4A3BH

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3bH00
1YI2A 2UU9Q 1XNRQ 2YTVA 3K81C 3GTPH 4JI4Q 3GTJH 4JBWA 2D0OA 3TS2A 3AFQA 5M3FG 4DR3Q 5FLXc 3HKZG 1N32L 1TWGH 1IBML 3HKSA 1XNQQ 1PYBA 3ICEA 3D0FA 4JI2Q 3TEHB 1HJPA 1MKHA 1OXVA 3LGJA 5IWAQ 4X6AH 5ELOA 4A3CH 4YCUA 3EIVA 4JI3Q 2VUMH 2YTXA 4DK3C 1LUZA 1X3EA 3AFPA 4MZ9A 1VCIA 3T1HQ 3AEVA 5K36G 4TQUS 4EQ5A 4JI0L 1X6OA 1I94Q 1PH6A 3CCLA 1NE3A 1B8AA 5BR8Q 3STBC 4DAMA 2E2IH 2AHOB 4X66Q 4A3KH 4YY3L 1EUJA 1VS0A 2H5XA 3JAMc 4A3MG 3J7A5 3S15H 5DLQE 4LF8Q 4YHHQ 4X65L 1UE5A 5M3MG 4LF6Q 4PZ6A 4B3ML 4DPGA 1HNZL 2AWNA 1Y1WG 4C3IH 2D62A 1SRUA 1WYDA 3DLLA 2OTJA 5GAEC 1L1OB 3F2CA 4TVAB 4R4OA 3D31A 5FJ8G 3H15A 3TQYA 4POFA 4GNXA 5FLMG 5C0XI 4DR6Q 3UE0A 3W1GA 2ZTEA 2ZJQA 4R4CA 2IX0A 1VQ6A 2A1AA 4DKAC 3G6EA 4A75A 1XJVA 4A3EG 1YHQA 2HIVA 4GOPB 3S1NH 3U4ZA 1I6HH 2DGYA 3G71A 2ATWA 3M4OH 3AQQA 1A0IA 2MFIA 1N34L 1E22A 4L5SA 3UE1A 4IJLA 4YCWA 4UP9A 1Q82C 2JA6H 1KL9A 2ES2A 4A3BH 4KHPL 3K7AH 1EQRA 2UU9L 1DGSA 1XNRL 3L7ZC 5IP9G 1EIFA 1E3PA 3NELA 2MNAA 1WCMH 1UE6A 1E7ZA 4DV0L 4OX9Q 3I4NG 1Y1VH 4LW1A 3G4SA 1KRTA 3GTLH 4GKKL 1C7YA 3I7FA 2GN5A 5C0XJ 2RHSB 2XTIA 3W5OA 1X9NA 1VQOA 2CCZA 1SLJA 4JOIC 1PH9A 1XNQL 4BA2I 4C3HH 4IOAA 5LMUQ 4LUOA 1Y14B 4PZ7A 5GAGC 1SMXA 4JI8L 3I56A 2QGQA 3CF5A 4DR2L 1PHJA 1TWCH 4XTCS 1NMGA 1OXTA 1Z47A 4JI1L 4DUYL 5E7NA 1GD7A 3ULPA 1KC8C 3A0JA 4JC0A 3GTQH 1N32Q 1KIXA 2QA4A 4A3IG 2B3GA 1YVCA 1I94L 1IBMQ 5JJLA 3CMAA 3ERSX 1YEZA 5IT9c 3HOZG 2JEAI 2YTYA 3HFZB 1G291 4A93H 2Q2UA 2JK8A 4HIDA 4WJ4A 4IO9A 1QVCA 2AKWB 2CQOA 3GO5A 5C44G 4WJ3M 1YHBA 2Q2IA 2ZJPA 3EBEA 3PO2G 2OQKA 1EIYB 1A62A 1IBLQ 3F8TA 1VQGA 2YYZA 4JI0Q 3Q8DA 2EQSA 3ULLA 4OXPA 2E2HH 3GTKH 3RZOH 3S17H 5C4XG 4BBSH 3RZDH 1BBWA 4A3GG 4BXXH 4O0AA 4YY3Q 1PH7A 4HJ8A 3PF5A 4DV5L 5HY6A 4X65Q 2NVXH 1L1OA 2JA5H 4B3MQ 1HNZQ 1PH2A 2R7ZG 1K3RA 2NVTH 3J81i 2BA1A 2N49A 1P16A 4HJ7A 2YV5A 4IPGA 2RF4A 3I2ZA 4OO1G 2IHEA 1UEBA 3U4VA 1QVFA 2JA7G 2NVQH 5JEAJ 4GOPA 2OCEA 2JA9A 3L0OA 3S14H 4OWTB 2PNHA 1VQKA 2NN6G 1SFOH 5JEAG 2B63G 1N33Q 3B6YA 2R92G 5AJ3L 1FGUA 3H0GG 3F2BA 1Q12A 5J3BA 1Q7YC 1Q81C 4JCVE 1IBKL 1VQNA 2JA8H 4B3RL 2ASBA 4JYAQ 1IYJB 2UUBL 3NEMA 1FL0A 1HZ9A 3M9BA 3HOYG 2ZM6L 4B3SL 4LUZA 4KHPQ 3KF8B 1YNXA 5IYBG 4RMFA 4BY1G 4DV0Q 5IYDH 1CSQA 4A3GH 3VDYA 4GKKQ 1HR0L 1QUQB 1IBLL 1N8RC 1XMOL 1U0LA 3PCOB 4DV1L 1SE8A 3HOUH 4P71A 1XTDA 4NXML 4QIWE 2N3SA 3E0EA 4AIMA 2Z6KA 3K80C 4HJ9A 1IZ6A 4KHZA 1HR0W 2PQAB 1X3GA 1CKNB 4JI8Q 2DUDA 4DR2Q 1CKMA 3I4MG 4JI1Q 4DUYQ 1VQ5A 4BY7H 3I4OA 3F1ZA 3HOVG 2N78A 1NMFA 1L0WA 2K5NA 3UDXA 3ER0A 1YIJA 1YJWA 3J7ZC 2BH8A 4YWLA 3SGIA 2E2JH 3TS0A 1RIPA 4NXNQ 4LF9L 4A3FG 1E1OA 5JJKA 2N8NA 3BZKA 3RLNA 4AYBE 5C3EG 1TXYA 3PIOA 4DK6C 3AYHB 2GVBA 4J15A 1X3FA 2HQLA 5LMNL 1N36Q 4QY7A 2K75A 3PUVA 1JE5A 3CP0A 4DAYB 5M3FH 3S2HH 1NTGA 1OXUA 5LMNW 2VS1A 1GM5A 1JJ2A 1PA6A 5GADC 4LF5L 3PV0A 1PFSA 5GAHC 4LFBL 4RG1A 1TWAH 2VZAA 1SN8A 3CCJA 1KHIA 4DV5Q 1VQ4A 4EX5A 1QVGA 1N33L 3HOWG 4DV4L 4LF7Q 4JBMA 3STBD 2F4VL 5IP7G 1W3SA 4A4IA 2R93G 2E5LQ 4YCVA 1X56A 3S24A 2HHHL 4JYAL 2JEBI 2AMCB 5GQOA 4LNQA 2R7FA 1NY4A 1V1QA 3KJPA 2CWPA 1YBYA 1VQHA 3KF6B 1I3QH 3PUYA 1HZAA 5AJ3Q 4HIMA 1AE2A 3G48A 3T1YL 2ZTDA 4A3MH 5C3EH 5HGQA 1YJ9A 4PG3A 3RLOA 4R4TA 3HOXG 3PF4A 1OXXK 2I5HA 1IBKQ 1XPUA 1EOVA 4IPCA 3MXNB 5M3MH 1PH5A 4DUZQ 4B3RQ 4X62L 4GN3B 1QZGA 3CCMA 4DV7L 1VQDA 2UUBQ 1QUQA 1GO3E 2IY5B 1Y1WH 2ZM6Q 4B3SQ 2FXQA 2I0QA 1D7QA 3MEFA 4L5QA 2CKZB 2UXBL 1C0AA 4HJ5A 2K5VA 1O7IA 2GVAA 2PQAA 1HR0Q 3UDIA 1FVIA 2PI2E 1OXSC 2MQHA 3KLWA 5FJ8H 1CKNA 1LYLA 2KHIA 3M4QA 3WWVA 5FLMH 4DV1Q 4DR5L 3J81j 4NXMQ 4GN5A 2HT1A 4LWCA 5EAYA 1VQPA 1VQ7A 4DR4L 4R4QA 4OWWB 4NXNL 4OWXB 1JJGA 1GKHA 3NENA 3CMEA 4A3EH 4ME3A 1I50H 3S1MH 1WFQA 1IXRA 3NBHB 1K73C 4B3TL 4A3LG 4OO1I 5IYCG 2UUAL 1PVOA 1UWVA 4AYBG 1R9TH 4AH6A 2ZJRA 1N36L 2VL6A 5IP9H 2V1CC 2MO0A 4QJFA 4DV3L 2Y0SG 3I4NH 5JJIA 2NN6I 1K0RA 3CCUA 2RHQB 2ID0A 4LF9Q 1CUKA 3KOJA 1VQCA 1BBUA 1U5KA 3S1RH 1P8LA 3PO3G 4K0KQ 3W1BA 2ALYB 4LFAL 4POGA 1E1TA 4GKJL 1PH3A 1FJGL 2E8GA 4IPHA 4QGUA 5LMNQ 4LF7L 1X65A 1Q1EA 2D0PA 3IRBA 2E5LL 1K8AC 4A3DG 3CXCA 1LM0A 2YU9H 3CCSA 4HJAA 4X64L 1OTCA 1RL2A 4GN4B 4A3IH 3JAMi 4LF5Q 3M3YH 3HOZH 4LFBQ 4GNXC 3CC7A 3CCEA 2OQ0A 1UE1A 4JBJA 4DV4Q 1WOCA 2BH2A 1YITA 3KF6A 2OWOA 5C44H 2F4VQ 3K8AA 2HHHQ 4DUZL 1EQQA 4H02A 2NVYH 1MJCA 3PO2H 2F52A 1X55A 1MJEA 2WB1E 1XPOA 1M1KC 3TRZA 3GTGH 4R1JA 5C4XH 1PH8A 1S72A 4A3CG 3PUXA 1Z9FA 1KAWA 2NZOA 4DR1L 2VUMG 1K8GA 3T1YQ 1JB7A 1D8LA 1M90C 2EIFA 1UE7A 1HNWL 1G51A 3ZJYC 1QZHA 4X62Q 1EFWA 4DV7Q 2R7ZH 4IFDJ 2UXDL 3DM3A 1KXLA 3S1QH 3J80c 4A3KG 1B7YB 2VNUD 1Q8KA 1VQLA 2LXKA 1PV4A 4IFDG 2UXBQ 1BKBA 1C9OA 3KDFB 2JA7H 5ELNA 2KCTA 4Y7NH 3RN5A 2VW9A 1HNXL 1EWIA 4DR5Q 2B63H 2R92H 4DV6L 1J6QA 5M5XH 4DR4Q 3H0GH 3CPFA 4LFCL 1K9MC 1XMQL 3U50C 4JI7L 4UP7A 3PSIA 4KLKA 1XPRA 3A5UA 4K0KL 4B3TQ 2HIXA 2UUAQ 4PMWA 3HOYH 2Y0SE 2WFWA 1SR3A 1K83H 1CSPA 2R6GA 3CAMA 5IYBH 2I5LX 3KYHC 5GROA 4DV3Q 4YWKA 4BY1H 2QEXA 4JBKA 1WJJA 2Q2HA 2UXCL 2IX1A 3FKIG 3GTMH 1CKOA 3I55A 3EN2A 4IOCA 1ASYA 1G6PA 3L2PA 1X54A 1A8VA 1JJCB 3RNUA 1ASZA 3U58A 1LTLA 4A76A 3J81c 2JA6G 4A3BG 1H95A 3TREA 1A63A 3CD6A 1VQAA 3K7UC 4LFAQ 1EYGA 1WCMG 2VQEL 4GKJQ 1VQIA 1FJGQ 1Y1VG 4FDBA 1YZ6A 3OTOL 4MNOA 1L1OC 1I5FA 2IT1A 5IY0A 1W2BA 3I4MH 4UP8A 3CCVA 1WI5A 2ZTCA 3CC4A 3H3VI 1L2FA 1SROA 4NB3A 4AQYL 4A3JG 1S3OA 3HOVH 2VQFL 4X64Q 2JE6I 1TWHH 4MTNA 4OONA 1XMOQ 2AWOA 1Q1BA 2JJQA 4PZ8A 1TWFH 1PYSB 4GOPC 4JV5L 2WB1G 3OYYA 2WAQG 1GVPA 5H1SE 3CCRA 4A3FH 1N9WA 2IHFA 2K5HA 3A5ZB 2UUCL 4DR7L 2CFMA 1KRSA 3UDGA 1PH1A 3K0XA 1J5EQ 3GDEA 2PMZE 5IE8A 4P73A 4JI6L 3BZCA 4JI5L 3KJOA 5M5YH 4GLVB 2PI2A 4LF4L 1B70B 4A93G 4DV2L 2MO1A 2RCNA 3FKIH 4BA1I 1IL2A 1Q86C 3RR5A 4DR1Q 3BJUA 2K4KA 2LSSA 3JC66 4UPAA 2KCMA 1HNWQ 4JI4L 2XGTA 1KQSA 3RLFA 3HOWH 3KDFA 4C3JH 2K52A 3KFUA 2B29A 2Z6KC 2UXDQ 4BBSG 1BVSA 4DR3L 5IP7H 2R93H 4Y52H 4BXXG 2KHJA 2K50A 3FP9A 3E9IA 4A3JH 2I5MX 4ALPA 1PH4A 2OTLA 1HZBA 4JI2L 2CWAA 5C0XG 4QL5A 3PUWA 3M85A 3S2DH 5IWAL 4QQBX 4O2DA 1VQBA 2JA5G 1VQJA 1HNXQ 3PIPA 3E9HA 4DV6Q 4JI3L 3HKZE 4BBRG 3F2DA 2KENA 4LFCQ 1VQEA 1XMQQ 4JI7Q 1V9PA 3J80i 3HOXH 3BU2A 3T1HL 1VQ9A 2Z0SA 4GLAC 1Q46A 3GD7A 3A74A 4GS3A 3UDFA 5BR8L 4X66L 2VY3A 3CQZH 1E24A 3CPWA 4HIOA 4C2MH 4LF8L 5C4JH 4LUVA 4YHHL 4HIKA 3H3VH 2JA8G 1JMCA 2UXCQ 4LF6L 3PGZA 4P74A 4APVA 4XIGS 2C35B 2L15A 2K14A 1V43A 4GLXA 1YJNA 5M5WH 2R7DA 1HH2P 5IYDG 1S40A 2EXDA 2VQEQ 2Q2TA 3OTOQ 4DNIA 4A3LH 4IFDI 4P75A 4DR6L 1J5EL 5IYCH 1VQFA 3PUZA 4NPSA 3HOUG 1YHAA 3CW2C 4YWMA 1JT8A 4AQYQ 3RN2A 3CC2A 4R4IA 2VQFQ 1NJIC 2WP8J 4UY8C 2WAQE 4GNXB 3ULJA 4BBRH 4L5RC 1NBWA 4JV5Q 1VQ8A 2NZHA 3M4PA 1VQMA 1HZCA 1KD1C 2UUCQ 3GTOH 4BY7G 4DR7Q 2BA0A 3OW2A 4IJHA 3PO3H 1T9HA 2A19A 2KBNA 4OX9L 4JG2A 2JQOA 4JI6Q 1AE3A 4KI0A 4JI5Q 2A8VA 1AH9A 3CCQA 2LXJA 4JOIA 3FHWA 4LF4Q 4A3DH 4DV2Q 3S16H 4P72A 1N34Q 1MIUA 4L5TA 2F3IA 5LMUL 3M7NA 4IPDA
chains in the Genus database with same CATH superfamily
1IKLA 1XNRQ 3K81C 4JBWA 2D0OA 5M3FB 3HKZB 4JW0A 5JVH3 4IZ8A 4DR3Q 3VYTA 1TWGH 5FLXE 3MFGA 4H13C 5T1IA 2WIIB 1HJPA 3LGJA 1F77A 1GHJA 3K7AB 5K36G 3AEVA 3VYSA 1X6OA 1UUPA 2B8GA 1PH6A 3GV3A 1NE3A 4ZQ3A 5BR8Q 4DAMA 2AHOB 3IL8A 4A3KH 2SEBD 2MPMA 1UE5A 1FD7D 5M3MG 4LF6Q 1LT3D 1IKMA 1B50A 1Y1WG 3KLSX 1WYDA 1QB5D 3DLLA 1Y69U 5IGEA 5GAEC 1KNAA 1HXYD 4R4OA 4DR6Q 2XVSA 3TQYA 4DK0A 1BCPD 3UE0A 2ZTEA 1VF7A 2XIWA 3G6EA 1XJVA 5M9OA 3U4ZA 2DGYA 3M4OH 1N34L 1A0IA 2MFIA 3QOLA 5C4HA 4YCWA 3HGBA 1KL9A 2JSOA 1D1IA 3DHQA 4IUQA 1EQRA 4A3BH 4NW2A 1DGSA 2MNAA 1SDFA 1WCMH 4OX9Q 1Y1VH 1IYVA 1C7YA 1EZ6A 2CH4W 5LHY1 1WD0A 5C0XJ 5IGCA 4H7BA 3HRZC 5BN5A 5GAGC 4JI8L 1OXTA 1GD7A 3ULPA 1QOHA 3MXGA 1EIGA 2B3GA 1IBMQ 1I94L 1YNJC 5JJLA 5IT9c 2XNAC 2K6AA 2JEAI 3HOZG 2YTYA 3HFZB 2Q2UA 3TP8A 2NB0A 2AKWB 2CQOA 4WJ3M 4K5WA 2SDFA 3PMFA 3PO2G 1EYDA 4XDXA 2DNCA 5A2QL 3GTKH 2F0QA 4RCNA 1H9MA 4A3GB 2PZUA 1BBWA 5ELCA 5ELEA 1AN8A 2OT2A 4O0AA 3BDCA 1WTPA 2IJ0A 5C0XH 1L1OA 4V0BA 1FR3A 4B3MQ 1WTOA 2R7ZG 1K3RA 4XT3B 2BA1A 2YV5A 2IX3A 4FVMA 4BY7B 5EGTA 1UEBA 3U4VA 1QVFA 2NVQH 1MD2D 3L0OA 2L55A 5M5XB 2B63G 1SFOH 2EVBA 3B6YA 2ZXOA 1Q12A 4OGQC 3KBGA 1IBKL 1B53A 1VQNA 2JA8H 2ASBA 1HZ9A 4LUZA 4KHPQ 3KF8B 1YNXA 5IYBG 1EL0A 1F2MA 1CSQA 2EDGA 2KHSA 4DXGA 1N8RC 2HCCA 3OIQA 1XMOL 3FMCA 1JR0D 5C6AA 1SE8A 2XWBB 2N3SA 3E0EA 2FINB 4AIMA 4HJ9A 1STNA 1WTWA 1SNCA 4G7OC 1F2ZA 2K33A 1BNZA 2WINB 1CKNB 2DUDA 2K01A 1PFNA 4DN4M 1E2VA 2B2TC 4HCSA 1HFGA 2E74C 1NMFA 1I3QB 1L0WA 1YJWA 3J7ZC 2E2JH 4YWLA 4A3MB 1E1OA 5JJKA 2N8NA 5KNDA 5CC4A 3AYHB 2XRQD 1X3FA 2HQLA 4EQNA 5LMNL 1N36Q 4GZYC 5C5MA 4CDFC 4DAYB 3BZDB 1U9RA 1CHPD 5M3FH 3S2HH 5LMNW 2F0KA 1S5ED 2O2LD 2VS1A 2A6EC 5DM63 4LF5L 3ERQA 4ZKCB 3Q23A 2VZAA 4B9XA 2L0CA 3HOWB 1FNWA 1KHIA 4S3SA 4DV5Q 2EY2A 4C3JG 4LF7Q 4JBMA 5IP7G 4JYAL 4QMGA 1R9TB 1BBXC 4LNQA 1YBYA 2LY7A 3KF6B 1D5XC 4PG3A 3RLOA 5C5LA 1PH5A 4X62L 4GN3B 4HR7B 5E4XA 1VQDA 1QUQA 2ZM6Q 3QR8A 1B44D 2E76C 4L5QA 1EY8A 2YU9B 2HQEA 2Z9HA 1DD2A 4A3IB 1FVIA 3KLWA 2MQHA 5FJ8H 4QCLA 3WWVA 4C56C 4DR4L 1WTQA 1WTXA 4OWXB 1GKHA 1I50H 3VR2A 1IXRA 1K73C 5I9PA 4MHEA 4CJ1B 4WFN3 2B2WC 2EY6A 4AYBG 4AH6A 2V1CC 4QJFA 3I4NH 4E6IA 1JQYD 5C4XB 1K0RA 3KUPA 4LF9Q 1U5KA 3RUZA 2ALYB 4POGA 1YNJD 1STHA 1SYDA 2E8GA 3S1QB 2E5LL 1F9PA 4CDEC 1I4XA 3BDOA 2JA7B 