4A3BH

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3bH00
4LW1A 4GKKQ 4X65Q 1WOCA 4WJ4A 3RN5A 1A62A 2JQOA 3TQYA 3L2PA 4DR7Q 1M90C 2UUCL 1WYDA 3GO5A 4KHPQ 2QEXA 4MTNA 1OTCA 3TRZA 3K7UC 3TS0A 3I4NH 1N8RC 3A0JA 1VQHA 3D31A 3KDFA 4GKJQ 1SLJA 4OXPA 3H0GG 3I7FA 2HQLA 1G291 1CKNA 2KHIA 4DV7Q 2PI2E 1YIJA 2ES2A 2F52A 1IZ6A 1QUQB 4XTCS 5M3MH 1DGSA 1L1OA 4H02A 3MXNB 1MJEA 2OTLA 4PZ6A 1T9HA 5GADC 1HZAA 4QL5A 4JV5L 1YHAA 3F8TA 3ULPA 1J6QA 3I55A 1KD1C 2R7ZG 2NN6I 4BBRG 3BZCA 3CCEA 4DUYQ 1JB7A 1KRTA 1G6PA 5FLMG 1KRSA 4QGUA 3RN2A 2JA6G 3S1MH 4OO1I 2R7FA 1L1OC 2F3IA 1YI2A 1KAWA 1O7IA 3F1ZA 1UEBA 3AEVA 4DK6C 3MEFA 3OTOL 1YJ9A 2WP8J 2VUMH 2MO1A 4KLKA 3KFUA 4A3IG 1NJIC 1HNZL 2LXKA 1FGUA 3DLLA 1EYGA 1PH8A 4FDBA 4OWXB 5C0XJ 4A3LH 3PUWA 3F2CA 2IX0A 4HJ5A 1IBMQ 2YYZA 2LXJA 2NZOA 2RF4A 3PV0A 3PO2H 5IYBH 2XTIA 1UE5A 1JE5A 2R92H 2KCTA 4DR6L 2DGYA 1EQRA 2ID0A 1EWIA 4UPAA 2EIFA 4DR1L 3VDYA 4LUZA 4DR3L 3CQZH 4APVA 5LMUL 2UUCQ 2ZJQA 1VQLA 1VQ7A 1XNRL 3A74A 1RIPA 3GTGH 3PUZA 4A3BG 1HZCA 1VQKA 1CUKA 1QVCA 1HNXL 4AYBG 3CF5A 2B63H 2HT1A 1LTLA 2B29A 1HH2P 2F4VL 3M9BA 2CCZA 2K5VA 1N9WA 2PI2A 4P72A 5EAYA 3AFPA 4DV2L 4O0AA 3OW2A 4GLXA 2WB1E 4JI8L 2A8VA 4DKAC 1IBLL 3I4NG 2VNUD 3ICEA 1X3EA 4DR4L 1J5EQ 2PMZE 3J7ZC 4B3TL 4R4OA 3M3YH 4LF4L 4JV5Q 2E2HH 1GD7A 4JI4L 4IOAA 4LF9L 1BKBA 4JI2Q 4YY3L 4BA2I 1WCMH 2N49A 4ALPA 3KF6A 1N36L 4XIGS 1Y14B 4GN5A 3S14H 1L0WA 3PO3H 3KOJA 3ERSX 3KDFB 3HOXH 1LM0A 3CXCA 2NN6G 4R1JA 2HIVA 1PFSA 1WI5A 4YCWA 3STBD 1YZ6A 4AH6A 3CCVA 3HFZB 2KHJA 4OO1G 1Q8KA 4JI3L 5HY6A 1HNZQ 3HOVH 4A93G 3RLFA 3M4PA 4L5RC 1XJVA 2I0QA 1VQDA 1VCIA 1L1OB 4A93H 3W5OA 4IPDA 1V43A 4C2MH 3G48A 1GKHA 2FXQA 2JE6I 2Y0SG 4DR6Q 5IYDH 4JBMA 1AE2A 1Q86C 5C44G 4DR1Q 2VUMG 4A3DH 2L15A 4DR3Q 1VQGA 3GTQH 1U0LA 4IFDJ 1XNRQ 4Y52H 3EBEA 4DV1L 2AMCB 3J81i 4BY7H 3UE0A 1HNXQ 1VQCA 5IYBG 1X3FA 3KYHC 3S1NH 5C3EH 4K0KL 1TWAH 2R92G 3PCOB 2F4VQ 2C35B 4L5QA 1NTGA 5J3BA 4DV2Q 2UUBQ 3GTJH 1NBWA 4IPCA 1KC8C 4JI8Q 5K36G 1IBLQ 4YWLA 4A3MG 3CCJA 1S72A 2JA8H 4DR4Q 4MNOA 4LF4Q 1SMXA 2B63G 3HOZH 1EIYB 5H1SE 1WFQA 1TXYA 1YJWA 4JI4Q 2N3SA 3CMAA 4LF9Q 1EOVA 4IOCA 2VW9A 4KHZA 5HGQA 1P16A 2K50A 2ZTCA 4A3FH 1PH6A 4DPGA 3RZDH 1IBML 1JJCB 1VQFA 2BA0A 4LFAQ 2ALYB 1E22A 4X64L 3M4QA 2V1CC 1E1OA 4YWMA 4P75A 3W1GA 4JI3Q 2E8GA 1Q1BA 4JBWA 3IRBA 4IJLA 2K5HA 3PO3G 3H15A 4A3EH 3AQQA 1MKHA 1E1TA 2DUDA 4GNXA 2D0PA 1MJCA 4ME3A 4JBKA 4LF8L 1YHBA 2MQHA 4LFBL 1VQAA 4YWKA 1VQMA 1Q82C 3W1BA 2BH8A 3HOVG 3J7A5 1YVCA 3J80i 4DV1Q 4A3KH 1R9TH 1Z47A 4IO9A 3G4SA 1TWGH 1V9PA 1J5EL 2OCEA 3L7ZC 3JAMc 3CCMA 4GNXC 4A3JH 3UE1A 1IL2A 5IP9H 2YU9H 4K0KQ 1NMFA 5ELNA 3J81j 4B3ML 3KJPA 4X6AH 3GTKH 4A3GG 4JYAQ 2KBNA 2HIXA 1W3SA 2WFWA 2BA1A 4JI2L 1ASYA 2AWNA 2E2IH 3GD7A 4B3SQ 3M4OH 1HJPA 3UDIA 2RCNA 2OWOA 2VS1A 3ER0A 4JOIA 5M3FG 4UP9A 1N33L 3RLOA 3M7NA 4BY1G 5LMNW 2I5LX 5C3EG 1A63A 1H95A 3CMEA 1TWHH 3OYYA 3ULLA 4A75A 2CWAA 4P71A 4MZ9A 5IWAQ 3JAMi 3CCQA 1OXVA 4GLVB 4UP7A 3RNUA 1XMOQ 4BXXH 5ELOA 3BZKA 2R93G 4JOIC 3CCRA 4LWCA 1VQIA 2VY3A 2JA8G 2N8NA 2MO0A 4X64Q 1UWVA 4A3CH 1N32Q 2Q2IA 1KQSA 3TEHB 1MIUA 4R4IA 4X66L 3HOWH 2CWPA 4DUZL 1VS0A 3CW2C 4RMFA 2NVTH 3GTPH 5IYCH 3CC7A 4A3FG 2D62A 2UU9L 2D0OA 3AFQA 2E2JH 5C4XH 4A76A 4LF7L 4IJHA 1GVPA 4LUOA 3S2DH 3I4MG 4B3RL 4LF8Q 4NXML 1JJGA 4GOPA 4JCVE 3RR5A 2UUBL 4LFBQ 2VQEQ 4C3JH 2CKZB 1UE7A 1Z9FA 1YHQA 1QVGA 5BR8Q 3K80C 5JJLA 1JT8A 1XPUA 5AJ3L 3KJOA 4BBSH 1D7QA 4JI5L 3G71A 1Q46A 4A3EG 4GLAC 3HOUH 2LSSA 4B3MQ 4GOPC 4EQ5A 1IXRA 3CAMA 3GTMH 5IT9c 4EX5A 2JEBI 1GM5A 1I94L 4OWTB 2NZHA 3T1YQ 3F2DA 1HR0W 2R7DA 5M3MG 4A3KG 1EUJA 4LFAL 3CCLA 4R4CA 1V1QA 2Z0SA 4PG3A 4Y7NH 4A3JG 1N33Q 1S40A 4GN4B 3J81c 3Q8DA 2IHEA 4GNXB 1IBKL 1I3QH 1HNWQ 2KCMA 1CKNB 1A0IA 2PQAA 3DM3A 5C4JH 2IX1A 3H3VH 2NVYH 5IP7H 4C3IH 5JEAG 2ZTDA 2EQSA 2IHFA 2WB1G 3E9IA 1K73C 3K81C 1NE3A 4L5SA 1QUQA 4X66Q 4HJ8A 2WAQE 4NXNL 1K3RA 1NY4A 1VQ4A 1N34L 4DUZQ 3H0GH 4A3LG 3STBC 3HKZG 3B6YA 4J15A 1VQJA 3UDGA 1PH1A 4X62Q 2UU9Q 1YITA 3PO2G 4BXXG 4LF7Q 4KI0A 4OX9L 4B3RQ 2R6GA 4NXMQ 1AH9A 4HIMA 4JBJA 4JYAL 5GAEC 3PF4A 1L2FA 4AQYL 1VQPA 4HJ9A 2YTVA 5GAHC 4B3SL 3PUYA 2JA7H 4O2DA 1KXLA 1GO3E 5AJ3Q 4DV0Q 1KHIA 5IYCG 1PH7A 4JI0L 1SE8A 4JI5Q 4JI7L 3L0OA 3HOYH 1X65A 3RZOH 4BBRH 2PNHA 4JG2A 1OXUA 1QZHA 5FLMH 2HHHL 3PIOA 3ULJA 4QQBX 5JJIA 4R4TA 4JC0A 1Y1WH 4RG1A 5IWAL 1I94Q 4IPHA 1XPOA 1XMOL 3CPFA 1PH4A 1UE1A 3K0XA 1Y1VH 3G6EA 1K8GA 4DR2L 4POGA 1XPRA 4UY8C 4BBSG 5JJKA 4DV4Q 1FL0A 1WJJA 4IPGA 4A3IH 1FJGL 3J80c 1N32L 1IBKQ 1VQ6A 1K8AC 4A4IA 1FVIA 4P74A 4GOPB 4JI1L 1M1KC 1C7YA 1EFWA 4DV6L 4HJ7A 4WJ3M 1WCMG 1ASZA 1A8VA 1HZ9A 3HOXG 1PA6A 1K9MC 2EXDA 4A3BH 1LUZA 2VQEL 1Q12A 2B3GA 3E9HA 4NXNQ 3HKSA 5BR8L 1N34Q 4NPSA 3KF6B 3FKIH 4DV5L 4LF5L 3WWVA 5C0XG 3PF5A 1VQ8A 4OX9Q 5LMNL 4IFDI 1HZBA 5IYDG 2BH2A 4A3DG 3SGIA 3JC66 3K7AH 4UP8A 4BA1I 2VQFL 1BBWA 4QJFA 4AQYQ 2Q2HA 2PQAB 3U4VA 4R4QA 3T1HL 3T1YL 3S1QH 3RLNA 3NELA 3I2ZA 4JI0Q 5GQOA 4JI7Q 4BY7G 2QA4A 5M5YH 2YTXA 1EQQA 5FJ8H 1HNWL 2UXBL 4DAMA 3CC2A 1CKMA 1SRUA 2HHHQ 4GN3B 2UXDQ 3TS2A 5M5WH 3M85A 2Q2TA 1VQEA 1I5FA 2I5HA 2JK8A 1PH3A 2JA7G 3S17H 3S2HH 3UDXA 4HJAA 1E24A 4DR2Q 1XMQQ 4JI6L 2KENA 3HOYG 2IT1A 1FJGQ 2ZM6L 1B70B 1Q1EA 4QY7A 2ZJRA 3KF8B 3EN2A 3PIPA 1PH5A 1JMCA 4AYBE 4LF6L 3HOZG 2UXCL 1E3PA 1X6OA 2AHOB 3AYHB 1Y1WG 1PH9A 4JI1Q 4HIKA 4DV6Q 2RHSB 4DR5L 4L5TA 2I5MX 3S1RH 3BU2A 1KIXA 3S15H 2E5LL 4DAYB 3A5UA 2Q2UA 3S16H 2GVBA 4X62L 3PGZA 5C44H 1Y1VG 1BVSA 1OXSC 2MNAA 1SR3A 1PVOA 3U4ZA 2OTJA 3PSIA 1TWCH 4YHHL 1B8AA 3I56A 1X3GA 1HR0L 4DV0L 2K14A 2VL6A 4DV5Q 3KLWA 4LF5Q 1IYJB 3CCSA 1Q7YC 2OQ0A 2ZTEA 1KL9A 1RL2A 2JA5H 5LMNQ 1E7ZA 2JJQA 1XNQL 2MFIA 2OQKA 1CSPA 1P8LA 1TWFH 1X9NA 4TQUS 5IY0A 3F2BA 2VQFQ 4P73A 2JA9A 2NVXH 4A3MH 3T1HQ 3FP9A 4TVAB 3NENA 1VQBA 1SN8A 3FKIG 2UUAL 4DNIA 4DV4L 4HIDA 1JJ2A 4IFDG 1U5KA 1QZGA 2UXBQ 3TREA 1I50H 1UE6A 5IP9G 4NB3A 3A5ZB 2Y0SE 5M5XH 3E0EA 3I4OA 1BBUA 2ATWA 3H3VI 4YCVA 4DV3L 4JI6Q 1X56A 1X54A 2ZM6Q 1Q81C 3HKZE 5C0XI 4DK3C 4POFA 5FJ8G 4LF6Q 1LYLA 2GN5A 2N78A 2A1AA 5E7NA 2UXCQ 4GS3A 1PV4A 4LFCL 4LUVA 3U58A 1QVFA 3CD6A 1AE3A 4AIMA 4DR5Q 3S24A 3OTOQ 2E5LQ 2AWOA 4YCUA 2XGTA 3PUVA 4GKKL 4X65L 1C9OA 2K5NA 3GTOH 2RHQB 3GDEA 1YNXA 2YV5A 1YJNA 4DR7L 4A3CG 1XTDA 4HIOA 4KHPL 2A19A 4YHHQ 1PH2A 3HOWG 1I6HH 4PZ8A 1OXTA 4GKJL 1VQNA 1HR0Q 4QIWE 2GVAA 1PYBA 3CPWA 2R7ZH 1X55A 2CFMA 4A3GH 4LNQA 3UDFA 2Z6KA 1YBYA 4DV7L 5C4XG 1PHJA 3CC4A 1SROA 3ZJYC 3NBHB 3CCUA 1XNQQ 2JA6H 5LMUQ 3LGJA 2UXDL 4PZ7A 1SFOH 1K83H 2QGQA 5M3FH 2ZJPA 2IY5B 3FHWA 3BJUA 3CP0A 4BY1H 4PMWA 2K52A 5GAGC 1XMQL 1D8LA 2AKWB 1CSQA 2WAQG 2Z6KC 1K0RA 3NEMA 1VQOA 2UUAQ 1NMGA 5JEAJ 4C3HH 1G51A 5FLXc 1CKOA 4DUYL 2JA5G 3D0FA 3HOUG 1C0AA 2H5XA 5GROA 2R93H 3GTLH 3K8AA 1VQ5A 2VZAA 4B3TQ 4DV3Q 1VQ9A 2JEAI 4OWWB 1PYSB 1EIFA 2YTYA 2CQOA 3EIVA 3U50C 2K4KA 1B7YB 1OXXK 4YY3Q 5DLQE 2K75A 1W2BA 1N36Q 4LFCQ 1YEZA 4OONA 5IE8A 3PUXA 2ASBA 1S3OA 2NVQH 3I4MH 5IP7G
