZA 1HNZQ 4P72A 1UE7A 1VQPA 4QIWE 2UUBQ 5AJ3L 4LF4Q 2EQSA 1SMXA 3HKZG 1UE6A 4BXXH 3CP0A 3HOXH 3I4MH 1N33L 3WWVA 4GKKQ 1Q7YC 4JBWA 2Z0SA 3RLOA 1I94Q 4DV3Q 2BA1A 3J81i 4DV2L 4B3TQ 1XNQQ 1VQEA 1VQ8A 1VQ6A 4WJ4A 4GN5A 1I6HH 1GKHA 1SR3A 4LNQA 4LUOA 2WB1E 3HOUH 4JBKA 4PZ6A 3U4VA 5IE8A 4JI1Q 1GM5A 1XPRA 4B3ML 4NXML 1Q1BA 3NELA 3CCQA 1K3RA 4A3CG 1N36L 3TRZA 2AWNA 3LGJA 3PO2G 3CPWA 4DPGA 2KHIA 3OW2A 3GTKH 2HQLA 3CD6A 2UXDQ 2RF4A 3CAMA 4TQUS 1PH6A 1PH2A 1SFOH 1PV4A 4HIOA 2Q2UA 3S15H 4R4CA 3ZJYC 4JYAQ 1J5EQ 5IYCG 2BA0A 1P16A 1PH8A 4O2DA 1T9HA 4KHPL 4MNOA 4HJAA 2MNAA 1QZHA 1SN8A 3PUYA 1HNWL 1N8RC 3E9IA 2JA7H 3TEHB 4DK6C 5FLMG 4L5TA 5LMUL 2D0OA 3CPFA 4AQYL 2PQAB 3A5ZB 5JEAJ 4HJ8A 1QVFA 3S1QH 2JK8A 1L1OB 4UPAA 3A5UA 2KBNA 2NN6G 4JBMA 3PUWA 1L0WA 2UXBL 3Q8DA 1JT8A 5C3EH 1VQ4A 1X3GA 4Y7NH 1YJ9A 1N33Q 3PSIA 1VQ9A 1AE3A 4DV2Q 1X3EA 2F3IA 4DAMA 1E1TA 2ZJRA 1EIYB 1VQJA 3GTOH 1CKNB 4DV5Q 1ASZA 4BXXG 2OCEA 2R7DA 4K0KL 1LM0A 1YI2A 3HOXG 3M4OH 1HZCA 2I5MX 3B6YA 1QZGA 2JJQA 2UUAL 3I4MG 4NXMQ 1OXUA 1NBWA 2AWOA 3U50C 4YHHQ 3F2DA 2F52A 4A3FG 1B8AA 1Q8KA 1XMQL 1YITA 3CC2A 3HOUG 4GLVB 3GTJH 1PYBA 1M1KC 3H3VI 3DM3A 3TS2A 1Y14B 4JI2Q 4R4IA 2KHJA 3G48A 1TWFH 2YTYA 4JC0A 5LMNW 3J7A5 5JEAG 4J15A 4P74A 4JG2A 4JI6L 5JJLA 3VDYA 4GLAC 3KF6A 4DV4Q 5M5XH 1V1QA 4JI7Q 5GROA 3PIPA 1A62A 2JA9A 3MXNB 1YEZA 1MJCA 3PUVA 1OXSC 3JAMc 5LMUQ 3GTMH 4AQYQ 1Y1WH 1VQIA 4JI4Q 3I4NH 4LWCA 1N32Q 1X55A 3CCSA 4BA2I 2YV5A 3KOJA 3T1HQ 3BU2A 2B63H 2HIVA 2K75A 4DR5L 2JA7G 4QL5A 1VQDA 2JEBI 3G71A 3KDFA 2CWAA 1N34Q 3EN2A 4YCVA 4IFDI 1DGSA 3F8TA 5DLQE 3JAMi 2AHOB 5C3EG 5IP7H 1IBKL 4BY7H 3E0EA 1EQQA 1MIUA 1K0RA 1U0LA 3CXCA 1X3FA 1VCIA 4A3EG 2UXCL 1LYLA 1UEBA 1X65A 1BBUA 4DR7Q 3AFQA 2ATWA 4LF8L 4A3BH 4YWKA 1QUQB 1E3PA 5C44H 5IYBH 4JI8Q 4P71A 4B3RL 4YCWA 2VUMH 5K36G 2Q2TA 1E7ZA 3RR5A 3PIOA 2HHHL 2BH8A 1S40A 1NTGA 4JI6Q 4LW1A 4A3DG 2YYZA 2Q2HA 1HNXL 1TXYA 3CQZH 4POFA 3T1YL 3HOYH 2B29A 1D7QA 4JOIC 4DR2Q 4JCVE 4LF7L 4MTNA 1BBWA 1LUZA 4TVAB 4GNXB 1OTCA 3H3VH 3CCMA 3ULLA 4LFCL 4LFAL 1CKOA 1GO3E 2R93G 1IBLL 3A0JA 4DR6L 4DR5Q 2F4VQ 4IPDA 1XNRL 2JE6I 1HZ9A 1EFWA 3GDEA 1IL2A 1Y1WG 1XMOQ 1HR0W 3I4NG 1EWIA 2RHQB 2YTVA 4GLXA 4A3IH 4BY1H 3K7UC 4LUVA 3G4SA 2CFMA 1WI5A 4EQ5A 4UP7A 4YY3L 4BBRH 1YIJA 1IBKQ 2B63G 1CSPA 2VQEL 1PFSA 1WJJA 2NVYH 1OXVA 3PCOB 5LMNL 4GOPC 5M3FH 1KXLA 3M4PA 3S1NH 4QY7A 2XTIA 3M85A 2QEXA 4DV1L 1GD7A 3CC4A 4AYBE 4DV0L 5EAYA 4BY7G 5IP7G 4NPSA 5IYDG 2KCTA 1X54A 1VQ7A 1I3QH 3S16H 2E2HH 4GN3B 4OONA 2ASBA 3GTGH 2E2JH 4AYBG 2HHHQ 4IOAA 3M4QA 1N9WA 2IHEA 2QGQA 1MJEA 4UY8C 2PNHA 2A19A 4A3BG 5IP9H 1SROA 2ZTCA 5C44G 2ZM6Q 4DNIA 5IYBG 3CCVA 3OTOL 3T1YQ 1HNXQ 4YCUA 2IX1A 1M90C 2VUMG 4UP8A 2GVBA 1PH1A 4LF7Q 1FJGL 2ZTDA 3K81C 4QGUA 2A8VA 1E22A 1FGUA 5ELNA 4DV7Q 4L5RC 1KL9A 4NB3A 4DUZL 2IHFA 4DR6Q 3UDFA 3KYHC 2JA8H 4GNXC 4OX9L 1VQKA 4IFDJ 4QQBX 5AJ3Q 4A93H 2VW9A 2UU9L 2UXBQ 2L15A 3GO5A 4L5SA 4JI5L 2CWPA 4AH6A 1C9OA 2VQEQ 5LMNQ 2V1CC 3NBHB 4YWLA 4A3JH 3MEFA 2AMCB 3CCRA 1C7YA 2N8NA 3UE0A 3TS0A 2MFIA 4BY1G 4A3IG 3HOVH 1TWHH 4DV1Q 3G6EA 4POGA 2ES2A 4DV0Q 4BBRG 2IY5B 4HIDA 3W1BA 5H1SE 4IPGA 4PMWA 3KJPA 4A75A 1NJIC 4B3MQ 3PO3H 3W1GA 3H15A 4HIKA 3M3YH 4O0AA 1N36Q 4ALPA 4X64L 2K5NA 2H5XA 2HIXA 3CMEA 2WP8J 3DLLA 2HT1A 1Q86C 1CSQA 4OXPA 2NZOA 4DR1L 3OTOQ 3ULJA 1HR0L 4X66L 3EIVA 1FJGQ 4IFDG 4JI3L 1G6PA 1KC8C 1AH9A 1G291 3OYYA 1A8VA 3L0OA 4R1JA 4P73A 5IP9G 1EUJA 3TQYA 4KHPQ 2K52A 4DUZQ 1HNWQ 1S72A 1TWAH 5IY0A 3PF4A 3STBD 2R7ZH 4P75A 1IZ6A 3I56A 3KLWA 1MKHA 1VS0A 1I5FA 1E24A 3KF8B 3H0GH 1R9TH 2FXQA 3TREA 1W2BA 4JI5Q 1E1OA 3A74A 5IWAL 1L1OA 2R7FA 1PH5A 2BH2A 2JA8G 5FLXc 1NMFA 1L1OC 1NY4A 3SGIA 2A1AA 1PYSB 1KRSA 2EXDA 4K0KQ 4C3JH 1GVPA 1YVCA 1QVGA 4YWMA 2UUAQ 1XPUA 1NE3A 4LF5L 3ULPA 1CUKA 1Q82C 4A3JG 5FJ8H 1JJ2A 2OTLA 4WJ3M 3AQQA 5C0XI 2ZJPA 2DUDA 4X64Q 1YZ6A 1W3SA 1XMQQ 1UE1A 3RNUA 2VL6A 2KENA 1RIPA 2IX0A 4C2MH 1EOVA 2KCMA 1HNZL 4X66Q 4LF9L 3GTLH 1OXXK 3PUZA 3HOWH 4HJ9A 5M5YH 3PUXA 4JOIA 5M5WH 1UE5A 5E7NA 4IOCA 4X6AH 3AYHB 1J6QA 3CCLA 1V43A 4KLKA 1XNQL 2Q2IA 5M3MH 5GAGC 3RLFA 1KD1C 1I94L 4A3LH 3U58A 1C0AA 3RN2A 1K83H 2JA6H 3CMAA 2E2IH 4OO1I 1VQNA 2DGYA 3BZKA 3UDXA 1VQAA 1EYGA 3I7FA 4DK3C 2ZTEA 5IWAQ 2R7ZG 2JEAI 2B3GA 1VQFA 4B3SL 3M9BA 4XIGS 1VQ5A 2I0QA 3IRBA 1BVSA 1D8LA 3ER0A 1XJVA 4JBJA 3AFPA 2VZAA 4GOPA 2UUCL 1Z9FA 5GAHC 3H0GG 2UXDL 2NVTH 5HGQA 3STBC 3K80C 2PI2A 2YTXA 4XTCS 1P8LA 3L2PA 1OXTA 3HOZH 1TWGH 3HFZB 2I5LX 5FLMH 1KAWA 2UXCQ 1J5EL 2NZHA 4UP9A 1VQOA 4LF6L 4LFBQ 4LF8Q 3U4ZA 3UDIA 4A3KH 4EX5A 3CF5A 3S1RH 3K0XA 1SE8A 1X6OA 5FJ8G 4B3RQ 3NENA 4LF9Q 1QUQA 1S3OA 3RLNA 3EBEA 2MO0A 5ELOA 2K4KA 2YU9H 2LSSA 2IT1A 4A76A 2PMZE 1Y1VH 5C4XH 1XPOA 1AE2A 3ERSX 2OWOA 2R92H 4MZ9A 1RL2A 3HOWG 3NEMA 1WOCA 3GD7A 4DKAC 1EQRA 5C4JH 3RN5A 3ICEA 1JJGA 4A3FH 5GADC 4DV5L 3PGZA 1Q81C 4LFAQ 3CCJA 4LFCQ 2K14A 1PHJA 4R4TA 3D0FA 3HOYG 3HKSA 3S17H 4NXNL 4GN4B 4GNXA 4HJ7A 2GVAA 3FHWA 1IBLQ 4BBSH 3CW2C 1XTDA 5M3MG 1SLJA 3GTQH 4A3LG 4YHHL 1XNRQ 2D0PA 1EIFA 2WB1G 5HY6A 1QVCA 1A0IA 4DUYL 4B3SQ 1LTLA 3CCEA 1KIXA 2JA6G 4GKJL 3KFUA 1HZAA 2Z6KA 4DV6L 1JB7A 2UUCQ 4YY3Q 4R4OA 1K8GA 3F2CA 1VQMA 2Z6KC 5C0XJ 2AKWB 4JI2L 3KF6B 3F2BA 3W5OA 1VQCA 1U5KA 3PF5A 2D62A 4DV4L 4LF6Q 2MO1A 1KQSA 4JV5L 3D31A 4JI7L 4Y52H 1Q12A 5M3FG 3HOZG 2NVQH 5JJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2F A;  4KHZ A;  4C3I H;  4JI4 L;  1N32 L;  4BA1 I;  1PA6 A;  4A3K G;  1WFQ A;  1ASY A;  3T1H L;  1FL0 A;  4H02 A;  2VQF L;  2CQO A;  1VQB A;  5GQO A;  3KDF B;  1YNX A;  4DR4 L;  1PH9 A;  3E9H A;  4IPC A;  5BR8 L;  1V9P A;  1X9N A;  2JA5 H;  1Q46 A;  4A3E H;  1PVO A;  3K8A A;  4ME3 A;  1N34 L;  3AEV A;  4IPH A;  1SRU A;  1Y1V G;  5C0X G;  3UE1 A;  1YJN A;  1K9M C;  4JI0 L;  4NXN Q;  4JYA L;  5C4X G;  2R92 G;  2N3S A;  4RMF A;  2RCN A;  4DR3 L;  4OX9 Q;  3S2D H;  1IYJ B;  4DUY Q;  2VS1 A;  2K5H A;  4DAY B;  3S1M H;  2UU9 Q;  4OWT B;  4DR7 L;  4GKJ Q;  2EIF A;  4DV6 Q;  4A3D H;  2RHS B;  2Y0S E;  1YHQ A;  2PQA A;  3FKI H;  1IBM L;  1IXR A;  5J3B A;  1HH2 P;  1HJP A;  4JI8 L;  1PH3 A;  4BBS G;  1WCM H;  4R4Q A;  2ID0 A;  2NN6 I;  1UWV A;  3FP9 A;  3JC6 6;  2WAQ E;  4A93 G;  2OTJ A;  1YBY A;  2ALY B;  2Y0S G;  1HZB A;  4IO9 A;  2CKZ B;  3BJU A;  3CCU A;  4PZ7 A;  4A3M H;  1YHA A;  3S2H H;  4A4I A;  4A3G H;  4JV5 Q;  2R93 H;  2OQK A;  2WAQ G;  2ZJQ A;  3L7Z C;  3I55 A;  1CKN A;  4OWX B;  2E5L L;  4DR2 L;  3I4O A;  4PZ8 A;  1CKM A;  4IJH A;  2CCZ A;  4OO1 G;  4HIM A;  1Z47 A;  2K5V A;  2N78 A;  4AIM A;  4X62 L;  1VQL A;  1KRT A;  3HOV G;  4OWW B;  2C35 B;  2JQO A;  2GN5 A;  4X65 L;  1PH7 A;  3PO3 G;  4FDB A;  4DR1 Q;  4LUZ A;  3K7A H;  2VQF Q;  1Q1E A;  3RZO H;  3GTP H;  2F4V L;  4DR4 Q;  4HJ5 A;  1HR0 Q;  4L5Q A;  4GOP B;  5BR8 Q;  3UDG A;  2UUB L;  4JI3 Q;  4LF4 L;  1XMO L;  3J80 c;  1JE5 A;  2LXK A;  2MQH A;  1BKB A;  1VQG A;  1YHB A;  3J7Z C;  4JI0 Q;  2NVX H;  1B7Y B;  3S14 H;  3S24 A;  4DV3 L;  4B3T L;  2QA4 A;  2JA5 G;  4DR3 Q;  4A3C H;  5JJI A;  1H95 A;  4C3H H;  1K73 C;  3F1Z A;  3PO2 H;  4GS3 A;  1TWC H;  1I50 H;  4APV A;  1NMG A;  1G51 A;  2N49 A;  2WFW A;  2R6G A;  1VQH A;  3J80 i;  4JI1 L;  1IBM Q;  1O7I A;  3PV0 A;  4GKK L;  3BZC A;  5IT9 c;  1X56 A;  3CC7 A;  3M7N A;  5IYC H;  2LXJ A;  3FKI G;  4IJL A;  1B70 B;  2ZM6 L;  2OQ0 A;  1WYD A;  2VY3 A;  4RG1 A;  1JJC B;  4LFB L;  4LF5 Q;  1WCM G;  2E5L Q;  4PG3 A;  4KI0 A;  1A63 A;  1KHI A;  4X62 Q;  2VNU D;  3J81 j;  1FVI A;  1K8A C;  1JMC A;  4QJF A;  2I5H A;  2K50 A;  4A3M G;  5GAE C;  1YJW A;  2E8G A;  4A3G G;  4DV7 L;  2PI2 E;  3RZD H;  4X65 Q;  3J81 c;  3KJO A;  1PH4 A;  3HKZ E;  5IYD H;  2XGT A;  3I2Z A;  1HNZ Q;  4P72 A;  1UE7 A;  1VQP A;  4QIW E;  2UUB Q;  5AJ3 L;  4LF4 Q;  2EQS A;  1SMX A;  3HKZ G;  1UE6 A;  4BXX H;  3CP0 A;  3HOX H;  3I4M H;  1N33 L;  3WWV A;  4GKK Q;  1Q7Y C;  4JBW A;  2Z0S A;  3RLO A;  1I94 Q;  4DV3 Q;  2BA1 A;  3J81 i;  4DV2 L;  4B3T Q;  1XNQ Q;  1VQE A;  1VQ8 A;  1VQ6 A;  4WJ4 A;  4GN5 A;  1I6H H;  1GKH A;  1SR3 A;  4LNQ A;  4LUO A;  2WB1 E;  3HOU H;  4JBK A;  4PZ6 A;  3U4V A;  5IE8 A;  4JI1 Q;  1GM5 A;  1XPR A;  4B3M L;  4NXM L;  1Q1B A;  3NEL A;  3CCQ A;  1K3R A;  4A3C G;  1N36 L;  3TRZ A;  2AWN A;  3LGJ A;  3PO2 G;  3CPW A;  4DPG A;  2KHI A;  3OW2 A;  3GTK H;  2HQL A;  3CD6 A;  2UXD Q;  2RF4 A;  3CAM A;  4TQU S;  1PH6 A;  1PH2 A;  1SFO H;  1PV4 A;  4HIO A;  2Q2U A;  3S15 H;  4R4C A;  3ZJY C;  4JYA Q;  1J5E Q;  5IYC G;  2BA0 A;  1P16 A;  1PH8 A;  4O2D A;  1T9H A;  4KHP L;  4MNO A;  4HJA A;  2MNA A;  1QZH A;  1SN8 A;  3PUY A;  1HNW L;  1N8R C;  3E9I A;  2JA7 H;  3TEH B;  4DK6 C;  5FLM G;  4L5T A;  5LMU L;  2D0O A;  3CPF A;  4AQY L;  2PQA B;  3A5Z B;  5JEA J;  4HJ8 A;  1QVF A;  3S1Q H;  2JK8 A;  1L1O B;  4UPA A;  3A5U A;  2KBN A;  2NN6 G;  4JBM A;  3PUW A;  1L0W A;  2UXB L;  3Q8D A;  1JT8 A;  5C3E H;  1VQ4 A;  1X3G A;  4Y7N H;  1YJ9 A;  1N33 Q;  3PSI A;  1VQ9 A;  1AE3 A;  4DV2 Q;  1X3E A;  2F3I A;  4DAM A;  1E1T A;  2ZJR A;  1EIY B;  1VQJ A;  3GTO H;  1CKN B;  4DV5 Q;  1ASZ A;  4BXX G;  2OCE A;  2R7D A;  4K0K L;  1LM0 A;  1YI2 A;  3HOX G;  3M4O H;  1HZC A;  2I5M X;  3B6Y A;  1QZG A;  2JJQ A;  2UUA L;  3I4M G;  4NXM Q;  1OXU A;  1NBW A;  2AWO A;  3U50 C;  4YHH Q;  3F2D A;  2F52 A;  4A3F G;  1B8A A;  1Q8K A;  1XMQ L;  1YIT A;  3CC2 A;  3HOU G;  4GLV B;  3GTJ H;  1PYB A;  1M1K C;  3H3V I;  3DM3 A;  3TS2 A;  1Y14 B;  4JI2 Q;  4R4I A;  2KHJ A;  3G48 A;  1TWF H;  2YTY A;  4JC0 A;  5LMN W;  3J7A 5;  5JEA G;  4J15 A;  4P74 A;  4JG2 A;  4JI6 L;  5JJL A;  3VDY A;  4GLA C;  3KF6 A;  4DV4 Q;  5M5X H;  1V1Q A;  4JI7 Q;  5GRO A;  3PIP A;  1A62 A;  2JA9 A;  3MXN B;  1YEZ A;  1MJC A;  3PUV A;  1OXS C;  3JAM c;  5LMU Q;  3GTM H;  4AQY Q;  1Y1W H;  1VQI A;  4JI4 Q;  3I4N H;  4LWC A;  1N32 Q;  1X55 A;  3CCS A;  4BA2 I;  2YV5 A;  3KOJ A;  3T1H Q;  3BU2 A;  2B63 H;  2HIV A;  2K75 A;  4DR5 L;  2JA7 G;  4QL5 A;  1VQD A;  2JEB I;  3G71 A;  3KDF A;  2CWA A;  1N34 Q;  3EN2 A;  4YCV A;  4IFD I;  1DGS A;  3F8T A;  5DLQ E;  3JAM i;  2AHO B;  5C3E G;  5IP7 H;  1IBK L;  4BY7 H;  3E0E A;  1EQQ A;  1MIU A;  1K0R A;  1U0L A;  3CXC A;  1X3F A;  1VCI A;  4A3E G;  2UXC L;  1LYL A;  1UEB A;  1X65 A;  1BBU A;  4DR7 Q;  3AFQ A;  2ATW A;  4LF8 L;  4A3B H;  4YWK A;  1QUQ B;  1E3P A;  5C44 H;  5IYB H;  4JI8 Q;  4P71 A;  4B3R L;  4YCW A;  2VUM H;  5K36 G;  2Q2T A;  1E7Z A;  3RR5 A;  3PIO A;  2HHH L;  2BH8 A;  1S40 A;  1NTG A;  4JI6 Q;  4LW1 A;  4A3D G;  2YYZ A;  2Q2H A;  1HNX L;  1TXY A;  3CQZ H;  4POF A;  3T1Y L;  3HOY H;  2B29 A;  1D7Q A;  4JOI C;  4DR2 Q;  4JCV E;  4LF7 L;  4MTN A;  1BBW A;  1LUZ A;  4TVA B;  4GNX B;  1OTC A;  3H3V H;  3CCM A;  3ULL A;  4LFC L;  4LFA L;  1CKO A;  1GO3 E;  2R93 G;  1IBL L;  3A0J A;  4DR6 L;  4DR5 Q;  2F4V Q;  4IPD A;  1XNR L;  2JE6 I;  1HZ9 A;  1EFW A;  3GDE A;  1IL2 A;  1Y1W G;  1XMO Q;  1HR0 W;  3I4N G;  1EWI A;  2RHQ B;  2YTV A;  4GLX A;  4A3I H;  4BY1 H;  3K7U C;  4LUV A;  3G4S A;  2CFM A;  1WI5 A;  4EQ5 A;  4UP7 A;  4YY3 L;  4BBR H;  1YIJ A;  1IBK Q;  2B63 G;  1CSP A;  2VQE L;  1PFS A;  1WJJ A;  2NVY H;  1OXV A;  3PCO B;  5LMN L;  4GOP C;  5M3F H;  1KXL A;  3M4P A;  3S1N H;  4QY7 A;  2XTI A;  3M85 A;  2QEX A;  4DV1 L;  1GD7 A;  3CC4 A;  4AYB E;  4DV0 L;  5EAY A;  4BY7 G;  5IP7 G;  4NPS A;  5IYD G;  2KCT A;  1X54 A;  1VQ7 A;  1I3Q H;  3S16 H;  2E2H H;  4GN3 B;  4OON A;  2ASB A;  3GTG H;  2E2J H;  4AYB G;  2HHH Q;  4IOA A;  3M4Q A;  1N9W A;  2IHE A;  2QGQ A;  1MJE A;  4UY8 C;  2PNH A;  2A19 A;  4A3B G;  5IP9 H;  1SRO A;  2ZTC A;  5C44 G;  2ZM6 Q;  4DNI A;  5IYB G;  3CCV A;  3OTO L;  3T1Y Q;  1HNX Q;  4YCU A;  2IX1 A;  1M90 C;  2VUM G;  4UP8 A;  2GVB A;  1PH1 A;  4LF7 Q;  1FJG L;  2ZTD A;  3K81 C;  4QGU A;  2A8V A;  1E22 A;  1FGU A;  5ELN A;  4DV7 Q;  4L5R C;  1KL9 A;  4NB3 A;  4DUZ L;  2IHF A;  4DR6 Q;  3UDF A;  3KYH C;  2JA8 H;  4GNX C;  4OX9 L;  1VQK A;  4IFD J;  4QQB X;  5AJ3 Q;  4A93 H;  2VW9 A;  2UU9 L;  2UXB Q;  2L15 A;  3GO5 A;  4L5S A;  4JI5 L;  2CWP A;  4AH6 A;  1C9O A;  2VQE Q;  5LMN Q;  2V1C C;  3NBH B;  4YWL A;  4A3J H;  3MEF A;  2AMC B;  3CCR A;  1C7Y A;  2N8N A;  3UE0 A;  3TS0 A;  2MFI A;  4BY1 G;  4A3I G;  3HOV H;  1TWH H;  4DV1 Q;  3G6E A;  4POG A;  2ES2 A;  4DV0 Q;  4BBR G;  2IY5 B;  4HID A;  3W1B A;  5H1S E;  4IPG A;  4PMW A;  3KJP A;  4A75 A;  1NJI C;  4B3M Q;  3PO3 H;  3W1G A;  3H15 A;  4HIK A;  3M3Y H;  