4Y7NB 4GN4B 1EY4A 4ODGA 2MGSA 3M3YH 5EKLA 1ESRA 3CC7A 3CCEA 2B8FA 4O42A 1YITA 5FK9C 1MSHA 2OWOA 4XQNA 4BY1B 1XPOA 3LX0A 3OMCA 2L9HA 3PUXA 4RGTA 3R8BA 3QB3A 1JB7A 2EPBA 3M7GA 3A54A 4FNFA 2UXDL 5IGDA 5FKAC 1SE2A 3NBIA 3I4MB 1W6JA 3V96A 2VNUD 3LNNA 1GUSA 1C9OA 1J8IA 1BF4A 3T13A 3RN5A 4C3IB 4K8JA 2R92H 1ESFA 5M5XH 3H0GH 1K9MC 1K3BC 2AUJD 1S5DD 4UP7A 5CGKA 5CR3A 1GUNA 1DJRD 2K32A 5EPJA 2UUAQ 2Y0SE 1SR3A 1J9OA 5M5YB 3S1NB 4JBKA 5KEEA 4DNTB 2KQ3A 3GTMH 3I55A 1ASYA 1A8VA 1JJCB 2RDFA 1ASZA 1LV9A 1LTLA 2JA6G 3K7UC 1Y8NB 1DM0B 1VQIA 2QILA 3OTOL 2F3VA 1L1OC 1W2BA 1WI5A 3H3VI 2EJFC 3TP6A 3HOVH 1UNSA 2VQFL 2AWOA 1QG7A 1SNOA 1V1PB 2Q2TA 2WAQG 1GVPA 3CCRA 1DONA 3O13A 1N9WA 2K5HA 4DR7L 2ICIA 4ZCKA 4DF7A 2A6ED 2IW3A 1TS4A 2I46A 4PMBA 4JI6L 3BZCA 3KJOA 4XQJA 4ZUIA 4GLVB 2PI2A 1B70B 1EQVA 4C2MB 4DV2L 2MO1A 1RD9D 4CKEA 2ENBA 3PIP3 4BA1I 1IL2A 1Q86C 3NK9A 2K4KA 1PRTC 2LSSA 3BJUA 5I4DA 3KLRA 1SSOA 1KQSA 1LTTD 4WJWA 3HOWH 2B29A 4BBSG 4DR3L 5JAVA 1QNKA 1XTCD 2NVXB 1ET9A 4QL5A 3M85A 4QQBX 2Y0SB 2ZXPA 1VQJA 3U9SA 4BBRB 3EQLC 3VR3A 1XMQQ 4JI7Q 1VQ9A 3HOXH 4L8JA 3A74A 4M1UB 5IT9E 5BR8L 1S5BD 1V8QA 3I70A 3G7LA 1RTNA 4K6DA 4LJZC 3OSOA 4LF6L 2F0LA 1JWUD 3CU7A 4APVA 3L3OC 2V4DA 2A74C 4N8FA 5M5WH 3V05A 5IYDG 2KCCA 1L0XB 1TWGB 4DR6L 1J5EL 5IYCH 1VF5C 1W6KA 4DGZA 3D6WA 3NQIA 1TQOA 4R4IA 2KOLA 3ULJA 2K1BA 1IYUA 2DJGC 3GTOH 2C5CA 2A19A 4IUVA 3BVZA 4OX9L 1EQTA 4DA2A 4JI5Q 3CCQA 1F2YA 4RHSA 1STAA 1MIUA 4KKSA 4X3SA 4M8AA 3ND8A 4H44C 1H9KA 2UU9Q 3JAML 4JI4Q 3N52A 3GTJH 3OW7A 2F0TA 5A35A 5I6WA 3F2UA 3C1EA 1IBML 2GA4B 3HKSA 1T5XD 3PIO3 3ZYYX 3ICEA 3D0FA 2L11A 5IWAQ 3SK6A 2EYFA 3CRLC 5ELOA 4A3CH 3M4OB 4NDXA 4PMCA 3EIVA 3NHHA 4G7HC 4A3BB 1VCIA 2F0SA 1WCMB 5EQ0A 2E2IH 1HTPA 3URYA 3JAME 1EY5A 1B3QA 2XRSD 5FO7B 4B3ML 4DPGA 1Y1WB 4C3HG 4C3IH 5JVG3 1A3TA 2HCIA 1NSNS 2NZ1D 1L1OB 3BVGA 3D31A 2JP1A 2IX0A 1MGSA 3OIPA 4A3EG 3S1NH 2ATWA 3D4WA 1ZYRC 4IJLA 1KAAA 2ES2A 4KHPL 2MUYA 4RGNA 3GTKB 1E7ZA 4H0LC 4LW1A 4CKBA 3H3VC 2PO4A 5KNBA 3I7FA 4HMJA 1DXMA 1ENAA 1X9NA 1SLJA 1XNQL 1GHKA 1XWEA 4C3HH 4XYOA 4LUOA 4PZ7A 1I4PA 2QGQA 2B2TA 4RA8A 3MVVA 1X32A 3GTQH 2NVQB 1N32Q 1B1ZA 1PRTD 1LTID 2KUMA 1SFOB 4NP5A 1A2TA 1CK1A 3I90A 4HIDA 2F0DA 1EY7A 1QVCA 2JA8B 5C44G 2AQ3B 1CZGA 4HSVA 3I91A 1C8CA 3GTGB 3QWNA 4X3TA 2YYZA 3Q8DA 2EQSA 3ULLA 3S17H 1LABA 5EBDA 4DAPA 4BXXH 4YY3Q 1EY9A 1PH7A 3D3RA 2WACA 4DV5L 2NVXH 2R7ZB 2XWJB 5IGGA 2JA5H 3QOJA 1PH2A 4QUFA 3J81i 1UEAB 4G4KA 1F9SA 1P16A 4HJ7A 1WTHA 2EE1A 4OO1G 2DJFC 3R3OA 5JEAJ 4GOPA 1A2UA 3D8GA 5DEHA 2OCEA 2IL8A 5CBAE 2E2JB 4OWTB 2PNHA 2NN6G 5JEAG 1FGUA 2J0TD 3F2BA 1LTAD 5J3BA 1Q7YC 4JCVE 5J39A 1VMPA 1U4MA 1JOOA 1K83B 2R61A 3HOYG 2ZM6L 1ZXTA 1TS5A 3EROA 3S2HB 1QUQB 2MJ8A 2D9UA 3A7LA 3HOUH 4P71A 4C1NI 4KHZA 4HSPA 1X3GA 2B2WA 1SYBA 4DUYQ 5NUCA 1HRJA 3OPOA 4FF1A 5KYIA 1VQ5A 3I4OA 3D6CA 2N78A 3T51B 3UDXA 2BH8A 1NR2A 3SGIA 2VB2X 4NXNQ 4LF9L 4A3FG 4AYBE 5C3EG 4KKUA 4J15A 3J7YW 3SXHA 1BCPB 1BQQT 2DN8A 1JE5A 1S5FD 3VR4A 1OXUA 1JJ2A 4KMUC 3PV0A 5GAHC 4RG1A 1TWAH 1VQ4A 1N33L 2Q8TA 4EX5A 1I50B 2R93G 5ISRA 5K36H 2KA7A 1KDAA 3T16A 1V1QA 2CWPA 3I4NB 3AMUA 2Q8RE 3SR1A 3TP7A 3PUYA 5AJ3Q 1AE2A 3C3LA 2ZTDA 5C3EH 2F0PA 3MHBA 3I72A 1XPUA 1EOVA 5M3MH 3QIAA 2UUBQ 5IIFA 1GO3E 2QEJC 3MXPA 1Y1WH 1TR5A 2FXQA 3SVMA 4B3SQ 2I0QA 2XSCA 1D7QA 2CKZB 1C0AA 2K5VA 2EZVA 1PZID 1ZYRD 4Z9CB 1HR0Q 2J7ZA 2PI2E 1MHWC 1LYLA 4DV1Q 2HT1A 3M3YB 3J81j 2FMCA 1VQPA 5EAYA 2XN9C 3OWFA 1IL8A 4R4QA 3NENA 4Q5VA 1QJOA 2CQAA 1CA5A 4JK1C 5KIXA 4A3LG 4OO1I 4AYBB 2UUAL 1PVOA 1KABA 5JJIA 1LTSD 2NN6I 2EY5A 1ILQA 4K8IA 5D3IB 2ID0A 1I4HA 1CUKA 2BCOA 4RHRA 3PO3G 1EU4A 4IUPA 4CHTB 1PH3A 1CA6A 2KECA 1EZ8A 1X65A 3IRBA 3VA5A 1U4PA 1ENCA 2EJGC 1MSGA 1LM0A 3CCSA 4HJAA 1OTCA 4XXEA 5EKKA 2R92B 3HOZH 4LFBQ 1BCPF 3H0GB 1RTOA 1SNDA 4JBJA 2BH2A 4DV4Q 1WOCA 3CKIB 1JWMD 2X6LA 2F4VQ 5BN3A 1XX8A 4DUZL 4H02A 3PO2H 1MJCA 1JOKA 4G57A 2F52A 2PW5A 1F9QA 1M1KC 3GTGH 4R1JA 3MXNA 3J7AF 3GTMB 1QILA 2VUMG 3T1YQ 5ELBA 1STGA 4KTAA 1UE7A 3ZJYC 1QZHA 2EY1A 3TBIB 4DV7Q 5CV7A 2R7ZH 4IFDJ 1SMYC 2B2UA 1KXLA 3J80c 1S5CD 1B7YB 4KD3A 1Q8KA 1FNVA 1VQLA 1PV4A 1H9JA 4IFDG 2UXBQ 1B9NA 1BKBA 1PFMA 3HOVB 2B2YA 3NBHA 4ZKBB 1TU2B 2B63H 4LK1C 3K5MA 3KBXA 1CT1D 1NR4A 1XMQL 3KLSA 4JI7L 5FO8B 1SXTA 3PSIA 1JE4A 4ABNA 4K0KL 1DYQA 4KD4A 3SE0A 4P2CB 4PMWA 4DNRB 2WFWA 1K83H 1MBYA 4OELB 2I5LX 5IYBH 3KYHC 4JPBW 1GOZA 2QEXA 5DM73 3FPUB 1IHZA 3NTIA 3MFYA 2OF1A 1CKOA 1G6PA 1CHQD 2K28A 3GP7A 4IQZA 3RNUA 3J81c 4YIJA 4LFAQ 1EYGA 4GKJQ 2IT1A 5CBEE 1WVLA 3C46A 4UP8A 4IFDH 2B2VA 1L2FA 4A3JG 1Q1BA 2JJQA 3ONAB 2F0JA 4GOPC 2WB1G 2RSOA 4O1NA 2IHFA 3A5ZB 3HOXB 4KN4C 1SE4A 1PH1A 1BOSA 5IE8A 4JI5L 2F03A 4A93G 2RCNA 5LL6X 4DR1Q 4UPAA 3HP3A 1IW7C 1KDBA 1HNWQ 4JI4L 5M5WB 2XGTA 2LS01 3RLFA 3KDFA 4C3JH 3KFUA 4CKCA 2HDLA 5IP7H 1LT4D 3K57A 4IURA 3E9IA 4A3JH 1EWHA 4ALPA 1PH4A 2OTLA 1HZBA 4HMIA 4V190 5IWAL 1HTLD 1RDPD 1HNXQ 3PIPA 3E9HA 4DV6Q 2EXZA 3F2DA 3BDLA 2IWHA 1H9RA 4LFCQ 1EY6A 3GTOB 1V9PA 2F1MA 1YNNC 2KJXA 2Z0SA 3UDFA 4XQQA 4JVZA 5D3DA 3W3AA 1E24A 3CPWA 4HIOA 4N9PA 5C4JH 2M9VA 4LUVA 3H3VH 4G7ZC 2UXCQ 1JMCA 4P74A 2C35B 2L15A 2K14A 1V43A 4KJNA 4UAIA 4IN3A 3GTJB 1SYGA 4K6LA 2VQEQ 3KK7A 4IFDI 3FEWX 4K2LA 1G2SA 4YWMA 3RN2A 1TVXA 5FO9B 3K5NA 4JV5Q 3X3MA 2EYJA 1VQ8A 4RKLA 3M4PA 1E2ZA 1HZCA 4BY7G 3OW2A 1T9HA 4PNYA 1PYWD 4JG2A 2JQOA 1E2WA 2E2IB 1AH9A 3EA6A 4KY6A 1EYCA 3S16H 4P72A 1N34Q 3VYUA 2F3IA 1O78A 1T5EA 1C4QA 4CDCC 2K05A 1O80A 3TS2A 2D5DA 1PZJD 5FLXc 1N32L 2L12A 2KEDA 1Y8PB 1GUWA 1G6ZA 2A5HA 5I2YA 3TEHB 1MKHA 4X6AH 3TZDA 1LTBD 1SMYD 1D1KA 2F0HA 4FF4A 2YTXA 1LUZA 3A8KE 1X3EA 4MZ9A 2AQ1B 3T1HQ 4TQUS 4EQ5A 2EYPA 5ELDA 1I94Q 3CCLA 4J8QA 2EJMA 4X66Q 4YY3L 1EUJA 1NNXA 2H5XA 4A3MG 4LF8Q 1HHVA 1I4GA 4C3HB 1JWSD 1PDQA 2AWNA 2F0VA 1K8OA 2JN4A 3F2CA 3GTQB 1LT6D 3RD4A 4GNXA 3H15A 4POFA 5FLMG 3W1GA 1NUCA 4HN7A 2ZJQA 3P20A 4R4CA 4A3EB 2A73B 3S1MB 4A75A 3A56A 1YHQA 4GOPB 1I6HH 2D2CC 3G71A 4KKTA 3AQQA 5IT9L 1Q82C 1F9RA 5G3LD 4UP9A 1GJXA 2JA6H 1EU3A 1PMRA 1WTRA 1XNRL 3L7ZC 5IP9G 3WOEA 3S17B 4U68A 3G4SA 3GTLH 1KRTA 2HUGA 3I4LA 3NTKA 1VMCA 2QDLA 2XTIA 2B2UC 1TIID 4B08A 1VQOA 4JOIC 1PH9A 2CCZA 2O5IC 2JA5B 4PV1C 5EPLA 2K5QA 1LT5D 2B2YC 3T56B 1Y14B 1SMXA 1TWCH 1ICWA 4DUYL 1SYFA 1JORA 5E7NA 3Q6SA 1Z7TA 4JC0A 1GXDC 4WRDA 2CH4A 1KIXA 4A3IG 5EKIA 3CMAA 3ERSX 1YEZA 1IW7D 2RCFA 2NWGA 5E1FA 1L0YB 1G291 3MEHA 2JK8A 4N8X1 5C44B 4WJ4A 4DK1A 2RKSA 1YHBA 2Q2IA 2ZJPA 3EBEA 2OQKA 3HZXA 4LMQD 4JI0Q 2RDGA 3DEOA 3NUCA 5C4XG 3RZOH 1JB3A 4BBSH 1LTRD 3RZDH 3HOUB 1YNND 3PF5A 4LAAA 5HY6A 2B2VC 2VXWA 4X65Q 1HNZQ 1LLRD 2NVTH 2SNMA 3TDQA 2G5DA 1HPCA 3CRKC 3VA7A 2JA7G 2K04A 3I3CA 3S14H 5AJ3L 2WKDA 1QCBD 1VDZA 3EJIA 5JPNC 4JYAQ 1H9SA 1IYJB 2UUBL 5G3LF 3CHBD 3MA2B 4B3SL 4MTKA 3NXWA 4BY1G 4DV0Q 5IYDH 3VDYA 4GKKQ 4QF4A 1HR0L 4RKBA 3L9AX 1U0LA 3PCOB 4DV1L 4KJOA 1TWAB 1X3QA 1IZ6A 5CV6A 1HR0W 3J80E 4DR2Q 1HQRD 3I4MG 3BYTB 4JI1Q 2NUCA 2PPBC 3F1ZA 1CTMA 2F0EA 2K5NA 1Q3LA 1SE3A 3SK5A 1QWYA 1RIPA 5C3EB 4FP5D 2KCNA 3BZKA 3RLNA 1TXYA 2BDOA 1HUNA 3DXJC 1CQFA 5M3MB 1A3UA 4EVOA 2EYHA 4X3KA 3SK4A 4BS9A 3PUVA 1JCKB 4CDDC 2AUKA 3NWTA 5GADC 4F88A 1LACA 1LO5D 4LFBL 1B3AA 2K03A 1QVGA 4DV4L 2B39A 4EGVA 2F4VL 2IPKD 4A4IA 2E5LQ 4YCVA 4K5XA 5ELFA 2R7FA 4FF3A 2Z6BA 2EYOA 4FXGC 2MHVA 3SDZA 1G8ZD 1HZAA 3HG9A 5C4ZA 4HIMA 3G48A 3T1YL 1CFMA 1YJ9A 5HGQA 4R4TA 3RMHA 2F0UA 2I5HA 4B3RQ 4IPCA 3MXNB 2A69C 1PRTB 4DV7L 3MEFA 2UXBL 4HJ5A 2QF7A 2H1EA 5K5PA 1QE6A 2PQAA 1FNUA 1IBLQ 3L2PA 1FGBD 2KHIA 1R4QB 3M4QA 3HOZB 4NXMQ 4QUCA 5L37A 4LWCA 4A3EH 3S1MH 1WFQA 3NBHB 2TSSA 1B2TA 4N9TA 1UWVA 3PO2B 2WV6D 2ZJRA 1N36L 2VL6A 5EJWA 1SNPA 2Y0SG 3LWEA 3CCUA 1K8MA 2TMPA 3S1RH 4LFAL 4GKJL 1PZKD 4IPHA 4LF7L 3T4AC 1Q1EA 2D0PA 4RGMA 1K8AC 2PCFB 3SHLA 4A3DG 4KHVA 1KTKA 1RL2A 3OOCA 3JAMi 1CZWA 2Q8IB 2K5WA 2B63B 4GNXC 2E2DC 1UE1A 2OQ0A 2K7VA 5C44H 2HHHQ 2NVYH 1X55A 4J6HA 2WB1E 3W2DA 3TRZA 3NE5B 1BUVT 1PH8A 1HFNA 4DR1L 4DFAA 4C1NK 1M90C 2EIFA 1HNWL 1G51A 4UDUC 1EFWA 4EQPA 4A3KG 3M4YA 4OO1H 1BXTA 3KDFB 2DNEA 5ELNA 3A8IE 2KCTA 2JXMB 5AFWA 2VW9A 1PRTF 4DR5Q 2FFKB 1HNXL 2NN6H 4DV6L 5JEAH 1J6QA 3K59A 3ND9A 3CPFA 4LFCL 2JYOA 3Q0AA 3E5SA 3A5UA 4B3TQ 3HOYH 3C2PA 1CSPA 2R6GA 4DV3Q 2SOBA 2UXCL 1Q90A 2IX1A 3FKIG 3EN2A 2LMCB 1PTOC 1O7YA 4A3BG 3TREA 1A63A 1VQAA 4C3JB 1WCMG 2VQEL 1FJGQ 1Y1VG 4FDBA 2CW0C 4MNOA 5IY0A 4FYDA 4EQOA 4A3JB 3CC4A 3K6OA 1OO9B 1SROA 4NB3A 2ZT9C 4X64Q 4OONA 1TWHH 3IAYA 1SJHD 4FXKC 3K58A 2QKIC 1TWFH 1PYSB 2WB1B 3P75A 1U4RA 1EFID 4JV5L 3OYYA 4A3FH 1KDCA 3A8JE 3UDGA 3MTSA 3E3XA 3K0XA 4R8IA 1J5EQ 3GDEA 2PMZE 1PFBA 4I7ZC 5EBCA 2A68C 3H94A 4A93B 2N88A 1TKWB 4XYQA 3FKIH 5C4JB 2L1BA 1HA6A 1EY0A 2F0MA 1UAPA 3RR5A 2LKVA 3P7JA 3BS1A 2E2HB 3GV6A 1MI2A 2K52A 3R2TA 1I6VC 2R93H 2KEEA 2KHJA 3FP9A 2I5MX 2X69A 5DAUA 2CWAA 5C0XG 3S2DH 5CYUA 1B9MA 2A69D 4O2DA 1TT2A 1DOLA 1ICFB 2KENA 1SNQA 1SYEA 1VQEA 1HCZA 1M8AA 3T1HL 3BU2A 3H6MA 4BWGB 4HTHA 3NSWA 4GLAC 3GD7A 4X66L 2VY3A 3CQZH 2N55A 3X3NA 4LF8L 3S16B 3DWAA 5IGFA 3FVQA 2JA8G 4NKLA 3PGZA 4J1MA 5KYLA 2R7DA 1S40A 2EXDA 1RHPA 5C3XA 2Z8LA 2VB3X 4A3LH 4P75A 3A7AB 2DY8A 1YHAA 1JT8A 2PMZB 4AQYQ 2F4IA 4UY8C 2WAQE 4GNXB 1NBWA 2DY7A 4F8MA 4ZK9B 2NZHA 2HDMA 1CI3M 2UUCQ 4TRDA 1XXGA 4IJHA 3N6RA 3PO3H 3TP5A 2L5TA 1EOTA 1BO0A 4XT1B 2A8VA 2K5DA 1I4QA 2LXJA 4JOIA 4LF4Q 