chains in the Genus database with same CATH superfamily
1D1KA 1I4HA 4WJ4A 1WOCA 2Z1CA 3SK8A 3TQYA 1JWMD 2UUCL 1CTMA 1WYDA 1OTCA 3I4NH 1VQHA 3D31A 3KDFA 1SLJA 4OXPA 4FF4A 1LTRD 4A3BB 1BXTA 4XDXA 3D4DA 3X3NA 2PI2E 4KY7A 5JAVA 3JAME 1DGSA 1L1OA 2EYPA 1MBYA 3OHXC 5J39A 1HZAA 1OO9B 1GUWA 1YHAA 3F8TA 4C56C 3ULPA 1D5MC 3MXGA 1KD1C 1XTCD 4BBRG 3CCEA 1KRTA 1RKNA 4V0BA 4OO1I 1S4ZA 1O7IA 4X3KA 1UEBA 1AEXA 4DK6C 5A2QE 3OTOL 1GUNA 5CORA 5EPLA 2MO1A 1KDCA 4KLKA 4OELB 3T4AC 3NP8A 4A3IG 1HNZL 3TN2A 3FPPA 5C0XJ 3PUWA 2F3VA 2F0KA 2EOTA 2NZOA 2YYZA 1I4PA 3PO2H 1HQMC 4IUNA 1JE5A 2R92H 2NWGA 1IL8A 3BVZA 4KHVA 2DGYA 1EQRA 4UPAA 4Z9CB 4DR3L 2PZUA 2NB0A 1HCZA 1VQLA 3A74A 5K36H 1SNCA 1CUKA 5C44B 1HNXL 2R61A 3I8ZA 3NWSA 5E3FA 5EAYA 1O7LA 3OW2A 3T51B 1ILQA 2F0UA 3DEOA 4QMGA 3PQIA 4JVZA 1AP0A 2VNUD 5KRUA 2F03A 3J7ZC 2RVLA 3M3YH 2BDNA 4LF4L 2KHSA 3V2TA 4JI4L 1HUMA 3A55A 3MXUA 2NVXB 1WCMH 4ALPA 3OW7A 3TZUA 3S14H 1HA5A 1Z7TA 3J81E 1B50A 1EIHA 4RAUC 5E4WC 2QKIC 1PFSA 4YCWA 5HY6A 1CHQD 4CKCA 1VQDA 4A93H 4IPDA 3G48A 1AE2A 5KYLA 2VUMG 2ZT9C 4RFBA 1B1ZA 4GZYC 3BYYB 5I2YA 4IFDJ 1SYGA 1TS3A 2MP1A 1ZYRD 5IYBG 5C3EH 2F4VQ 1UAPA 3HOVB 4FNFA 1NTGA 5DM63 3D3RA 2UUBQ 1EY7A 3GTJH 4C2MB 1KC8C 4MTKA 4JI8Q 1WD1A 4A3MG 3CCJA 2ZXRA 2JA8H 3P75A 1SMXA 1EIYB 1JR0D 1WFQA 4ZLTF 5NUCA 4HR7B 1ENCA 4EQNA 2K50A 3Q0AA 1F2YA 3NHHA 4UDUC 4DPGA 1IBML 3S1NB 2SNSA 1VQFA 3J80E 4IQZA 1SYCA 4X64L 1RTOA 4JPBW 3SE0A 2F1MA 1H9SB 3A56A 3IRBA 2WKDA 1DCZA 1GXDC 4N9TA 2L55A 4FF2A 3PO3G 3VA7A 3H15A 2DUDA 4ZQ3A 2D0PA 1MJCA 3OIPA 1YHBA 4A3FB 1ET6A 3RZDB 2BH8A 4A3KH 3VYTA 2F0GA 3AB9A 1R9TH 4IFDH 1TR5A 5KIXA 3JAMc 3UE1A 4K0KQ 3NQIA 4A3GG 3DWAA 2KBNA 5ELDA 3E6ZX 3NK9A 1PDQA 2WFWA 4RCOA 4JI2L 1LT6D 5JEAH 4A3EB 3M4OH 3MVVA 5CV5A 2OWOA 3VR3A 2VS1A 2L5TA 1EZ6A 4QCLA 2BCOA 2KEDA 4BY1G 2R3ZA 5LMNW 1A63A 1PLFA 1H95A 1TWHH 2IW3A 2F0JA 1KDAA 4MZ9A 1OXVA 4GLVB 1SMYD 2YU9B 4JOIC 3GTKB 2MO0A 3ND8A 1MIUA 1S5ED 3OWEB 4CHTB 5LL6S 1SYBA 4DUZL 2NVTH 3CW2C 4PQXA 4RMFA 1FGBD 3QO2A 5IYCH 2ICEC 2D62A 1DOMA 4A76A 1GVPA 4B3RL 2PW7A 4KJNA 2Q8IB 4C3JH 3QOLA 2VQEQ 1WVLA 1UE7A 1YHQA 2PPBC 4HTHA 4RWSC 5JJLA 5AJ3L 1PMRA 3G71A 4IURA 2A68D 4TSSA 3UI2A 1NUCA 3HP3A 1EY9A 3NSWA 1GM5A 3IFDA 3T1YQ 4LFAL 3CCLA 4TRDA 1GHJA 1V1QA 4JK1C 4PG3A 2EYLA 3BG3A 3J81c 1IBKL 3Q8DA 2IHEA 1HXYD 4XT1B 1CI3M 1H9KA 5IP7H 2F0DA 3R2TA 3HG9A 2E76C 2XVSA 4L5SA 4X66Q 2FMMA 4HJ8A 2DY7A 2EJFC 5D3DA 1K3RA 1CT1D 1PTOH 1N34L 3H0GH 4JW0A 1LT4D 3B6YA 4BXXG 3UDGA 3PO2G 1I3QB 4LF7Q 2K33A 4OX9L 2Z4IA 1AH9A 4HIMA 5GAEC 1L2FA 4HJ9A 1V1OA 4B3SL 2CQAA 3NWTA 1PH7A 1WD0A 4JI5Q 1RJTA 3L0OA 3O13A 2IX3A 1QZHA 3VYUA 5FLMH 1FNWA 4R4TA 1W6KA 1QNUA 3DEPA 3QR8A 2B2VA 2XWBB 5IGFA 5JJKA 1IYUA 2E75C 1MSHA 4IPGA 3C1EA 3J80c 1N32L 4NKLA 1K8AC 4A4IA 1CQFA 3DMUA 1EFWA 3HOYB 3RZOB 2B8GA 1WCMG 4BBRB 3NPPA 1ASZA 1XWEA 3I73A 1LACA 3BDLA 2OEOA 2EXDA 1TU2B 3IFTA 4ZYSA 4NXNQ 1Y1VB 5BR8L 1SBBB 2RCFA 4C3IG 4LF5L 4IUPA 5C5LA 5C0XG 5IGGA 2BH2A 1H9JA 3SGIA 3S15H 2VQFL 2Q2HA 2PQAB 4ULLA 4R4QA 2DJFC 3U4VA 1PZJD 3S1QH 3SXHA 5FO9B 1QOHA 3I2ZA 4JI7Q 5EGTA 2YTXA 1EQQA 4DAMA 4GN3B 4ZAIA 3FKIB 3M85A 5BN5A 2I07B 1PH3A 1F9QA 3S2HH 3NTHA 4WJWA 2IT1A 3T16A 2ZM6L 2ZJRA 4OO1H 3PIPA 3GQBA 2E2IB 5ELFA 1U4RA 3AYHB 5I2XA 1PH9A 4HIKA 2PO4A 2F0WA 4DV6Q 2ENBA 5M5YB 2E74C 2GVBA 4X62L 3PGZA 2MNAA 1F2LA 1LTGD 1PVOA 3MXPA 2OTJA 5CC4A 1B8AA 5CV8A 5T1IA 1HR0L 4DV0L 4DV5Q 4G7OC 4FYDA 1JCKB 3P1HA 1Q7YC 2ZTEA 3I91A 4G7ZC 3HOWB 1SAPA 5LMNQ 3SDZA 2MFIA 2OQKA 1P8LA 2NBFA 4TQUS 5IY0A 3S1RB 1HTLD 1PZKD 3NENA 4IFDG 4S3SA 1R4QB 1I50H 3IAYA 1RF2D 3A5ZB 2Y0SE 3Q22A 2D2CC 4KKSA 1VMCA 2ATWA 3H3VI 1NR2A 1X54A 4K6LA 2NUCA 5C0XI 5JPMC 4DK3C 4POFA 5FJ8G 4LF6Q 5C6AA 4GS3A 1PV4A 3MXNA 3QB3A 1ZXTA 5IT9L 1CK1A 3OTOQ 5JVH3 2A6HD 4X65L 4K6DA 3A7AB 3BDOA 1JC7A 1I6HH 1ICWA 1KNEA 4GKJL 3TP6A 3QG1A 4R9WA 1YBYA 1HFGA 3CCUA 4KJOA 2UXDL 4M8AA 2PZWA 1ZYRC 1SFOH 1K83H 4C3JG 2QGQA 4HEDA 2G5DA 2K05A 2ASBA 2AKWB 2A69D 4WORA 4H44C 4DUYL 2H5XA 4K5VA 1VQ5A 4A3GB 2JA6B 5I6YA 2JEAI 4OWWB 2JP1A 3DUZA 4LFCQ 5IE8A 2ZXOA 3I4MH 5IP7G 5CBAE 2F0PA 3RN5A 2K04A 3J7AF 3L2PA 2XIWA 4N8FA 1NCVA 2H1EA 1WTVA 4KHPQ 1E2ZA 1BF4A 4F7XA 1N8RC 1ESRA 3A0JA 3H0GG 1CKNA 2KHIA 5KNBA 2XRSD 4AYBB 1QUQB 5M3MH 1SEBD 1MJEA 1T9HA 5GADC 4JV5L 2QILA 3I55A 2R7ZG 1JB7A 3BZCA 3JAML 3I4NB 5FLMG 5EKIA 3A54A 4QGUA 2DY8A 1L1OC 4B08A 4ZUIA 1YI2A 4KN7C 1KAWA 3KK7A 3MEFA 1YJ9A 5LL6X 2VUMH 4QB4A 3HEJA 3KFUA 3OMGA 1NJIC 2CH4A 3C2PA 1SMYC 2VXWA 5A2QL 1BR9A 4HJ5A 1IBMQ 5IYBH 2XTIA 1UE5A 4DFAA 2KCTA 4DR6L 4CKBA 4DR1L 3VDYA 3CQZH 4APVA 3GTGH 1XNRL 1V1PB 1RIPA 1HZCA 1QVCA 4RHRA 2B29A 1HH2P 3M9BA 1TQOA 2CCZA 2PI2A 3AFPA 4O0AA 5D14A 2WB1E 1BCPF 1HRJA 2A68C 2R92B 3J7YW 2A8VA 2NYZD 3ICEA 1X3EA 4DR4L 1CM9A 4B3TL 1HA6A 2B2WA 4TKOB 2BOSA 2WKCA 2XRQD 2E2HH 1STEA 1EU3A 2M9VA 2HDMA 2SDFA 4LF9L 5CR3A 4JI2Q 4YY3L 1JOOA 1EY6A 3PO3H 1L0WA 2F4IA 2HUGA 3KDFB 3HOXH 1AZPA 1LM0A 3CXCA 3CCVA 1QNKA 1IW7C 2FFKB 4AH6A 2KHJA 4OO1G 4JI3L 1WTRA 3J81L 5EKLA 1EQTA 3RLFA 3M3YB 1L1OB 2K03A 1K28A 1GKHA 2Y0SG 2JE6I 3NXWA 1NR4A 4A3DH 1WCMB 4EQOA 1VQGA 4Y52H 2K1BA 3J81i 5C4ZA 5COYA 4FF1A 3UE0A 1VQCA 1F9RA 5EKKA 3KYHC 2A5HA 1TWAH 1JWSD 4L5QA 1Q90A 5J3BA 4DV2Q 4A93B 5IGBA 1KABA 1K3BC 1IBLQ 1JORA 4YWLA 3IKJA 1S72A 2O4XA 2B63G 4IALA 2MUYA 1TXYA 2N3SA 1TS2A 1PRTC 5HGQA 3M4YA 2WIIB 1PH6A 5C3EB 1JJCB 1RD9D 4LFAQ 2ALYB 3M4QA 4ZRZA 1E1OA 4P75A 3W1GA 3WOEA 2E8GA 1Q1BA 3J80L 2JA8B 3DXJC 4KD3A 4HSVA 5E1FA 2B2YC 1E1TA 5CBEE 4GNXA 3A7LA 1TY2A 4LF8L 3BYTB 2MQHA 3KUPA 1VQAA 4YWKA 2L4NA 1VQMA 1A3UA 1QG7A 1YVCA 3J80i 4DV1Q 4R8IA 1Z47A 4DA2A 1IKLA 1TWGH 1U4LA 3CCMA 2RA4A 1RHPA 3NUCA 3RD4A 5ELNA 3KJPA 2M00A 1MD2D 2OF1A 2HIXA 5ELEA 2BA1A 4B3SQ 4FXKC 2DNEA 4XXEA 1H9MA 5EPKA 3M7NA 2EJMA 1C4QA 3CMEA 2LY7A 4A3KB 1R9TB 3VR5A 5KNDA 1KLUD 1G8ZD 4UP7A 4BXXH 1DJRD 5JPNC 3GV3A 2N8NA 4A3CH 1D6EC 1N32Q 2Q2IA 1KQSA 3S1MB 3MTSA 3M4OB 4FXDA 2K5DA 1PRTB 3AFQA 2E2JH 4DK0A 5C4XH 4IJHA 1TWHB 1PTOC 4LUOA 3I4MG 1TIID 3E3XA 4NXML 1JJGA 3OOCA 4JCVE 3RR5A 4LFBQ 2JSOA 2CKZB 4K8IA 5BR8Q 3K80C 4N8X1 1JT8A 3SHLA 1Y8PB 4B3MQ 2NVTB 3GTMH 4HCSA 5IT9c 3ZYYX 1I94L 2NZHA 3TP7A 5M3MG 3K57A 2HDLA 1N33Q 4A3JG 2DNCA 1S40A 4X3UA 2F0NA 1A0IA 1LV9A 1D1IA 1YNNC 5C4JH 2IX1A 2NVYH 2K5WA 3H3VH 4C3IH 2ZTDA 5C0XH 2EQSA 2WB1G 3E9IA 1K73C 4K2KA 1HFNA 1IKMA 1EWCA 2WAQE 5L37A 2JN4A 2A6HC 2XSCA 1L0XB 4EGVA 1CA6A 3STBC 3HKZG 2UU9Q 4X62Q 4CDFC 2NTSA 1EY0A 3C1FA 1K8OA 4AQYL 3PUYA 4DAYA 1KXLA 3QOJA 3EVQA 3PMFA 4DV0Q 4JI0L 4V190 3MZ5A 1B9MA 3PIOA 1PTOB 1SNDA 