4O0A A;  1N36 Q;  4ALP A;  4X64 L;  2K5N A;  2H5X A;  2HIX A;  3CME A;  2WP8 J;  3DLL A;  2HT1 A;  1Q86 C;  1CSQ A;  4OXP A;  2NZO A;  4DR1 L;  3OTO Q;  3ULJ A;  1HR0 L;  4X66 L;  3EIV A;  1FJG Q;  4IFD G;  4JI3 L;  1G6P A;  1KC8 C;  1AH9 A;  1G29 1;  3OYY A;  1A8V A;  3L0O A;  4R1J A;  4P73 A;  5IP9 G;  1EUJ A;  3TQY A;  4KHP Q;  2K52 A;  4DUZ Q;  1HNW Q;  1S72 A;  1TWA H;  5IY0 A;  3PF4 A;  3STB D;  2R7Z H;  4P75 A;  1IZ6 A;  3I56 A;  3KLW A;  1MKH A;  1VS0 A;  1I5F A;  1E24 A;  3KF8 B;  3H0G H;  1R9T H;  2FXQ A;  3TRE A;  1W2B A;  4JI5 Q;  1E1O A;  3A74 A;  5IWA L;  1L1O A;  2R7F A;  1PH5 A;  2BH2 A;  2JA8 G;  5FLX c;  1NMF A;  1L1O C;  1NY4 A;  3SGI A;  2A1A A;  1PYS B;  1KRS A;  2EXD A;  4K0K Q;  4C3J H;  1GVP A;  1YVC A;  1QVG A;  4YWM A;  2UUA Q;  1XPU A;  1NE3 A;  4LF5 L;  3ULP A;  1CUK A;  1Q82 C;  4A3J G;  5FJ8 H;  1JJ2 A;  2OTL A;  4WJ3 M;  3AQQ A;  5C0X I;  2ZJP A;  2DUD A;  4X64 Q;  1YZ6 A;  1W3S A;  1XMQ Q;  1UE1 A;  3RNU A;  2VL6 A;  2KEN A;  1RIP A;  2IX0 A;  4C2M H;  1EOV A;  2KCM A;  1HNZ L;  4X66 Q;  4LF9 L;  3GTL H;  1OXX K;  3PUZ A;  3HOW H;  4HJ9 A;  5M5Y H;  3PUX A;  4JOI A;  5M5W H;  1UE5 A;  5E7N A;  4IOC A;  4X6A H;  3AYH B;  1J6Q A;  3CCL A;  1V43 A;  4KLK A;  1XNQ L;  2Q2I A;  5M3M H;  5GAG C;  3RLF A;  1KD1 C;  1I94 L;  4A3L H;  3U58 A;  1C0A A;  3RN2 A;  1K83 H;  2JA6 H;  3CMA A;  2E2I H;  4OO1 I;  1VQN A;  2DGY A;  3BZK A;  3UDX A;  1VQA A;  1EYG A;  3I7F A;  4DK3 C;  2ZTE A;  5IWA Q;  2R7Z G;  2JEA I;  2B3G A;  1VQF A;  4B3S L;  3M9B A;  4XIG S;  1VQ5 A;  2I0Q A;  3IRB A;  1BVS A;  1D8L A;  3ER0 A;  1XJV A;  4JBJ A;  3AFP A;  2VZA A;  4GOP A;  2UUC L;  1Z9F A;  5GAH C;  3H0G G;  2UXD L;  2NVT H;  5HGQ A;  3STB C;  3K80 C;  2PI2 A;  2YTX A;  4XTC S;  1P8L A;  3L2P A;  1OXT A;  3HOZ H;  1TWG H;  3HFZ B;  2I5L X;  5FLM H;  1KAW A;  2UXC Q;  1J5E L;  2NZH A;  4UP9 A;  1VQO A;  4LF6 L;  4LFB Q;  4LF8 Q;  3U4Z A;  3UDI A;  4A3K H;  4EX5 A;  3CF5 A;  3S1R H;  3K0X A;  1SE8 A;  1X6O A;  5FJ8 G;  4B3R Q;  3NEN A;  4LF9 Q;  1QUQ A;  1S3O A;  3RLN A;  3EBE A;  2MO0 A;  5ELO A;  2K4K A;  2YU9 H;  2LSS A;  2IT1 A;  4A76 A;  2PMZ E;  1Y1V H;  5C4X H;  1XPO A;  1AE2 A;  3ERS X;  2OWO A;  2R92 H;  4MZ9 A;  1RL2 A;  3HOW G;  3NEM A;  1WOC A;  3GD7 A;  4DKA C;  1EQR A;  5C4J H;  3RN5 A;  3ICE A;  1JJG A;  4A3F H;  5GAD C;  4DV5 L;  3PGZ A;  1Q81 C;  4LFA Q;  3CCJ A;  4LFC Q;  2K14 A;  1PHJ A;  4R4T A;  3D0F A;  3HOY G;  3HKS A;  3S17 H;  4NXN L;  4GN4 B;  4GNX A;  4HJ7 A;  2GVA A;  3FHW A;  1IBL Q;  4BBS H;  3CW2 C;  1XTD A;  5M3M G;  1SLJ A;  3GTQ H;  4A3L G;  4YHH L;  1XNR Q;  2D0P A;  1EIF A;  2WB1 G;  5HY6 A;  1QVC A;  1A0I A;  4DUY L;  4B3S Q;  1LTL A;  3CCE A;  1KIX A;  2JA6 G;  4GKJ L;  3KFU A;  1HZA A;  2Z6K A;  4DV6 L;  1JB7 A;  2UUC Q;  4YY3 Q;  4R4O A;  1K8G A;  3F2C A;  1VQM A;  2Z6K C;  5C0X J;  2AKW B;  4JI2 L;  3KF6 B;  3F2B A;  3W5O A;  1VQC A;  1U5K A;  3PF5 A;  2D62 A;  4DV4 L;  4LF6 Q;  2MO1 A;  1KQS A;  4JV5 L;  3D31 A;  4JI7 L;  4Y52 H;  1Q12 A;  5M3F G;  3HOZ G;  2NVQ H;  5JJK A; 
#chains in the Genus database with same CATH topology
 4KHZ A;  4FXD A;  2O5I C;  1TS4 A;  1TWH B;  4A3K G;  1H9K A;  4DNT B;  4IUV A;  4IPC A;  4KN7 C;  2KED A;  2HDM A;  4A3E H;  2HD3 A;  3JAM L;  2M2L A;  1SJE D;  2B2W A;  5C0X G;  1YJN A;  1ESR A;  4DR3 L;  2RCN A;  2XIW A;  2K5H A;  4DAY B;  1TU2 B;  2CH4 W;  1EY6 A;  1YHQ A;  1IBM L;  5J3B A;  1WCM H;  1UWV A;  4Q0F A;  4A93 G;  2OTJ A;  5E1F A;  1YBY A;  2ALY B;  2Y0S G;  4IO9 A;  1CZW A;  2CKZ B;  3BJU A;  4KTA A;  3CCU A;  4FF4 A;  2Z8L A;  4JV5 Q;  4RKL A;  2R93 H;  2WAQ G;  4ULL A;  4X3S A;  1R9T B;  4PV1 C;  4PZ8 A;  3HP3 A;  1PZI D;  4OWW B;  3CHB D;  3R2T A;  3EQL C;  2IWH A;  1QNU A;  3PO3 G;  3K7A H;  4PNY A;  4PQX A;  5BR8 Q;  3UDG A;  4JI3 Q;  3SVM A;  1K0S A;  1F2Y A;  4B9X A;  5A2Q L;  4J8Q A;  5IGD A;  1YHB A;  3J7Z C;  1H95 A;  5JOB A;  4C2M B;  2JA5 G;  5JJI A;  3GTL B;  1B9N A;  2Z1C A;  3F1Z A;  3PO2 H;  1DOK A;  1TWC H;  4APV A;  1TY0 A;  1G51 A;  2WFW A;  2TMP A;  4JI1 L;  3P75 A;  1F9S A;  1NAP A;  1M8A A;  3BZC A;  3J7Y W;  3CC7 A;  3M7N A;  2E2I B;  4XDX A;  3FKI G;  4IJL A;  1B70 B;  2VY3 A;  1WTH A;  5CV5 A;  4LF5 Q;  4PG3 A;  1QOH A;  1MBY A;  4L6T B;  1FVI A;  1K28 A;  1PYW D;  2I5H A;  5KIX A;  4A3M G;  1YJW A;  2NN6 H;  3MC0 B;  3RZD H;  2ZT9 C;  2XGT A;  5M3F B;  1PTO C;  1HNZ Q;  5DNF A;  4QIW E;  3MXG A;  4HCE A;  1MHW C;  3O13 A;  3HOX H;  3ND9 A;  2B39 A;  3WWV A;  3K5M A;  2BA1 A;  4DV2 L;  4B3T Q;  4L8J A;  4WJ4 A;  3KLS X;  3K5O A;  5EKK A;  3SHL A;  3U4V A;  1LAB A;  5IE8 A;  4NXM L;  1Y1V B;  4A3C G;  1N36 L;  2R92 B;  1BOS A;  1Z6H A;  4FF2 A;  3CPW A;  3QG1 A;  3OW2 A;  2B8F A;  4K2K A;  1JOO A;  4TSS A;  4TQU S;  1PH2 A;  1SAP A;  3GTQ B;  1GUN A;  3TBI B;  3S15 H;  4R8N A;  5IYC G;  2BA0 A;  5CYU A;  1QZH A;  2Q8I B;  5CV8 A;  1N8R C;  3A8K E;  3TEH B;  3PIP 3;  5LMU L;  2D0O A;  3HOV B;  1WD0 A;  2JK8 A;  1SE3 A;  3D4R A;  1JT8 A;  4NP5 A;  3Q8D A;  4Y7N H;  1N33 Q;  1X3E A;  4DAM A;  4BXX G;  1TVX A;  5K5P A;  3M4O H;  3B6Y A;  1QZG A;  1YNN D;  2AUJ D;  4MIU A;  1NBW A;  2AWO A;  3U50 C;  4I65 A;  4I7Z C;  4A3F G;  1B8A A;  5FLX L;  1XMQ L;  3P1H A;  3HOU G;  3GTJ H;  3BDC A;  3DM3 A;  3TS2 A;  1LLR D;  4JI2 Q;  4R4I A;  3FMC A;  1LTA D;  1TWF H;  4JC0 A;  3J7A 5;  1B9M A;  3S2D B;  1K3B C;  4J15 A;  3E5S A;  3NWS A;  1A62 A;  2JA9 A;  1YEZ A;  3PUV A;  1ICW A;  1LT4 D;  1WTV A;  3V05 A;  1B50 A;  1TKW B;  1X55 A;  2EY2 A;  2WV6 D;  4A3G B;  4N9P A;  2HIV A;  4DR5 L;  2JA7 G;  1UAP A;  1PTO H;  2F0M A;  1JR0 D;  2JEB I;  1GUO A;  2CWA A;  3BYY B;  1DGS A;  1NSN S;  3F8T A;  1E2Z A;  1OO9 B;  2AHO B;  5C3E G;  1IBK L;  1O78 A;  5I2Y A;  1EZ8 A;  1Y8O B;  4CKE A;  1VCI A;  2KJX A;  1X65 A;  5TSS A;  3AFQ A;  4LF8 L;  5IYB H;  4DAY A;  4P71 A;  3DXJ C;  4B3R L;  2VUM H;  5K36 G;  2Q2T A;  1SNO A;  2BH8 A;  5KNC A;  4M1U B;  1D6E C;  4HTH A;  4QUF A;  3ERQ A;  2YYZ A;  1K8O A;  3T53 B;  4K6L A;  5LL6 X;  4FVM A;  4TVA B;  1CHP D;  3CCM A;  3GQB A;  3ULL A;  2EVB A;  1I4P