5IOCA 5IODA 1ONLA 5A2QE 1DOMA 1RJTA 3VR6A 4IPDA 4K5VA 3M7NA 1YI2A 1ML0D 2YTVA 3GTPH 4RGOS 1DOKA 1F2LA 1EEFD 1SAPA 3AFQA 5M3FG 3HKZG 4ID6A 1XNQQ 1PYBA 2F0OA 1AFPA 1KNEA 4JI2Q 2Z4IA 1OXVA 3EFXD 1CQVA 4KK7A 1I6HB 4YCUA 4JI3Q 2VUMH 4DK3C 2BE5C 1D5MC 3AFPA 2JA6B 2Z1CA 2NTTA 1NCVA 3Q24A 4JI0L 3V2TA 1KLGD 3GTLB 1B8AA 3AB9A 1DZ1A 3DUZA 3STBC 1K0SA 1VS0A 3J7A5 3JAMc 3S15H 4RH6A 5DLQE 3R2IA 4YHHQ 3OMGA 4X65L 4IALA 1PTOB 4PZ6A 2BOSA 1TY2A 4ME5A 1HNZL 5D14A 5CV4A 2A6HC 2D62A 1SRUA 1TWCB 2WAQB 2FJ2A 2OTJA 4ULLA 3GQBA 4IUTA 2PZTA 4TVAB 3VR5A 1M4VA 5FJ8G 1SYCA 1PTOD 3A55A 5C0XI 5E4WC 1VQ6A 2A1AA 4DKAC 3S9WA 2HIVA 2CW0D 5JOBA 4L5SA 1E22A 3UE1A 1EYAA 3K7AH 2G9HD 2UU9L 4CGYB 1EIFA 1E3PA 3NELA 4DV0L 3I4NG 1UE6A 2FHTA 3RZOB 1H9SB 4BBSB 4ILWA 4GKKL 3RZDB 3DM1A 2GN5A 4MN3A 1STEA 2RHSB 3R93A 3W5OA 1ENFA 4DU9A 2MP1A 2RDHA 4R8NA 4BA2I 4IOAA 5LMUQ 2NVTB 2A68D 2P5ZX 1PHJA 3NQTA 3I56A 3CF5A 4DR2L 4CJ2C 4XTCS 1NMGA 1Z47A 4JI1L 1KC8C 3A0JA 4ZAIA 2QA4A 3S14B 5TSSA 1YVCA 2H4OA 4K2KA 1Q8IA 1NAPA 1FYCA 3I8ZA 4A93H 4IO9A 3D4DA 3GO5A 3DWPA 3U9OA 2QW7A 4WORA 1EIYB 1A62A 4FF2A 3F8TA 1VQGA 1G91A 4KV6A 2E2HH 4OXPA 4U673 3DWQA 3IKJA 5LL6S 2PZWA 4A3GG 2F0IA 4HJ8A 2M2LA 1Z6HA 1SEBD 1LTGD 2N49A 3E6ZX 4IPGA 2RF4A 3I2ZA 2IHEA 1CM9A 4ZYSA 2JA9A 1PTOF 1PXUA 1VQKA 2R92G 3PQIA 4B9WA 1N33Q 3H0GG 4TKOB 4CBVA 3QO2A 4QB4A 1Q81C 3QJYA 3H09A 1R4PB 4B3RL 1STYA 3NEMA 1FL0A 3MC0B 3OWEB 3M9BA 1EIHA 1KLUD 4RMFA 4A3GH 3LWUA 1IBLL 1SJED 1XTDA 4NXML 4QIWE 1STBA 2Z6KA 3K80C 1WTVA 4OIJA 2PQAB 4K14A 2NTSA 4JI8Q 3D4RA 5JJZA 1CKMA 2RA4A 3T53B 4BY7H 4FO2A 2QCPX 4RFBA 3HOVG 1RF2D 3ER0A 4OIKA 1YIJA 2C9OA 2G9DA 3TS0A 3K0YA 3OHXC 3FDTA 3PIOA 4DK6C 2EYMA 2GVBA 2PNRC 5HURA 4Q0FA 3E0JA 4QY7A 3SEBA 2K75A 1S4ZA 4ZLTF 3CP0A 4RCOA 1NTGA 1E0BA 1GM5A 4IUNA 5CV9A 1PA6A 2BE5D 1PFSA 1SN8A 3CCJA 2PW7A 1O7ZA 3HOWG 3STBD 2Z4HA 1W3SA 3HEJA 1X56A 1TS3A 3S24A 3SK8A 2I07B 2HHHL 2JEBI 5T1GA 2AMCB 2NBFA 5GQOA 1NY4A 3KJPA 3BG3A 1VQHA 1I3QH 2BDNA 3MWYW 2A6HD 5KGUA 5CMDA 4A3MH 3PF4A 3KF8A 3HOXG 3S1RB 1OXXK 1IBKQ 1G2TA 4CJ0B 5CV8A 4QIWB 4DUZQ 1QZGA 4IUUA 3CCMA 1ZKOA 1PTOH 2L4NA 2IY5B 1EEID 2F3WA 2CHBD 3H91A 1AP0A 1O7IA 2GVAA 3UDIA 1OXSC 3I73A 1XMOQ 1CKNA 5FLMH 4DR5L 4GN5A 1VQ7A 2PYKA 4OWWB 1JJGA 4L6TB 4NXNL 4ZRZA 3TZUA 3CMEA 4ME3A 4F87A 5JPMC 3K5OA 4B3TL 5IYCG 4NMZA 2NVYB 1R9TH 2HD3A 3C1FA 5J22A 5CV5A 5IP9H 4DV3L 2MO0A 1GUGA 4HCEA 2RHQB 3TN2A 1C48A 3KOJA 1VQCA 4DXFA 1BBUA 2X6GA 1P8LA 4K0KQ 3W1BA 4KN7C 4DAYA 1E1TA 5BN4A 2M00A 5FOBB 1FJGL 2PQEA 1II3A 1TY0A 4QGUA 5LMNQ 4A3DB 4KY7A 2AQ2B 2RBMA 3CXCA 3VYRA 2YU9H 4X64L 2R3ZA 4A3IH 3IFDA 3J80L 4LF5Q 4FXDA 4OL7A 4TSSA 4I65A 1K28A 3KF6A 1EWCA 2OEOA 3K8AA 1EQQA 4RAUC 3HOYB 1MJEA 2FMMA 3EVQA 3AU7A 5J1ZA 5C4XH 1S72A 5C3WA 4A3CG 1Z9FA 1KAWA 1AW7A 2NZOA 1K8GA 1GUOA 1D8LA 3FPPA 1JC7A 1I4RA 2O5JC 3NP8A 4X62Q 1RODA 4A3KB 3DM3A 3S1QH 1TS2A 3J81L 1AZQA 1AEXA 2LXKA 4MIUA 2JA7H 1HQMC 1TWHB 4Y7NH 2EOTA 1EWIA 1TWFB 4C3IG 4DR4Q 1HUMA 4A3FB 2WKCA 3U50C 3UI2A 4KLKA 1XPRA 3NPPA 2RSNA 2HIXA 1JOQA 1A15A 3TMEA 1HA5A 3CAMA 4BY1H 5GROA 4YWKA 4R9WA 3FKIB 1WJJA 4L63B 2OXPA 2Q2HA 4UHVA 3Q22A 1U4LA 4OEMB 1B4OA 4IOCA 2EYLA 4F7XA 1X54A 3G6JB 1RCVD 1BCPC 5KRUA 3U58A 4A76A 3ITPA 1DCZA 1H95A 3J81E 1SBBB 3CD6A 1Y1VB 1ET6A 2SNSA 1YZ6A 2R93B 1I5FA 3I4MH 2E75C 1BR9A 3CCVA 3MZ5A 2ZTCA 4X3UA 1X3PA 3S2DB 4AQYL 3DMUA 1S3OA 2F0WA 2JE6I 4MTNA 4PZ8A 3P1HA 2F0NA 1XYIA 1D2BA 5H1SE 2UUCL 2CFMA 1KRSA 3BVMA 3NTHA 4P73A 2CVRA 3CQZB 5M5YH 5E3FA 5I2XA 4LF4L 1QNUA 4OHJA 2ZXRA 3JC66 5F2DA 2KCMA 4HAEA 1A3VA 5I9OA 5HGTA 3MAQA 1A6XA 1O7LA 2UXDQ 2Z6KC 3HS0C 1BVSA 2KVMA 1JICA 5D65A 4Y52H 1GUTA 4BXXG 2K50A 4JI2L 3PUWA 1VQBA 2RVLA 2F0FA 1PLFA 2JA5G 3MXUA 1V1OA 5KNCA 4ZUJA 4PQXA 4JI3L 3HKZE 4BBRG 1AZPA 1ZEQX 5COYA 3J80i 3PO3B 5DNFA 1D6EC 1Q46A 4GS3A 1Y8OB 5I6YA 4C2MH 4HEDA 4HIKA 4YHHL 4DAVA 3J7AV 1RKNA 4XIGS 4GLXA 3GTPB 1YJNA 3FRPB 5CORA 4I7AA 1HH2P 2LFNA 5IGBA 3QG1A 1SNMA 3OTOQ 4DNIA 3WDNA 1VQFA 3PUZA 4NPSA 3HOUG 1V1PA 3CW2C 2ICEC 3CC2A 2VQFQ 1NJIC 2WP8J 5FLXL 3IFTA 4BBRH 1BDOA 4L5RC 2VUMB 3WOFA 3K5LA 4RWSC 1VQMA 1KD1C 4DR7Q 3NWSA 2BA0A 3DEPA 4KY5A 1ILPA 2KBNA 4JI6Q 1AE3A 4KI0A 2O4XA 5EPKA 3FHWA 3BYYB 4A3DH 3S15B 4DV2Q 2J4XA 1WD1A 2NYZD 3TSSA 2F0GA 4L5TA 2RQXA 1D5ZC 5LMUL 2QDBA
chains in the Genus database with same CATH topology
1YI2A 2UU9Q 1XNRQ 2YTVA 3K81C 3GTPH 4JI4Q 3GTJH 4JBWA 2D0OA 3TS2A 3AFQA 5M3FG 4DR3Q 5FLXc 3HKZG 1N32L 1TWGH 1IBML 3HKSA 1XNQQ 1PYBA 3ICEA 3D0FA 4JI2Q 3TEHB 1HJPA 1MKHA 1OXVA 3LGJA 5IWAQ 4X6AH 5ELOA 4A3CH 4YCUA 3EIVA 4JI3Q 2VUMH 2YTXA 4DK3C 1LUZA 1X3EA 3AFPA 4MZ9A 1VCIA 3T1HQ 3AEVA 5K36G 4TQUS 4EQ5A 4JI0L 1X6OA 1I94Q 1PH6A 3CCLA 1NE3A 1B8AA 5BR8Q 3STBC 4DAMA 2E2IH 2AHOB 4X66Q 4A3KH 4YY3L 1EUJA 1VS0A 2H5XA 3JAMc 4A3MG 3J7A5 3S15H 5DLQE 4LF8Q 4YHHQ 4X65L 1UE5A 5M3MG 4LF6Q 4PZ6A 4B3ML 4DPGA 1HNZL 2AWNA 1Y1WG 4C3IH 2D62A 1SRUA 1WYDA 3DLLA 2OTJA 5GAEC 1L1OB 3F2CA 4TVAB 4R4OA 3D31A 5FJ8G 3H15A 3TQYA 4POFA 4GNXA 5FLMG 5C0XI 4DR6Q 3UE0A 3W1GA 2ZTEA 2ZJQA 4R4CA 2IX0A 1VQ6A 2A1AA 4DKAC 3G6EA 4A75A 1XJVA 4A3EG 1YHQA 2HIVA 4GOPB 3S1NH 3U4ZA 1I6HH 2DGYA 3G71A 2ATWA 3M4OH 3AQQA 1A0IA 2MFIA 1N34L 1E22A 4L5SA 3UE1A 4IJLA 4YCWA 4UP9A 1Q82C 2JA6H 1KL9A 2ES2A 4A3BH 4KHPL 3K7AH 1EQRA 2UU9L 1DGSA 1XNRL 3L7ZC 5IP9G 1EIFA 1E3PA 3NELA 2MNAA 1WCMH 1UE6A 1E7ZA 4DV0L 4OX9Q 3I4NG 1Y1VH 4LW1A 3G4SA 1KRTA 3GTLH 4GKKL 1C7YA 3I7FA 2GN5A 5C0XJ 2RHSB 2XTIA 3W5OA 1X9NA 1VQOA 2CCZA 1SLJA 4JOIC 1PH9A 1XNQL 4BA2I 4C3HH 4IOAA 5LMUQ 4LUOA 1Y14B 4PZ7A 5GAGC 1SMXA 4JI8L 3I56A 2QGQA 3CF5A 4DR2L 1PHJA 1TWCH 4XTCS 1NMGA 1OXTA 1Z47A 4JI1L 4DUYL 5E7NA 1GD7A 3ULPA 1KC8C 3A0JA 4JC0A 3GTQH 1N32Q 1KIXA 2QA4A 4A3IG 2B3GA 1YVCA 1I94L 1IBMQ 5JJLA 3CMAA 3ERSX 1YEZA 5IT9c 3HOZG 2JEAI 2YTYA 3HFZB 1G291 4A93H 2Q2UA 2JK8A 4HIDA 4WJ4A 4IO9A 1QVCA 2AKWB 2CQOA 3GO5A 5C44G 4WJ3M 1YHBA 2Q2IA 2ZJPA 3EBEA 3PO2G 2OQKA 1EIYB 1A62A 1IBLQ 3F8TA 1VQGA 2YYZA 4JI0Q 3Q8DA 2EQSA 3ULLA 4OXPA 2E2HH 3GTKH 3RZOH 3S17H 5C4XG 4BBSH 3RZDH 1BBWA 4A3GG 4BXXH 4O0AA 4YY3Q 1PH7A 4HJ8A 3PF5A 4DV5L 5HY6A 4X65Q 2NVXH 1L1OA 2JA5H 4B3MQ 1HNZQ 1PH2A 2R7ZG 1K3RA 2NVTH 3J81i 2BA1A 2N49A 1P16A 4HJ7A 2YV5A 4IPGA 2RF4A 3I2ZA 4OO1G 2IHEA 1UEBA 3U4VA 1QVFA 2JA7G 2NVQH 5JEAJ 4GOPA 2OCEA 2JA9A 3L0OA 3S14H 4OWTB 2PNHA 1VQKA 2NN6G 1SFOH 5JEAG 2B63G 1N33Q 3B6YA 2R92G 5AJ3L 1FGUA 3H0GG 3F2BA 1Q12A 5J3BA 1Q7YC 1Q81C 4JCVE 1IBKL 1VQNA 2JA8H 4B3RL 2ASBA 4JYAQ 1IYJB 2UUBL 3NEMA 1FL0A 1HZ9A 3M9BA 3HOYG 2ZM6L 4B3SL 4LUZA 4KHPQ 3KF8B 1YNXA 5IYBG 4RMFA 4BY1G 4DV0Q 5IYDH 1CSQA 4A3GH 3VDYA 4GKKQ 1HR0L 1QUQB 1IBLL 1N8RC 1XMOL 1U0LA 3PCOB 4DV1L 1SE8A 3HOUH 4P71A 1XTDA 4NXML 4QIWE 2N3SA 3E0EA 4AIMA 2Z6KA 3K80C 4HJ9A 1IZ6A 4KHZA 1HR0W 2PQAB 1X3GA 1CKNB 4JI8Q 2DUDA 4DR2Q 1CKMA 3I4MG 4JI1Q 4DUYQ 1VQ5A 4BY7H 3I4OA 3F1ZA 3HOVG 2N78A 1NMFA 1L0WA 2K5NA 3UDXA 3ER0A 1YIJA 1YJWA 3J7ZC 2BH8A 4YWLA 3SGIA 2E2JH 3TS0A 1RIPA 4NXNQ 4LF9L 4A3FG 1E1OA 5JJKA 2N8NA 3BZKA 3RLNA 4AYBE 5C3EG 1TXYA 3PIOA 4DK6C 3AYHB 2GVBA 4J15A 1X3FA 2HQLA 5LMNL 1N36Q 4QY7A 2K75A 3PUVA 1JE5A 3CP0A 4DAYB 5M3FH 3S2HH 1NTGA 1OXUA 5LMNW 2VS1A 1GM5A 1JJ2A 1PA6A 5GADC 4LF5L 3PV0A 1PFSA 5GAHC 4LFBL 4RG1A 1TWAH 2VZAA 1SN8A 3CCJA 1KHIA 4DV5Q 1VQ4A 4EX5A 1QVGA 1N33L 3HOWG 4DV4L 4LF7Q 4JBMA 3STBD 2F4VL 5IP7G 1W3SA 4A4IA 2R93G 2E5LQ 4YCVA 1X56A 3S24A 2HHHL 4JYAL 2JEBI 2AMCB 5GQOA 4LNQA 2R7FA 1NY4A 1V1QA 3KJPA 2CWPA 1YBYA 1VQHA 3KF6B 1I3QH 3PUYA 1HZAA 5AJ3Q 4HIMA 1AE2A 3G48A 3T1YL 2ZTDA 4A3MH 5C3EH 5HGQA 1YJ9A 4PG3A 3RLOA 4R4TA 3HOXG 3PF4A 1OXXK 2I5HA 1IBKQ 1XPUA 1EOVA 4IPCA 3MXNB 5M3MH 1PH5A 4DUZQ 4B3RQ 4X62L 4GN3B 1QZGA 3CCMA 4DV7L 1VQDA 2UUBQ 1QUQA 1GO3E 2IY5B 1Y1WH 2ZM6Q 4B3SQ 2FXQA 2I0QA 1D7QA 3MEFA 4L5QA 2CKZB 2UXBL 1C0AA 4HJ5A 2K5VA 1O7IA 2GVAA 2PQAA 1HR0Q 3UDIA 1FVIA 2PI2E 1OXSC 2MQHA 3KLWA 5FJ8H 1CKNA 1LYLA 2KHIA 3M4QA 3WWVA 5FLMH 4DV1Q 4DR5L 3J81j 4NXMQ 4GN5A 2HT1A 4LWCA 5EAYA 1VQPA 1VQ7A 4DR4L 4R4QA 4OWWB 4NXNL 4OWXB 1JJGA 1GKHA 3NENA 3CMEA 4A3EH 4ME3A 1I50H 3S1MH 1WFQA 1IXRA 3NBHB 1K73C 4B3TL 4A3LG 4OO1I 5IYCG 2UUAL 1PVOA 1UWVA 4AYBG 1R9TH 4AH6A 2ZJRA 1N36L 2VL6A 5IP9H 2V1CC 2MO0A 4QJFA 4DV3L 2Y0SG 3I4NH 5JJIA 2NN6I 1K0RA 3CCUA 2RHQB 2ID0A 4LF9Q 1CUKA 3KOJA 1VQCA 1BBUA 1U5KA 3S1RH 1P8LA 3PO3G 4K0KQ 3W1BA 2ALYB 4LFAL 4POGA 1E1TA 4GKJL 1PH3A 1FJGL 2E8GA 4IPHA 4QGUA 5LMNQ 4LF7L 1X65A 1Q1EA 2D0PA 3IRBA 2E5LL 1K8AC 4A3DG 3CXCA 1LM0A 2YU9H 3CCSA 4HJAA 4X64L 1OTCA 1RL2A 4GN4B 4A3IH 3JAMi 4LF5Q 3M3YH 3HOZH 4LFBQ 4GNXC 3CC7A 3CCEA 2OQ0A 1UE1A 4JBJA 4DV4Q 1WOCA 2BH2A 1YITA 3KF6A 2OWOA 5C44H 2F4VQ 3K8AA 2HHHQ 4DUZL 1EQQA 4H02A 2NVYH 1MJCA 3PO2H 2F52A 1X55A 1MJEA 2WB1E 1XPOA 1M1KC 3TRZA 3GTGH 4R1JA 5C4XH 1PH8A 1S72A 4A3CG 3PUXA 1Z9FA 1KAWA 2NZOA 4DR1L 2VUMG 1K8GA 3T1YQ 1JB7A 1D8LA 1M90C 2EIFA 1UE7A 1HNWL 1G51A 3ZJYC 1QZHA 4X62Q 1EFWA 4DV7Q 2R7ZH 4IFDJ 2UXDL 3DM3A 1KXLA 3S1QH 3J80c 4A3KG 1B7YB 2VNUD 1Q8KA 1VQLA 2LXKA 1PV4A 4IFDG 2UXBQ 1BKBA 1C9OA 3KDFB 2JA7H 5ELNA 2KCTA 4Y7NH 3RN5A 2VW9A 1HNXL 1EWIA 4DR5Q 2B63H 2R92H 4DV6L 1J6QA 5M5XH 4DR4Q 3H0GH 3CPFA 4LFCL 1K9MC 1XMQL 3U50C 4JI7L 4UP7A 3PSIA 4KLKA 1XPRA 3A5UA 4K0KL 4B3TQ 2HIXA 2UUAQ 4PMWA 3HOYH 2Y0SE 2WFWA 1SR3A 1K83H 1CSPA 2R6GA 3CAMA 5IYBH 2I5LX 3KYHC 5GROA 4DV3Q 4YWKA 4BY1H 2QEXA 4JBKA 1WJJA 2Q2HA 2UXCL 2IX1A 3FKIG 3GTMH 