5C3XA 3H0GB 3A8JE 1ICFB 5BN4A 2A73B 1XMOL 2A69C 2EYJA 1PH4A 5FLXE 4DR2L 4BBSG 1FL0A 1WJJA 4DXGA 5KNCA 1FJGL 3VR2A 4NMZA 1SXTA 1XXGA 4P74A 5TSSA 4JI1L 1M1KC 2QEJC 1S5FD 4WJ3M 2B2VC 3T53B 4HAEA 4B9WA 3HOXG 4A3BH 2RBMA 1NAPA 1EL0A 2QW7A 3KF6B 4ZCKA 5ELBA 3PF5A 1X3QA 3BVMA 1VQ8A 1PFBA 2EY6A 4A3DG 3JC66 3K7AH 4UP8A 3T1HL 2Z6BA 1SJED 1XX8A 5GQOA 1SYFA 1HNWL 5FJ8H 2HHHQ 5HGTA 1GUSA 3OSOA 2UXDQ 5M5WH 1BDOA 1VQEA 2JA7G 2F0FA 4HJAA 2A74C 1MGSA 3NBHA 2M2LA 3S15B 1PH5A 2UXCL 3QIAA 1LTBD 1X6OA 2AHOB 5IGEA 1SE4A 4RA8A 1Y1WG 3S1QB 4CJ2C 2RHSB 4DR5L 1KIXA 2E5LL 1LO5D 2Q2UA 3S16H 5C44H 1IHZA 4QUCA 2PMZB 1OXSC 3DM1A 1SR3A 4RGMA 4YHHL 5BN3A 3S2HB 2XWJB 4CGYB 3WDNA 3KLWA 2IJ0A 4F87A 2Q8TA 1XNQL 4G7HC 4P73A 3EFXD 2JA9A 2NVXH 4I7ZC 1PXUA 3FP9A 3OMCA 2QDLA 1SN8A 2UUAL 2HCIA 4B9XA 1Q3LA 1QZGA 4PNYA 3TREA 2UXBQ 1A2UA 1D5ZC 4NB3A 5K5PA 2B2UC 5M5XH 3E0EA 1KDBA 1BBUA 1IW7D 3HOUB 3BVGA 1G6ZA 4JI6Q 1X56A 2EY2A 5HURA 1LYLA 2N78A 3CD6A 2BE5D 1ONLA 3I3CA 3FEWX 1B2TA 4Y7NB 4CJ1B 1I50B 5G3LD 5C5MA 2SEBD 4YCUA 3PUVA 5DAUA 5D3IB 4A3CG 1EYCA 2AUJD 1PH2A 4PZ8A 3TDQA 2D5DA 2GVAA 1EQVA 1PYBA 3LWEA 2R7ZH 1X55A 3T13A 3UDFA 2Z6KA 5C4XG 1SNMA 1PHJA 2Q8RE 3ZJYC 1UUPA 4PZ7A 1JOQA 5D65A 1PRTD 1FYCA 4YIJA 4PMWA 5GAGC 1D8LA 3MWYW 2WAQG 3NEMA 1VQOA 2AQ1B 3MA2B 4DF7A 2JA5G 5KEEA 1C0AA 5FLXc 4IUUA 1SE3A 1EYAA 1I6HB 2X6GA 1T5EA 4ODGA 5GROA 2R93H 2EYFA 3G7LA 1JB3A 1EY4A 2FJ2A 5IOCA 4OIJA 1B44D 4B3TQ 1F2MA 4X3TA 4DV3Q 1SNQA 1VQ9A 1EIFA 1B7YB 1SFOB 1K83B 4YY3Q 1VF7A 3HGBA 2X6LA 4OONA 5E4XA 3PUXA 1K0SA 1S3OA 4RGNA 4A3IB 2NVQH 1T5XD 4GKKQ 3TP5A 1CZGA 2SOBA 4EQPA 2J7ZA 4DAPA 2JQOA 3EJIA 4DR7Q 1M90C 2C9OA 2QEXA 4MTNA 3TRZA 3K7UC 3SEBA 4KKUA 3I7FA 2HQLA 3FDTA 1E2VA 1WTHA 4DV7Q 4KY5A 2ES2A 3V96A 1IZ6A 4XTCS 4H02A 3I4MB 3MXNB 2OTLA 4PZ6A 2FMCA 1J6QA 1E0BA 2E2DC 2NN6I 2KUMA 1QCBD 3RN2A 3A8IE 3R93A 3H94A 4NP5A 2G9DA 4XQNA 4G57A 2WP8J 5M3MB 4LJZC 4C3HG 2LXKA 1EYGA 5CV6A 4FDBA 1PTOD 3F2CA 2IX0A 1SYEA 2LXJA 3PV0A 3S17B 4IUVA 1AFPA 4LMQD 3NBIA 1U4MA 1UNSA 2VB2X 2ZJQA 2UUCQ 1VQ7A 4A3BG 3PUZA 1VQKA 2VUMB 2B63H 1A6XA 1A15A 5FO7B 5JJZA 3S9WA 3SK5A 2F4VL 4P72A 1N9WA 3HKZB 5FK9C 4GLXA 3MHBA 5FKAC 4FF3A 4JI8L 4DKAC 2AUKA 1ZEQX 2PMZE 4R4OA 1I4RA 1YNND 4IUQA 3TBIB 4QF4A 1STGA 1TWFB 4FO2A 2AQ2B 4IOAA 1WTXA 4A3MB 4OHJA 5M9OA 2FHTA 2N49A 2F0HA 1Y14B 1DYQA 4KTAA 3KOJA 2B2WC 1Y8NB 2EDGA 4QIWB 2WACA 3PIP3 2HIVA 1WI5A 3STBD 1YZ6A 3HFZB 1HNZQ 1Q8IA 3M4PA 3GP7A 3VYRA 4L5RC 2I0QA 1CZWA 1V43A 2EYOA 3W2DA 5IYDH 3SVMA 2SNMA 5C44G 1SNOA 1Q86C 3DWQA 4OEMB 4XT3B 5EPJA 4DR3Q 3PO3B 4RGOS 3GTQH 4OIKA 3HOXB 4BY7H 3FRPB 1HNXQ 2F0OA 4L6TB 4K0KL 3K6OA 2C35B 2KCNA 4KD4A 1NBWA 2F0QA 2XNAC 2TSSA 4A3DB 4K14A 4MNOA 2ZXPA 4LF4Q 3HOZH 1AW7A 3VR4A 5H1SE 1U9RA 2K01A 2MHVA 5IGCA 1ENFA 4X3SA 1YJWA 4JI4Q 1EOVA 1SSOA 3NTIA 4H0LC 4IOCA 2VW9A 4KHZA 5DNFA 1P16A 4BY1B 2BA0A 1TWAB 1E22A 1K8MA 4CJ0B 4YWMA 3GTLB 1MSGA 1F9PA 1MKHA 4CDEC 1JICA 3OPOA 1X3PA 1LT3D 4KKTA 1Q82C 3W1BA 4FVMA 3HOVG 3J7A5 2EVBA 4IO9A 3G4SA 1WTOA 1J5EL 1IL2A 2OCEA 3L7ZC 4A3JH 4GNXC 5IP9H 1NMFA 4BWGB 1EEFD 2E2IH 4HCEA 3GD7A 3UDIA 2RCNA 4KN4C 4UP9A 1M8AA 3OYYA 2C5CA 3ULLA 1TS4A 2CWAA 4L8JA 3JAMi 2ICIA 3C46A 1XMOQ 3RNUA 5ELOA 3BZKA 2R93G 2EE1A 3H3VC 4X64Q 1STBA 2RSOA 1EWHA 4X66L 3HOWH 1QWYA 2X69A 2CWPA 3BS1A 3GTPH 4A3FG 2D0OA 4PV1C 3L9AX 2I46A 4LF7L 3S2DH 4ABNA 3CU7A 4GOPA 3I72A 1V8QA 3PO2B 1Z9FA 2P5ZX 1QVGA 2CVRA 4LAAA 1XPUA 4BBSH 1Z6HA 4FXGC 4JI5L 4K5WA 1C8CA 1Q46A 4Q0FA 4GLAC 4A3EG 1PFMA 1QJOA 2D9UA 4J8QA 3H91A 4DAVA 2JEBI 1JOKA 2E2JB 1SYDA 3W3AA 5C4XB 3F2DA 1HR0W 2R7DA 4R4CA 1HNWQ 4GN4B 4GNXB 1RDPD 3QJYA 4K2LA 1ENAA 4DXFA 3DM3A 1MI2A 2PNRC 1KAAA 3AU7A 3CHBD 2L0CA 1RTNA 5J1ZA 3FMCA 2IHFA 1HQRD 1M4VA 3EROA 2B2TA 3GTMB 3K81C 2BE5C 1HHVA 1QUQA 3S14B 4NXNL 3TZDA 4DUZQ 1YITA 3KF8A 1F9SA 4KI0A 1EYDA 4B3RQ 1BUVT 1YNJC 2K6AA 2OXPA 4JBJA 2NVYB 5C4JB 4JYAL 1VQPA 4C3IB 2YTVA 5GAHC 5JOBA 3AMUA 2EYHA 3E0JA 4XQQA 2JA7H 4O2DA 1X32A 2K7VA 5AJ3Q 1KHIA 4JI7L 1X65A 4ZKBB 2PNHA 4JG2A 1OXUA 1WTWA 2B39A 3RUZA 3ULJA 4QQBX 5JJIA 4JC0A 1Y1WH 4RG1A 5IWAL 1LT5D 1XPOA 4R8NA 2GA4B 3DWPA 3CPFA 1UE1A 3K0XA 3G6EA 4POGA 4UY8C 3P7JA 2EJGC 2KECA 1IBKQ 5I9PA 2MJ8A 1VQ6A 1GUOA 1V1PA 3GTJB 1C7YA 5FLXL 4DV6L 3HZXA 1VF5C 4HJ7A 1B53A 1LABA 3U9SA 1A8VA 5CV4A 3K5MA 1XYIA 1ET9A 2L11A 1PA6A 1K9MC 4KY6A 1D5XC 2B3GA 3E9HA 3HKSA 2CHBD 1S5BD 2LS01 1N34Q 4NPSA 4DV5L 1LTTD 3K0YA 3WWVA 2PQEA 1SE2A 5LMNL 4OX9Q 1HZBA 5IYDG 4ZKCB 4BA1I 1BBWA 4QJFA 1I6VC 4IUTA 3RLNA 1GHKA 4BY7G 2CH4W 4HMJA 1W6JA 1AZQA 3CC2A 1SRUA 4J1MA 1JQYD 4WRDA 2DJGC 5AFWA 2NN6H 3HOYG 1E24A 4HSPA 1WTQA 1JMCA 1Q1EA 3K7AB 5DEHA 4LF6L 3HOZG 4AYBE 1O78A 5EBDA 4HN7A 4L5TA 3BU2A 2LFNA 5IGDA 4ILWA 4DAYB 2CW0C 1Y1VG 1BVSA 1LTSD 5M5WB 3U4ZA 1TWCH 1X3GA 1H9RA 3RMHA 2K14A 2VL6A 3SK6A 1EU4A 4LF5Q 2JA5H 2OQ0A 1RL2A 2JJQA 2BDOA 1CSPA 1ML0D 2Z9HA 3LX0A 1X9NA 2O5JC 1STHA 2K32A 2VQFQ 1BBXC 3D6WA 3TP8A 3S16B 2EXZA 4O1NA 4DNRB 1EEID 3FKIG 4DV4L 4C3JB 5I9OA 5IP9G 4Q5VA 1TKWB 3OWFA 2LKVA 2OT2A 3D4WA 3I4OA 4DNTB 1A3VA 1DOKA 2ZM6Q 1Q81C 3HRZC 3C3LA 4RCNA 3MFGA 4LFCL 3U58A 3ERQA 3H09A 4NW2A 4ZK9B 1MHWC 3LNNA 4MHEA 1BQQT 2AWOA 2XGTA 3GTOH 1C9OA 2RHQB 3GDEA 3A8KE 1YJNA 1TT2A 5M5XB 4KHPL 3P20A 2A19A 1STAA 3HOWG 1OXTA 1HR0Q 2H4OA 2L1BA 1GUTA 4LNQA 3CC4A 1SROA 5LHY1 3NBHB 2EZVA 1EY5A 5M3FH 2IY5B 3FHWA 3BJUA 3CP0A 2K52A 1XMQL 1CSQA 2Z6KC 1K0RA 2JXMB 3DHQA 5JVG3 1NMGA 5JEAJ 4C3HH 5IODA 1CKOA 2EYMA 1FR3A 1GJXA 1FNVA 3K8AA 3FPUB 4LK1C 5I6WA 2R7ZB 1SJHD 4MN3A 1PYSB 3OIQA 3EIVA 2K4KA 5CV7A 1OXXK 4IZ8A 4QUFA 2K75A 2O5IC 1YEZA 5T1GA 4C3HB 2B2YA 4LW1A 4X65Q 1A62A 2R93B 3EA6A 2EPBA 3HS0C 3GO5A 1Y69U 3K5NA 3TS0A 1WTPA 4XYQA 4GKJQ 1G2SA 1G291 4DGZA 2PYKA 4UHVA 1G2TA 2RDFA 1YIJA 2F52A 5C4HA 5CMDA 2NVQB 3WOFA 4QL5A 5CGKA 2KOLA 1NSNS 3PIO3 4CDDC 2F0TA 4DUYQ 1G6PA 2JA6G 1GUGA 1KRSA 3S1MH 1VDZA 2R7FA 2F3IA 3F1ZA 3AEVA 2IWHA 3Q6SA 1J8IA 2EY1A 1A3TA 5A35A 3K59A 1LLRD 5CV9A 1FGUA 3DLLA 1PH8A 4OWXB 4A3LH 2L9HA 4KV6A 2RF4A 1ZKOA 2ID0A 1EWIA 2EIFA 2A6ED 4LUZA 5LMUL 2Y0SB 2JYOA 4AYBG 3CF5A 2HT1A 3QWNA 5EJWA 1LTLA 3R3OA 2NTTA 1S5DD 2FINB 3FVQA 4C1NI 2K5VA 1H9SA 4DV2L 3VA5A 2RDGA 1DZ1A 1Y8OB 2WV6D 1KTKA 2J4XA 3F2UA 1SNPA 1IBLL 3I4NG 3CRKC 1J5EQ 1B4OA 1PYWD 1EIGA 4JV5Q 1GD7A 4H13C 1BKBA 3Q23A 1KNAA 4BA2I 1N36L 5G3LF 3KF6A 4XIGS 4GN5A 2B63B 3SR1A 1HUNA 5ISRA 3ERSX 1S5CD 2NN6G 4IN3A 4R1JA 1Q8KA 4G4KA 3HOVH 1BCPC 1XJVA 1YNJD 1VCIA 3CKIB 3NE5B 3W5OA 4C2MH 2FXQA 4DR6Q 4JBMA 4DR1Q 2L15A 1QILA 1PRTF 2VB3X 1U0LA 1XNRQ 3EBEA 4N9PA 4DV1L 2AMCB 2O2LD 3LWUA 2F3WA 3S1NH 1X3FA 2R92G 3PCOB 3L3OC 3M7GA 4IPCA 5K36G 4DR4Q 4J6HA 4K8JA 3GTQB 3MC0B 3CMAA 4LF9Q 2B8FA 4BY7B 1BOSA 2KJXA 2MPMA 2ZTCA 4A3FH 1JE4A 3RZDH 2F0VA 1FD7D 3J7AV 2HCCA 4OL7A 