A;  1SYD A;  4IPD A;  1XNR L;  2JE6 I;  1W6K A;  1IL2 A;  3GDE A;  1ET9 A;  3TZD A;  1HR0 W;  1MI2 A;  2Z6B A;  1EWI A;  2YTV A;  4A3I H;  4FYD A;  1WI5 A;  4UP7 A;  4BBR H;  2B63 G;  4LMQ D;  1PFS A;  4GOP C;  3DWA A;  1U4L A;  3NTK A;  2QEX A;  4DV1 L;  3RUZ A;  2LFN A;  4DV0 L;  5IP7 G;  1KNE A;  1I3Q H;  3HS0 C;  4C3H G;  1FYC A;  1GUT A;  2ASB A;  3GTG H;  1BCP D;  1DZ1 A;  1RTN A;  1N9W A;  2A6H D;  3M4Q A;  1MJE A;  2BOS A;  1EY8 A;  4LFB Q;  3P20 A;  1HNX Q;  2JN4 A;  1ILQ A;  4E6I A;  4OIJ A;  2A8V A;  1JB3 A;  4KKS A;  2CH4 A;  4DV7 Q;  2ICE C;  1KL9 A;  4DUZ L;  2K5W A;  1MSG A;  1WTO A;  2F0H A;  4A93 H;  2VW9 A;  2L15 A;  3QIA A;  5BN5 A;  4L5S A;  5EKI A;  2EDG A;  1B4O A;  2VQE Q;  2V1C C;  5E4W C;  1YNJ C;  3OMG A;  3N6R A;  3UE0 A;  1BBX C;  3TS0 A;  2NTT A;  2MFI A;  3X3N A;  2RQX A;  3SK5 A;  4HID A;  3PO3 H;  4B3M Q;  2CW0 C;  2RDH A;  3W1G A;  4HIK A;  5KYL A;  4ALP A;  2K5N A;  2HIX A;  1IYU A;  3U9S A;  4V19 0;  2HT1 A;  1TII D;  2NZO A;  4DXF A;  3OTO Q;  3D6W A;  4X66 L;  3EIV A;  4JI3 L;  1KC8 C;  1AH9 A;  2K7V A;  3OYY A;  3LNN A;  1JWU D;  2PQE A;  3DM1 A;  4TRD A;  5CGK A;  3MAQ A;  4KD3 A;  3I56 A;  5M5X B;  1ML0 D;  4JVZ A;  3BZD B;  3KF8 B;  3TRE A;  1W2B A;  3BVG A;  5IWA L;  2BH2 A;  1J9O A;  2QW7 A;  5C5M A;  3EA6 A;  2JA8 G;  1HQM C;  2C9O A;  5CBE E;  1NMF A;  1L1O C;  2Z4H A;  4CKC A;  3TP8 A;  2DJF C;  5IOD A;  3I4N B;  4C3J H;  4DF7 A;  3H94 A;  4YWM A;  4LF5 L;  1CUK A;  2EYL A;  5C0X I;  5IOC A;  1W3S A;  1HFN A;  1HHV A;  1H9M A;  2HCC A;  4TKO B;  2KEN A;  4BY7 B;  3R3O A;  1HNZ L;  4LF9 L;  1CK1 A;  1OXX K;  3PUZ A;  4AYB B;  1G8Z D;  5C3W A;  4JOI A;  1UE5 A;  3CCL A;  4A3B B;  1X32 A;  3DEP A;  1KD1 C;  1SDF A;  1EYD A;  5DM7 3;  2HUG A;  3BZK A;  3NQI A;  5KND A;  5I4D A;  2JEA I;  4B3S L;  4WFN 3;  1II3 A;  2F3W A;  4JBJ A;  3AFP A;  2VZA A;  2RDG A;  5D3I B;  2YTX A;  2QDL A;  3L9A X;  1P8L A;  3L2P A;  1OXT A;  2PZT A;  4WJW A;  3HFZ B;  1KAW A;  2NZH A;  4BY1 B;  1KLG D;  3U4Z A;  4EX5 A;  1EY5 A;  4RGN A;  3K0X A;  2KHS A;  2NVY B;  5FJ8 G;  1MSH A;  1STE A;  2NUC A;  2MO0 A;  3PMF A;  2YU9 H;  3BDL A;  3NK9 A;  4A76 A;  2PMZ E;  5C4X H;  1AE2 A;  5G3L F;  5I9P A;  2OWO A;  3S16 B;  1WTP A;  2PYK A;  3OOC A;  4QUC A;  4DKA C;  4A3F H;  2JSO A;  5GAD C;  1Q81 C;  3GTK B;  2DY7 A;  4NXN L;  4BBS H;  2A69 D;  1SFO B;  1PFB A;  5HY6 A;  4DUY L;  4H44 C;  1LTL A;  4KD4 A;  1SJH D;  4GKJ L;  1JB7 A;  5I9O A;  1SNP A;  1K8G A;  2Z6K C;  4JI2 L;  2JA7 B;  3F2B A;  3FDT A;  2K03 A;  3SDZ A;  1LTS D;  1KQS A;  4J1M A;  3VYT A;  4RAU C;  4RHS A;  4DFA A;  2D5D A;  3W2D A;  1PDQ A;  4ZUJ A;  5M3F G;  1IYV A;  1CZG A;  4C3I H;  2CHB D;  5EGT A;  1PA6 A;  2LKV A;  1WFQ A;  2E74 C;  1FL0 A;  2CQO A;  1YNX A;  2XRQ D;  1T5E A;  1X9N A;  3M3Y B;  1V9P A;  1Q46 A;  2EYP A;  4XYQ A;  3SR1 A;  5IIF A;  2EY5 A;  4BWG B;  1Y1V G;  3IL8 A;  4JYA L;  2L1B A;  3EFX D;  2I07 B;  2R92 G;  1B1Z A;  4RMF A;  5K36 H;  2CQA A;  2VS1 A;  1L0X B;  4ILW A;  1LTR D;  2EJM A;  2RHS B;  2Y0S E;  2DNC A;  2ID0 A;  3I73 A;  2WAQ E;  2R7Z B;  2N88 A;  3OSO A;  2EYM A;  3S2H H;  1YHA A;  1G2S A;  2OQK A;  3I55 A;  1CKN A;  4IJH A;  5HUR A;  4IQZ A;  1Z47 A;  2K5V A;  4AIM A;  3HOV G;  2C35 B;  1PZK D;  1UUP A;  1PRT F;  3R93 A;  2JQO A;  1SSO A;  3OHX C;  4Q5V A;  3QOJ A;  2VQF Q;  3RZO H;  1Q1E A;  2A74 C;  3GTP H;  4DR4 Q;  1HR0 Q;  4L5Q A;  1ONL A;  2UUB L;  4LF4 L;  1JE5 A;  1RTO A;  2MQH A;  3G7L A;  1BKB A;  1VQG A;  4JI0 Q;  3TP5 A;  5ELE A;  2NVX H;  2XWJ B;  3S24 A;  3S14 H;  2QA4 A;  2RDF A;  1STG A;  4C3H H;  1PRT D;  1K73 C;  1JOR A;  3HOW B;  5M5Y B;  5M5W B;  2N49 A;  1VQH A;  3M7G A;  1BXT A;  2BE5 D;  1PRT B;  2F0F A;  1S5D D;  2NBF A;  1BUV T;  2LXJ A;  5IGF A;  4LFB L;  2R61 A;  4RG1 A;  2F0O A;  2E5L Q;  1KNA A;  1UEA B;  4X62 Q;  1CFM A;  4A3G G;  4DV7 L;  2PI2 E;  4X65 Q;  1PH4 A;  1JWS D;  1LT6 D;  3Q23 A;  3HG9 A;  1UE7 A;  3HOZ B;  4EGV A;  1IW7 D;  4KY7 A;  3I4M H;  4GKK Q;  4JBW A;  1I94 Q;  4DV3 Q;  4EVO A;  3J81 i;  4FF3 A;  1VQ8 A;  4JPB W;  2E2J B;  5E3F A;  1GKH A;  1SR3 A;  2FIN B;  4LNQ A;  2WB1 E;  1I4R A;  3WOE A;  3QO2 A;  4KV6 A;  4B3M L;  3CCQ A;  3NEL A;  2SOB A;  1KAA A;  1SYF A;  2F0S A;  5JEA H;  3TRZ A;  2A5H A;  2AWN A;  2CVR A;  2XSC A;  3MFY A;  4K5W A;  5C4J B;  4QF4 A;  2KHI A;  1KLU D;  5J39 A;  2G5D A;  2HQL A;  3CD6 A;  2RF4 A;  3S17 B;  1VF5 C;  1PV4 A;  4HIO A;  2JA8 B;  3NSW A;  3TP6 A;  1DCZ A;  2IX3 A;  1P16 A;  4O2D A;  4IAL A;  4HJA A;  1JOK A;  4L5T A;  4AQY L;  2PQA B;  3A5Z B;  5JEA J;  3VR6 A;  3VYS A;  2KBN A;  1L0W A;  2IL8 A;  1VMC A;  2F0G A;  2B2Y A;  1I4G A;  1LTB D;  1RKN A;  1EIY B;  5D65 A;  1ASZ A;  3I3C A;  1EOT A;  2Q8R E;  2QIL A;  2PPB C;  4S3S A;  3H3V I;  3MFG A;  4K5V A;  5COR A;  4JG2 A;  4JI6 L;  5JJL A;  3VDY A;  4GLA C;  3C1F A;  3FPP A;  3MEH A;  1V1Q A;  1V1P A;  4JI7 Q;  3VR4 A;  5KEE A;  3A7A B;  4G7Z C;  3MXN B;  4IUN A;  1WCM B;  1ENF A;  5BN3 A;  1Y1W H;  3A8J E;  4JI4 Q;  2WIN B;  4LWC A;  4MTK A;  3CCS A;  4BA2 I;  2K75 A;  3T16 A;  2PW5 A;  2JYO A;  1VQD A;  1SXT A;  5JAV A;  1N34 Q;  4YCV A;  3HKZ B;  1HA6 A;  1DM0 B;  4IUR A;  2N55 A;  3K7A B;  1MIU A;  1X3F A;  1SE4 A;  2QKI C;  1A15 A;  2ATW A;  2OT2 A;  5ISR A;  5C44 H;  4JI8 Q;  3RR5 A;  4O42 A;  1EWC A;  4ZLT F;  1K83 B;  1X3P A;  4LW1 A;  3PO2 B;  1Y8N B;  1YNN C;  1TXY A;  3CQZ H;  3T1Y L;  4JOI C;  2G9H D;  2B2T C;  3NXW A;  4JCV E;  4LF7 L;  1T5X D;  3MTS A;  1LUZ A;  2K05 A;  4IZ8 A;  1CKO A;  1PMR A;  1TY2 A;  1EY4 A;  2L55 A;  4DR6 L;  1C4Q A;  2B2U A;  2MPM A;  3A56 A;  2Q8T A;  3I4N G;  1QG7 A;  1I6V C;  4LUV A;  1GUG A;  3RZD B;  1YIJ A;  2KEC A;  1OXV A;  4FO2 A;  1CT1 D;  5EPK A;  2EE1 A;  5M3F H;  3M4P A;  4X3K A;  3K5N A;  3CC4 A;  1K8M A;  4BY7 G;  3D6C A;  2G9D A;  4NPS A;  5IYD G;  3HOX B;  2F0I A;  2NZ1 D;  1VQ7 A;  1GXD C;  2E2H H;  4AYB G;  3TSS A;  2HHH Q;  4IOA A;  3C1E A;  1HCZ A;  1SEB D;  1AFP A;  4A3B G;  1ICF B;  3CCV A;  2EJG C;  4YCU A;  2DN8 A;  1KDB A;  1IHZ A;  1FJG L;  4XQN A;  3K81 