1CKOA 3I55A 3EN2A 4IOCA 1ASYA 1G6PA 3L2PA 1X54A 1A8VA 1JJCB 3RNUA 1ASZA 3U58A 1LTLA 4A76A 3J81c 2JA6G 4A3BG 1H95A 3TREA 1A63A 3CD6A 1VQAA 3K7UC 4LFAQ 1EYGA 1WCMG 2VQEL 4GKJQ 1VQIA 1FJGQ 1Y1VG 4FDBA 1YZ6A 3OTOL 4MNOA 1L1OC 1I5FA 2IT1A 5IY0A 1W2BA 3I4MH 4UP8A 3CCVA 1WI5A 2ZTCA 3CC4A 3H3VI 1L2FA 1SROA 4NB3A 4AQYL 4A3JG 1S3OA 3HOVH 2VQFL 4X64Q 2JE6I 1TWHH 4MTNA 4OONA 1XMOQ 2AWOA 1Q1BA 2JJQA 4PZ8A 1TWFH 1PYSB 4GOPC 4JV5L 2WB1G 3OYYA 2WAQG 1GVPA 5H1SE 3CCRA 4A3FH 1N9WA 2IHFA 2K5HA 3A5ZB 2UUCL 4DR7L 2CFMA 1KRSA 3UDGA 1PH1A 3K0XA 1J5EQ 3GDEA 2PMZE 5IE8A 4P73A 4JI6L 3BZCA 4JI5L 3KJOA 5M5YH 4GLVB 2PI2A 4LF4L 1B70B 4A93G 4DV2L 2MO1A 2RCNA 3FKIH 4BA1I 1IL2A 1Q86C 3RR5A 4DR1Q 3BJUA 2K4KA 2LSSA 3JC66 4UPAA 2KCMA 1HNWQ 4JI4L 2XGTA 1KQSA 3RLFA 3HOWH 3KDFA 4C3JH 2K52A 3KFUA 2B29A 2Z6KC 2UXDQ 4BBSG 1BVSA 4DR3L 5IP7H 2R93H 4Y52H 4BXXG 2KHJA 2K50A 3FP9A 3E9IA 4A3JH 2I5MX 4ALPA 1PH4A 2OTLA 1HZBA 4JI2L 2CWAA 5C0XG 4QL5A 3PUWA 3M85A 3S2DH 5IWAL 4QQBX 4O2DA 1VQBA 2JA5G 1VQJA 1HNXQ 3PIPA 3E9HA 4DV6Q 4JI3L 3HKZE 4BBRG 3F2DA 2KENA 4LFCQ 1VQEA 1XMQQ 4JI7Q 1V9PA 3J80i 3HOXH 3BU2A 3T1HL 1VQ9A 2Z0SA 4GLAC 1Q46A 3GD7A 3A74A 4GS3A 3UDFA 5BR8L 4X66L 2VY3A 3CQZH 1E24A 3CPWA 4HIOA 4C2MH 4LF8L 5C4JH 4LUVA 4YHHL 4HIKA 3H3VH 2JA8G 1JMCA 2UXCQ 4LF6L 3PGZA 4P74A 4APVA 4XIGS 2C35B 2L15A 2K14A 1V43A 4GLXA 1YJNA 5M5WH 2R7DA 1HH2P 5IYDG 1S40A 2EXDA 2VQEQ 2Q2TA 3OTOQ 4DNIA 4A3LH 4IFDI 4P75A 4DR6L 1J5EL 5IYCH 1VQFA 3PUZA 4NPSA 3HOUG 1YHAA 3CW2C 4YWMA 1JT8A 4AQYQ 3RN2A 3CC2A 4R4IA 2VQFQ 1NJIC 2WP8J 4UY8C 2WAQE 4GNXB 3ULJA 4BBRH 4L5RC 1NBWA 4JV5Q 1VQ8A 2NZHA 3M4PA 1VQMA 1HZCA 1KD1C 2UUCQ 3GTOH 4BY7G 4DR7Q 2BA0A 3OW2A 4IJHA 3PO3H 1T9HA 2A19A 2KBNA 4OX9L 4JG2A 2JQOA 4JI6Q 1AE3A 4KI0A 4JI5Q 2A8VA 1AH9A 3CCQA 2LXJA 4JOIA 3FHWA 4LF4Q 4A3DH 4DV2Q 3S16H 4P72A 1N34Q 1MIUA 4L5TA 2F3IA 5LMUL 3M7NA 4IPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 A;  2UU9 Q;  1XNR Q;  2YTV A;  3K81 C;  3GTP H;  4JI4 Q;  3GTJ H;  4JBW A;  2D0O A;  3TS2 A;  3AFQ A;  5M3F G;  4DR3 Q;  5FLX c;  3HKZ G;  1N32 L;  1TWG H;  1IBM L;  3HKS A;  1XNQ Q;  1PYB A;  3ICE A;  3D0F A;  4JI2 Q;  3TEH B;  1HJP A;  1MKH A;  1OXV A;  3LGJ A;  5IWA Q;  4X6A H;  5ELO A;  4A3C H;  4YCU A;  3EIV A;  4JI3 Q;  2VUM H;  2YTX A;  4DK3 C;  1LUZ A;  1X3E A;  3AFP A;  4MZ9 A;  1VCI A;  3T1H Q;  3AEV A;  5K36 G;  4TQU S;  4EQ5 A;  4JI0 L;  1X6O A;  1I94 Q;  1PH6 A;  3CCL A;  1NE3 A;  1B8A A;  5BR8 Q;  3STB C;  4DAM A;  2E2I H;  2AHO B;  4X66 Q;  4A3K H;  4YY3 L;  1EUJ A;  1VS0 A;  2H5X A;  3JAM c;  4A3M G;  3J7A 5;  3S15 H;  5DLQ E;  4LF8 Q;  4YHH Q;  4X65 L;  1UE5 A;  5M3M G;  4LF6 Q;  4PZ6 A;  4B3M L;  4DPG A;  1HNZ L;  2AWN A;  1Y1W G;  4C3I H;  2D62 A;  1SRU A;  1WYD A;  3DLL A;  2OTJ A;  5GAE C;  1L1O B;  3F2C A;  4TVA B;  4R4O A;  3D31 A;  5FJ8 G;  3H15 A;  3TQY A;  4POF A;  4GNX A;  5FLM G;  5C0X I;  4DR6 Q;  3UE0 A;  3W1G A;  2ZTE A;  2ZJQ A;  4R4C A;  2IX0 A;  1VQ6 A;  2A1A A;  4DKA C;  3G6E A;  4A75 A;  1XJV A;  4A3E G;  1YHQ A;  2HIV A;  4GOP B;  3S1N H;  3U4Z A;  1I6H H;  2DGY A;  3G71 A;  2ATW A;  3M4O H;  3AQQ A;  1A0I A;  2MFI A;  1N34 L;  1E22 A;  4L5S A;  3UE1 A;  4IJL A;  4YCW A;  4UP9 A;  1Q82 C;  2JA6 H;  1KL9 A;  2ES2 A;  4A3B H;  4KHP L;  3K7A H;  1EQR A;  2UU9 L;  1DGS A;  1XNR L;  3L7Z C;  5IP9 G;  1EIF A;  1E3P A;  3NEL A;  2MNA A;  1WCM H;  1UE6 A;  1E7Z A;  4DV0 L;  4OX9 Q;  3I4N G;  1Y1V H;  4LW1 A;  3G4S A;  1KRT A;  3GTL H;  4GKK L;  1C7Y A;  3I7F A;  2GN5 A;  5C0X J;  2RHS B;  2XTI A;  3W5O A;  1X9N A;  1VQO A;  2CCZ A;  1SLJ A;  4JOI C;  1PH9 A;  1XNQ L;  4BA2 I;  4C3H H;  4IOA A;  5LMU Q;  4LUO A;  1Y14 B;  4PZ7 A;  5GAG C;  1SMX A;  4JI8 L;  3I56 A;  2QGQ A;  3CF5 A;  4DR2 L;  1PHJ A;  1TWC H;  4XTC S;  1NMG A;  1OXT A;  1Z47 A;  4JI1 L;  4DUY L;  5E7N A;  1GD7 A;  3ULP A;  1KC8 C;  3A0J A;  4JC0 A;  3GTQ H;  1N32 Q;  1KIX A;  2QA4 A;  4A3I G;  2B3G A;  1YVC A;  1I94 L;  1IBM Q;  5JJL A;  3CMA A;  3ERS X;  1YEZ A;  5IT9 c;  3HOZ G;  2JEA I;  2YTY A;  3HFZ B;  1G29 1;  4A93 H;  2Q2U A;  2JK8 A;  4HID A;  4WJ4 A;  4IO9 A;  1QVC A;  2AKW B;  2CQO A;  3GO5 A;  5C44 G;  4WJ3 M;  1YHB A;  2Q2I A;  2ZJP A;  3EBE A;  3PO2 G;  2OQK A;  1EIY B;  1A62 A;  1IBL Q;  3F8T A;  1VQG A;  2YYZ A;  4JI0 Q;  3Q8D A;  2EQS A;  3ULL A;  4OXP A;  2E2H H;  3GTK H;  3RZO H;  3S17 H;  5C4X G;  4BBS H;  3RZD H;  1BBW A;  4A3G G;  4BXX H;  4O0A A;  4YY3 Q;  1PH7 A;  4HJ8 A;  3PF5 A;  4DV5 L;  5HY6 A;  4X65 Q;  2NVX H;  1L1O A;  2JA5 H;  4B3M Q;  1HNZ Q;  1PH2 A;  2R7Z G;  1K3R A;  2NVT H;  3J81 i;  2BA1 A;  2N49 A;  1P16 A;  4HJ7 A;  2YV5 A;  4IPG A;  2RF4 A;  3I2Z A;  4OO1 G;  2IHE A;  1UEB A;  3U4V A;  1QVF A;  2JA7 G;  2NVQ H;  5JEA J;  4GOP A;  2OCE A;  2JA9 A;  3L0O A;  3S14 H;  4OWT B;  2PNH A;  1VQK A;  2NN6 G;  1SFO H;  5JEA G;  2B63 G;  1N33 Q;  3B6Y A;  2R92 G;  5AJ3 L;  1FGU A;  3H0G G;  3F2B A;  1Q12 A;  5J3B A;  1Q7Y C;  1Q81 C;  4JCV E;  1IBK L;  1VQN A;  2JA8 H;  4B3R L;  2ASB A;  4JYA Q;  1IYJ B;  2UUB L;  3NEM A;  1FL0 A;  1HZ9 A;  3M9B A;  3HOY G;  2ZM6 L;  4B3S L;  4LUZ A;  4KHP Q;  3KF8 B;  1YNX A;  5IYB G;  4RMF A;  4BY1 G;  4DV0 Q;  5IYD H;  1CSQ A;  4A3G H;  3VDY A;  4GKK Q;  1HR0 L;  1QUQ B;  1IBL L;  1N8R C;  1XMO L;  1U0L A;  3PCO B;  4DV1 L;  1SE8 A;  3HOU H;  4P71 A;  1XTD A;  4NXM L;  4QIW E;  2N3S A;  3E0E A;  4AIM A;  2Z6K A;  3K80 C;  4HJ9 A;  1IZ6 A;  4KHZ A;  1HR0 W;  2PQA B;  1X3G A;  1CKN B;  4JI8 Q;  2DUD A;  4DR2 Q;  1CKM A;  3I4M G;  4JI1 Q;  4DUY Q;  1VQ5 A;  4BY7 H;  3I4O A;  3F1Z A;  3HOV G;  2N78 A;  1NMF A;  1L0W A;  2K5N A;  3UDX A;  3ER0 A;  1YIJ A;  1YJW A;  3J7Z C;  2BH8 A;  4YWL A;  3SGI A;  2E2J H;  3TS0 A;  1RIP A;  4NXN Q;  4LF9 L;  4A3F G;  1E1O A;  5JJK A;  2N8N A;  3BZK A;  3RLN A;  4AYB E;  5C3E G;  1TXY A;  3PIO A;  4DK6 C;  3AYH B;  2GVB A;  4J15 A;  1X3F A;  2HQL A;  5LMN L;  1N36 Q;  4QY7 A;  2K75 A;  3PUV A;  1JE5 A;  3CP0 A;  4DAY B;  5M3F H;  3S2H H;  1NTG A;  1OXU A;  5LMN W;  2VS1 A;  1GM5 A;  1JJ2 A;  1PA6 A;  5GAD C;  4LF5 L;  3PV0 A;  1PFS A;  5GAH C;  4LFB L;  4RG1 A;  1TWA H;  2VZA A;  1SN8 A;  3CCJ A;  1KHI A;  4DV5 Q;  1VQ4 A;  4EX5 A;  1QVG A;  1N33 L;  3HOW G;  4DV4 L;  4LF7 Q;  4JBM A;  3STB D;  2F4V L;  5IP7 G;  1W3S A;  4A4I A;  2R93 G;  2E5L Q;  4YCV A;  1X56 A;  3S24 A;  2HHH L;  4JYA L;  2JEB I;  2AMC B;  5GQO A;  4LNQ A;  2R7F A;  1NY4 A;  1V1Q A;  3KJP A;  2CWP A;  1YBY A;  1VQH A;  3KF6 B;  1I3Q H;  3PUY A;  1HZA A;  5AJ3 Q;  4HIM A;  1AE2 A;  3G48 A;  3T1Y L;  2ZTD A;  4A3M H;  5C3E H;  5HGQ A;  1YJ9 A;  4PG3 A;  3RLO A;  4R4T A;  3HOX G;  3PF4 A;  1OXX K;  2I5H A;  1IBK Q;  1XPU A;  1EOV A;  4IPC A;  3MXN B;  5M3M H;  1PH5 A;  4DUZ Q;  4B3R Q;  4X62 L;  4GN3 B;  1QZG A;  3CCM A;  4DV7 L;  1VQD A;  2UUB Q;  1QUQ A;  1GO3 E;  2IY5 B;  1Y1W H;  2ZM6 Q;  4B3S Q;  2FXQ A;  2I0Q A;  1D7Q A;  3MEF A;  4L5Q A;  2CKZ B;  2UXB L;  1C0A A;  4HJ5 A;  2K5V A;  1O7I A;  2GVA A;  2PQA A;  1HR0 Q;  3UDI A;  1FVI A;  2PI2 E;  1OXS C;  2MQH A;  3KLW A;  5FJ8 H;  1CKN A;  1LYL A;  2KHI A;  3M4Q A;  3WWV A;  5FLM H;  4DV1 Q;  4DR5 L;  3J81 j;  4NXM Q;  4GN5 A;  2HT1 A;  4LWC A;  5EAY A;  1VQP A;  1VQ7 A;  4DR4 L;  4R4Q A;  4OWW B;  4NXN L;  4OWX B;  1JJG A;  1GKH A;  3NEN A;  3CME A;  4A3E H;  4ME3 A;  1I50 H;  3S1M H;  1WFQ A;  1IXR A;  3NBH B;  1K73 C;  4B3T L;  4A3L G;  4OO1 I;  5IYC G;  2UUA L;  1PVO A;  1UWV A;  4AYB G;  1R9T H;  4AH6 A;  2ZJR A;  1N36 L;  2VL6 A;  5IP9 H;  2V1C C;  2MO0 A;  4QJF A;  4DV3 L;  2Y0S G;  3I4N H;  5JJI A;  2NN6 I;  1K0R A;  3CCU A;  2RHQ B;  2ID0 A;  4LF9 Q;  1CUK A;  3KOJ A;  1VQC A;  1BBU A;  1U5K A;  3S1R H;  1P8L A;  3PO3 G;  4K0K Q;  3W1B A;  2ALY B;  4LFA L;  4POG A;  1E1T A;  4GKJ L;  1PH3 A;  1FJG L;  2E8G A;  4IPH A;  4QGU A;  5LMN Q;  4LF7 L;  1X65 A;  1Q1E A;  2D0P A;  3IRB A;  2E5L L;  1K8A C;  4A3D G;  3CXC A;  1LM0 A;  2YU9 H;  3CCS A;  4HJA A;  4X64 L;  1OTC A;  1RL2 A;  4GN4 B;  4A3I H;  3JAM i;  4LF5 Q;  3M3Y H;  3HOZ H;  4LFB Q;  4GNX C;  3CC7 A;  3CCE A;  2OQ0 A;  1UE1 A;  4JBJ A;  4DV4 Q;  1WOC A;  2BH2 A;  1YIT A;  3KF6 A;  2OWO A;  5C44 H;  2F4V Q;  3K8A A;  2HHH Q;  4DUZ L;  1EQQ A;  4H02 A;  2NVY H;  1MJC A;  3PO2 H;  2F52 A;  1X55 A;  1MJE A;  2WB1 E;  1XPO A;  1M1K C;  3TRZ A;  3GTG H;  4R1J A;  5C4X H;  1PH8 A;  1S72 A;  4A3C G;  3PUX A;  1Z9F A;  1KAW A;  2NZO A;  4DR1 L;  2VUM G;  1K8G A;  3T1Y Q;  1JB7 A;  1D8L A;  1M90 C;  2EIF A;  1UE7 A;  1HNW L;  1G51 A;  3ZJY C;  1QZH A;  4X62 Q;  1EFW A;  4DV7 Q;  2R7Z H;  4IFD J;  2UXD L;  3DM3 A;  1KXL A;  3S1Q H;  3J80 c;  4A3K G;  1B7Y B;  2VNU D;  1Q8K A;  1VQL A;  2LXK A;  1PV4 A;  4IFD G;  2UXB Q;  1BKB A;  1C9O A;  3KDF B;  2JA7 H;  5ELN A;  2KCT A;  4Y7N H;  3RN5 A;  2VW9 A;  1HNX L;  1EWI A;  4DR5 Q;  2B63 H;  2R92 H;  4DV6 L;  1J6Q A;  5M5X H;  4DR4 Q;  3H0G H;  3CPF A;  4LFC L;  1K9M C;  1XMQ L;  3U50 C;  4JI7 L;  4UP7 A;  3PSI A;  4KLK A;  1XPR A;  3A5U A;  4K0K L;  4B3T Q;  2HIX A;  2UUA Q;  4PMW A;  3HOY H;  2Y0S E;  2WFW A;  1SR3 A;  1K83 H;  1CSP A;  2R6G A;  3CAM A;  5IYB H;  2I5L X;  3KYH C;  5GRO A;  4DV3 Q;  4YWK