2V1CC 3D6CA 2Z8LA 4JI3Q 4JBWA 3Q24A 4IJLA 4U68A 1I4XA 2K5HA 3HOZB 4CBVA 4A3EH 3AQQA 4WFN3 3X3MA 4ME3A 4JBKA 1B3AA 2RDHA 1UEAB 2PZTA 4LFBL 1CQVA 1BCPB 5EBCA 1V9PA 4A93G 1O80A 1DM0B 4CKEA 2L12A 2YU9H 4X6AH 4B3ML 3J81j 3GTKH 4JYAQ 3KLSX 1W3SA 1ASYA 2AWNA 1HJPA 1EFID 3ER0A 2F0MA 4JOIA 5M3FG 3I4LA 1N33L 3RLOA 1PTOF 1QB5D 2I5LX 5C3EG 3KBXA 2CW0D 4A75A 4P71A 5IWAQ 3CCQA 4A3JB 1VMPA 3CCRA 4LWCA 1I4QA 1VQIA 2VY3A 2JA8G 1G91A 1UWVA 3TEHB 4R4IA 1DD2A 1IYVA 1HTPA 1ESFA 1VS0A 2WB1B 3CC7A 2UU9L 2EY5A 5J22A 1II3A 1PZID 4LF8Q 1LTID 1EZ8A 2UUBL 3N52A 2IL8A 1DONA 3VYSA 4BS9A 3KJOA 3K58A 3HOUH 2LSSA 3CQZB 5EQ0A 4GOPC 4XQJA 1CA5A 4EQ5A 1IXRA 3GTGB 3GTPB 3CAMA 4EX5A 2B2UA 2HD3A 1R4PB 1JWUD 4OWTB 3NTKA 3G6JB 4A3KG 3S2DB 1EUJA 5I4DA 2Z0SA 4Y7NH 1J9OA 1I3QH 2KCMA 1CKNB 1TY0A 2PQAA 3VR6A 4BBSB 2HQEA 5JEAG 2N55A 4M1UB 2E2HB 4KK7A 1CHPD 2IPKD 4KMUC 5CYUA 1NE3A 3IL8A 3K5OA 3I90A 2QCPX 1NY4A 1VQ4A 4A3LG 1SDFA 2K5QA 1F77A 2MGSA 4ID6A 5KYIA 4J15A 1VQJA 1PH1A 3R8BA 3BDCA 1TS5A 2B2TC 2R6GA 4NXMQ 3PF4A 3I70A 3V05A 4HMIA 3MEHA 4H7BA 1GO3E 5ELCA 3HOYH 5IYCG 3RZOH 1SE8A 4UAIA 4BBRH 5FOBB 2HHHL 1C48A 3SK4A 4EVOA 2RSNA 1I94Q 1DOLA 4IPHA 5F2DA 1Y1VH 1K8GA 1XPRA 4DV4Q 4A3IH 3TMEA 4RKBA 1FVIA 4GOPB 2JA7B 1L0YB 4F8MA 1HZ9A 1FNUA 2KVMA 4NDXA 4E6IA 1Y1WB 3NQTA 1RODA 4PMCA 2QF7A 1LUZA 3U9OA 2VQEL 1Q12A 1NNXA 3FKIH 2PW5A 4IFDI 5DM73 1CFMA 4AQYQ 3T1YL 3NELA 1D2BA 3TSSA 3EQLC 4JI0Q 2J0TD 2QA4A 4PMBA 2F0LA 5M5YH 2UXBL 1CKMA 1F2ZA 3D4RA 2K28A 3KLSA 3TS2A 2Q2TA 1TWGB 3GV6A 1I5FA 2F0SA 2I5HA 2JK8A 2KQ3A 2F0EA 2XN9C 3MAQA 3S17H 3UDXA 4DR2Q 1XMQQ 4JI6L 2KENA 1FJGQ 1B9NA 1B70B 4QY7A 3KF8B 3EN2A 3KLRA 2V4DA 4XYOA 1E3PA 4JI1Q 4U673 2KCCA 4L63B 1GOZA 2I5MX 3S1RH 3A5UA 4RGTA 2LMCB 4ZUJA 1O7ZA 3PSIA 2TMPA 3I56A 2WINB 2Z4HA 2A6EC 4DN4M 1U4PA 1IYJB 5FO8B 3CCSA 1KL9A 1EOTA 1E7ZA 1TWFH 1HPCA 4P2CB 3F2BA 4A3MH 3T1HQ 2PCFB 3MFYA 4TVAB 4K5XA 1VQBA 4DNIA 4HIDA 1JJ2A 1U5KA 1TWCB 3CRLC 3H6MA 1UE6A 3ITPA 3R2IA 4RKLA 4RH6A 1KLGD 2WAQB 4DK1A 2JA5B 3ND9A 1BCPD 4YCVA 4DV3L 5IT9E 2F0IA 1E2WA 1EY8A 3HKZE 4OGQC 2UXCQ 2GN5A 2RKSA 5IIFA 2A1AA 5E7NA 1QVFA 1DXMA 4LUVA 1BNZA 1AE3A 4AIMA 1I4GA 4DR5Q 3S24A 2KEEA 2E5LQ 3T56B 1QE6A 4GKKL 2K5NA 1RCVD 3N6RA 1YNXA 2YV5A 4DR7L 1STYA 1BO0A 1XTDA 3D8GA 2G9HD 4HIOA 4F88A 4YHHQ 2NZ1D 1VQNA 4QIWE 3CPWA 1AN8A 3ONAB 4A3GH 2CFMA 2RQXA 4I7AA 3K5LA 2AQ3B 1STNA 5KGUA 3E5SA 4DV7L 2DN8A 1XNQQ 2JA6H 5LMUQ 3KBGA 3LGJA 2ZJPA 2N88A 3GTOB 4BY1H 1A2TA 1LTAD 4FP5D 4DU9A 4I65A 2UUAQ 3HOUG 1B3QA 3URYA 1G51A 3D0FA 1O7YA 2KA7A 4CDCC 4MIUA 3GTLH 1ILPA 2QDBA 4RHSA 2VZAA 4ME5A 2YTYA 2CQOA 3U50C 4C1NK 1W2BA 5DLQE 5C3WA 5M3FB 1N36Q 1PFNA 4O42A 1D7QA 3BZDB 1TVXA
chains in the Genus database with same CATH topology
4LW1A 4GKKQ 4X65Q 1WOCA 4WJ4A 3RN5A 1A62A 2JQOA 3TQYA 3L2PA 4DR7Q 1M90C 2UUCL 1WYDA 3GO5A 4KHPQ 2QEXA 4MTNA 1OTCA 3TRZA 3K7UC 3TS0A 3I4NH 1N8RC 3A0JA 1VQHA 3D31A 3KDFA 4GKJQ 1SLJA 4OXPA 3H0GG 3I7FA 2HQLA 1G291 1CKNA 2KHIA 4DV7Q 2PI2E 1YIJA 2ES2A 2F52A 1IZ6A 1QUQB 4XTCS 5M3MH 1DGSA 1L1OA 4H02A 3MXNB 1MJEA 2OTLA 4PZ6A 1T9HA 5GADC 1HZAA 4QL5A 4JV5L 1YHAA 3F8TA 3ULPA 1J6QA 3I55A 1KD1C 2R7ZG 2NN6I 4BBRG 3BZCA 3CCEA 4DUYQ 1JB7A 1KRTA 1G6PA 5FLMG 1KRSA 4QGUA 3RN2A 2JA6G 3S1MH 4OO1I 2R7FA 1L1OC 2F3IA 1YI2A 1KAWA 1O7IA 3F1ZA 1UEBA 3AEVA 4DK6C 3MEFA 3OTOL 1YJ9A 2WP8J 2VUMH 2MO1A 4KLKA 3KFUA 4A3IG 1NJIC 1HNZL 2LXKA 1FGUA 3DLLA 1EYGA 1PH8A 4FDBA 4OWXB 5C0XJ 4A3LH 3PUWA 3F2CA 2IX0A 4HJ5A 1IBMQ 2YYZA 2LXJA 2NZOA 2RF4A 3PV0A 3PO2H 5IYBH 2XTIA 1UE5A 1JE5A 2R92H 2KCTA 4DR6L 2DGYA 1EQRA 2ID0A 1EWIA 4UPAA 2EIFA 4DR1L 3VDYA 4LUZA 4DR3L 3CQZH 4APVA 5LMUL 2UUCQ 2ZJQA 1VQLA 1VQ7A 1XNRL 3A74A 1RIPA 3GTGH 3PUZA 4A3BG 1HZCA 1VQKA 1CUKA 1QVCA 1HNXL 4AYBG 3CF5A 2B63H 2HT1A 1LTLA 2B29A 1HH2P 2F4VL 3M9BA 2CCZA 2K5VA 1N9WA 2PI2A 4P72A 5EAYA 3AFPA 4DV2L 4O0AA 3OW2A 4GLXA 2WB1E 4JI8L 2A8VA 4DKAC 1IBLL 3I4NG 2VNUD 3ICEA 1X3EA 4DR4L 1J5EQ 2PMZE 3J7ZC 4B3TL 4R4OA 3M3YH 4LF4L 4JV5Q 2E2HH 1GD7A 4JI4L 4IOAA 4LF9L 1BKBA 4JI2Q 4YY3L 4BA2I 1WCMH 2N49A 4ALPA 3KF6A 1N36L 4XIGS 1Y14B 4GN5A 3S14H 1L0WA 3PO3H 3KOJA 3ERSX 3KDFB 3HOXH 1LM0A 3CXCA 2NN6G 4R1JA 2HIVA 1PFSA 1WI5A 4YCWA 3STBD 1YZ6A 4AH6A 3CCVA 3HFZB 2KHJA 4OO1G 1Q8KA 4JI3L 5HY6A 1HNZQ 3HOVH 4A93G 3RLFA 3M4PA 4L5RC 1XJVA 2I0QA 1VQDA 1VCIA 1L1OB 4A93H 3W5OA 4IPDA 1V43A 4C2MH 3G48A 1GKHA 2FXQA 2JE6I 2Y0SG 4DR6Q 5IYDH 4JBMA 1AE2A 1Q86C 5C44G 4DR1Q 2VUMG 4A3DH 2L15A 4DR3Q 1VQGA 3GTQH 1U0LA 4IFDJ 1XNRQ 4Y52H 3EBEA 4DV1L 2AMCB 3J81i 4BY7H 3UE0A 1HNXQ 1VQCA 5IYBG 1X3FA 3KYHC 3S1NH 5C3EH 4K0KL 1TWAH 2R92G 3PCOB 2F4VQ 2C35B 4L5QA 1NTGA 5J3BA 4DV2Q 2UUBQ 3GTJH 1NBWA 4IPCA 1KC8C 4JI8Q 5K36G 1IBLQ 4YWLA 4A3MG 3CCJA 1S72A 2JA8H 4DR4Q 4MNOA 4LF4Q 1SMXA 2B63G 3HOZH 1EIYB 5H1SE 1WFQA 1TXYA 1YJWA 4JI4Q 2N3SA 3CMAA 4LF9Q 1EOVA 4IOCA 2VW9A 4KHZA 5HGQA 1P16A 2K50A 2ZTCA 4A3FH 1PH6A 4DPGA 3RZDH 1IBML 1JJCB 1VQFA 2BA0A 4LFAQ 2ALYB 1E22A 4X64L 3M4QA 2V1CC 1E1OA 4YWMA 4P75A 3W1GA 4JI3Q 2E8GA 1Q1BA 4JBWA 3IRBA 4IJLA 2K5HA 3PO3G 3H15A 4A3EH 3AQQA 1MKHA 1E1TA 2DUDA 4GNXA 2D0PA 1MJCA 4ME3A 4JBKA 4LF8L 1YHBA 2MQHA 4LFBL 1VQAA 4YWKA 1VQMA 1Q82C 3W1BA 2BH8A 3HOVG 3J7A5 1YVCA 3J80i 4DV1Q 4A3KH 1R9TH 1Z47A 4IO9A 3G4SA 1TWGH 1V9PA 1J5EL 2OCEA 3L7ZC 3JAMc 3CCMA 4GNXC 4A3JH 3UE1A 1IL2A 5IP9H 2YU9H 4K0KQ 1NMFA 5ELNA 3J81j 4B3ML 3KJPA 4X6AH 3GTKH 4A3GG 4JYAQ 2KBNA 2HIXA 1W3SA 2WFWA 2BA1A 4JI2L 1ASYA 2AWNA 2E2IH 3GD7A 4B3SQ 3M4OH 1HJPA 3UDIA 2RCNA 2OWOA 2VS1A 3ER0A 4JOIA 5M3FG 4UP9A 1N33L 3RLOA 3M7NA 4BY1G 5LMNW 2I5LX 5C3EG 1A63A 1H95A 3CMEA 1TWHH 3OYYA 3ULLA 4A75A 2CWAA 4P71A 4MZ9A 5IWAQ 3JAMi 3CCQA 1OXVA 4GLVB 4UP7A 3RNUA 1XMOQ 4BXXH 5ELOA 3BZKA 2R93G 4JOIC 3CCRA 4LWCA 1VQIA 2VY3A 2JA8G 2N8NA 2MO0A 4X64Q 1UWVA 4A3CH 1N32Q 2Q2IA 1KQSA 3TEHB 1MIUA 4R4IA 4X66L 3HOWH 2CWPA 4DUZL 1VS0A 3CW2C 4RMFA 2NVTH 3GTPH 5IYCH 3CC7A 4A3FG 2D62A 2UU9L 2D0OA 3AFQA 2E2JH 5C4XH 4A76A 4LF7L 4IJHA 1GVPA 4LUOA 3S2DH 3I4MG 4B3RL 4LF8Q 4NXML 1JJGA 4GOPA 4JCVE 3RR5A 2UUBL 4LFBQ 2VQEQ 4C3JH 2CKZB 1UE7A 1Z9FA 1YHQA 1QVGA 5BR8Q 3K80C 5JJLA 1JT8A 1XPUA 5AJ3L 3KJOA 4BBSH 1D7QA 4JI5L 3G71A 1Q46A 4A3EG 4GLAC 3HOUH 2LSSA 4B3MQ 4GOPC 4EQ5A 1IXRA 3CAMA 3GTMH 5IT9c 4EX5A 2JEBI 1GM5A 1I94L 4OWTB 2NZHA 3T1YQ 3F2DA 1HR0W 2R7DA 5M3MG 4A3KG 1EUJA 4LFAL 3CCLA 4R4CA 1V1QA 2Z0SA 4PG3A 4Y7NH 4A3JG 1N33Q 1S40A 4GN4B 3J81c 3Q8DA 2IHEA 4GNXB 1IBKL 1I3QH 1HNWQ 2KCMA 1CKNB 1A0IA 2PQAA 3DM3A 5C4JH 2IX1A 3H3VH 2NVYH 5IP7H 4C3IH 5JEAG 2ZTDA 2EQSA 2IHFA 2WB1G 3E9IA 1K73C 3K81C 1NE3A 4L5SA 1QUQA 4X66Q 4HJ8A 2WAQE 4NXNL 1K3RA 1NY4A 1VQ4A 1N34L 4DUZQ 3H0GH 4A3LG 3STBC 3HKZG 3B6YA 4J15A 1VQJA 3UDGA 1PH1A 4X62Q 2UU9Q 1YITA 3PO2G 4BXXG 4LF7Q 4KI0A 4OX9L 4B3RQ 2R6GA 4NXMQ 1AH9A 