C;  4ZQ3 A;  3I4L A;  1MGS A;  1NR4 A;  4XT1 B;  2BDO A;  4ZKC B;  3SK4 A;  3UDF A;  3KYH C;  1SYB A;  3KBG A;  3S15 B;  1NCV A;  1B3A A;  2WKC A;  1STB A;  2UXB Q;  4JI5 L;  4AH6 A;  1C9O A;  5LMN Q;  2Z4I A;  3NBH B;  4A3J H;  3R8B A;  2AMC B;  2KQ3 A;  5I6W A;  3CCR A;  2RA4 A;  3HOV H;  4BY1 G;  1HRJ A;  1IKL A;  4OEL B;  1S5B D;  2OF1 A;  3KJP A;  4A75 A;  2F0T A;  4I7A A;  4O0A A;  4X64 L;  3URY A;  2KOL A;  2AQ3 B;  1CA5 A;  1CSQ A;  1ZKO A;  4OXP A;  1SMY D;  4MHE A;  4H0L C;  3ULJ A;  1HR0 L;  4IFD G;  1SYE A;  2VB3 X;  2Z9H A;  4HN7 A;  3R2I A;  3TQY A;  5IP9 G;  3GTJ B;  4A3D B;  1PTO F;  1I4Q A;  1HNW Q;  1BCP C;  1TWA H;  5IY0 A;  1JIC A;  2A6H C;  3PF4 A;  4DA2 A;  1TWF B;  4P75 A;  5CV7 A;  1RDP D;  5CV6 A;  1C48 A;  3T4A C;  1MKH A;  2F4I A;  1I5F A;  1FNV A;  4K2L A;  3MXP A;  1NNX A;  1E1O A;  2R7F A;  1TQO A;  4O1N A;  4CGY B;  1NY4 A;  3SGI A;  4RCN A;  2A1A A;  1KRS A;  4K0K Q;  1GVP A;  3F2U A;  3ITP A;  3ONA B;  1QVG A;  2UUA Q;  1XPU A;  1Q82 C;  2XNA C;  2B2V A;  1KDA A;  4F88 A;  4WJ3 M;  2ZJP A;  1PTO B;  1X3Q A;  1UE1 A;  3RNU A;  1WTX A;  3J7A V;  1EOV A;  5CV9 A;  3GV3 A;  3E3X A;  3A7L A;  4HMJ A;  3T51 B;  5E7N A;  4IOC A;  3AYH B;  1AW7 A;  1AZQ A;  1DOL A;  4KLK A;  1F9R A;  5M3M H;  1I94 L;  2MHV A;  2VUM B;  4A3L H;  2A68 D;  3NP8 A;  3U58 A;  1C0A A;  5D3D A;  2JA6 H;  3CMA A;  3VR5 A;  2F0U A;  1VQN A;  3BG3 A;  3UDX A;  3OWF A;  5F2D A;  3I7F A;  1EEF D;  1Y8P B;  2R7Z G;  2B3G A;  2KVM A;  1U4R A;  3IRB A;  1BVS A;  1HUN A;  2UUC L;  3H0G G;  2NVT H;  5HGQ A;  4XTC S;  1TT2 A;  3DEO A;  4FF1 A;  1TWG H;  2I5L X;  2ZXR A;  1S5F D;  1QE6 A;  3Q6S A;  4A3I B;  1DYQ A;  1S5E D;  1XWE A;  3UDI A;  3CF5 A;  4A3K H;  3S1R H;  4BBR B;  4EQN A;  1WTQ A;  5C4H A;  3EBE A;  3W3A A;  5LHY 1;  2K4K A;  5C0X H;  5NUC A;  1RL2 A;  3GTG B;  3HOW G;  3NEM A;  3GD7 A;  5C3X A;  3ICE A;  1EQR A;  4C1N I;  2K32 A;  3V96 A;  2RVL A;  3PGZ A;  3NHH A;  3HKS A;  2GVA A;  1ESF A;  1TS3 A;  2JP1 A;  2D0P A;  1EIF A;  2TSS A;  1A63 A;  1A0I A;  3G6J B;  1BQQ T;  4YY3 Q;  4R4O A;  3OPO A;  5C0X J;  3TN2 A;  3W5O A;  4G7O C;  1U5K A;  4DAP A;  4JK1 C;  3S1Q B;  5CMD A;  4LF6 Q;  4JV5 L;  3KUP A;  4JI7 L;  4Y52 H;  2SNS A;  3HOZ G;  2NVQ H;  5JJK A;  1L2F A;  3LWU A;  3GTO B;  4JI4 L;  4BA1 I;  2QEJ C;  5I2X A;  1ASY A;  4HSV A;  3DUZ A;  1CTM A;  4H02 A;  3M4Y A;  1VQB A;  5GQO A;  3KDF B;  3IFD A;  1PH9 A;  1L0Y B;  2BDN A;  3E9H A;  5BR8 L;  2JA5 H;  2OXP A;  3K8A A;  4ME3 A;  1N34 L;  2B2Y C;  3QWN A;  4IPH A;  1K9M C;  3UE1 A;  3K58 A;  1HQR D;  2B2W C;  4OX9 Q;  1IYJ B;  1STY A;  3S1M H;  3E6Z X;  2UU9 Q;  4OWT B;  2EIF A;  4DV6 Q;  4C1N K;  3FKI H;  5EPL A;  2F0V A;  4JI8 L;  4R4Q A;  3JC6 6;  5T1I A;  4HR7 B;  4A3M H;  3I8Z A;  4A4I A;  2A69 C;  2ZJQ A;  3L7Z C;  3K59 A;  4OWX B;  1CKM A;  3D8G A;  4OO1 G;  2J4X A;  4HIM A;  1LTT D;  1VQL A;  1KRT A;  3C46 A;  4OIK A;  4C3J B;  4DR1 Q;  1HXY D;  4LUZ A;  4HMI A;  4GOP B;  4WOR A;  4RGO S;  2LXK A;  2FJ2 A;  4CDF C;  5IYD H;  1R4Q B;  4B3T L;  4A3C H;  4DR3 Q;  1SNQ A;  4GS3 A;  3I90 A;  1I50 H;  3J80 i;  1LTI D;  5FO7 B;  3HOY B;  1IBM Q;  4F8M A;  3PV0 A;  5IGB A;  5IT9 c;  4ZUI A;  1X56 A;  1A2U A;  1CA6 A;  2WB1 B;  2F0J A;  4CHT B;  5ELF A;  5IYC H;  2ICI A;  3DHQ A;  2NYZ D;  2OQ0 A;  1JJC B;  2WII B;  1D1I A;  1WCM G;  1HTP A;  1KHI A;  3J81 j;  3D4D A;  1K8A C;  2XRS D;  1YNJ D;  4QJF A;  5GAE C;  2L12 A;  1BNZ A;  2F1M A;  1ZYR D;  4B08 A;  1Y69 U;  3J81 c;  5IT9 E;  2VB2 X;  4BS9 A;  3I2Z A;  4C56 C;  2FHT A;  1VQP A;  1RCV D;  1E2V A;  1F2Z A;  2B2U C;  2EQS A;  3HKZ G;  1UE6 A;  3A8I E;  4BXX H;  1O7Y A;  3CP0 A;  4DN4 M;  1B3Q A;  1N33 L;  1A3U A;  2PNR C;  1Q7Y C;  1A3T A;  2Z0S A;  3RLO A;  4CJ0 B;  1XNQ Q;  3NTI A;  5EBD A;  3J81 E;  1I6H H;  4LUO A;  3HOU H;  4JBK A;  4DGZ A;  2YU9 B;  1DON A;  1BO0 A;  4JI1 Q;  1XPR A;  5C4X B;  1Q1B A;  4RKB A;  1K3R A;  2D2C C;  3LGJ A;  3PO2 G;  3GTK H;  5G3L D;  3AB9 A;  2UXD Q;  3CAM A;  4LJZ C;  4RCO A;  1PH6 A;  1SFO H;  2Q2U A;  1HTL D;  5CC4 A;  2C5C A;  3H3V C;  2XWB B;  1J5E Q;  3H6M A;  4IUP A;  1BDO A;  1PXU A;  2BE5 C;  1HNW L;  1IL8 A;  3OIQ A;  4RGM A;  3E9I A;  2JA7 H;  3ERO A;  4DK6 C;  5FLM G;  1TS2 A;  4HJ8 A;  3RMH A;  3A5U A;  1L1O B;  1EEI D;  2A6E D;  2VNU D;  2NN6 G;  3PUW A;  1IKM A;  5IGC A;  5C3E H;  1X3G A;  1YJ9 A;  2KUM A;  1QIL A;  4IN3 A;  1O80 A;  1VQ9 A;  2VXW A;  1AE3 A;  4DV2 Q;  1J8I A;  5KNB A;  2F3I A;  2EOT A;  1E1T A;  4C3I B;  4K0K L;  2OCE A;  2R7D A;  5EJW A;  3HOX G;  1HZC A;  2I5M X;  2UUA L;  4NXM Q;  2HDL A;  1QWY A;  2RCF A;  3SK6 A;  4YHH Q;  3F2D A;  1Q8K A;  5FK9 C;  1YIT A;  3CC2 A;  1PYB A;  4RHR A;  3N52 A;  1Y14 B;  4N8F A;  1EU4 A;  5KGU A;  1G2T A;  2YTY A;  5LMN W;  4HCS A;  5JPN C;  4RFB A;  3H0G B;  3PIP A;  1ZEQ X;  2PCF B;  4FXG C;  3TDQ A;  5LMU Q;  3VA5 A;  3GTM H;  1W6J A;  1N32 Q;  1B2T A;  1JOQ A;  2YV5 A;  3KOJ A;  4DNR B;  3BU2 A;  3T1H Q;  2B63 H;  1EIG A;  1H9S B;  4RA8 A;  3IFT A;  3G71 A;  3KDF A;  3EN2 A;  4IFD I;  3JAM i;  5DLQ E;  1H9R A;  5IP7 H;  2DNE A;  3E0E A;  3RZO B;  4QIW B;  3MA2 B;  1U0L A;  3GTP B;  3CXC A;  4LK1 C;  1LYL A;  2B2V C;  1BBU A;  4ZYS A;  4DR7 Q;  3PQI A;  1M4V A;  4YWK A;  1QUQ B;  1EY7 A;  1WD1 A;  3S14 B;  2NVX B;  4KN4 C;  3KF8 A;  5D14 A;  3PIO A;  1S40 A;  1NTG A;  1JC7 A;  4G4K A;  2V4D A;  3E0J A;  4A3D G;  3P7J A;  3FPU B;  1HNX L;  1D7Q A;  2B29 A;  2L0C A;  4DR2 Q;  3VYR A;  4MTN A;  5FKA C;  1BBW A;  2O4X A;  4GNX B;  1OTC A;  3H3V H;  1KDC A;  3H91 A;  4DR5 Q;  2F4V Q;  1HZ9 A;  1EFW A;  1XMO Q;  2H4O A;  3GV6 A;  2RHQ B;  4GLX A;  3A54 A;  2CFM A;  4EQ5 A;  4YY3 L;  1IBK Q;  2VQE L;  1WJJ A;  3PCO B;  1Q3L A;  1KXL A;  3S1N H;  2L11 A;  4QY7 A;  5ELD A;  4KHV A;  2XTI A;  2KA7 A;  2P5Z X;  1D1K A;  4AYB E;  2NB0 A;  2LY7 A;  1EYA A;  1PLF A;  3I4M B;  2KCT A;  3QJY A;  1RHP A;  3MZ5 A;  4OON A;  2E2J H;  3UI2 A;  3SEB A;  2EY1 A;  2IHE A;  3T56 B;  3AMU A;  2QGQ A;  5DM6 3;  2ZM6 Q;  2IX1 A;  5IYB G;  3OTO L;  1M90 C;  2VUM G;  1EYC A;  1GHJ A;  