A;  4BY1 H;  2QEX A;  4JBK A;  1WJJ A;  2Q2H A;  2UXC L;  2IX1 A;  3FKI G;  3GTM H;  1CKO A;  3I55 A;  3EN2 A;  4IOC A;  1ASY A;  1G6P A;  3L2P A;  1X54 A;  1A8V A;  1JJC B;  3RNU A;  1ASZ A;  3U58 A;  1LTL A;  4A76 A;  3J81 c;  2JA6 G;  4A3B G;  1H95 A;  3TRE A;  1A63 A;  3CD6 A;  1VQA A;  3K7U C;  4LFA Q;  1EYG A;  1WCM G;  2VQE L;  4GKJ Q;  1VQI A;  1FJG Q;  1Y1V G;  4FDB A;  1YZ6 A;  3OTO L;  4MNO A;  1L1O C;  1I5F A;  2IT1 A;  5IY0 A;  1W2B A;  3I4M H;  4UP8 A;  3CCV A;  1WI5 A;  2ZTC A;  3CC4 A;  3H3V I;  1L2F A;  1SRO A;  4NB3 A;  4AQY L;  4A3J G;  1S3O A;  3HOV H;  2VQF L;  4X64 Q;  2JE6 I;  1TWH H;  4MTN A;  4OON A;  1XMO Q;  2AWO A;  1Q1B A;  2JJQ A;  4PZ8 A;  1TWF H;  1PYS B;  4GOP C;  4JV5 L;  2WB1 G;  3OYY A;  2WAQ G;  1GVP A;  5H1S E;  3CCR A;  4A3F H;  1N9W A;  2IHF A;  2K5H A;  3A5Z B;  2UUC L;  4DR7 L;  2CFM A;  1KRS A;  3UDG A;  1PH1 A;  3K0X A;  1J5E Q;  3GDE A;  2PMZ E;  5IE8 A;  4P73 A;  4JI6 L;  3BZC A;  4JI5 L;  3KJO A;  5M5Y H;  4GLV B;  2PI2 A;  4LF4 L;  1B70 B;  4A93 G;  4DV2 L;  2MO1 A;  2RCN A;  3FKI H;  4BA1 I;  1IL2 A;  1Q86 C;  3RR5 A;  4DR1 Q;  3BJU A;  2K4K A;  2LSS A;  3JC6 6;  4UPA A;  2KCM A;  1HNW Q;  4JI4 L;  2XGT A;  1KQS A;  3RLF A;  3HOW H;  3KDF A;  4C3J H;  2K52 A;  3KFU A;  2B29 A;  2Z6K C;  2UXD Q;  4BBS G;  1BVS A;  4DR3 L;  5IP7 H;  2R93 H;  4Y52 H;  4BXX G;  2KHJ A;  2K50 A;  3FP9 A;  3E9I A;  4A3J H;  2I5M X;  4ALP A;  1PH4 A;  2OTL A;  1HZB A;  4JI2 L;  2CWA A;  5C0X G;  4QL5 A;  3PUW A;  3M85 A;  3S2D H;  5IWA L;  4QQB X;  4O2D A;  1VQB A;  2JA5 G;  1VQJ A;  1HNX Q;  3PIP A;  3E9H A;  4DV6 Q;  4JI3 L;  3HKZ E;  4BBR G;  3F2D A;  2KEN A;  4LFC Q;  1VQE A;  1XMQ Q;  4JI7 Q;  1V9P A;  3J80 i;  3HOX H;  3BU2 A;  3T1H L;  1VQ9 A;  2Z0S A;  4GLA C;  1Q46 A;  3GD7 A;  3A74 A;  4GS3 A;  3UDF A;  5BR8 L;  4X66 L;  2VY3 A;  3CQZ H;  1E24 A;  3CPW A;  4HIO A;  4C2M H;  4LF8 L;  5C4J H;  4LUV A;  4YHH L;  4HIK A;  3H3V H;  2JA8 G;  1JMC A;  2UXC Q;  4LF6 L;  3PGZ A;  4P74 A;  4APV A;  4XIG S;  2C35 B;  2L15 A;  2K14 A;  1V43 A;  4GLX A;  1YJN A;  5M5W H;  2R7D A;  1HH2 P;  5IYD G;  1S40 A;  2EXD A;  2VQE Q;  2Q2T A;  3OTO Q;  4DNI A;  4A3L H;  4IFD I;  4P75 A;  4DR6 L;  1J5E L;  5IYC H;  1VQF A;  3PUZ A;  4NPS A;  3HOU G;  1YHA A;  3CW2 C;  4YWM A;  1JT8 A;  4AQY Q;  3RN2 A;  3CC2 A;  4R4I A;  2VQF Q;  1NJI C;  2WP8 J;  4UY8 C;  2WAQ E;  4GNX B;  3ULJ A;  4BBR H;  4L5R C;  1NBW A;  4JV5 Q;  1VQ8 A;  2NZH A;  3M4P A;  1VQM A;  1HZC A;  1KD1 C;  2UUC Q;  3GTO H;  4BY7 G;  4DR7 Q;  2BA0 A;  3OW2 A;  4IJH A;  3PO3 H;  1T9H A;  2A19 A;  2KBN A;  4OX9 L;  4JG2 A;  2JQO A;  4JI6 Q;  1AE3 A;  4KI0 A;  4JI5 Q;  2A8V A;  1AH9 A;  3CCQ A;  2LXJ A;  4JOI A;  3FHW A;  4LF4 Q;  4A3D H;  4DV2 Q;  3S16 H;  4P72 A;  1N34 Q;  1MIU A;  4L5T A;  2F3I A;  5LMU L;  3M7N A;  4IPD A; 
#chains in the Genus database with same CATH topology
 1IKL A;  1XNR Q;  3K81 C;  4JBW A;  2D0O A;  5M3F B;  3HKZ B;  4JW0 A;  5JVH 3;  4IZ8 A;  4DR3 Q;  3VYT A;  1TWG H;  5FLX E;  3MFG A;  4H13 C;  5T1I A;  2WII B;  1HJP A;  3LGJ A;  1F77 A;  1GHJ A;  3K7A B;  5K36 G;  3AEV A;  3VYS A;  1X6O A;  1UUP A;  2B8G A;  1PH6 A;  3GV3 A;  1NE3 A;  4ZQ3 A;  5BR8 Q;  4DAM A;  2AHO B;  3IL8 A;  4A3K H;  2SEB D;  2MPM A;  1UE5 A;  1FD7 D;  5M3M G;  4LF6 Q;  1LT3 D;  1IKM A;  1B50 A;  1Y1W G;  3KLS X;  1WYD A;  1QB5 D;  3DLL A;  1Y69 U;  5IGE A;  5GAE C;  1KNA A;  1HXY D;  4R4O A;  4DR6 Q;  2XVS A;  3TQY A;  4DK0 A;  1BCP D;  3UE0 A;  2ZTE A;  1VF7 A;  2XIW A;  3G6E A;  1XJV A;  5M9O A;  3U4Z A;  2DGY A;  3M4O H;  1N34 L;  1A0I A;  2MFI A;  3QOL A;  5C4H A;  4YCW A;  3HGB A;  1KL9 A;  2JSO A;  1D1I A;  3DHQ A;  4IUQ A;  1EQR A;  4A3B H;  4NW2 A;  1DGS A;  2MNA A;  1SDF A;  1WCM H;  4OX9 Q;  1Y1V H;  1IYV A;  1C7Y A;  1EZ6 A;  2CH4 W;  5LHY 1;  1WD0 A;  5C0X J;  5IGC A;  4H7B A;  3HRZ C;  5BN5 A;  5GAG C;  4JI8 L;  1OXT A;  1GD7 A;  3ULP A;  1QOH A;  3MXG A;  1EIG A;  2B3G A;  1IBM Q;  1I94 L;  1YNJ C;  5JJL A;  5IT9 c;  2XNA C;  2K6A A;  2JEA I;  3HOZ G;  2YTY A;  3HFZ B;  2Q2U A;  3TP8 A;  2NB0 A;  2AKW B;  2CQO A;  4WJ3 M;  4K5W A;  2SDF A;  3PMF A;  3PO2 G;  1EYD A;  4XDX A;  2DNC A;  5A2Q L;  3GTK H;  2F0Q A;  4RCN A;  1H9M A;  4A3G B;  2PZU A;  1BBW A;  5ELC A;  5ELE A;  1AN8 A;  2OT2 A;  4O0A A;  3BDC A;  1WTP A;  2IJ0 A;  5C0X H;  1L1O A;  4V0B A;  1FR3 A;  4B3M Q;  1WTO A;  2R7Z G;  1K3R A;  4XT3 B;  2BA1 A;  2YV5 A;  2IX3 A;  4FVM A;  4BY7 B;  5EGT A;  1UEB A;  3U4V A;  1QVF A;  2NVQ H;  1MD2 D;  3L0O A;  2L55 A;  5M5X B;  2B63 G;  1SFO H;  2EVB A;  3B6Y A;  2ZXO A;  1Q12 A;  4OGQ C;  3KBG A;  1IBK L;  1B53 A;  1VQN A;  2JA8 H;  2ASB A;  1HZ9 A;  4LUZ A;  4KHP Q;  3KF8 B;  1YNX A;  5IYB G;  1EL0 A;  1F2M A;  1CSQ A;  2EDG A;  2KHS A;  4DXG A;  1N8R C;  2HCC A;  3OIQ A;  1XMO L;  3FMC A;  1JR0 D;  5C6A A;  1SE8 A;  2XWB B;  2N3S A;  3E0E A;  2FIN B;  4AIM A;  4HJ9 A;  1STN A;  1WTW A;  1SNC A;  4G7O C;  1F2Z A;  2K33 A;  1BNZ A;  2WIN B;  1CKN B;  2DUD A;  2K01 A;  1PFN A;  4DN4 M;  1E2V A;  2B2T C;  4HCS A;  1HFG A;  2E74 C;  1NMF A;  1I3Q B;  1L0W A;  1YJW A;  3J7Z C;  2E2J H;  4YWL A;  4A3M B;  1E1O A;  5JJK A;  2N8N A;  5KND A;  5CC4 A;  3AYH B;  2XRQ D;  1X3F A;  2HQL A;  4EQN A;  5LMN L;  1N36 Q;  4GZY C;  5C5M A;  4CDF C;  4DAY B;  3BZD B;  1U9R A;  1CHP D;  5M3F H;  3S2H H;  5LMN W;  2F0K A;  1S5E D;  2O2L D;  2VS1 A;  2A6E C;  5DM6 3;  4LF5 L;  3ERQ A;  4ZKC B;  3Q23 A;  2VZA A;  4B9X A;  2L0C A;  3HOW B;  1FNW A;  1KHI A;  4S3S A;  4DV5 Q;  2EY2 A;  4C3J G;  4LF7 Q;  4JBM A;  5IP7 G;  4JYA L;  4QMG A;  1R9T B;  1BBX C;  4LNQ A;  1YBY A;  2LY7 A;  3KF6 B;  1D5X C;  4PG3 A;  3RLO A;  5C5L A;  1PH5 A;  4X62 L;  4GN3 B;  4HR7 B;  5E4X A;  1VQD A;  1QUQ A;  2ZM6 Q;  3QR8 A;  1B44 D;  2E76 C;  4L5Q A;  1EY8 A;  2YU9 B;  2HQE A;  2Z9H A;  1DD2 A;  4A3I B;  1FVI A;  3KLW A;  2MQH A;  5FJ8 H;  4QCL A;  3WWV A;  4C56 C;  4DR4 L;  1WTQ A;  1WTX A;  4OWX B;  1GKH A;  1I50 H;  3VR2 A;  1IXR A;  1K73 C;  5I9P A;  4MHE A;  4CJ1 B;  4WFN 3;  2B2W C;  2EY6 A;  4AYB G;  4AH6 A;  2V1C C;  4QJF A;  3I4N H;  4E6I A;  1JQY D;  5C4X B;  1K0R A;  3KUP A;  4LF9 Q;  1U5K A;  3RUZ A;  2ALY B;  4POG A;  1YNJ D;  1STH A;  1SYD A;  2E8G A;  3S1Q B;  2E5L L;  1F9P A;  4CDE C;  1I4X A;  3BDO A;  2JA7 B;  4Y7N B;  4GN4 B;  1EY4 A;  4ODG A;  2MGS A;  3M3Y H;  5EKL A;  1ESR A;  3CC7 A;  3CCE A;  2B8F A;  4O42 A;  1YIT A;  5FK9 C;  1MSH A;  2OWO A;  4XQN A;  4BY1 B;  1XPO A;  3LX0 A;  3OMC A;  2L9H A;  3PUX A;  4RGT A;  3R8B A;  3QB3 A;  1JB7 A;  2EPB A;  3M7G A;  3A54 A;  4FNF A;  2UXD L;  5IGD A;  5FKA C;  1SE2 A;  3NBI A;  3I4M B;  1W6J A;  3V96 A;  2VNU D;  3LNN A;  1GUS A;  1C9O A;  1J8I A;  1BF4 A;  3T13 A;  3RN5 A;  4C3I B;  4K8J A;  2R92 H;  1ESF A;  5M5X H;  3H0G H;  1K9M C;  1K3B C;  2AUJ D;  1S5D D;  4UP7 A;  5CGK A;  5CR3 A;  1GUN A;  1DJR D;  2K32 A;  5EPJ A;  2UUA Q;  2Y0S E;  1SR3 A;  1J9O A;  5M5Y B;  3S1N B;  4JBK A;  5KEE A;  4DNT B;  2KQ3 A;  3GTM H;  3I55 A;  1ASY A;  1A8V A;  1JJC B;  2RDF A;  1ASZ A;  1LV9 A;  1LTL A;  2JA6 G;  3K7U C;  1Y8N B;  1DM0 B;  1VQI A;  2QIL A;  3OTO L;  2F3V A;  1L1O C;  1W2B A;  1WI5 A;  3H3V I;  2EJF C;  3TP6 A;  3HOV H;  1UNS A;  2VQF L;  2AWO A;  1QG7 A;  1SNO A;  1V1P B;  2Q2T A;  2WAQ G;  1GVP A;  3CCR A;  1DON A;  3O13 A;  1N9W A;  2K5H A;  4DR7 L;  2ICI A;  4ZCK A;  4DF7 A;  2A6E D;  2IW3 A;  1TS4 A;  2I46 A;  4PMB A;  4JI6 L;  3BZC A;  3KJO A;  4XQJ A;  4ZUI A;  4GLV B;  2PI2 A;  1B70 B;  1EQV A;  4C2M B;  4DV2 L;  2MO1 A;  1RD9 D;  4CKE A;  2ENB A;  3PIP 3;  4BA1 I;  1IL2 A;  1Q86 C;  3NK9 A;  2K4K A;  1PRT C;  2LSS A;  3BJU A;  5I4D A;  3KLR A;  1SSO A;  1KQS A;  1LTT D;  4WJW A;  3HOW H;  2B29 A;  4BBS G;  4DR3 L;  5JAV A;  1QNK A;  1XTC D;  2NVX B;  1ET9 A;  4QL5 A;  3M85 A;  4QQB X;  2Y0S B;  2ZXP A;  1VQJ A;  3U9S A;  4BBR B;  3EQL C;  3VR3 A;  1XMQ Q;  4JI7 Q;  1VQ9 A;  3HOX H;  4L8J A;  3A74 A;  4M1U B;  5IT9 E;  5BR8 L;  1S5B D;  1V8Q A;  3I70 A;  3G7L A;  1RTN A;  4K6D A;  4LJZ C;  3OSO A;  4LF6 L;  2F0L A;  1JWU D;  3CU7 A;  4APV A;  3L3O C;  2V4D A;  2A74 C;  4N8F A;  5M5W H;  3V05 A;  5IYD G;  2KCC A;  1L0X B;  1TWG B;  4DR6 L;  1J5E L;  5IYC H;  1VF5 C;  1W6K A;  4DGZ A;  3D6W A;  3NQI A;  1TQO A;  4R4I A;  2KOL A;  3ULJ A;  2K1B A;  1IYU A;  2DJG C;  3GTO H;  2C5C A;  2A19 A;  4IUV A;  3BVZ A;  4OX9 L;  1EQT A;  4DA2 A;  4JI5 Q;  3CCQ A;  1F2Y A;  4RHS A;  1STA A;  1MIU A;  4KKS A;  4X3S A;  4M8A A;  3ND8 A;  4H44 C;  1H9K A;  2UU9 Q;  3JAM L;  4JI4 Q;  3N52 A;  3GTJ H;  3OW7 A;  2F0T A;  5A35 A;  5I6W A;  3F2U A;  3C1E A;  1IBM L;  2GA4 B;  3HKS A;  1T5X D;  3PIO 3;  3ZYY X;  3ICE A;  3D0F A;  2L11 A;  5IWA Q;  3SK6 A;  2EYF A;  3CRL C;  5ELO A;  4A3C H;  3M4O B;  4NDX A;  4PMC A;  3EIV A;  3NHH A;  4G7H C;  4A3B B;  1VCI A;  2F0S A;  1WCM B;  5EQ0 A;  2E2I H;  1HTP A;  3URY A;  3JAM E;  1EY5 A;  1B3Q A;  2XRS D;  5FO7 B;  4B3M L;  4DPG A;  1Y1W B;  4C3H G;  4C3I H;  5JVG 3;  1A3T A;  2HCI A;  1NSN S;  2NZ1 D;  1L1O B;  3BVG A;  3D31 A;  2JP1 A;  2IX0 A;  1MGS A;  3OIP A;  