4HIMA 4JBJA 4JYAL 5GAEC 3PF4A 1L2FA 4AQYL 1VQPA 4HJ9A 2YTVA 5GAHC 4B3SL 3PUYA 2JA7H 4O2DA 1KXLA 1GO3E 5AJ3Q 4DV0Q 1KHIA 5IYCG 1PH7A 4JI0L 1SE8A 4JI5Q 4JI7L 3L0OA 3HOYH 1X65A 3RZOH 4BBRH 2PNHA 4JG2A 1OXUA 1QZHA 5FLMH 2HHHL 3PIOA 3ULJA 4QQBX 5JJIA 4R4TA 4JC0A 1Y1WH 4RG1A 5IWAL 1I94Q 4IPHA 1XPOA 1XMOL 3CPFA 1PH4A 1UE1A 3K0XA 1Y1VH 3G6EA 1K8GA 4DR2L 4POGA 1XPRA 4UY8C 4BBSG 5JJKA 4DV4Q 1FL0A 1WJJA 4IPGA 4A3IH 1FJGL 3J80c 1N32L 1IBKQ 1VQ6A 1K8AC 4A4IA 1FVIA 4P74A 4GOPB 4JI1L 1M1KC 1C7YA 1EFWA 4DV6L 4HJ7A 4WJ3M 1WCMG 1ASZA 1A8VA 1HZ9A 3HOXG 1PA6A 1K9MC 2EXDA 4A3BH 1LUZA 2VQEL 1Q12A 2B3GA 3E9HA 4NXNQ 3HKSA 5BR8L 1N34Q 4NPSA 3KF6B 3FKIH 4DV5L 4LF5L 3WWVA 5C0XG 3PF5A 1VQ8A 4OX9Q 5LMNL 4IFDI 1HZBA 5IYDG 2BH2A 4A3DG 3SGIA 3JC66 3K7AH 4UP8A 4BA1I 2VQFL 1BBWA 4QJFA 4AQYQ 2Q2HA 2PQAB 3U4VA 4R4QA 3T1HL 3T1YL 3S1QH 3RLNA 3NELA 3I2ZA 4JI0Q 5GQOA 4JI7Q 4BY7G 2QA4A 5M5YH 2YTXA 1EQQA 5FJ8H 1HNWL 2UXBL 4DAMA 3CC2A 1CKMA 1SRUA 2HHHQ 4GN3B 2UXDQ 3TS2A 5M5WH 3M85A 2Q2TA 1VQEA 1I5FA 2I5HA 2JK8A 1PH3A 2JA7G 3S17H 3S2HH 3UDXA 4HJAA 1E24A 4DR2Q 1XMQQ 4JI6L 2KENA 3HOYG 2IT1A 1FJGQ 2ZM6L 1B70B 1Q1EA 4QY7A 2ZJRA 3KF8B 3EN2A 3PIPA 1PH5A 1JMCA 4AYBE 4LF6L 3HOZG 2UXCL 1E3PA 1X6OA 2AHOB 3AYHB 1Y1WG 1PH9A 4JI1Q 4HIKA 4DV6Q 2RHSB 4DR5L 4L5TA 2I5MX 3S1RH 3BU2A 1KIXA 3S15H 2E5LL 4DAYB 3A5UA 2Q2UA 3S16H 2GVBA 4X62L 3PGZA 5C44H 1Y1VG 1BVSA 1OXSC 2MNAA 1SR3A 1PVOA 3U4ZA 2OTJA 3PSIA 1TWCH 4YHHL 1B8AA 3I56A 1X3GA 1HR0L 4DV0L 2K14A 2VL6A 4DV5Q 3KLWA 4LF5Q 1IYJB 3CCSA 1Q7YC 2OQ0A 2ZTEA 1KL9A 1RL2A 2JA5H 5LMNQ 1E7ZA 2JJQA 1XNQL 2MFIA 2OQKA 1CSPA 1P8LA 1TWFH 1X9NA 4TQUS 5IY0A 3F2BA 2VQFQ 4P73A 2JA9A 2NVXH 4A3MH 3T1HQ 3FP9A 4TVAB 3NENA 1VQBA 1SN8A 3FKIG 2UUAL 4DNIA 4DV4L 4HIDA 1JJ2A 4IFDG 1U5KA 1QZGA 2UXBQ 3TREA 1I50H 1UE6A 5IP9G 4NB3A 3A5ZB 2Y0SE 5M5XH 3E0EA 3I4OA 1BBUA 2ATWA 3H3VI 4YCVA 4DV3L 4JI6Q 1X56A 1X54A 2ZM6Q 1Q81C 3HKZE 5C0XI 4DK3C 4POFA 5FJ8G 4LF6Q 1LYLA 2GN5A 2N78A 2A1AA 5E7NA 2UXCQ 4GS3A 1PV4A 4LFCL 4LUVA 3U58A 1QVFA 3CD6A 1AE3A 4AIMA 4DR5Q 3S24A 3OTOQ 2E5LQ 2AWOA 4YCUA 2XGTA 3PUVA 4GKKL 4X65L 1C9OA 2K5NA 3GTOH 2RHQB 3GDEA 1YNXA 2YV5A 1YJNA 4DR7L 4A3CG 1XTDA 4HIOA 4KHPL 2A19A 4YHHQ 1PH2A 3HOWG 1I6HH 4PZ8A 1OXTA 4GKJL 1VQNA 1HR0Q 4QIWE 2GVAA 1PYBA 3CPWA 2R7ZH 1X55A 2CFMA 4A3GH 4LNQA 3UDFA 2Z6KA 1YBYA 4DV7L 5C4XG 1PHJA 3CC4A 1SROA 3ZJYC 3NBHB 3CCUA 1XNQQ 2JA6H 5LMUQ 3LGJA 2UXDL 4PZ7A 1SFOH 1K83H 2QGQA 5M3FH 2ZJPA 2IY5B 3FHWA 3BJUA 3CP0A 4BY1H 4PMWA 2K52A 5GAGC 1XMQL 1D8LA 2AKWB 1CSQA 2WAQG 2Z6KC 1K0RA 3NEMA 1VQOA 2UUAQ 1NMGA 5JEAJ 4C3HH 1G51A 5FLXc 1CKOA 4DUYL 2JA5G 3D0FA 3HOUG 1C0AA 2H5XA 5GROA 2R93H 3GTLH 3K8AA 1VQ5A 2VZAA 4B3TQ 4DV3Q 1VQ9A 2JEAI 4OWWB 1PYSB 1EIFA 2YTYA 2CQOA 3EIVA 3U50C 2K4KA 1B7YB 1OXXK 4YY3Q 5DLQE 2K75A 1W2BA 1N36Q 4LFCQ 1YEZA 4OONA 5IE8A 3PUXA 2ASBA 1S3OA 2NVQH 3I4MH 5IP7G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LW1 A;  4GKK Q;  4X65 Q;  1WOC A;  4WJ4 A;  3RN5 A;  1A62 A;  2JQO A;  3TQY A;  3L2P A;  4DR7 Q;  1M90 C;  2UUC L;  1WYD A;  3GO5 A;  4KHP Q;  2QEX A;  4MTN A;  1OTC A;  3TRZ A;  3K7U C;  3TS0 A;  3I4N H;  1N8R C;  3A0J A;  1VQH A;  3D31 A;  3KDF A;  4GKJ Q;  1SLJ A;  4OXP A;  3H0G G;  3I7F A;  2HQL A;  1G29 1;  1CKN A;  2KHI A;  4DV7 Q;  2PI2 E;  1YIJ A;  2ES2 A;  2F52 A;  1IZ6 A;  1QUQ B;  4XTC S;  5M3M H;  1DGS A;  1L1O A;  4H02 A;  3MXN B;  1MJE A;  2OTL A;  4PZ6 A;  1T9H A;  5GAD C;  1HZA A;  4QL5 A;  4JV5 L;  1YHA A;  3F8T A;  3ULP A;  1J6Q A;  3I55 A;  1KD1 C;  2R7Z G;  2NN6 I;  4BBR G;  3BZC A;  3CCE A;  4DUY Q;  1JB7 A;  1KRT A;  1G6P A;  5FLM G;  1KRS A;  4QGU A;  3RN2 A;  2JA6 G;  3S1M H;  4OO1 I;  2R7F A;  1L1O C;  2F3I A;  1YI2 A;  1KAW A;  1O7I A;  3F1Z A;  1UEB A;  3AEV A;  4DK6 C;  3MEF A;  3OTO L;  1YJ9 A;  2WP8 J;  2VUM H;  2MO1 A;  4KLK A;  3KFU A;  4A3I G;  1NJI C;  1HNZ L;  2LXK A;  1FGU A;  3DLL A;  1EYG A;  1PH8 A;  4FDB A;  4OWX B;  5C0X J;  4A3L H;  3PUW A;  3F2C A;  2IX0 A;  4HJ5 A;  1IBM Q;  2YYZ A;  2LXJ A;  2NZO A;  2RF4 A;  3PV0 A;  3PO2 H;  5IYB H;  2XTI A;  1UE5 A;  1JE5 A;  2R92 H;  2KCT A;  4DR6 L;  2DGY A;  1EQR A;  2ID0 A;  1EWI A;  4UPA A;  2EIF A;  4DR1 L;  3VDY A;  4LUZ A;  4DR3 L;  3CQZ H;  4APV A;  5LMU L;  2UUC Q;  2ZJQ A;  1VQL A;  1VQ7 A;  1XNR L;  3A74 A;  1RIP A;  3GTG H;  3PUZ A;  4A3B G;  1HZC A;  1VQK A;  1CUK A;  1QVC A;  1HNX L;  4AYB G;  3CF5 A;  2B63 H;  2HT1 A;  1LTL A;  2B29 A;  1HH2 P;  2F4V L;  3M9B A;  2CCZ A;  2K5V A;  1N9W A;  2PI2 A;  4P72 A;  5EAY A;  3AFP A;  4DV2 L;  4O0A A;  3OW2 A;  4GLX A;  2WB1 E;  4JI8 L;  2A8V A;  4DKA C;  1IBL L;  3I4N G;  2VNU D;  3ICE A;  1X3E A;  4DR4 L;  1J5E Q;  2PMZ E;  3J7Z C;  4B3T L;  4R4O A;  3M3Y H;  4LF4 L;  4JV5 Q;  2E2H H;  1GD7 A;  4JI4 L;  4IOA A;  4LF9 L;  1BKB A;  4JI2 Q;  4YY3 L;  4BA2 I;  1WCM H;  2N49 A;  4ALP A;  3KF6 A;  1N36 L;  4XIG S;  1Y14 B;  4GN5 A;  3S14 H;  1L0W A;  3PO3 H;  3KOJ A;  3ERS X;  3KDF B;  3HOX H;  1LM0 A;  3CXC A;  2NN6 G;  4R1J A;  2HIV A;  1PFS A;  1WI5 A;  4YCW A;  3STB D;  1YZ6 A;  4AH6 A;  3CCV A;  3HFZ B;  2KHJ A;  4OO1 G;  1Q8K A;  4JI3 L;  5HY6 A;  1HNZ Q;  3HOV H;  4A93 G;  3RLF A;  3M4P A;  4L5R C;  1XJV A;  2I0Q A;  1VQD A;  1VCI A;  1L1O B;  4A93 H;  3W5O A;  4IPD A;  1V43 A;  4C2M H;  3G48 A;  1GKH A;  2FXQ A;  2JE6 I;  2Y0S G;  4DR6 Q;  5IYD H;  4JBM A;  1AE2 A;  1Q86 C;  5C44 G;  4DR1 Q;  2VUM G;  4A3D H;  2L15 A;  4DR3 Q;  1VQG A;  3GTQ H;  1U0L A;  4IFD J;  1XNR Q;  4Y52 H;  3EBE A;  4DV1 L;  2AMC B;  3J81 i;  4BY7 H;  3UE0 A;  1HNX Q;  1VQC A;  5IYB G;  1X3F A;  3KYH C;  3S1N H;  5C3E H;  4K0K L;  1TWA H;  2R92 G;  3PCO B;  2F4V Q;  2C35 B;  4L5Q A;  1NTG A;  5J3B A;  4DV2 Q;  2UUB Q;  3GTJ H;  1NBW A;  4IPC A;  1KC8 C;  4JI8 Q;  5K36 G;  1IBL Q;  4YWL A;  4A3M G;  3CCJ A;  1S72 A;  2JA8 H;  4DR4 Q;  4MNO A;  4LF4 Q;  1SMX A;  2B63 G;  3HOZ H;  1EIY B;  5H1S E;  1WFQ A;  1TXY A;  1YJW A;  4JI4 Q;  2N3S A;  3CMA A;  4LF9 Q;  1EOV A;  4IOC A;  2VW9 A;  4KHZ A;  5HGQ A;  1P16 A;  2K50 A;  2ZTC A;  4A3F H;  1PH6 A;  4DPG A;  3RZD H;  1IBM L;  1JJC B;  1VQF A;  2BA0 A;  4LFA Q;  2ALY B;  1E22 A;  4X64 L;  3M4Q A;  2V1C C;  1E1O A;  4YWM A;  4P75 A;  3W1G A;  4JI3 Q;  2E8G A;  1Q1B A;  4JBW A;  3IRB A;  4IJL A;  2K5H A;  3PO3 G;  3H15 A;  4A3E H;  3AQQ A;  1MKH A;  1E1T A;  2DUD A;  4GNX A;  2D0P A;  1MJC A;  4ME3 A;  4JBK A;  4LF8 L;  1YHB A;  2MQH A;  4LFB L;  1VQA A;  4YWK A;  1VQM A;  1Q82 C;  3W1B A;  2BH8 A;  3HOV G;  3J7A 5;  1YVC A;  3J80 i;  4DV1 Q;  4A3K H;  1R9T H;  1Z47 A;  4IO9 A;  3G4S A;  1TWG H;  1V9P A;  1J5E L;  2OCE A;  3L7Z C;  3JAM c;  3CCM A;  4GNX C;  4A3J H;  3UE1 A;  