1VDZ A;  2GVB A;  1HUM A;  4LAA A;  1E22 A;  5ELN A;  4P2C B;  1QCB D;  2ENB A;  4NB3 A;  2IHF A;  1A2T A;  4FP5 D;  1HFG A;  2SEB D;  3KBX A;  2JA8 H;  2EPB A;  4OX9 L;  2EZV A;  5AJ3 Q;  2UU9 L;  2CWP A;  4YWL A;  5COY A;  1C7Y A;  1DXM A;  4A3I G;  1TWH H;  4DV1 Q;  3G6E A;  4POG A;  2ES2 A;  4DV0 Q;  2HQE A;  4BBR G;  2H1E A;  5H1S E;  2I46 A;  1NJI C;  4PMB A;  4ZKB B;  1AZP A;  4A3E B;  2F0Q A;  2WP8 J;  1EU3 A;  4HSP A;  5IGE A;  2K01 A;  3Q22 A;  4DR1 L;  1D5X C;  1G6P A;  1ENA A;  2B8G A;  4GZY C;  2F03 A;  1VF7 A;  4KHP Q;  2FMM A;  3NPP A;  4DUZ Q;  1S72 A;  3STB D;  4JW0 A;  2RKS A;  1IZ6 A;  1SNM A;  1VS0 A;  2IPK D;  1CQV A;  1E24 A;  1DOM A;  2F0E A;  1R9T H;  2R93 B;  1GHK A;  4DXG A;  1L1O A;  4EQO A;  1GJX A;  3NE5 B;  4DK1 A;  3KLR A;  1Y1W B;  3I72 A;  1U4P A;  1LO5 D;  3BYT B;  2OTL A;  5FJ8 H;  4H7B A;  1FD7 D;  4KKT A;  5IT9 L;  3V2T A;  1MD2 D;  1RIP A;  4C2M H;  4N8X 1;  1V1O A;  2KCM A;  3GTL H;  4X66 Q;  4G7H C;  4HJ9 A;  1TWC B;  4MN3 A;  3WOF A;  4X6A H;  2QF7 A;  1J6Q A;  5CV4 A;  5C44 B;  1V43 A;  2XN9 C;  2Q2I A;  3J81 L;  5GAG C;  1XNQ L;  1H9J A;  4QB4 A;  3RN2 A;  1K83 H;  2EYJ A;  3I70 A;  1SMY C;  3NWT A;  2E2I H;  4OO1 I;  2KCN A;  1VQA A;  3CQZ B;  1EYG A;  1B44 D;  4DK3 C;  3S9W A;  5IWA Q;  3M9B A;  2K04 A;  2D9U A;  1XJV A;  5CBA E;  1H9S A;  3CRL C;  1JWM D;  1Z7T A;  2UXD L;  3MXU A;  1JCK B;  4XYO A;  3H09 A;  1ZXT A;  2UXC Q;  5FLM H;  1J5E L;  1SND A;  5KYI A;  4C3J G;  1GOZ A;  2X69 A;  1X6O A;  2R3Z A;  3NEN A;  4LF9 Q;  3U9O A;  1QUQ A;  1S3O A;  3A55 A;  4KMU C;  2L4N A;  1TS5 A;  1F9P A;  5ELO A;  2LSS A;  2IT1 A;  5J22 A;  1Y1V H;  1BF4 A;  1FNW A;  2R92 H;  2E2H B;  3C2P A;  1A3V A;  1WOC A;  2K5D A;  2F0K A;  1Q8I A;  4LFA Q;  4LFC Q;  2K14 A;  1PHJ A;  4R4T A;  3D0F A;  3HOY G;  1FNU A;  4GNX A;  1IBL Q;  4HJ7 A;  1FR3 A;  1XTD A;  2X6G A;  3SK8 A;  1SLJ A;  1TR5 A;  3GTQ H;  4YHH L;  2WB1 G;  5L37 A;  2M00 A;  1QVC A;  4B3S Q;  1KIX A;  3KFU A;  2Z6K A;  3IAY A;  3FEW X;  1R4P B;  1EQT A;  1VQM A;  4ZCK A;  2A68 C;  4KKU A;  2AKW B;  1SYG A;  3KF6 B;  1XYI A;  2KCC A;  2NWG A;  5AFW A;  2MP1 A;  4N9T A;  4FNF A;  2MO1 A;  1U4M A;  1Q12 A;  4Y7N B;  2WKD A;  4A3J B;  1PFM A;  5EKL A;  3NTH A;  1N32 L;  1LAC A;  3M4O B;  3CU7 A;  3T1H L;  3L3O C;  2VQF L;  4DR4 L;  1STN A;  3CKI B;  3HRZ C;  4XQJ A;  3TME A;  1SE2 A;  2PZU A;  1PVO A;  5M9O A;  3AEV A;  3OW7 A;  1SRU A;  4NXN Q;  4JI0 L;  5C4X G;  2RSN A;  2N3S A;  3S2D H;  1F2M A;  4DUY Q;  4XXE A;  3GP7 A;  4GKJ Q;  2EYH A;  4DR7 L;  1EY9 A;  4A3D H;  2PQA A;  1IXR A;  4BBS G;  1HH2 P;  1HJP A;  1PH3 A;  2NN6 I;  1TWA B;  3FP9 A;  4RH6 A;  2IW3 A;  1HZB A;  1PTO D;  4PZ7 A;  3I91 A;  3PIO 3;  4A3G H;  2E5L L;  1XTC D;  4DR2 L;  4KJN A;  3I4O A;  2CCZ A;  4X62 L;  2N78 A;  2K6A A;  4NDX A;  2GN5 A;  2PO4 A;  4X65 L;  1PH7 A;  4FDB A;  5JPM C;  2F4V L;  4HJ5 A;  4C3I G;  1XMO L;  3J80 c;  5EBC A;  1WTW A;  4ABN A;  1O7L A;  4GKK L;  4JYA Q;  1B7Y B;  1F2L A;  1EQV A;  4DV3 L;  3VA7 A;  3MXN A;  1CM9 A;  2PMZ B;  2XVS A;  1NMG A;  1F9Q A;  2R6G A;  1JQY D;  4U67 3;  3J80 E;  1O7I A;  5M3M B;  2K33 A;  3FVQ A;  2JA6 B;  2ZM6 L;  2J7Z A;  2F0N A;  1WYD A;  3OWE B;  3D4W A;  2RBM A;  5FO9 B;  1ENC A;  4KI0 A;  1PZJ D;  1VMP A;  1JMC A;  2K50 A;  2QCP X;  2E8G A;  3KJO A;  2F0P A;  2NVT B;  3HKZ E;  4P72 A;  2EJF C;  1TWG B;  2UUB Q;  4LF4 Q;  5AJ3 L;  1A6X A;  3VR3 A;  1SMX A;  1BCP F;  4K14 A;  4F87 A;  4A3K B;  2MUY A;  2A73 B;  3S1R B;  4RWS C;  4X3U A;  1I3Q B;  1VQ6 A;  5IGG A;  1VQE A;  1RD9 D;  2O5J C;  5LL6 S;  5HGT A;  4GN5 A;  3ZYY X;  1QB5 D;  2PZW A;  4HAE A;  2K5Q A;  4DU9 A;  2K1B A;  4OGQ C;  4PZ6 A;  5FO8 B;  1GM5 A;  4F7X A;  2E75 C;  2EY6 A;  4UAI A;  3QR8 A;  4G57 A;  5J1Z A;  4DPG A;  1E0B A;  1RJT A;  1BCP B;  3X3M A;  4H13 C;  1SBB B;  4R4C A;  3ZJY C;  4CBV A;  4A93 B;  2Y0S B;  3BDO A;  1PH8 A;  2OEO A;  1T9H A;  4KHP L;  3BVM A;  4MNO A;  2MNA A;  1SN8 A;  3RD4 A;  3PUY A;  2WAQ B;  2O2L D;  5DEH A;  4KY5 A;  3K57 A;  3CPF A;  1QVF A;  3S1Q H;  4UPA A;  4JBM A;  1VQ4 A;  3PO3 B;  3PSI A;  2WAC A;  2NVQ B;  1ZYR C;  2ZJR A;  2F3V A;  1VQJ A;  4CDC C;  1CKN B;  4DV5 Q;  3GTO H;  2FFK B;  1LM0 A;  1YI2 A;  3NUC A;  1G91 A;  1CQF A;  3I4M G;  4NW2 A;  2JJQ A;  2E2D C;  1D5M C;  1OXU A;  2JA5 B;  2F52 A;  5C4Z A;  4CJ1 B;  3KLS A;  3DMU A;  4GLV B;  3LX0 A;  1M1K C;  2KHJ A;  3G48 A;  4M8A A;  4U68 A;  5JEA G;  4P74 A;  4DAV A;  5CR3 A;  2K28 A;  3KF6 A;  3NBH A;  5M5X H;  4DV4 Q;  3S1M B;  4IUT A;  5GRO A;  3FKI B;  4NKL A;  1MJC A;  1OXS C;  3JAM c;  2LS0 1;  4AQY Q;  1VQI A;  3I4N H;  5E4X A;  1V8Q A;  4RGT A;  4A3M B;  3Q24 A;  5DAU A;  1EZ6 A;  3EJI A;  4DK0 A;  4QL5 A;  5ELC A;  4EQP A;  2EYO A;  4BY7 H;  1BR9 A;  3JAM E;  1EQQ A;  1K0R A;  5BN4 A;  2A6E C;  4A3E G;  2UXC L;  4HED A;  1UEB A;  4K6D A;  2DY8 A;  1RF2 D;  3DWQ A;  4A3B H;  1E3P A;  4FXK C;  4YCW A;  3K0Y A;  1E7Z A;  2HHH L;  1E2W A;  3HGB A;  4JI6 Q;  4CDD C;  4PMC A;  3HEJ A;  1I50 B;  5EQ0 A;  3Q0A A;  2Q2H A;  2B2T A;  4POF A;  1AEX A;  3BS1 A;  1HPC A;  3HOY H;  2ZXP A;  1QJO A;  3BVZ A;  1GUW A;  1WTR A;  3QB3 A;  3K5L A;  2AQ1 B;  3MVV A;  4LFC L;  4LFA L;  2R93 G;  1GO3 E;  1WVL A;  1IBL L;  3A0J A;  2QDB A;  1O7Z A;  2CW0 D;  4ID6 A;  1Y1W G;  1EIH A;  1EY0 A;  2UXB L;  4BY1 H;  3K7U C;  2PW7 A;  3G4S A;  3OMC A;  4UHV A;  4V0B A;  1CSP A;  1CI3 M;  3D3R A;  2NVY H;  3TP7 A;  5A2Q E;  5LMN L;  3DWP A;  3M85 A;  2LMC B;  1GD7 A;  5JVG 3;  5EAY A;  4OL7 A;  1EL0 A;  1S5C D;  1FGB D;  1X54 A;  3S16 H;  1AN8 A;  4GN3 B;  4IFD H;  5A35 A;  1I6H B;  4A3F B;  4UY8 C;  2PNH A;  2A19 A;  5IP9 H;  3HOU B;  1SRO A;  2ZTC A;  5C44 G;  4DNI A;  1LT3 D;  3T1Y Q;  1PRT C;  4BBS B;  4J6H A;  4UP8 A;  4K8I A;  1PH1 A;  4LF7 Q;  2ZTD A;  3FRP B;  4QGU A;  1FGU A;  4L5R C;  3SE0 A;  2EXZ A;  4DR6 Q;  4GNX C;  1VQK A;  4IFD J;  4QQB X;  2JXM B;  1ET6 A;  4CJ2 C;  5JJZ A;  1LTG D;  3GO5 A;  2F0W A;  1XXG A;  5FOB B;  1F77 A;  4NMZ A;  3MEF A;  1D5Z C;  1V1P B;  2N8N A;  1I4H A;  2HCI A;  3MWY W;  1KTK