4A3E G;  3S1N H;  2ATW A;  3D4W A;  1ZYR C;  4IJL A;  1KAA A;  2ES2 A;  4KHP L;  2MUY A;  4RGN A;  3GTK B;  1E7Z A;  4H0L C;  4LW1 A;  4CKB A;  3H3V C;  2PO4 A;  5KNB A;  3I7F A;  4HMJ A;  1DXM A;  1ENA A;  1X9N A;  1SLJ A;  1XNQ L;  1GHK A;  1XWE A;  4C3H H;  4XYO A;  4LUO A;  4PZ7 A;  1I4P A;  2QGQ A;  2B2T A;  4RA8 A;  3MVV A;  1X32 A;  3GTQ H;  2NVQ B;  1N32 Q;  1B1Z A;  1PRT D;  1LTI D;  2KUM A;  1SFO B;  4NP5 A;  1A2T A;  1CK1 A;  3I90 A;  4HID A;  2F0D A;  1EY7 A;  1QVC A;  2JA8 B;  5C44 G;  2AQ3 B;  1CZG A;  4HSV A;  3I91 A;  1C8C A;  3GTG B;  3QWN A;  4X3T A;  2YYZ A;  3Q8D A;  2EQS A;  3ULL A;  3S17 H;  1LAB A;  5EBD A;  4DAP A;  4BXX H;  4YY3 Q;  1EY9 A;  1PH7 A;  3D3R A;  2WAC A;  4DV5 L;  2NVX H;  2R7Z B;  2XWJ B;  5IGG A;  2JA5 H;  3QOJ A;  1PH2 A;  4QUF A;  3J81 i;  1UEA B;  4G4K A;  1F9S A;  1P16 A;  4HJ7 A;  1WTH A;  2EE1 A;  4OO1 G;  2DJF C;  3R3O A;  5JEA J;  4GOP A;  1A2U A;  3D8G A;  5DEH A;  2OCE A;  2IL8 A;  5CBA E;  2E2J B;  4OWT B;  2PNH A;  2NN6 G;  5JEA G;  1FGU A;  2J0T D;  3F2B A;  1LTA D;  5J3B A;  1Q7Y C;  4JCV E;  5J39 A;  1VMP A;  1U4M A;  1JOO A;  1K83 B;  2R61 A;  3HOY G;  2ZM6 L;  1ZXT A;  1TS5 A;  3ERO A;  3S2H B;  1QUQ B;  2MJ8 A;  2D9U A;  3A7L A;  3HOU H;  4P71 A;  4C1N I;  4KHZ A;  4HSP A;  1X3G A;  2B2W A;  1SYB A;  4DUY Q;  5NUC A;  1HRJ A;  3OPO A;  4FF1 A;  5KYI A;  1VQ5 A;  3I4O A;  3D6C A;  2N78 A;  3T51 B;  3UDX A;  2BH8 A;  1NR2 A;  3SGI A;  2VB2 X;  4NXN Q;  4LF9 L;  4A3F G;  4AYB E;  5C3E G;  4KKU A;  4J15 A;  3J7Y W;  3SXH A;  1BCP B;  1BQQ T;  2DN8 A;  1JE5 A;  1S5F D;  3VR4 A;  1OXU A;  1JJ2 A;  4KMU C;  3PV0 A;  5GAH C;  4RG1 A;  1TWA H;  1VQ4 A;  1N33 L;  2Q8T A;  4EX5 A;  1I50 B;  2R93 G;  5ISR A;  5K36 H;  2KA7 A;  1KDA A;  3T16 A;  1V1Q A;  2CWP A;  3I4N B;  3AMU A;  2Q8R E;  3SR1 A;  3TP7 A;  3PUY A;  5AJ3 Q;  1AE2 A;  3C3L A;  2ZTD A;  5C3E H;  2F0P A;  3MHB A;  3I72 A;  1XPU A;  1EOV A;  5M3M H;  3QIA A;  2UUB Q;  5IIF A;  1GO3 E;  2QEJ C;  3MXP A;  1Y1W H;  1TR5 A;  2FXQ A;  3SVM A;  4B3S Q;  2I0Q A;  2XSC A;  1D7Q A;  2CKZ B;  1C0A A;  2K5V A;  2EZV A;  1PZI D;  1ZYR D;  4Z9C B;  1HR0 Q;  2J7Z A;  2PI2 E;  1MHW C;  1LYL A;  4DV1 Q;  2HT1 A;  3M3Y B;  3J81 j;  2FMC A;  1VQP A;  5EAY A;  2XN9 C;  3OWF A;  1IL8 A;  4R4Q A;  3NEN A;  4Q5V A;  1QJO A;  2CQA A;  1CA5 A;  4JK1 C;  5KIX A;  4A3L G;  4OO1 I;  4AYB B;  2UUA L;  1PVO A;  1KAB A;  5JJI A;  1LTS D;  2NN6 I;  2EY5 A;  1ILQ A;  4K8I A;  5D3I B;  2ID0 A;  1I4H A;  1CUK A;  2BCO A;  4RHR A;  3PO3 G;  1EU4 A;  4IUP A;  4CHT B;  1PH3 A;  1CA6 A;  2KEC A;  1EZ8 A;  1X65 A;  3IRB A;  3VA5 A;  1U4P A;  1ENC A;  2EJG C;  1MSG A;  1LM0 A;  3CCS A;  4HJA A;  1OTC A;  4XXE A;  5EKK A;  2R92 B;  3HOZ H;  4LFB Q;  1BCP F;  3H0G B;  1RTO A;  1SND A;  4JBJ A;  2BH2 A;  4DV4 Q;  1WOC A;  3CKI B;  1JWM D;  2X6L A;  2F4V Q;  5BN3 A;  1XX8 A;  4DUZ L;  4H02 A;  3PO2 H;  1MJC A;  1JOK A;  4G57 A;  2F52 A;  2PW5 A;  1F9Q A;  1M1K C;  3GTG H;  4R1J A;  3MXN A;  3J7A F;  3GTM B;  1QIL A;  2VUM G;  3T1Y Q;  5ELB A;  1STG A;  4KTA A;  1UE7 A;  3ZJY C;  1QZH A;  2EY1 A;  3TBI B;  4DV7 Q;  5CV7 A;  2R7Z H;  4IFD J;  1SMY C;  2B2U A;  1KXL A;  3J80 c;  1S5C D;  1B7Y B;  4KD3 A;  1Q8K A;  1FNV A;  1VQL A;  1PV4 A;  1H9J A;  4IFD G;  2UXB Q;  1B9N A;  1BKB A;  1PFM A;  3HOV B;  2B2Y A;  3NBH A;  4ZKB B;  1TU2 B;  2B63 H;  4LK1 C;  3K5M A;  3KBX A;  1CT1 D;  1NR4 A;  1XMQ L;  3KLS A;  4JI7 L;  5FO8 B;  1SXT A;  3PSI A;  1JE4 A;  4ABN A;  4K0K L;  1DYQ A;  4KD4 A;  3SE0 A;  4P2C B;  4PMW A;  4DNR B;  2WFW A;  1K83 H;  1MBY A;  4OEL B;  2I5L X;  5IYB H;  3KYH C;  4JPB W;  1GOZ A;  2QEX A;  5DM7 3;  3FPU B;  1IHZ A;  3NTI A;  3MFY A;  2OF1 A;  1CKO A;  1G6P A;  1CHQ D;  2K28 A;  3GP7 A;  4IQZ A;  3RNU A;  3J81 c;  4YIJ A;  4LFA Q;  1EYG A;  4GKJ Q;  2IT1 A;  5CBE E;  1WVL A;  3C46 A;  4UP8 A;  4IFD H;  2B2V A;  1L2F A;  4A3J G;  1Q1B A;  2JJQ A;  3ONA B;  2F0J A;  4GOP C;  2WB1 G;  2RSO A;  4O1N A;  2IHF A;  3A5Z B;  3HOX B;  4KN4 C;  1SE4 A;  1PH1 A;  1BOS A;  5IE8 A;  4JI5 L;  2F03 A;  4A93 G;  2RCN A;  5LL6 X;  4DR1 Q;  4UPA A;  3HP3 A;  1IW7 C;  1KDB A;  1HNW Q;  4JI4 L;  5M5W B;  2XGT A;  2LS0 1;  3RLF A;  3KDF A;  4C3J H;  3KFU A;  4CKC A;  2HDL A;  5IP7 H;  1LT4 D;  3K57 A;  4IUR A;  3E9I A;  4A3J H;  1EWH A;  4ALP A;  1PH4 A;  2OTL A;  1HZB A;  4HMI A;  4V19 0;  5IWA L;  1HTL D;  1RDP D;  1HNX Q;  3PIP A;  3E9H A;  4DV6 Q;  2EXZ A;  3F2D A;  3BDL A;  2IWH A;  1H9R A;  4LFC Q;  1EY6 A;  3GTO B;  1V9P A;  2F1M A;  1YNN C;  2KJX A;  2Z0S A;  3UDF A;  4XQQ A;  4JVZ A;  5D3D A;  3W3A A;  1E24 A;  3CPW A;  4HIO A;  4N9P A;  5C4J H;  2M9V A;  4LUV A;  3H3V H;  4G7Z C;  2UXC Q;  1JMC A;  4P74 A;  2C35 B;  2L15 A;  2K14 A;  1V43 A;  4KJN A;  4UAI A;  4IN3 A;  3GTJ B;  1SYG A;  4K6L A;  2VQE Q;  3KK7 A;  4IFD I;  3FEW X;  4K2L A;  1G2S A;  4YWM A;  3RN2 A;  1TVX A;  5FO9 B;  3K5N A;  4JV5 Q;  3X3M A;  2EYJ A;  1VQ8 A;  4RKL A;  3M4P A;  1E2Z A;  1HZC A;  4BY7 G;  3OW2 A;  1T9H A;  4PNY A;  1PYW D;  4JG2 A;  2JQO A;  1E2W A;  2E2I B;  1AH9 A;  3EA6 A;  4KY6 A;  1EYC A;  3S16 H;  4P72 A;  1N34 Q;  3VYU A;  2F3I A;  1O78 A;  1T5E A;  1C4Q A;  4CDC C;  2K05 A;  1O80 A;  3TS2 A;  2D5D A;  1PZJ D;  5FLX c;  1N32 L;  2L12 A;  2KED A;  1Y8P B;  1GUW A;  1G6Z A;  2A5H A;  5I2Y A;  3TEH B;  1MKH A;  4X6A H;  3TZD A;  1LTB D;  1SMY D;  1D1K A;  2F0H A;  4FF4 A;  2YTX A;  1LUZ A;  3A8K E;  1X3E A;  4MZ9 A;  2AQ1 B;  3T1H Q;  4TQU S;  4EQ5 A;  2EYP A;  5ELD A;  1I94 Q;  3CCL A;  4J8Q A;  2EJM A;  4X66 Q;  4YY3 L;  1EUJ A;  1NNX A;  2H5X A;  4A3M G;  4LF8 Q;  1HHV A;  1I4G A;  4C3H B;  1JWS D;  1PDQ A;  2AWN A;  2F0V A;  1K8O A;  2JN4 A;  3F2C A;  3GTQ B;  1LT6 D;  3RD4 A;  4GNX A;  3H15 A;  4POF A;  5FLM G;  3W1G A;  1NUC A;  4HN7 A;  2ZJQ A;  3P20 A;  4R4C A;  4A3E B;  2A73 B;  3S1M B;  4A75 A;  3A56 A;  1YHQ A;  4GOP B;  1I6H H;  2D2C C;  3G71 A;  4KKT A;  3AQQ A;  5IT9 L;  1Q82 C;  1F9R A;  5G3L D;  4UP9 A;  1GJX A;  2JA6 H;  1EU3 A;  1PMR A;  1WTR A;  1XNR L;  3L7Z C;  5IP9 G;  3WOE A;  3S17 B;  4U68 A;  3G4S A;  3GTL H;  1KRT A;  2HUG A;  3I4L A;  3NTK A;  1VMC A;  2QDL A;  2XTI A;  2B2U C;  1TII D;  4B08 A;  1VQO A;  4JOI C;  1PH9 A;  2CCZ A;  2O5I C;  2JA5 B;  4PV1 C;  5EPL A;  2K5Q A;  1LT5 D;  2B2Y C;  3T56 B;  1Y14 B;  1SMX A;  1TWC H;  1ICW A;  4DUY L;  1SYF A;  1JOR A;  5E7N A;  3Q6S A;  1Z7T A;  4JC0 A;  1GXD C;  4WRD A;  2CH4 A;  1KIX A;  4A3I G;  5EKI A;  3CMA A;  3ERS X;  1YEZ A;  1IW7 D;  2RCF A;  2NWG A;  5E1F A;  1L0Y B;  1G29 1;  3MEH A;  2JK8 A;  4N8X 1;  5C44 B;  4WJ4 A;  4DK1 A;  2RKS A;  1YHB A;  2Q2I A;  2ZJP A;  3EBE A;  2OQK A;  3HZX A;  4LMQ D;  4JI0 Q;  2RDG A;  3DEO A;  3NUC A;  5C4X G;  3RZO H;  1JB3 A;  4BBS H;  1LTR D;  3RZD H;  3HOU B;  1YNN D;  3PF5 A;  4LAA A;  5HY6 A;  2B2V C;  2VXW A;  4X65 Q;  1HNZ Q;  1LLR D;  2NVT H;  2SNM A;  3TDQ A;  2G5D A;  1HPC A;  3CRK C;  3VA7 A;  2JA7 G;  2K04 A;  3I3C A;  3S14 H;  5AJ3 L;  2WKD A;  1QCB D;  1VDZ A;  3EJI A;  5JPN C;  4JYA Q;  1H9S A;  1IYJ B;  2UUB L;  5G3L F;  3CHB D;  3MA2 B;  4B3S L;  4MTK A;  3NXW A;  4BY1 G;  4DV0 Q;  5IYD H;  3VDY A;  4GKK Q;  4QF4 A;  1HR0 L;  4RKB A;  3L9A X;  1U0L A;  3PCO B;  4DV1 L;  4KJO A;  1TWA B;  1X3Q A;  1IZ6 A;  5CV6 A;  1HR0 W;  3J80 E;  4DR2 Q;  1HQR D;  3I4M G;  3BYT B;  4JI1 Q;  2NUC A;  2PPB C;  3F1Z A;  1CTM A;  2F0E A;  2K5N A;  1Q3L A;  1SE3 A;  3SK5 A;  1QWY A;  1RIP A;  5C3E B;  4FP5 D;  2KCN A;  3BZK A;  3RLN A;  1TXY A;  2BDO A;  1HUN A;  3DXJ C;  1CQF A;  5M3M B;  1A3U A;  4EVO A;  2EYH A;  4X3K A;  3SK4 A;  4BS9 A;  3PUV A;  1JCK B;  4CDD C;  2AUK A;  3NWT A;  5GAD C;  4F88 A;  1LAC A;  1LO5 D;  4LFB L;  1B3A A;  2K03 A;  1QVG A;  4DV4 L;  2B39 A;  4EGV A;  2F4V L;  2IPK D;  4A4I A;  2E5L Q;  4YCV A;  4K5X A;  5ELF A;  2R7F A;  4FF3 A;  2Z6B A;  2EYO A;  4FXG C;  2MHV A;  3SDZ A;  1G8Z D;  1HZA A;  3HG9 A;  5C4Z A;  4HIM A;  3G48 A;  3T1Y L;  1CFM A;  1YJ9 A;  5HGQ A;  4R4T A;  3RMH A;  2F0U A;  2I5H A;  4B3R Q;  4IPC A;  3MXN B;  2A69 C;  1PRT B;  4DV7 L;  3MEF A;  2UXB L;  4HJ5 A;  2QF7 A;  2H1E A;  5K5P A;  1QE6 A;  2PQA A;  1FNU A;  1IBL Q;  3L2P A;  1FGB D;  2KHI A;  1R4Q B;  3M4Q A;  3HOZ B;  4NXM Q;  4QUC A;  5L37 A;  4LWC A;  4A3E H;  3S1M H;  1WFQ A;  3NBH B;  2TSS A;  1B2T A;  4N9T A;  1UWV A;  3PO2 B;  2WV6 D;  2ZJR A;  1N36 L;  2VL6 A;  5EJW A;  1SNP A;  2Y0S G;  3LWE A;  3CCU A;  1K8M A;  2TMP A;  3S1R H;  4LFA L;  4GKJ L;  1PZK D;  4IPH A;  4LF7 L;  3T4A C;  1Q1E A;  2D0P A;  4RGM A;  1K8A C;  2PCF B;  3SHL A;  4A3D G;  4KHV A;  1KTK A;  1RL2 A;  3OOC A;  3JAM i;  1CZW A;  2Q8I B;  2K5W A;  2B63 B;  4GNX C;  2E2D C;  1UE1 A;  2OQ0 A;  2K7V A;  5C44 H;  2HHH Q;  2NVY H;  1X55 A;  4J6H A;  2WB1 E;  3W2D A;  3TRZ A;  3NE5 B;  1BUV T;  1PH8 A;  1HFN A;  4DR1 L;  4DFA A;  4C1N K;  1M90 C;  2EIF A;  1HNW L;  1G51 A;  4UDU C;  1EFW A;  4EQP A;  4A3K G;  3M4Y A;  4OO1 H;  1BXT A;  3KDF B;  2DNE A;  5ELN A;  3A8I E;  2KCT A;  2JXM B;  5AFW A;  2VW9 A;  1PRT F;  4DR5 Q;  2FFK B;  1HNX L;  2NN6 H;  4DV6 L;  5JEA