1IL2 A;  5IP9 H;  2YU9 H;  4K0K Q;  1NMF A;  5ELN A;  3J81 j;  4B3M L;  3KJP A;  4X6A H;  3GTK H;  4A3G G;  4JYA Q;  2KBN A;  2HIX A;  1W3S A;  2WFW A;  2BA1 A;  4JI2 L;  1ASY A;  2AWN A;  2E2I H;  3GD7 A;  4B3S Q;  3M4O H;  1HJP A;  3UDI A;  2RCN A;  2OWO A;  2VS1 A;  3ER0 A;  4JOI A;  5M3F G;  4UP9 A;  1N33 L;  3RLO A;  3M7N A;  4BY1 G;  5LMN W;  2I5L X;  5C3E G;  1A63 A;  1H95 A;  3CME A;  1TWH H;  3OYY A;  3ULL A;  4A75 A;  2CWA A;  4P71 A;  4MZ9 A;  5IWA Q;  3JAM i;  3CCQ A;  1OXV A;  4GLV B;  4UP7 A;  3RNU A;  1XMO Q;  4BXX H;  5ELO A;  3BZK A;  2R93 G;  4JOI C;  3CCR A;  4LWC A;  1VQI A;  2VY3 A;  2JA8 G;  2N8N A;  2MO0 A;  4X64 Q;  1UWV A;  4A3C H;  1N32 Q;  2Q2I A;  1KQS A;  3TEH B;  1MIU A;  4R4I A;  4X66 L;  3HOW H;  2CWP A;  4DUZ L;  1VS0 A;  3CW2 C;  4RMF A;  2NVT H;  3GTP H;  5IYC H;  3CC7 A;  4A3F G;  2D62 A;  2UU9 L;  2D0O A;  3AFQ A;  2E2J H;  5C4X H;  4A76 A;  4LF7 L;  4IJH A;  1GVP A;  4LUO A;  3S2D H;  3I4M G;  4B3R L;  4LF8 Q;  4NXM L;  1JJG A;  4GOP A;  4JCV E;  3RR5 A;  2UUB L;  4LFB Q;  2VQE Q;  4C3J H;  2CKZ B;  1UE7 A;  1Z9F A;  1YHQ A;  1QVG A;  5BR8 Q;  3K80 C;  5JJL A;  1JT8 A;  1XPU A;  5AJ3 L;  3KJO A;  4BBS H;  1D7Q A;  4JI5 L;  3G71 A;  1Q46 A;  4A3E G;  4GLA C;  3HOU H;  2LSS A;  4B3M Q;  4GOP C;  4EQ5 A;  1IXR A;  3CAM A;  3GTM H;  5IT9 c;  4EX5 A;  2JEB I;  1GM5 A;  1I94 L;  4OWT B;  2NZH A;  3T1Y Q;  3F2D A;  1HR0 W;  2R7D A;  5M3M G;  4A3K G;  1EUJ A;  4LFA L;  3CCL A;  4R4C A;  1V1Q A;  2Z0S A;  4PG3 A;  4Y7N H;  4A3J G;  1N33 Q;  1S40 A;  4GN4 B;  3J81 c;  3Q8D A;  2IHE A;  4GNX B;  1IBK L;  1I3Q H;  1HNW Q;  2KCM A;  1CKN B;  1A0I A;  2PQA A;  3DM3 A;  5C4J H;  2IX1 A;  3H3V H;  2NVY H;  5IP7 H;  4C3I H;  5JEA G;  2ZTD A;  2EQS A;  2IHF A;  2WB1 G;  3E9I A;  1K73 C;  3K81 C;  1NE3 A;  4L5S A;  1QUQ A;  4X66 Q;  4HJ8 A;  2WAQ E;  4NXN L;  1K3R A;  1NY4 A;  1VQ4 A;  1N34 L;  4DUZ Q;  3H0G H;  4A3L G;  3STB C;  3HKZ G;  3B6Y A;  4J15 A;  1VQJ A;  3UDG A;  1PH1 A;  4X62 Q;  2UU9 Q;  1YIT A;  3PO2 G;  4BXX G;  4LF7 Q;  4KI0 A;  4OX9 L;  4B3R Q;  2R6G A;  4NXM Q;  1AH9 A;  4HIM A;  4JBJ A;  4JYA L;  5GAE C;  3PF4 A;  1L2F A;  4AQY L;  1VQP A;  4HJ9 A;  2YTV A;  5GAH C;  4B3S L;  3PUY A;  2JA7 H;  4O2D A;  1KXL A;  1GO3 E;  5AJ3 Q;  4DV0 Q;  1KHI A;  5IYC G;  1PH7 A;  4JI0 L;  1SE8 A;  4JI5 Q;  4JI7 L;  3L0O A;  3HOY H;  1X65 A;  3RZO H;  4BBR H;  2PNH A;  4JG2 A;  1OXU A;  1QZH A;  5FLM H;  2HHH L;  3PIO A;  3ULJ A;  4QQB X;  5JJI A;  4R4T A;  4JC0 A;  1Y1W H;  4RG1 A;  5IWA L;  1I94 Q;  4IPH A;  1XPO A;  1XMO L;  3CPF A;  1PH4 A;  1UE1 A;  3K0X A;  1Y1V H;  3G6E A;  1K8G A;  4DR2 L;  4POG A;  1XPR A;  4UY8 C;  4BBS G;  5JJK A;  4DV4 Q;  1FL0 A;  1WJJ A;  4IPG A;  4A3I H;  1FJG L;  3J80 c;  1N32 L;  1IBK Q;  1VQ6 A;  1K8A C;  4A4I A;  1FVI A;  4P74 A;  4GOP B;  4JI1 L;  1M1K C;  1C7Y A;  1EFW A;  4DV6 L;  4HJ7 A;  4WJ3 M;  1WCM G;  1ASZ A;  1A8V A;  1HZ9 A;  3HOX G;  1PA6 A;  1K9M C;  2EXD A;  4A3B H;  1LUZ A;  2VQE L;  1Q12 A;  2B3G A;  3E9H A;  4NXN Q;  3HKS A;  5BR8 L;  1N34 Q;  4NPS A;  3KF6 B;  3FKI H;  4DV5 L;  4LF5 L;  3WWV A;  5C0X G;  3PF5 A;  1VQ8 A;  4OX9 Q;  5LMN L;  4IFD I;  1HZB A;  5IYD G;  2BH2 A;  4A3D G;  3SGI A;  3JC6 6;  3K7A H;  4UP8 A;  4BA1 I;  2VQF L;  1BBW A;  4QJF A;  4AQY Q;  2Q2H A;  2PQA B;  3U4V A;  4R4Q A;  3T1H L;  3T1Y L;  3S1Q H;  3RLN A;  3NEL A;  3I2Z A;  4JI0 Q;  5GQO A;  4JI7 Q;  4BY7 G;  2QA4 A;  5M5Y H;  2YTX A;  1EQQ A;  5FJ8 H;  1HNW L;  2UXB L;  4DAM A;  3CC2 A;  1CKM A;  1SRU A;  2HHH Q;  4GN3 B;  2UXD Q;  3TS2 A;  5M5W H;  3M85 A;  2Q2T A;  1VQE A;  1I5F A;  2I5H A;  2JK8 A;  1PH3 A;  2JA7 G;  3S17 H;  3S2H H;  3UDX A;  4HJA A;  1E24 A;  4DR2 Q;  1XMQ Q;  4JI6 L;  2KEN A;  3HOY G;  2IT1 A;  1FJG Q;  2ZM6 L;  1B70 B;  1Q1E A;  4QY7 A;  2ZJR A;  3KF8 B;  3EN2 A;  3PIP A;  1PH5 A;  1JMC A;  4AYB E;  4LF6 L;  3HOZ G;  2UXC L;  1E3P A;  1X6O A;  2AHO B;  3AYH B;  1Y1W G;  1PH9 A;  4JI1 Q;  4HIK A;  4DV6 Q;  2RHS B;  4DR5 L;  4L5T A;  2I5M X;  3S1R H;  3BU2 A;  1KIX A;  3S15 H;  2E5L L;  4DAY B;  3A5U A;  2Q2U A;  3S16 H;  2GVB A;  4X62 L;  3PGZ A;  5C44 H;  1Y1V G;  1BVS A;  1OXS C;  2MNA A;  1SR3 A;  1PVO A;  3U4Z A;  2OTJ A;  3PSI A;  1TWC H;  4YHH L;  1B8A A;  3I56 A;  1X3G A;  1HR0 L;  4DV0 L;  2K14 A;  2VL6 A;  4DV5 Q;  3KLW A;  4LF5 Q;  1IYJ B;  3CCS A;  1Q7Y C;  2OQ0 A;  2ZTE A;  1KL9 A;  1RL2 A;  2JA5 H;  5LMN Q;  1E7Z A;  2JJQ A;  1XNQ L;  2MFI A;  2OQK A;  1CSP A;  1P8L A;  1TWF H;  1X9N A;  4TQU S;  5IY0 A;  3F2B A;  2VQF Q;  4P73 A;  2JA9 A;  2NVX H;  4A3M H;  3T1H Q;  3FP9 A;  4TVA B;  3NEN A;  1VQB A;  1SN8 A;  3FKI G;  2UUA L;  4DNI A;  4DV4 L;  4HID A;  1JJ2 A;  4IFD G;  1U5K A;  1QZG A;  2UXB Q;  3TRE A;  1I50 H;  1UE6 A;  5IP9 G;  4NB3 A;  3A5Z B;  2Y0S E;  5M5X H;  3E0E A;  3I4O A;  1BBU A;  2ATW A;  3H3V I;  4YCV A;  4DV3 L;  4JI6 Q;  1X56 A;  1X54 A;  2ZM6 Q;  1Q81 C;  3HKZ E;  5C0X I;  4DK3 C;  4POF A;  5FJ8 G;  4LF6 Q;  1LYL A;  2GN5 A;  2N78 A;  2A1A A;  5E7N A;  2UXC Q;  4GS3 A;  1PV4 A;  4LFC L;  4LUV A;  3U58 A;  1QVF A;  3CD6 A;  1AE3 A;  4AIM A;  4DR5 Q;  3S24 A;  3OTO Q;  2E5L Q;  2AWO A;  4YCU A;  2XGT A;  3PUV A;  4GKK L;  4X65 L;  1C9O A;  2K5N A;  3GTO H;  2RHQ B;  3GDE A;  1YNX A;  2YV5 A;  1YJN A;  4DR7 L;  4A3C G;  1XTD A;  4HIO A;  4KHP L;  2A19 A;  4YHH Q;  1PH2 A;  3HOW G;  1I6H H;  4PZ8 A;  1OXT A;  4GKJ L;  1VQN A;  1HR0 Q;  4QIW E;  2GVA A;  1PYB A;  3CPW A;  2R7Z H;  1X55 A;  2CFM A;  4A3G H;  4LNQ A;  3UDF A;  2Z6K A;  1YBY A;  4DV7 L;  5C4X G;  1PHJ A;  3CC4 A;  1SRO A;  3ZJY C;  3NBH B;  3CCU A;  1XNQ Q;  2JA6 H;  5LMU Q;  3LGJ A;  2UXD L;  4PZ7 A;  1SFO H;  1K83 H;  2QGQ A;  5M3F H;  2ZJP A;  2IY5 B;  3FHW A;  3BJU A;  3CP0 A;  4BY1 H;  4PMW A;  2K52 A;  5GAG C;  1XMQ L;  1D8L A;  2AKW B;  1CSQ A;  2WAQ G;  2Z6K C;  1K0R A;  3NEM A;  1VQO A;  2UUA Q;  1NMG A;  5JEA J;  4C3H H;  1G51 A;  5FLX c;  1CKO A;  4DUY L;  2JA5 G;  3D0F A;  3HOU G;  1C0A A;  2H5X A;  5GRO A;  2R93 H;  3GTL H;  3K8A A;  1VQ5 A;  2VZA A;  4B3T Q;  4DV3 Q;  1VQ9 A;  2JEA I;  4OWW B;  1PYS B;  1EIF A;  2YTY A;  2CQO A;  3EIV A;  3U50 C;  2K4K A;  1B7Y B;  1OXX K;  4YY3 Q;  5DLQ E;  2K75 A;  1W2B A;  1N36 Q;  4LFC Q;  1YEZ A;  4OON A;  5IE8 A;  3PUX A;  2ASB A;  1S3O A;  2NVQ H;  3I4M H;  5IP7 G; 
#chains in the Genus database with same CATH topology