A;  4ME5 A;  3WDN A;  2IY5 B;  5C3E B;  3W1B A;  4IPG A;  2SDF A;  4PMW A;  3MHB A;  3H15 A;  3M3Y H;  1IW7 C;  1N36 Q;  1KAB A;  3CME A;  2H5X A;  3DLL A;  4WRD A;  2EYF A;  1Q86 C;  2F0L A;  1DJR D;  4OHJ A;  4B9W A;  1EFI D;  1FJG Q;  4IUU A;  1Q90 A;  2NTS A;  2AUK A;  2RSO A;  1G29 1;  2M9V A;  5C5L A;  1A8V A;  3L0O A;  4R1J A;  4P73 A;  1EUJ A;  2K52 A;  4ZAI A;  3NQT A;  1CHQ D;  2R7Z H;  1C8C A;  3KLW A;  5C6A A;  1STH A;  2BCO A;  3S2H B;  2J0T D;  1AP0 A;  1B53 A;  1SNC A;  3J80 L;  4JI5 Q;  3H0G H;  2FXQ A;  3A74 A;  1PH5 A;  3SXH A;  5FLX c;  4YIJ A;  1NR2 A;  4L63 B;  3VYU A;  1PYS B;  3LWE A;  3GTM B;  1ILP A;  2EXD A;  4ZRZ A;  1YVC A;  3KK7 A;  1NE3 A;  2B63 B;  3ULP A;  1JJ2 A;  4A3J G;  3AQQ A;  2DUD A;  4X64 Q;  1YZ6 A;  1XMQ Q;  5I6Y A;  3C3L A;  2IJ0 A;  2VL6 A;  5FLX E;  5ELB A;  2IX0 A;  2E76 C;  5JVH 3;  4C3H B;  3HOW H;  1QNK A;  3K6O A;  5M5Y H;  3PUX A;  5M5W H;  1EWH A;  1U9R A;  2AQ2 B;  4KK7 A;  4K5X A;  3RLF A;  1SYC A;  1HA5 A;  4X3T A;  2DGY A;  2ZXO A;  3J7A F;  1UNS A;  1S4Z A;  4CDE C;  2ZTE A;  1DD2 A;  2F0D A;  1JE4 A;  1VQF A;  2I0Q A;  4XIG S;  1VQ5 A;  1D8L A;  3ER0 A;  4GOP A;  1Z9F A;  5GAH C;  4KY6 A;  3STB C;  3K80 C;  2PI2 A;  3AU7 A;  1GUS A;  3VR2 A;  1NUC A;  3HOZ H;  4UP9 A;  2MGS A;  1VQO A;  4LF6 L;  4LF8 Q;  3IKJ A;  3QOL A;  1XX8 A;  1STA A;  1SE8 A;  2DJG C;  1G6Z A;  3EVQ A;  1LT5 D;  4R9W A;  4B3R Q;  5KRU A;  3S1N B;  3RLN A;  4OEM B;  1ROD A;  2X6L A;  1PFN A;  1XPO A;  4XT3 B;  3ERS X;  2SNM A;  4MZ9 A;  1LV9 A;  1I4X A;  3RN5 A;  1JJG A;  5C4J H;  4QMG A;  4DV5 L;  3CCJ A;  3CRK C;  4IUQ A;  3ND8 A;  3S17 H;  4GN4 B;  3FHW A;  3OIP A;  3CW2 C;  5M3M G;  4ODG A;  4QCL A;  4A3L G;  1XNR Q;  2L9H A;  3CCE A;  2JA6 G;  4R8I A;  1HZA A;  4DV6 L;  2UUC Q;  3F2C A;  4XQQ A;  4ZK9 B;  4K8J A;  4Z9C B;  2KEE A;  1VQC A;  4OO1 H;  3HZX A;  5EPJ A;  3PF5 A;  2GA4 B;  4CKB A;  2D62 A;  4DV4 L;  2MJ8 A;  2L5T A;  4KJO A;  4UDU C;  2FMC A;  3D31 A;  5T1G A;  1D2B A;  3NBI A;  3T13 A;  3TZU A; 
#chains in the Genus database with same CATH homology
 1L2F A;  4KHZ A;  4C3I H;  4JI4 L;  1N32 L;  4BA1 I;  1PA6 A;  4A3K G;  1WFQ A;  1ASY A;  3T1H L;  1FL0 A;  4H02 A;  2VQF L;  2CQO A;  1VQB A;  5GQO A;  3KDF B;  1YNX A;  4DR4 L;  1PH9 A;  3E9H A;  4IPC A;  5BR8 L;  1V9P A;  1X9N A;  2JA5 H;  1Q46 A;  4A3E H;  1PVO A;  3K8A A;  4ME3 A;  1N34 L;  3AEV A;  4IPH A;  1SRU A;  1Y1V G;  5C0X G;  3UE1 A;  1YJN A;  1K9M C;  4JI0 L;  4NXN Q;  4JYA L;  5C4X G;  2R92 G;  2N3S A;  4RMF A;  2RCN A;  4DR3 L;  4OX9 Q;  3S2D H;  1IYJ B;  4DUY Q;  2VS1 A;  2K5H A;  4DAY B;  3S1M H;  2UU9 Q;  4OWT B;  4DR7 L;  4GKJ Q;  2EIF A;  4DV6 Q;  4A3D H;  2RHS B;  2Y0S E;  1YHQ A;  2PQA A;  3FKI H;  1IBM L;  1IXR A;  5J3B A;  1HH2 P;  1HJP A;  4JI8 L;  1PH3 A;  4BBS G;  1WCM H;  4R4Q A;  2ID0 A;  2NN6 I;  1UWV A;  3FP9 A;  3JC6 6;  2WAQ E;  4A93 G;  2OTJ A;  1YBY A;  2ALY B;  2Y0S G;  1HZB A;  4IO9 A;  2CKZ B;  3BJU A;  3CCU A;  4PZ7 A;  4A3M H;  1YHA A;  3S2H H;  4A4I A;  4A3G H;  4JV5 Q;  2R93 H;  2OQK A;  2WAQ G;  2ZJQ A;  3L7Z C;  3I55 A;  1CKN A;  4OWX B;  2E5L L;  4DR2 L;  3I4O A;  4PZ8 A;  1CKM A;  4IJH A;  2CCZ A;  4OO1 G;  4HIM A;  1Z47 A;  2K5V A;  2N78 A;  4AIM A;  4X62 L;  1VQL A;  1KRT A;  3HOV G;  4OWW B;  2C35 B;  2JQO A;  2GN5 A;  4X65 L;  1PH7 A;  3PO3 G;  4FDB A;  4DR1 Q;  4LUZ A;  3K7A H;  2VQF Q;  1Q1E A;  3RZO H;  3GTP H;  2F4V L;  4DR4 Q;  4HJ5 A;  1HR0 Q;  4L5Q A;  4GOP B;  5BR8 Q;  3UDG A;  2UUB L;  4JI3 Q;  4LF4 L;  1XMO L;  3J80 c;  1JE5 A;  2LXK A;  2MQH A;  1BKB A;  1VQG A;  1YHB A;  3J7Z C;  4JI0 Q;  2NVX H;  1B7Y B;  3S14 H;  3S24 A;  4DV3 L;  4B3T L;  2QA4 A;  2JA5 G;  4DR3 Q;  4A3C H;  5JJI A;  1H95 A;  4C3H H;  1K73 C;  3F1Z A;  3PO2 H;  4GS3 A;  1TWC H;  1I50 H;  4APV A;  1NMG A;  1G51 A;  2N49 A;  2WFW A;  2R6G A;  1VQH A;  3J80 i;  4JI1 L;  1IBM Q;  1O7I A;  3PV0 A;  4GKK L;  3BZC A;  5IT9 c;  1X56 A;  3CC7 A;  3M7N A;  5IYC H;  2LXJ A;  3FKI G;  4IJL A;  1B70 B;  2ZM6 L;  2OQ0 A;  1WYD A;  2VY3 A;  4RG1 A;  1JJC B;  4LFB L;  4LF5 Q;  1WCM G;  2E5L Q;  4PG3 A;  4KI0 A;  1A63 A;  1KHI A;  4X62 Q;  2VNU D;  3J81 j;  1FVI A;  1K8A C;  1JMC A;  4QJF A;  2I5H A;  2K50 A;  4A3M G;  5GAE C;  1YJW A;  2E8G A;  4A3G G;  4DV7 L;  2PI2 E;  3RZD H;  4X65 Q;  3J81 c;  3KJO A;  1PH4 A;  3HKZ E;  5IYD H;  2XGT A;  3I2Z A;  1HNZ Q;  4P72 A;  1UE7 A;  1VQP A;  4QIW E;  2UUB Q;  5AJ3 L;  4LF4 Q;  2EQS A;  1SMX A;  3HKZ G;  1UE6 A;  4BXX H;  3CP0 A;  3HOX H;  3I4M H;  1N33 L;  3WWV A;  4GKK Q;  1Q7Y C;  4JBW A;  2Z0S A;  3RLO A;  1I94 Q;  4DV3 Q;  2BA1 A;  3J81 i;  4DV2 L;  4B3T Q;  1XNQ Q;  1VQE A;  1VQ8 A;  1VQ6 A;  4WJ4 A;  4GN5 A;  1I6H H;  1GKH A;  1SR3 A;  4LNQ A;  4LUO A;  2WB1 E;  3HOU H;  4JBK A;  4PZ6 A;  3U4V A;  5IE8 A;  4JI1 Q;  1GM5 A;  1XPR A;  4B3M L;  4NXM L;  1Q1B A;  3NEL A;  3CCQ A;  1K3R A;  4A3C G;  1N36 L;  3TRZ A;  2AWN A;  3LGJ A;  3PO2 G;  3CPW A;  4DPG A;  2KHI A;  3OW2 A;  3GTK H;  2HQL A;  3CD6 A;  2UXD Q;  2RF4 A;  3CAM A;  4TQU S;  1PH6 A;  1PH2 A;  1SFO H;  1PV4 A;  4HIO A;  2Q2U A;  3S15 H;  4R4C A;  3ZJY C;  4JYA Q;  1J5E Q;  5IYC G;  2BA0 A;  1P16 A;  1PH8 A;  4O2D A;  1T9H A;  4KHP L;  4MNO A;  4HJA A;  2MNA A;  1QZH A;  1SN8 A;  3PUY A;  1HNW L;  1N8R C;  3E9I A;  2JA7 H;  3TEH B;  4DK6 C;  5FLM G;  4L5T A;  5LMU L;  2D0O A;  3CPF A;  4AQY L;  2PQA B;  3A5Z B;  5JEA J;  4HJ8 A;  1QVF A;  3S1Q H;  2JK8 A;  1L1O B;  4UPA A;  3A5U A;  2KBN A;  2NN6 G;  4JBM A;  3PUW A;  1L0W A;  2UXB L;  3Q8D A;  1JT8 A;  5C3E H;  1VQ4 A;  1X3G A;  4Y7N H;  1YJ9 A;  1N33 Q;  3PSI A;  1VQ9 A;  1AE3 A;  4DV2 Q;  1X3E A;  2F3I A;  4DAM A;  1E1T A;  2ZJR A;  1EIY B;  1VQJ A;  3GTO H;  1CKN B;  4DV5 Q;  1ASZ A;  4BXX G;  2OCE A;  2R7D A;  4K0K L;  1LM0 A;  1YI2 A;  3HOX G;  3M4O H;  1HZC A;  2I5M X;  3B6Y A;  1QZG A;  2JJQ A;  2UUA L;  3I4M G;  4NXM Q;  1OXU A;  1NBW A;  2AWO A;  3U50 C;  4YHH Q;  3F2D A;  2F52 A;  4A3F G;  1B8A A;  1Q8K A;  1XMQ L;  1YIT A;  3CC2 A;  3HOU G;  4GLV B;  3GTJ H;  1PYB A;  1M1K C;  3H3V I;  3DM3 A;  3TS2 A;  