H;  1J6Q A;  3K59 A;  3ND9 A;  3CPF A;  4LFC L;  2JYO A;  3Q0A A;  3E5S A;  3A5U A;  4B3T Q;  3HOY H;  3C2P A;  1CSP A;  2R6G A;  4DV3 Q;  2SOB A;  2UXC L;  1Q90 A;  2IX1 A;  3FKI G;  3EN2 A;  2LMC B;  1PTO C;  1O7Y A;  4A3B G;  3TRE A;  1A63 A;  1VQA A;  4C3J B;  1WCM G;  2VQE L;  1FJG Q;  1Y1V G;  4FDB A;  2CW0 C;  4MNO A;  5IY0 A;  4FYD A;  4EQO A;  4A3J B;  3CC4 A;  3K6O A;  1OO9 B;  1SRO A;  4NB3 A;  2ZT9 C;  4X64 Q;  4OON A;  1TWH H;  3IAY A;  1SJH D;  4FXK C;  3K58 A;  2QKI C;  1TWF H;  1PYS B;  2WB1 B;  3P75 A;  1U4R A;  1EFI D;  4JV5 L;  3OYY A;  4A3F H;  1KDC A;  3A8J E;  3UDG A;  3MTS A;  3E3X A;  3K0X A;  4R8I A;  1J5E Q;  3GDE A;  2PMZ E;  1PFB A;  4I7Z C;  5EBC A;  2A68 C;  3H94 A;  4A93 B;  2N88 A;  1TKW B;  4XYQ A;  3FKI H;  5C4J B;  2L1B A;  1HA6 A;  1EY0 A;  2F0M A;  1UAP A;  3RR5 A;  2LKV A;  3P7J A;  3BS1 A;  2E2H B;  3GV6 A;  1MI2 A;  2K52 A;  3R2T A;  1I6V C;  2R93 H;  2KEE A;  2KHJ A;  3FP9 A;  2I5M X;  2X69 A;  5DAU A;  2CWA A;  5C0X G;  3S2D H;  5CYU A;  1B9M A;  2A69 D;  4O2D A;  1TT2 A;  1DOL A;  1ICF B;  2KEN A;  1SNQ A;  1SYE A;  1VQE A;  1HCZ A;  1M8A A;  3T1H L;  3BU2 A;  3H6M A;  4BWG B;  4HTH A;  3NSW A;  4GLA C;  3GD7 A;  4X66 L;  2VY3 A;  3CQZ H;  2N55 A;  3X3N A;  4LF8 L;  3S16 B;  3DWA A;  5IGF A;  3FVQ A;  2JA8 G;  4NKL A;  3PGZ A;  4J1M A;  5KYL A;  2R7D A;  1S40 A;  2EXD A;  1RHP A;  5C3X A;  2Z8L A;  2VB3 X;  4A3L H;  4P75 A;  3A7A B;  2DY8 A;  1YHA A;  1JT8 A;  2PMZ B;  4AQY Q;  2F4I A;  4UY8 C;  2WAQ E;  4GNX B;  1NBW A;  2DY7 A;  4F8M A;  4ZK9 B;  2NZH A;  2HDM A;  1CI3 M;  2UUC Q;  4TRD A;  1XXG A;  4IJH A;  3N6R A;  3PO3 H;  3TP5 A;  2L5T A;  1EOT A;  1BO0 A;  4XT1 B;  2A8V A;  2K5D A;  1I4Q A;  2LXJ A;  4JOI A;  4LF4 Q;  5IOC A;  5IOD A;  1ONL A;  5A2Q E;  1DOM A;  1RJT A;  3VR6 A;  4IPD A;  4K5V A;  3M7N A;  1YI2 A;  1ML0 D;  2YTV A;  3GTP H;  4RGO S;  1DOK A;  1F2L A;  1EEF D;  1SAP A;  3AFQ A;  5M3F G;  3HKZ G;  4ID6 A;  1XNQ Q;  1PYB A;  2F0O A;  1AFP A;  1KNE A;  4JI2 Q;  2Z4I A;  1OXV A;  3EFX D;  1CQV A;  4KK7 A;  1I6H B;  4YCU A;  4JI3 Q;  2VUM H;  4DK3 C;  2BE5 C;  1D5M C;  3AFP A;  2JA6 B;  2Z1C A;  2NTT A;  1NCV A;  3Q24 A;  4JI0 L;  3V2T A;  1KLG D;  3GTL B;  1B8A A;  3AB9 A;  1DZ1 A;  3DUZ A;  3STB C;  1K0S A;  1VS0 A;  3J7A 5;  3JAM c;  3S15 H;  4RH6 A;  5DLQ E;  3R2I A;  4YHH Q;  3OMG A;  4X65 L;  4IAL A;  1PTO B;  4PZ6 A;  2BOS A;  1TY2 A;  4ME5 A;  1HNZ L;  5D14 A;  5CV4 A;  2A6H C;  2D62 A;  1SRU A;  1TWC B;  2WAQ B;  2FJ2 A;  2OTJ A;  4ULL A;  3GQB A;  4IUT A;  2PZT A;  4TVA B;  3VR5 A;  1M4V A;  5FJ8 G;  1SYC A;  1PTO D;  3A55 A;  5C0X I;  5E4W C;  1VQ6 A;  2A1A A;  4DKA C;  3S9W A;  2HIV A;  2CW0 D;  5JOB A;  4L5S A;  1E22 A;  3UE1 A;  1EYA A;  3K7A H;  2G9H D;  2UU9 L;  4CGY B;  1EIF A;  1E3P A;  3NEL A;  4DV0 L;  3I4N G;  1UE6 A;  2FHT A;  3RZO B;  1H9S B;  4BBS B;  4ILW A;  4GKK L;  3RZD B;  3DM1 A;  2GN5 A;  4MN3 A;  1STE A;  2RHS B;  3R93 A;  3W5O A;  1ENF A;  4DU9 A;  2MP1 A;  2RDH A;  4R8N A;  4BA2 I;  4IOA A;  5LMU Q;  2NVT B;  2A68 D;  2P5Z X;  1PHJ A;  3NQT A;  3I56 A;  3CF5 A;  4DR2 L;  4CJ2 C;  4XTC S;  1NMG A;  1Z47 A;  4JI1 L;  1KC8 C;  3A0J A;  4ZAI A;  2QA4 A;  3S14 B;  5TSS A;  1YVC A;  2H4O A;  4K2K A;  1Q8I A;  1NAP A;  1FYC A;  3I8Z A;  4A93 H;  4IO9 A;  3D4D A;  3GO5 A;  3DWP A;  3U9O A;  2QW7 A;  4WOR A;  1EIY B;  1A62 A;  4FF2 A;  3F8T A;  1VQG A;  1G91 A;  4KV6 A;  2E2H H;  4OXP A;  4U67 3;  3DWQ A;  3IKJ A;  5LL6 S;  2PZW A;  4A3G G;  2F0I A;  4HJ8 A;  2M2L A;  1Z6H A;  1SEB D;  1LTG D;  2N49 A;  3E6Z X;  4IPG A;  2RF4 A;  3I2Z A;  2IHE A;  1CM9 A;  4ZYS A;  2JA9 A;  1PTO F;  1PXU A;  1VQK A;  2R92 G;  3PQI A;  4B9W A;  1N33 Q;  3H0G G;  4TKO B;  4CBV A;  3QO2 A;  4QB4 A;  1Q81 C;  3QJY A;  3H09 A;  1R4P B;  4B3R L;  1STY A;  3NEM A;  1FL0 A;  3MC0 B;  3OWE B;  3M9B A;  1EIH A;  1KLU D;  4RMF A;  4A3G H;  3LWU A;  1IBL L;  1SJE D;  1XTD A;  4NXM L;  4QIW E;  1STB A;  2Z6K A;  3K80 C;  1WTV A;  4OIJ A;  2PQA B;  4K14 A;  2NTS A;  4JI8 Q;  3D4R A;  5JJZ A;  1CKM A;  2RA4 A;  3T53 B;  4BY7 H;  4FO2 A;  2QCP X;  4RFB A;  3HOV G;  1RF2 D;  3ER0 A;  4OIK A;  1YIJ A;  2C9O A;  2G9D A;  3TS0 A;  3K0Y A;  3OHX C;  3FDT A;  3PIO A;  4DK6 C;  2EYM A;  2GVB A;  2PNR C;  5HUR A;  4Q0F A;  3E0J A;  4QY7 A;  3SEB A;  2K75 A;  1S4Z A;  4ZLT F;  3CP0 A;  4RCO A;  1NTG A;  1E0B A;  1GM5 A;  4IUN A;  5CV9 A;  1PA6 A;  2BE5 D;  1PFS A;  1SN8 A;  3CCJ A;  2PW7 A;  1O7Z A;  3HOW G;  3STB D;  2Z4H A;  1W3S A;  3HEJ A;  1X56 A;  1TS3 A;  3S24 A;  3SK8 A;  2I07 B;  2HHH L;  2JEB I;  5T1G A;  2AMC B;  2NBF A;  5GQO A;  1NY4 A;  3KJP A;  3BG3 A;  1VQH A;  1I3Q H;  2BDN A;  3MWY W;  2A6H D;  5KGU A;  5CMD A;  4A3M H;  3PF4 A;  3KF8 A;  3HOX G;  3S1R B;  1OXX K;  1IBK Q;  1G2T A;  4CJ0 B;  5CV8 A;  4QIW B;  4DUZ Q;  1QZG A;  4IUU A;  3CCM A;  1ZKO A;  1PTO H;  2L4N A;  2IY5 B;  1EEI D;  2F3W A;  2CHB D;  3H91 A;  1AP0 A;  1O7I A;  2GVA A;  3UDI A;  1OXS C;  3I73 A;  1XMO Q;  1CKN A;  5FLM H;  4DR5 L;  4GN5 A;  1VQ7 A;  2PYK A;  4OWW B;  1JJG A;  4L6T B;  4NXN L;  4ZRZ A;  3TZU A;  3CME A;  4ME3 A;  4F87 A;  5JPM C;  3K5O A;  4B3T L;  5IYC G;  4NMZ A;  2NVY B;  1R9T H;  2HD3 A;  3C1F A;  5J22 A;  5CV5 A;  5IP9 H;  4DV3 L;  2MO0 A;  1GUG A;  4HCE A;  2RHQ B;  3TN2 A;  1C48 A;  3KOJ A;  1VQC A;  4DXF A;  1BBU A;  2X6G A;  1P8L A;  4K0K Q;  3W1B A;  4KN7 C;  4DAY A;  1E1T A;  5BN4 A;  2M00 A;  5FOB B;  1FJG L;  2PQE A;  1II3 A;  1TY0 A;  4QGU A;  5LMN Q;  4A3D B;  4KY7 A;  2AQ2 B;  2RBM A;  3CXC A;  3VYR A;  2YU9 H;  4X64 L;  2R3Z A;  4A3I H;  3IFD A;  3J80 L;  4LF5 Q;  4FXD A;  4OL7 A;  4TSS A;  4I65 A;  1K28 A;  3KF6 A;  1EWC A;  2OEO A;  3K8A A;  1EQQ A;  4RAU C;  3HOY B;  1MJE A;  2FMM A;  3EVQ A;  3AU7 A;  5J1Z A;  5C4X H;  1S72 A;  5C3W A;  4A3C G;  1Z9F A;  1KAW A;  1AW7 A;  2NZO A;  1K8G A;  1GUO A;  1D8L A;  3FPP A;  1JC7 A;  1I4R A;  2O5J C;  3NP8 A;  4X62 Q;  1ROD A;  4A3K B;  3DM3 A;  3S1Q H;  1TS2 A;  3J81 L;  1AZQ A;  1AEX A;  2LXK A;  4MIU A;  2JA7 H;  1HQM C;  1TWH B;  4Y7N H;  2EOT A;  1EWI A;  1TWF B;  4C3I G;  4DR4 Q;  1HUM A;  4A3F B;  2WKC A;  3U50 C;  3UI2 A;  4KLK A;  1XPR A;  3NPP A;  2RSN A;  2HIX A;  1JOQ A;  1A15 A;  3TME A;  1HA5 A;  3CAM A;  4BY1 H;  5GRO A;  4YWK A;  4R9W A;  3FKI B;  1WJJ A;  4L63 B;  2OXP A;  2Q2H A;  4UHV A;  3Q22 A;  1U4L A;  4OEM B;  1B4O A;  4IOC A;  2EYL A;  4F7X A;  1X54 A;  3G6J B;  1RCV D;  1BCP C;  5KRU A;  3U58 A;  4A76 A;  3ITP A;  1DCZ A;  1H95 A;  3J81 E;  1SBB B;  3CD6 A;  1Y1V B;  1ET6 A;  2SNS A;  1YZ6 A;  2R93 B;  1I5F A;  3I4M H;  2E75 C;  1BR9 A;  3CCV A;  3MZ5 A;  2ZTC A;  4X3U A;  1X3P A;  3S2D B;  4AQY L;  3DMU A;  1S3O A;  2F0W A;  2JE6 I;  4MTN A;  4PZ8 A;  3P1H A;  2F0N A;  1XYI A;  1D2B A;  5H1S E;  2UUC L;  2CFM A;  1KRS A;  3BVM A;  3NTH A;  4P73 A;  2CVR A;  3CQZ B;  5M5Y H;  5E3F A;  5I2X A;  4LF4 L;  1QNU A;  4OHJ A;  2ZXR A;  3JC6 6;  5F2D A;  2KCM A;  4HAE A;  1A3V A;  5I9O A;  5HGT A;  3MAQ A;  1A6X A;  1O7L A;  2UXD Q;  2Z6K C;  3HS0 C;  1BVS A;  2KVM A;  1JIC A;  5D65 A;  4Y52 H;  1GUT A;  4BXX G;  2K50 A;  4JI2 L;  3PUW A;  1VQB A;  2RVL A;  2F0F A;  1PLF A;  2JA5 G;  3MXU A;  1V1O A;  5KNC A;  4ZUJ A;  4PQX A;  4JI3 L;  3HKZ E;  4BBR G;  1AZP A;  1ZEQ X;  5COY A;  3J80 i;  3PO3 B;  5DNF A;  1D6E C;  1Q46 A;  4GS3 A;  1Y8O B;  5I6Y A;  4C2M H;  4HED A;  4HIK A;  4YHH L;  4DAV A;  3J7A V;  1RKN A;  4XIG S;  4GLX A;  3GTP B;  1YJN A;  3FRP B;  5COR A;  4I7A A;  1HH2 P;  2LFN A;  5IGB A;  3QG1 A;  1SNM A;  3OTO Q;  4DNI A;  3WDN A;  1VQF A;  3PUZ A;  4NPS A;  3HOU G;  1V1P A;  3CW2 C;  2ICE C;  3CC2 A;  2VQF Q;  1NJI C;  2WP8 J;  5FLX L;  3IFT A;  4BBR H;  1BDO A;  4L5R C;  2VUM B;  3WOF A;  3K5L A;  4RWS C;  1VQM A;  1KD1 C;  4DR7 Q;  3NWS A;  2BA0 A;  3DEP A;  4KY5 A;  1ILP A;  2KBN A;  4JI6 Q;  1AE3 A;  4KI0 A;  2O4X A;  5EPK A;  3FHW A;  3BYY B;  4A3D H;  3S15 B;  4DV2 Q;  2J4X A;  1WD1 A;  2NYZ D;  3TSS A;  2F0G A;  4L5T A;  2RQX A;  1D5Z C;  5LMU L;  2QDB A; 
#chains in the Genus database with same CATH homology