 1D1K A;  1I4H A;  4WJ4 A;  1WOC A;  2Z1C A;  3SK8 A;  3TQY A;  1JWM D;  2UUC L;  1CTM A;  1WYD A;  1OTC A;  3I4N H;  1VQH A;  3D31 A;  3KDF A;  1SLJ A;  4OXP A;  4FF4 A;  1LTR D;  4A3B B;  1BXT A;  4XDX A;  3D4D A;  3X3N A;  2PI2 E;  4KY7 A;  5JAV A;  3JAM E;  1DGS A;  1L1O A;  2EYP A;  1MBY A;  3OHX C;  5J39 A;  1HZA A;  1OO9 B;  1GUW A;  1YHA A;  3F8T A;  4C56 C;  3ULP A;  1D5M C;  3MXG A;  1KD1 C;  1XTC D;  4BBR G;  3CCE A;  1KRT A;  1RKN A;  4V0B A;  4OO1 I;  1S4Z A;  1O7I A;  4X3K A;  1UEB A;  1AEX A;  4DK6 C;  5A2Q E;  3OTO L;  1GUN A;  5COR A;  5EPL A;  2MO1 A;  1KDC A;  4KLK A;  4OEL B;  3T4A C;  3NP8 A;  4A3I G;  1HNZ L;  3TN2 A;  3FPP A;  5C0X J;  3PUW A;  2F3V A;  2F0K A;  2EOT A;  2NZO A;  2YYZ A;  1I4P A;  3PO2 H;  1HQM C;  4IUN A;  1JE5 A;  2R92 H;  2NWG A;  1IL8 A;  3BVZ A;  4KHV A;  2DGY A;  1EQR A;  4UPA A;  4Z9C B;  4DR3 L;  2PZU A;  2NB0 A;  1HCZ A;  1VQL A;  3A74 A;  5K36 H;  1SNC A;  1CUK A;  5C44 B;  1HNX L;  2R61 A;  3I8Z A;  3NWS A;  5E3F A;  5EAY A;  1O7L A;  3OW2 A;  3T51 B;  1ILQ A;  2F0U A;  3DEO A;  4QMG A;  3PQI A;  4JVZ A;  1AP0 A;  2VNU D;  5KRU A;  2F03 A;  3J7Z C;  2RVL A;  3M3Y H;  2BDN A;  4LF4 L;  2KHS A;  3V2T A;  4JI4 L;  1HUM A;  3A55 A;  3MXU A;  2NVX B;  1WCM H;  4ALP A;  3OW7 A;  3TZU A;  3S14 H;  1HA5 A;  1Z7T A;  3J81 E;  1B50 A;  1EIH A;  4RAU C;  5E4W C;  2QKI C;  1PFS A;  4YCW A;  5HY6 A;  1CHQ D;  4CKC A;  1VQD A;  4A93 H;  4IPD A;  3G48 A;  1AE2 A;  5KYL A;  2VUM G;  2ZT9 C;  4RFB A;  1B1Z A;  4GZY C;  3BYY B;  5I2Y A;  4IFD J;  1SYG A;  1TS3 A;  2MP1 A;  1ZYR D;  5IYB G;  5C3E H;  2F4V Q;  1UAP A;  3HOV B;  4FNF A;  1NTG A;  5DM6 3;  3D3R A;  2UUB Q;  1EY7 A;  3GTJ H;  4C2M B;  1KC8 C;  4MTK A;  4JI8 Q;  1WD1 A;  4A3M G;  3CCJ A;  2ZXR A;  2JA8 H;  3P75 A;  1SMX A;  1EIY B;  1JR0 D;  1WFQ A;  4ZLT F;  5NUC A;  4HR7 B;  1ENC A;  4EQN A;  2K50 A;  3Q0A A;  1F2Y A;  3NHH A;  4UDU C;  4DPG A;  1IBM L;  3S1N B;  2SNS A;  1VQF A;  3J80 E;  4IQZ A;  1SYC A;  4X64 L;  1RTO A;  4JPB W;  3SE0 A;  2F1M A;  1H9S B;  3A56 A;  3IRB A;  2WKD A;  1DCZ A;  1GXD C;  4N9T A;  2L55 A;  4FF2 A;  3PO3 G;  3VA7 A;  3H15 A;  2DUD A;  4ZQ3 A;  2D0P A;  1MJC A;  3OIP A;  1YHB A;  4A3F B;  1ET6 A;  3RZD B;  2BH8 A;  4A3K H;  3VYT A;  2F0G A;  3AB9 A;  1R9T H;  4IFD H;  1TR5 A;  5KIX A;  3JAM c;  3UE1 A;  4K0K Q;  3NQI A;  4A3G G;  3DWA A;  2KBN A;  5ELD A;  3E6Z X;  3NK9 A;  1PDQ A;  2WFW A;  4RCO A;  4JI2 L;  1LT6 D;  5JEA H;  4A3E B;  3M4O H;  3MVV A;  5CV5 A;  2OWO A;  3VR3 A;  2VS1 A;  2L5T A;  1EZ6 A;  4QCL A;  2BCO A;  2KED A;  4BY1 G;  2R3Z A;  5LMN W;  1A63 A;  1PLF A;  1H95 A;  1TWH H;  2IW3 A;  2F0J A;  1KDA A;  4MZ9 A;  1OXV A;  4GLV B;  1SMY D;  2YU9 B;  4JOI C;  3GTK B;  2MO0 A;  3ND8 A;  1MIU A;  1S5E D;  3OWE B;  4CHT B;  5LL6 S;  1SYB A;  4DUZ L;  2NVT H;  3CW2 C;  4PQX A;  4RMF A;  1FGB D;  3QO2 A;  5IYC H;  2ICE C;  2D62 A;  1DOM A;  4A76 A;  1GVP A;  4B3R L;  2PW7 A;  4KJN A;  2Q8I B;  4C3J H;  3QOL A;  2VQE Q;  1WVL A;  1UE7 A;  1YHQ A;  2PPB C;  4HTH A;  4RWS C;  5JJL A;  5AJ3 L;  1PMR A;  3G71 A;  4IUR A;  2A68 D;  4TSS A;  3UI2 A;  1NUC A;  3HP3 A;  1EY9 A;  3NSW A;  1GM5 A;  3IFD A;  3T1Y Q;  4LFA L;  3CCL A;  4TRD A;  1GHJ A;  1V1Q A;  4JK1 C;  4PG3 A;  2EYL A;  3BG3 A;  3J81 c;  1IBK L;  3Q8D A;  2IHE A;  1HXY D;  4XT1 B;  1CI3 M;  1H9K A;  5IP7 H;  2F0D A;  3R2T A;  3HG9 A;  2E76 C;  2XVS A;  4L5S A;  4X66 Q;  2FMM A;  4HJ8 A;  2DY7 A;  2EJF C;  5D3D A;  1K3R A;  1CT1 D;  1PTO H;  1N34 L;  3H0G H;  4JW0 A;  1LT4 D;  3B6Y A;  4BXX G;  3UDG A;  3PO2 G;  1I3Q B;  4LF7 Q;  2K33 A;  4OX9 L;  2Z4I A;  1AH9 A;  4HIM A;  5GAE C;  1L2F A;  4HJ9 A;  1V1O A;  4B3S L;  2CQA A;  3NWT A;  1PH7 A;  1WD0 A;  4JI5 Q;  1RJT A;  3L0O A;  3O13 A;  2IX3 A;  1QZH A;  3VYU A;  5FLM H;  1FNW A;  4R4T A;  1W6K A;  1QNU A;  3DEP A;  3QR8 A;  2B2V A;  2XWB B;  5IGF A;  5JJK A;  1IYU A;  2E75 C;  1MSH A;  4IPG A;  3C1E A;  3J80 c;  1N32 L;  4NKL A;  1K8A C;  4A4I A;  1CQF A;  3DMU A;  1EFW A;  3HOY B;  3RZO B;  2B8G A;  1WCM G;  4BBR B;  3NPP A;  1ASZ A;  1XWE A;  3I73 A;  1LAC A;  3BDL A;  2OEO A;  2EXD A;  1TU2 B;  3IFT A;  4ZYS A;  4NXN Q;  1Y1V B;  5BR8 L;  1SBB B;  2RCF A;  4C3I G;  4LF5 L;  4IUP A;  5C5L A;  5C0X G;  5IGG A;  2BH2 A;  1H9J A;  3SGI A;  3S15 H;  2VQF L;  2Q2H A;  2PQA B;  4ULL A;  4R4Q A;  2DJF C;  3U4V A;  1PZJ D;  3S1Q H;  3SXH A;  5FO9 B;  1QOH A;  3I2Z A;  4JI7 Q;  5EGT A;  2YTX A;  1EQQ A;  4DAM A;  4GN3 B;  4ZAI A;  3FKI B;  3M85 A;  5BN5 A;  2I07 B;  1PH3 A;  1F9Q A;  3S2H H;  3NTH A;  4WJW A;  2IT1 A;  3T16 A;  2ZM6 L;  2ZJR A;  4OO1 H;  3PIP A;  3GQB A;  2E2I B;  5ELF A;  1U4R A;  3AYH B;  5I2X A;  1PH9 A;  4HIK A;  2PO4 A;  2F0W A;  4DV6 Q;  2ENB A;  5M5Y B;  2E74 C;  2GVB A;  4X62 L;  3PGZ A;  2MNA A;  1F2L A;  1LTG D;  1PVO A;  3MXP A;  2OTJ A;  5CC4 A;  1B8A A;  5CV8 A;  5T1I A;  1HR0 L;  4DV0 L;  4DV5 Q;  4G7O C;  4FYD A;  1JCK B;  3P1H A;  1Q7Y C;  2ZTE A;  3I91 A;  4G7Z C;  3HOW B;  1SAP A;  5LMN Q;  3SDZ A;  2MFI A;  2OQK A;  1P8L A;  2NBF A;  4TQU S;  5IY0 A;  3S1R B;  1HTL D;  1PZK D;  3NEN A;  4IFD G;  4S3S A;  1R4Q B;  1I50 H;  3IAY A;  1RF2 D;  3A5Z B;  2Y0S E;  3Q22 A;  2D2C C;  4KKS A;  1VMC A;  2ATW A;  3H3V I;  1NR2 A;  1X54 A;  4K6L A;  2NUC A;  5C0X I;  5JPM C;  4DK3 C;  4POF A;  5FJ8 G;  4LF6 Q;  5C6A A;  4GS3 A;  1PV4 A;  3MXN A;  3QB3 A;  1ZXT A;  5IT9 L;  1CK1 A;  3OTO Q;  5JVH 3;  2A6H D;  4X65 L;  4K6D A;  3A7A B;  3BDO A;  1JC7 A;  1I6H H;  1ICW A;  1KNE A;  4GKJ L;  3TP6 A;  3QG1 A;  4R9W A;  1YBY A;  1HFG A;  3CCU A;  4KJO A;  2UXD L;  4M8A A;  2PZW A;  1ZYR C;  1SFO H;  1K83 H;  4C3J G;  2QGQ A;  4HED A;  2G5D A;  2K05 A;  2ASB A;  2AKW B;  2A69 D;  4WOR A;  4H44 C;  4DUY L;  2H5X A;  4K5V A;  1VQ5 A;  4A3G B;  2JA6 B;  5I6Y A;  2JEA I;  4OWW B;  2JP1 A;  3DUZ A;  4LFC Q;  5IE8 A;  2ZXO A;  3I4M H;  5IP7 G;  5CBA E;  2F0P A;  3RN5 A;  2K04 A;  3J7A F;  3L2P A;  2XIW A;  4N8F A;  1NCV A;  2H1E A;  1WTV A;  4KHP Q;  1E2Z A;  1BF4 A;  4F7X A;  1N8R C;  1ESR A;  3A0J A;  3H0G G;  1CKN A;  2KHI A;  5KNB A;  2XRS D;  4AYB B;  1QUQ B;  5M3M H;  1SEB D;  1MJE A;  1T9H A;  5GAD C;  4JV5 L;  2QIL A;  3I55 A;  2R7Z G;  1JB7 A;  3BZC A;  3JAM L;  3I4N B;  5FLM G;  5EKI A;  3A54 A;  4QGU A;  2DY8 A;  1L1O C;  4B08 A;  4ZUI A;  1YI2 A;  4KN7 C;  1KAW A;  3KK7 A;  3MEF A;  1YJ9 A;  5LL6 X;  2VUM H;  4QB4 A;  3HEJ A;  3KFU A;  3OMG A;  1NJI C;  2CH4 A;  3C2P A;  1SMY C;  2VXW A;  5A2Q L;  1BR9 A;  4HJ5 A;  1IBM Q;  5IYB H;  2XTI A;  1UE5 A;  4DFA A;  2KCT A;  4DR6 L;  4CKB A;  4DR1 L;  3VDY A;  3CQZ H;  4APV A;  3GTG H;  1XNR L;  1V1P B;  1RIP A;  1HZC A;  1QVC A;  4RHR A;  2B29 A;  1HH2 P;  3M9B A;  1TQO A;  2CCZ A;  2PI2 A;  3AFP A;  4O0A A;  5D14 A;  2WB1 