1Y14 B;  4JI2 Q;  4R4I A;  2KHJ A;  3G48 A;  1TWF H;  2YTY A;  4JC0 A;  5LMN W;  3J7A 5;  5JEA G;  4J15 A;  4P74 A;  4JG2 A;  4JI6 L;  5JJL A;  3VDY A;  4GLA C;  3KF6 A;  4DV4 Q;  5M5X H;  1V1Q A;  4JI7 Q;  5GRO A;  3PIP A;  1A62 A;  2JA9 A;  3MXN B;  1YEZ A;  1MJC A;  3PUV A;  1OXS C;  3JAM c;  5LMU Q;  3GTM H;  4AQY Q;  1Y1W H;  1VQI A;  4JI4 Q;  3I4N H;  4LWC A;  1N32 Q;  1X55 A;  3CCS A;  4BA2 I;  2YV5 A;  3KOJ A;  3T1H Q;  3BU2 A;  2B63 H;  2HIV A;  2K75 A;  4DR5 L;  2JA7 G;  4QL5 A;  1VQD A;  2JEB I;  3G71 A;  3KDF A;  2CWA A;  1N34 Q;  3EN2 A;  4YCV A;  4IFD I;  1DGS A;  3F8T A;  5DLQ E;  3JAM i;  2AHO B;  5C3E G;  5IP7 H;  1IBK L;  4BY7 H;  3E0E A;  1EQQ A;  1MIU A;  1K0R A;  1U0L A;  3CXC A;  1X3F A;  1VCI A;  4A3E G;  2UXC L;  1LYL A;  1UEB A;  1X65 A;  1BBU A;  4DR7 Q;  3AFQ A;  2ATW A;  4LF8 L;  4A3B H;  4YWK A;  1QUQ B;  1E3P A;  5C44 H;  5IYB H;  4JI8 Q;  4P71 A;  4B3R L;  4YCW A;  2VUM H;  5K36 G;  2Q2T A;  1E7Z A;  3RR5 A;  3PIO A;  2HHH L;  2BH8 A;  1S40 A;  1NTG A;  4JI6 Q;  4LW1 A;  4A3D G;  2YYZ A;  2Q2H A;  1HNX L;  1TXY A;  3CQZ H;  4POF A;  3T1Y L;  3HOY H;  2B29 A;  1D7Q A;  4JOI C;  4DR2 Q;  4JCV E;  4LF7 L;  4MTN A;  1BBW A;  1LUZ A;  4TVA B;  4GNX B;  1OTC A;  3H3V H;  3CCM A;  3ULL A;  4LFC L;  4LFA L;  1CKO A;  1GO3 E;  2R93 G;  1IBL L;  3A0J A;  4DR6 L;  4DR5 Q;  2F4V Q;  4IPD A;  1XNR L;  2JE6 I;  1HZ9 A;  1EFW A;  3GDE A;  1IL2 A;  1Y1W G;  1XMO Q;  1HR0 W;  3I4N G;  1EWI A;  2RHQ B;  2YTV A;  4GLX A;  4A3I H;  4BY1 H;  3K7U C;  4LUV A;  3G4S A;  2CFM A;  1WI5 A;  4EQ5 A;  4UP7 A;  4YY3 L;  4BBR H;  1YIJ A;  1IBK Q;  2B63 G;  1CSP A;  2VQE L;  1PFS A;  1WJJ A;  2NVY H;  1OXV A;  3PCO B;  5LMN L;  4GOP C;  5M3F H;  1KXL A;  3M4P A;  3S1N H;  4QY7 A;  2XTI A;  3M85 A;  2QEX A;  4DV1 L;  1GD7 A;  3CC4 A;  4AYB E;  4DV0 L;  5EAY A;  4BY7 G;  5IP7 G;  4NPS A;  5IYD G;  2KCT A;  1X54 A;  1VQ7 A;  1I3Q H;  3S16 H;  2E2H H;  4GN3 B;  4OON A;  2ASB A;  3GTG H;  2E2J H;  4AYB G;  2HHH Q;  4IOA A;  3M4Q A;  1N9W A;  2IHE A;  2QGQ A;  1MJE A;  4UY8 C;  2PNH A;  2A19 A;  4A3B G;  5IP9 H;  1SRO A;  2ZTC A;  5C44 G;  2ZM6 Q;  4DNI A;  5IYB G;  3CCV A;  3OTO L;  3T1Y Q;  1HNX Q;  4YCU A;  2IX1 A;  1M90 C;  2VUM G;  4UP8 A;  2GVB A;  1PH1 A;  4LF7 Q;  1FJG L;  2ZTD A;  3K81 C;  4QGU A;  2A8V A;  1E22 A;  1FGU A;  5ELN A;  4DV7 Q;  4L5R C;  1KL9 A;  4NB3 A;  4DUZ L;  2IHF A;  4DR6 Q;  3UDF A;  3KYH C;  2JA8 H;  4GNX C;  4OX9 L;  1VQK A;  4IFD J;  4QQB X;  5AJ3 Q;  4A93 H;  2VW9 A;  2UU9 L;  2UXB Q;  2L15 A;  3GO5 A;  4L5S A;  4JI5 L;  2CWP A;  4AH6 A;  1C9O A;  2VQE Q;  5LMN Q;  2V1C C;  3NBH B;  4YWL A;  4A3J H;  3MEF A;  2AMC B;  3CCR A;  1C7Y A;  2N8N A;  3UE0 A;  3TS0 A;  2MFI A;  4BY1 G;  4A3I G;  3HOV H;  1TWH H;  4DV1 Q;  3G6E A;  4POG A;  2ES2 A;  4DV0 Q;  4BBR G;  2IY5 B;  4HID A;  3W1B A;  5H1S E;  4IPG A;  4PMW A;  3KJP A;  4A75 A;  1NJI C;  4B3M Q;  3PO3 H;  3W1G A;  3H15 A;  4HIK A;  3M3Y H;  4O0A A;  1N36 Q;  4ALP A;  4X64 L;  2K5N A;  2H5X A;  2HIX A;  3CME A;  2WP8 J;  3DLL A;  2HT1 A;  1Q86 C;  1CSQ A;  4OXP A;  2NZO A;  4DR1 L;  3OTO Q;  3ULJ A;  1HR0 L;  4X66 L;  3EIV A;  1FJG Q;  4IFD G;  4JI3 L;  1G6P A;  1KC8 C;  1AH9 A;  1G29 1;  3OYY A;  1A8V A;  3L0O A;  4R1J A;  4P73 A;  5IP9 G;  1EUJ A;  3TQY A;  4KHP Q;  2K52 A;  4DUZ Q;  1HNW Q;  1S72 A;  1TWA H;  5IY0 A;  3PF4 A;  3STB D;  2R7Z H;  4P75 A;  1IZ6 A;  3I56 A;  3KLW A;  1MKH A;  1VS0 A;  1I5F A;  1E24 A;  3KF8 B;  3H0G H;  1R9T H;  2FXQ A;  3TRE A;  1W2B A;  4JI5 Q;  1E1O A;  3A74 A;  5IWA L;  1L1O A;  2R7F A;  1PH5 A;  2BH2 A;  2JA8 G;  5FLX c;  1NMF A;  1L1O C;  1NY4 A;  3SGI A;  2A1A A;  1PYS B;  1KRS A;  2EXD A;  4K0K Q;  4C3J H;  1GVP A;  1YVC A;  1QVG A;  4YWM A;  2UUA Q;  1XPU A;  1NE3 A;  4LF5 L;  3ULP A;  1CUK A;  1Q82 C;  4A3J G;  5FJ8 H;  1JJ2 A;  2OTL A;  4WJ3 M;  3AQQ A;  5C0X I;  2ZJP A;  2DUD A;  4X64 Q;  1YZ6 A;  1W3S A;  1XMQ Q;  1UE1 A;  3RNU A;  2VL6 A;  2KEN A;  1RIP A;  2IX0 A;  4C2M H;  1EOV A;  2KCM A;  1HNZ L;  4X66 Q;  4LF9 L;  3GTL H;  1OXX K;  3PUZ A;  3HOW H;  4HJ9 A;  5M5Y H;  3PUX A;  4JOI A;  5M5W H;  1UE5 A;  5E7N A;  4IOC A;  4X6A H;  3AYH B;  1J6Q A;  3CCL A;  1V43 A;  4KLK A;  1XNQ L;  2Q2I A;  5M3M H;  5GAG C;  3RLF A;  1KD1 C;  1I94 L;  4A3L H;  3U58 A;  1C0A A;  3RN2 A;  1K83 H;  2JA6 H;  3CMA A;  2E2I H;  4OO1 I;  1VQN A;  2DGY A;  3BZK A;  3UDX A;  1VQA A;  1EYG A;  3I7F A;  4DK3 C;  2ZTE A;  5IWA Q;  2R7Z G;  2JEA I;  2B3G A;  1VQF A;  4B3S L;  3M9B A;  4XIG S;  1VQ5 A;  2I0Q A;  3IRB A;  1BVS A;  1D8L A;  3ER0 A;  1XJV A;  4JBJ A;  3AFP A;  2VZA A;  4GOP A;  2UUC L;  1Z9F A;  5GAH C;  3H0G G;  2UXD L;  2NVT H;  5HGQ A;  3STB C;  3K80 C;  2PI2 A;  2YTX A;  4XTC S;  1P8L A;  3L2P A;  1OXT A;  3HOZ H;  1TWG H;  3HFZ B;  2I5L X;  5FLM H;  1KAW A;  2UXC Q;  1J5E L;  2NZH A;  4UP9 A;  1VQO A;  4LF6 L;  4LFB Q;  4LF8 Q;  3U4Z A;  3UDI A;  4A3K H;  4EX5 A;  3CF5 A;  3S1R H;  3K0X A;  1SE8 A;  1X6O A;  5FJ8 G;  4B3R Q;  3NEN A;  4LF9 Q;  1QUQ A;  1S3O A;  3RLN A;  3EBE A;  2MO0 A;  5ELO A;  2K4K A;  2YU9 H;  2LSS A;  2IT1 A;  4A76 A;  2PMZ E;  1Y1V H;  5C4X H;  1XPO A;  1AE2 A;  3ERS X;  2OWO A;  2R92 H;  4MZ9 A;  1RL2 A;  3HOW G;  3NEM A;  1WOC A;  3GD7 A;  4DKA C;  1EQR A;  5C4J H;  3RN5 A;  3ICE A;  1JJG A;  4A3F H;  5GAD C;  4DV5 L;  3PGZ A;  1Q81 C;  4LFA Q;  3CCJ A;  4LFC Q;  2K14 A;  1PHJ A;  4R4T A;  3D0F A;  3HOY G;  3HKS A;  3S17 H;  4NXN L;  4GN4 B;  4GNX A;  4HJ7 A;  2GVA A;  3FHW A;  1IBL Q;  4BBS H;  3CW2 C;  1XTD A;  5M3M G;  1SLJ A;  3GTQ H;  4A3L G;  4YHH L;  1XNR Q;  2D0P A;  1EIF A;  2WB1 G;  5HY6 A;  1QVC A;  1A0I A;  4DUY L;  4B3S Q;  1LTL A;  3CCE A;  1KIX A;  2JA6 G;  4GKJ L;  3KFU A;  1HZA A;  2Z6K A;  4DV6 L;  1JB7 A;  2UUC Q;  4YY3 Q;  4R4O A;  1K8G A;  3F2C A;  1VQM A;  2Z6K C;  5C0X J;  2AKW B;  4JI2 L;  3KF6 B;  3F2B A;  3W5O A;  1VQC A;  1U5K A;  3PF5 A;  2D62 A;  4DV4 L;  4LF6 Q;  2MO1 A;  1KQS A;  4JV5 L;  3D31 A;  4JI7 L;  4Y52 H;  1Q12 A;  5M3F G;  3HOZ G;  2NVQ H;  5JJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...