 1YI2 A;  2UU9 Q;  1XNR Q;  2YTV A;  3K81 C;  3GTP H;  4JI4 Q;  3GTJ H;  4JBW A;  2D0O A;  3TS2 A;  3AFQ A;  5M3F G;  4DR3 Q;  5FLX c;  3HKZ G;  1N32 L;  1TWG H;  1IBM L;  3HKS A;  1XNQ Q;  1PYB A;  3ICE A;  3D0F A;  4JI2 Q;  3TEH B;  1HJP A;  1MKH A;  1OXV A;  3LGJ A;  5IWA Q;  4X6A H;  5ELO A;  4A3C H;  4YCU A;  3EIV A;  4JI3 Q;  2VUM H;  2YTX A;  4DK3 C;  1LUZ A;  1X3E A;  3AFP A;  4MZ9 A;  1VCI A;  3T1H Q;  3AEV A;  5K36 G;  4TQU S;  4EQ5 A;  4JI0 L;  1X6O A;  1I94 Q;  1PH6 A;  3CCL A;  1NE3 A;  1B8A A;  5BR8 Q;  3STB C;  4DAM A;  2E2I H;  2AHO B;  4X66 Q;  4A3K H;  4YY3 L;  1EUJ A;  1VS0 A;  2H5X A;  3JAM c;  4A3M G;  3J7A 5;  3S15 H;  5DLQ E;  4LF8 Q;  4YHH Q;  4X65 L;  1UE5 A;  5M3M G;  4LF6 Q;  4PZ6 A;  4B3M L;  4DPG A;  1HNZ L;  2AWN A;  1Y1W G;  4C3I H;  2D62 A;  1SRU A;  1WYD A;  3DLL A;  2OTJ A;  5GAE C;  1L1O B;  3F2C A;  4TVA B;  4R4O A;  3D31 A;  5FJ8 G;  3H15 A;  3TQY A;  4POF A;  4GNX A;  5FLM G;  5C0X I;  4DR6 Q;  3UE0 A;  3W1G A;  2ZTE A;  2ZJQ A;  4R4C A;  2IX0 A;  1VQ6 A;  2A1A A;  4DKA C;  3G6E A;  4A75 A;  1XJV A;  4A3E G;  1YHQ A;  2HIV A;  4GOP B;  3S1N H;  3U4Z A;  1I6H H;  2DGY A;  3G71 A;  2ATW A;  3M4O H;  3AQQ A;  1A0I A;  2MFI A;  1N34 L;  1E22 A;  4L5S A;  3UE1 A;  4IJL A;  4YCW A;  4UP9 A;  1Q82 C;  2JA6 H;  1KL9 A;  2ES2 A;  4A3B H;  4KHP L;  3K7A H;  1EQR A;  2UU9 L;  1DGS A;  1XNR L;  3L7Z C;  5IP9 G;  1EIF A;  1E3P A;  3NEL A;  2MNA A;  1WCM H;  1UE6 A;  1E7Z A;  4DV0 L;  4OX9 Q;  3I4N G;  1Y1V H;  4LW1 A;  3G4S A;  1KRT A;  3GTL H;  4GKK L;  1C7Y A;  3I7F A;  2GN5 A;  5C0X J;  2RHS B;  2XTI A;  3W5O A;  1X9N A;  1VQO A;  2CCZ A;  1SLJ A;  4JOI C;  1PH9 A;  1XNQ L;  4BA2 I;  4C3H H;  4IOA A;  5LMU Q;  4LUO A;  1Y14 B;  4PZ7 A;  5GAG C;  1SMX A;  4JI8 L;  3I56 A;  2QGQ A;  3CF5 A;  4DR2 L;  1PHJ A;  1TWC H;  4XTC S;  1NMG A;  1OXT A;  1Z47 A;  4JI1 L;  4DUY L;  5E7N A;  1GD7 A;  3ULP A;  1KC8 C;  3A0J A;  4JC0 A;  3GTQ H;  1N32 Q;  1KIX A;  2QA4 A;  4A3I G;  2B3G A;  1YVC A;  1I94 L;  1IBM Q;  5JJL A;  3CMA A;  3ERS X;  1YEZ A;  5IT9 c;  3HOZ G;  2JEA I;  2YTY A;  3HFZ B;  1G29 1;  4A93 H;  2Q2U A;  2JK8 A;  4HID A;  4WJ4 A;  4IO9 A;  1QVC A;  2AKW B;  2CQO A;  3GO5 A;  5C44 G;  4WJ3 M;  1YHB A;  2Q2I A;  2ZJP A;  3EBE A;  3PO2 G;  2OQK A;  1EIY B;  1A62 A;  1IBL Q;  3F8T A;  1VQG A;  2YYZ A;  4JI0 Q;  3Q8D A;  2EQS A;  3ULL A;  4OXP A;  2E2H H;  3GTK H;  3RZO H;  3S17 H;  5C4X G;  4BBS H;  3RZD H;  1BBW A;  4A3G G;  4BXX H;  4O0A A;  4YY3 Q;  1PH7 A;  4HJ8 A;  3PF5 A;  4DV5 L;  5HY6 A;  4X65 Q;  2NVX H;  1L1O A;  2JA5 H;  4B3M Q;  1HNZ Q;  1PH2 A;  2R7Z G;  1K3R A;  2NVT H;  3J81 i;  2BA1 A;  2N49 A;  1P16 A;  4HJ7 A;  2YV5 A;  4IPG A;  2RF4 A;  3I2Z A;  4OO1 G;  2IHE A;  1UEB A;  3U4V A;  1QVF A;  2JA7 G;  2NVQ H;  5JEA J;  4GOP A;  2OCE A;  2JA9 A;  3L0O A;  3S14 H;  4OWT B;  2PNH A;  1VQK A;  2NN6 G;  1SFO H;  5JEA G;  2B63 G;  1N33 Q;  3B6Y A;  2R92 G;  5AJ3 L;  1FGU A;  3H0G G;  3F2B A;  1Q12 A;  5J3B A;  1Q7Y C;  1Q81 C;  4JCV E;  1IBK L;  1VQN A;  2JA8 H;  4B3R L;  2ASB A;  4JYA Q;  1IYJ B;  2UUB L;  3NEM A;  1FL0 A;  1HZ9 A;  3M9B A;  3HOY G;  2ZM6 L;  4B3S L;  4LUZ A;  4KHP Q;  3KF8 B;  1YNX A;  5IYB G;  4RMF A;  4BY1 G;  4DV0 Q;  5IYD H;  1CSQ A;  4A3G H;  3VDY A;  4GKK Q;  1HR0 L;  1QUQ B;  1IBL L;  1N8R C;  1XMO L;  1U0L A;  3PCO B;  4DV1 L;  1SE8 A;  3HOU H;  4P71 A;  1XTD A;  4NXM L;  4QIW E;  2N3S A;  3E0E A;  4AIM A;  2Z6K A;  3K80 C;  4HJ9 A;  1IZ6 A;  4KHZ A;  1HR0 W;  2PQA B;  1X3G A;  1CKN B;  4JI8 Q;  2DUD A;  4DR2 Q;  1CKM A;  3I4M G;  4JI1 Q;  4DUY Q;  1VQ5 A;  4BY7 H;  3I4O A;  3F1Z A;  3HOV G;  2N78 A;  1NMF A;  1L0W A;  2K5N A;  3UDX A;  3ER0 A;  1YIJ A;  1YJW A;  3J7Z C;  2BH8 A;  4YWL A;  3SGI A;  2E2J H;  3TS0 A;  1RIP A;  4NXN Q;  4LF9 L;  4A3F G;  1E1O A;  5JJK A;  2N8N A;  3BZK A;  3RLN A;  4AYB E;  5C3E G;  1TXY A;  3PIO A;  4DK6 C;  3AYH B;  2GVB A;  4J15 A;  1X3F A;  2HQL A;  5LMN L;  1N36 Q;  4QY7 A;  2K75 A;  3PUV A;  1JE5 A;  3CP0 A;  4DAY B;  5M3F H;  3S2H H;  1NTG A;  1OXU A;  5LMN W;  2VS1 A;  1GM5 A;  1JJ2 A;  1PA6 A;  5GAD C;  4LF5 L;  3PV0 A;  1PFS A;  5GAH C;  4LFB L;  4RG1 A;  1TWA H;  2VZA A;  1SN8 A;  3CCJ A;  1KHI A;  4DV5 Q;  1VQ4 A;  4EX5 A;  1QVG A;  1N33 L;  3HOW G;  4DV4 L;  4LF7 Q;  4JBM A;  3STB D;  2F4V L;  5IP7 G;  1W3S A;  4A4I A;  2R93 G;  2E5L Q;  4YCV A;  1X56 A;  3S24 A;  2HHH L;  4JYA L;  2JEB I;  2AMC B;  5GQO A;  4LNQ A;  2R7F A;  1NY4 A;  1V1Q A;  3KJP A;  2CWP A;  1YBY A;  1VQH A;  3KF6 B;  1I3Q H;  3PUY A;  1HZA A;  5AJ3 Q;  4HIM A;  1AE2 A;  3G48 A;  3T1Y L;  2ZTD A;  4A3M H;  5C3E H;  5HGQ A;  1YJ9 A;  4PG3 A;  3RLO A;  4R4T A;  3HOX G;  3PF4 A;  1OXX K;  2I5H A;  1IBK Q;  1XPU A;  1EOV A;  4IPC A;  3MXN B;  5M3M H;  1PH5 A;  4DUZ Q;  4B3R Q;  4X62 L;  4GN3 B;  1QZG A;  3CCM A;  4DV7 L;  1VQD A;  2UUB Q;  1QUQ A;  1GO3 E;  2IY5 B;  1Y1W H;  2ZM6 Q;  4B3S Q;  2FXQ A;  2I0Q A;  1D7Q A;  3MEF A;  4L5Q A;  2CKZ B;  2UXB L;  1C0A A;  4HJ5 A;  2K5V A;  1O7I A;  2GVA A;  2PQA A;  1HR0 Q;  3UDI A;  1FVI A;  2PI2 E;  1OXS C;  2MQH A;  3KLW A;  5FJ8 H;  1CKN A;  1LYL A;  2KHI A;  3M4Q A;  3WWV A;  5FLM H;  4DV1 Q;  4DR5 L;  3J81 j;  4NXM Q;  4GN5 A;  2HT1 A;  4LWC A;  5EAY A;  1VQP A;  1VQ7 A;  4DR4 L;  4R4Q A;  4OWW B;  4NXN L;  4OWX B;  1JJG A;  1GKH A;  3NEN A;  3CME A;  4A3E H;  4ME3 A;  1I50 H;  3S1M H;  1WFQ A;  1IXR A;  3NBH B;  1K73 C;  4B3T L;  4A3L G;  4OO1 I;  5IYC G;  2UUA L;  1PVO A;  1UWV A;  4AYB G;  1R9T H;  4AH6 A;  2ZJR A;  1N36 L;  2VL6 A;  5IP9 H;  2V1C C;  2MO0 A;  4QJF A;  4DV3 L;  2Y0S G;  3I4N H;  5JJI A;  2NN6 I;  1K0R A;  3CCU A;  2RHQ B;  2ID0 A;  4LF9 Q;  1CUK A;  3KOJ A;  1VQC A;  1BBU A;  1U5K A;  3S1R H;  1P8L A;  3PO3 G;  4K0K Q;  3W1B A;  2ALY B;  4LFA L;  4POG A;  1E1T A;  4GKJ L;  1PH3 A;  1FJG L;  2E8G A;  4IPH A;  4QGU A;  5LMN Q;  4LF7 L;  1X65 A;  1Q1E A;  2D0P A;  3IRB A;  2E5L L;  1K8A C;  4A3D G;  3CXC A;  1LM0 A;  2YU9 H;  3CCS A;  4HJA A;  4X64 L;  1OTC A;  1RL2 A;  4GN4 B;  4A3I H;  3JAM i;  4LF5 Q;  3M3Y H;  3HOZ H;  4LFB Q;  4GNX C;  3CC7 A;  3CCE A;  2OQ0 A;  1UE1 A;  4JBJ A;  4DV4 Q;  1WOC A;  2BH2 A;  1YIT A;  3KF6 A;  2OWO A;  5C44 H;  2F4V Q;  3K8A A;  2HHH Q;  4DUZ L;  1EQQ A;  4H02 A;  2NVY H;  1MJC A;  3PO2 H;  2F52 A;  1X55 A;  1MJE A;  2WB1 E;  1XPO A;  1M1K C;  3TRZ A;  3GTG H;  4R1J A;  5C4X H;  1PH8 A;  1S72 A;  4A3C G;  3PUX A;  1Z9F A;  1KAW A;  2NZO A;  4DR1 L;  2VUM G;  1K8G A;  3T1Y Q;  1JB7 A;  1D8L A;  1M90 C;  2EIF A;  1UE7 A;  1HNW L;  1G51 A;  3ZJY C;  1QZH A;  4X62 Q;  1EFW A;  4DV7 Q;  2R7Z H;  4IFD J;  2UXD L;  3DM3 A;  1KXL A;  3S1Q H;  3J80 c;  4A3K G;  1B7Y B;  2VNU D;  1Q8K A;  1VQL A;  2LXK A;  1PV4 A;  4IFD G;  2UXB Q;  1BKB A;  1C9O A;  3KDF B;  2JA7 H;  5ELN A;  2KCT A;  4Y7N H;  3RN5 A;  2VW9 A;  1HNX L;  1EWI A;  4DR5 Q;  2B63 H;  2R92 H;  4DV6 L;  1J6Q A;  5M5X H;  4DR4 Q;  3H0G H;  3CPF A;  4LFC L;  1K9M C;  1XMQ L;  3U50 C;  4JI7 L;  4UP7 A;  3PSI A;  4KLK A;  1XPR A;  3A5U A;  4K0K L;  4B3T Q;  2HIX A;  2UUA Q;  4PMW A;  3HOY H;  2Y0S E;  2WFW A;  1SR3 A;  1K83 H;  1CSP A;  2R6G A;  3CAM A;  5IYB H;  2I5L X;  3KYH C;  5GRO A;  4DV3 Q;  4YWK A;  4BY1 H;  2QEX A;  4JBK A;  1WJJ A;  2Q2H A;  2UXC L;  2IX1 A;  3FKI G;  3GTM H;  1CKO A;  3I55 A;  3EN2 A;  4IOC A;  1ASY A;  1G6P A;  3L2P A;  1X54 A;  1A8V A;  1JJC B;  3RNU A;  1ASZ A;  3U58 A;  1LTL A;  4A76 A;  3J81 c;  2JA6 G;  4A3B G;  1H95 A;  3TRE A;  1A63 A;  3CD6 A;  1VQA A;  3K7U C;  4LFA Q;  1EYG A;  1WCM G;  2VQE L;  4GKJ Q;  1VQI A;  1FJG Q;  1Y1V G;  4FDB A;  1YZ6 A;  3OTO L;  4MNO A;  1L1O C;  1I5F A;  2IT1 A;  5IY0 A;  1W2B A;  3I4M H;  4UP8 A;  3CCV A;  1WI5 A;  2ZTC A;  3CC4 A;  3H3V I;  1L2F A;  1SRO A;  4NB3 A;  4AQY L;  4A3J G;  1S3O A;  3HOV H;  2VQF L;  4X64 Q;  2JE6 I;  1TWH H;  4MTN A;  4OON A;  1XMO Q;  2AWO A;  1Q1B A;  2JJQ A;  4PZ8 A;  1TWF H;  1PYS B;  4GOP C;  4JV5 L;  2WB1 G;  3OYY A;  2WAQ G;  1GVP A;  5H1S E;  3CCR A;  4A3F H;  1N9W A;  2IHF A;  2K5H A;  3A5Z B;  2UUC L;  4DR7 L;  2CFM A;  1KRS A;  3UDG A;  1PH1 A;  3K0X A;  1J5E Q;  3GDE A;  2PMZ E;  5IE8 A;  4P73 A;  4JI6 L;  3BZC A;  4JI5 L;  3KJO A;  5M5Y H;  4GLV B;  2PI2 A;  4LF4 L;  1B70 B;  4A93 G;  4DV2 L;  2MO1 A;  2RCN A;  3FKI H;  4BA1 I;  1IL2 A;  1Q86 C;  3RR5 A;  4DR1 Q;  3BJU A;  2K4K A;  2LSS A;  3JC6 6;  4UPA A;  2KCM A;  1HNW Q;  4JI4 L;  2XGT A;  1KQS A;  3RLF A;  3HOW H;  3KDF A;  4C3J H;  2K52 A;  3KFU A;  2B29 A;  2Z6K C;  2UXD Q;  4BBS G;  1BVS A;  4DR3 L;  5IP7 H;  2R93 H;  4Y52 H;  4BXX G;  2KHJ A;  2K50 A;  3FP9 A;  3E9I A;  4A3J H;  2I5M X;  4ALP A;  1PH4 A;  2OTL A;  1HZB A;  4JI2 L;  2CWA A;  5C0X G;  4QL5 A;  3PUW A;  3M85 A;  3S2D H;  5IWA L;  4QQB X;  4O2D A;  1VQB A;  2JA5 G;  1VQJ A;  1HNX Q;  3PIP A;  3E9H A;  4DV6 Q;  4JI3 L;  3HKZ E;  4BBR G;  3F2D A;  2KEN A;  4LFC Q;  1VQE A;  1XMQ Q;  4JI7 Q;  1V9P A;  3J80 i;  3HOX H;  3BU2 A;  3T1H L;  1VQ9 A;  2Z0S A;  4GLA C;  1Q46 A;  3GD7 A;  3A74 A;  4GS3 A;  3UDF A;  5BR8 L;  4X66 L;  2VY3 A;  3CQZ H;  1E24 A;  3CPW A;  4HIO A;  4C2M H;  4LF8 L;  5C4J H;  4LUV A;  4YHH L;  4HIK A;  3H3V H;  2JA8 G;  1JMC A;  2UXC Q;  4LF6 L;  3PGZ A;  4P74 A;  4APV A;  4XIG S;  2C35 B;  2L15 A;  2K14 A;  1V43 A;  4GLX A;  1YJN A;  5M5W H;  2R7D A;  1HH2 P;  5IYD G;  1S40 A;  2EXD A;  2VQE Q;  2Q2T A;  3OTO Q;  4DNI A;  4A3L H;  4IFD I;  4P75 A;  4DR6 L;  1J5E L;  5IYC H;  1VQF A;  3PUZ A;  4NPS A;  3HOU G;  1YHA A;  3CW2 C;  4YWM A;  1JT8 A;  4AQY Q;  3RN2 A;  3CC2 A;  4R4I A;  2VQF Q;  1NJI C;  2WP8 J;  4UY8 C;  2WAQ E;  4GNX B;  3ULJ A;  4BBR H;  4L5R C;  1NBW A;  4JV5 Q;  1VQ8 A;  2NZH A;  3M4P A;  1VQM A;  1HZC A;  1KD1 C;  2UUC Q;  3GTO H;  4BY7 G;  4DR7 Q;  2BA0 A;  3OW2 A;  4IJH A;  3PO3 H;  1T9H A;  2A19 A;  2KBN A;  4OX9 L;  4JG2 A;  2JQO A;  4JI6 Q;  1AE3 A;  4KI0 A;  4JI5 Q;  2A8V A;  1AH9 A;  3CCQ A;  2LXJ A;  4JOI A;  3FHW A;  4LF4 Q;  4A3D H;  4DV2 Q;  3S16 H;  4P72 A;  1N34 Q;  1MIU A;  4L5T A;  2F3I A;  5LMU L;  3M7N A;  4IPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...