E;  1BCP F;  1HRJ A;  2A68 C;  2R92 B;  3J7Y W;  2A8V A;  2NYZ D;  3ICE A;  1X3E A;  4DR4 L;  1CM9 A;  4B3T L;  1HA6 A;  2B2W A;  4TKO B;  2BOS A;  2WKC A;  2XRQ D;  2E2H H;  1STE A;  1EU3 A;  2M9V A;  2HDM A;  2SDF A;  4LF9 L;  5CR3 A;  4JI2 Q;  4YY3 L;  1JOO A;  1EY6 A;  3PO3 H;  1L0W A;  2F4I A;  2HUG A;  3KDF B;  3HOX H;  1AZP A;  1LM0 A;  3CXC A;  3CCV A;  1QNK A;  1IW7 C;  2FFK B;  4AH6 A;  2KHJ A;  4OO1 G;  4JI3 L;  1WTR A;  3J81 L;  5EKL A;  1EQT A;  3RLF A;  3M3Y B;  1L1O B;  2K03 A;  1K28 A;  1GKH A;  2Y0S G;  2JE6 I;  3NXW A;  1NR4 A;  4A3D H;  1WCM B;  4EQO A;  1VQG A;  4Y52 H;  2K1B A;  3J81 i;  5C4Z A;  5COY A;  4FF1 A;  3UE0 A;  1VQC A;  1F9R A;  5EKK A;  3KYH C;  2A5H A;  1TWA H;  1JWS D;  4L5Q A;  1Q90 A;  5J3B A;  4DV2 Q;  4A93 B;  5IGB A;  1KAB A;  1K3B C;  1IBL Q;  1JOR A;  4YWL A;  3IKJ A;  1S72 A;  2O4X A;  2B63 G;  4IAL A;  2MUY A;  1TXY A;  2N3S A;  1TS2 A;  1PRT C;  5HGQ A;  3M4Y A;  2WII B;  1PH6 A;  5C3E B;  1JJC B;  1RD9 D;  4LFA Q;  2ALY B;  3M4Q A;  4ZRZ A;  1E1O A;  4P75 A;  3W1G A;  3WOE A;  2E8G A;  1Q1B A;  3J80 L;  2JA8 B;  3DXJ C;  4KD3 A;  4HSV A;  5E1F A;  2B2Y C;  1E1T A;  5CBE E;  4GNX A;  3A7L A;  1TY2 A;  4LF8 L;  3BYT B;  2MQH A;  3KUP A;  1VQA A;  4YWK A;  2L4N A;  1VQM A;  1A3U A;  1QG7 A;  1YVC A;  3J80 i;  4DV1 Q;  4R8I A;  1Z47 A;  4DA2 A;  1IKL A;  1TWG H;  1U4L A;  3CCM A;  2RA4 A;  1RHP A;  3NUC A;  3RD4 A;  5ELN A;  3KJP A;  2M00 A;  1MD2 D;  2OF1 A;  2HIX A;  5ELE A;  2BA1 A;  4B3S Q;  4FXK C;  2DNE A;  4XXE A;  1H9M A;  5EPK A;  3M7N A;  2EJM A;  1C4Q A;  3CME A;  2LY7 A;  4A3K B;  1R9T B;  3VR5 A;  5KND A;  1KLU D;  1G8Z D;  4UP7 A;  4BXX H;  1DJR D;  5JPN C;  3GV3 A;  2N8N A;  4A3C H;  1D6E C;  1N32 Q;  2Q2I A;  1KQS A;  3S1M B;  3MTS A;  3M4O B;  4FXD A;  2K5D A;  1PRT B;  3AFQ A;  2E2J H;  4DK0 A;  5C4X H;  4IJH A;  1TWH B;  1PTO C;  4LUO A;  3I4M G;  1TII D;  3E3X A;  4NXM L;  1JJG A;  3OOC A;  4JCV E;  3RR5 A;  4LFB Q;  2JSO A;  2CKZ B;  4K8I A;  5BR8 Q;  3K80 C;  4N8X 1;  1JT8 A;  3SHL A;  1Y8P B;  4B3M Q;  2NVT B;  3GTM H;  4HCS A;  5IT9 c;  3ZYY X;  1I94 L;  2NZH A;  3TP7 A;  5M3M G;  3K57 A;  2HDL A;  1N33 Q;  4A3J G;  2DNC A;  1S40 A;  4X3U A;  2F0N A;  1A0I A;  1LV9 A;  1D1I A;  1YNN C;  5C4J H;  2IX1 A;  2NVY H;  2K5W A;  3H3V H;  4C3I H;  2ZTD A;  5C0X H;  2EQS A;  2WB1 G;  3E9I A;  1K73 C;  4K2K A;  1HFN A;  1IKM A;  1EWC A;  2WAQ E;  5L37 A;  2JN4 A;  2A6H C;  2XSC A;  1L0X B;  4EGV A;  1CA6 A;  3STB C;  3HKZ G;  2UU9 Q;  4X62 Q;  4CDF C;  2NTS A;  1EY0 A;  3C1F A;  1K8O A;  4AQY L;  3PUY A;  4DAY A;  1KXL A;  3QOJ A;  3EVQ A;  3PMF A;  4DV0 Q;  4JI0 L;  4V19 0;  3MZ5 A;  1B9M A;  3PIO A;  1PTO B;  1SND A;  5C3X A;  3H0G B;  3A8J E;  1ICF B;  5BN4 A;  2A73 B;  1XMO L;  2A69 C;  2EYJ A;  1PH4 A;  5FLX E;  4DR2 L;  4BBS G;  1FL0 A;  1WJJ A;  4DXG A;  5KNC A;  1FJG L;  3VR2 A;  4NMZ A;  1SXT A;  1XXG A;  4P74 A;  5TSS A;  4JI1 L;  1M1K C;  2QEJ C;  1S5F D;  4WJ3 M;  2B2V C;  3T53 B;  4HAE A;  4B9W A;  3HOX G;  4A3B H;  2RBM A;  1NAP A;  1EL0 A;  2QW7 A;  3KF6 B;  4ZCK A;  5ELB A;  3PF5 A;  1X3Q A;  3BVM A;  1VQ8 A;  1PFB A;  2EY6 A;  4A3D G;  3JC6 6;  3K7A H;  4UP8 A;  3T1H L;  2Z6B A;  1SJE D;  1XX8 A;  5GQO A;  1SYF A;  1HNW L;  5FJ8 H;  2HHH Q;  5HGT A;  1GUS A;  3OSO A;  2UXD Q;  5M5W H;  1BDO A;  1VQE A;  2JA7 G;  2F0F A;  4HJA A;  2A74 C;  1MGS A;  3NBH A;  2M2L A;  3S15 B;  1PH5 A;  2UXC L;  3QIA A;  1LTB D;  1X6O A;  2AHO B;  5IGE A;  1SE4 A;  4RA8 A;  1Y1W G;  3S1Q B;  4CJ2 C;  2RHS B;  4DR5 L;  1KIX A;  2E5L L;  1LO5 D;  2Q2U A;  3S16 H;  5C44 H;  1IHZ A;  4QUC A;  2PMZ B;  1OXS C;  3DM1 A;  1SR3 A;  4RGM A;  4YHH L;  5BN3 A;  3S2H B;  2XWJ B;  4CGY B;  3WDN A;  3KLW A;  2IJ0 A;  4F87 A;  2Q8T A;  1XNQ L;  4G7H C;  4P73 A;  3EFX D;  2JA9 A;  2NVX H;  4I7Z C;  1PXU A;  3FP9 A;  3OMC A;  2QDL A;  1SN8 A;  2UUA L;  2HCI A;  4B9X A;  1Q3L A;  1QZG A;  4PNY A;  3TRE A;  2UXB Q;  1A2U A;  1D5Z C;  4NB3 A;  5K5P A;  2B2U C;  5M5X H;  3E0E A;  1KDB A;  1BBU A;  1IW7 D;  3HOU B;  3BVG A;  1G6Z A;  4JI6 Q;  1X56 A;  2EY2 A;  5HUR A;  1LYL A;  2N78 A;  3CD6 A;  2BE5 D;  1ONL A;  3I3C A;  3FEW X;  1B2T A;  4Y7N B;  4CJ1 B;  1I50 B;  5G3L D;  5C5M A;  2SEB D;  4YCU A;  3PUV A;  5DAU A;  5D3I B;  4A3C G;  1EYC A;  2AUJ D;  1PH2 A;  4PZ8 A;  3TDQ A;  2D5D A;  2GVA A;  1EQV A;  1PYB A;  3LWE A;  2R7Z H;  1X55 A;  3T13 A;  3UDF A;  2Z6K A;  5C4X G;  1SNM A;  1PHJ A;  2Q8R E;  3ZJY C;  1UUP A;  4PZ7 A;  1JOQ A;  5D65 A;  1PRT D;  1FYC A;  4YIJ A;  4PMW A;  5GAG C;  1D8L A;  3MWY W;  2WAQ G;  3NEM A;  1VQO A;  2AQ1 B;  3MA2 B;  4DF7 A;  2JA5 G;  5KEE A;  1C0A A;  5FLX c;  4IUU A;  1SE3 A;  1EYA A;  1I6H B;  2X6G A;  1T5E A;  4ODG A;  5GRO A;  2R93 H;  2EYF A;  3G7L A;  1JB3 A;  1EY4 A;  2FJ2 A;  5IOC A;  4OIJ A;  1B44 D;  4B3T Q;  1F2M A;  4X3T A;  4DV3 Q;  1SNQ A;  1VQ9 A;  1EIF A;  1B7Y B;  1SFO B;  1K83 B;  4YY3 Q;  1VF7 A;  3HGB A;  2X6L A;  4OON A;  5E4X A;  3PUX A;  1K0S A;  1S3O A;  4RGN A;  4A3I B;  2NVQ H;  1T5X D;  4GKK Q;  3TP5 A;  1CZG A;  2SOB A;  4EQP A;  2J7Z A;  4DAP A;  2JQO A;  3EJI A;  4DR7 Q;  1M90 C;  2C9O A;  2QEX A;  4MTN A;  3TRZ A;  3K7U C;  3SEB A;  4KKU A;  3I7F A;  2HQL A;  3FDT A;  1E2V A;  1WTH A;  4DV7 Q;  4KY5 A;  2ES2 A;  3V96 A;  1IZ6 A;  4XTC S;  4H02 A;  3I4M B;  3MXN B;  2OTL A;  4PZ6 A;  2FMC A;  1J6Q A;  1E0B A;  2E2D C;  2NN6 I;  2KUM A;  1QCB D;  3RN2 A;  3A8I E;  3R93 A;  3H94 A;  4NP5 A;  2G9D A;  4XQN A;  4G57 A;  2WP8 J;  5M3M B;  4LJZ C;  4C3H G;  2LXK A;  1EYG A;  5CV6 A;  4FDB A;  1PTO D;  3F2C A;  2IX0 A;  1SYE A;  2LXJ A;  3PV0 A;  3S17 B;  4IUV A;  1AFP A;  4LMQ D;  3NBI A;  1U4M A;  1UNS A;  2VB2 X;  2ZJQ A;  2UUC Q;  1VQ7 A;  4A3B G;  3PUZ A;  1VQK A;  2VUM B;  2B63 H;  1A6X A;  1A15 A;  5FO7 B;  5JJZ A;  3S9W A;  3SK5 A;  2F4V L;  4P72 A;  1N9W A;  3HKZ B;  5FK9 C;  4GLX A;  3MHB A;  5FKA C;  4FF3 A;  4JI8 L;  4DKA C;  2AUK A;  1ZEQ X;  2PMZ E;  4R4O A;  1I4R A;  1YNN D;  4IUQ A;  3TBI B;  4QF4 A;  1STG A;  1TWF B;  4FO2 A;  2AQ2 B;  4IOA A;  1WTX A;  4A3M B;  4OHJ A;  5M9O A;  2FHT A;  2N49 A;  2F0H A;  1Y14 B;  1DYQ A;  4KTA A;  3KOJ A;  2B2W C;  1Y8N B;  2EDG A;  4QIW B;  2WAC A;  3PIP 3;  2HIV A;  1WI5 A;  3STB D;  1YZ6 A;  3HFZ B;  1HNZ Q;  1Q8I A;  3M4P A;  3GP7 A;  3VYR A;  4L5R C;  2I0Q A;  1CZW A;  1V43 A;  2EYO A;  3W2D A;  5IYD H;  3SVM A;  2SNM A;  5C44 G;  1SNO A;  1Q86 C;  3DWQ A;  4OEM B;  4XT3 B;  5EPJ A;  4DR3 Q;  3PO3 B;  4RGO S;  3GTQ H;  4OIK A;  3HOX B;  4BY7 H;  3FRP B;  1HNX Q;  2F0O A;  4L6T B;  4K0K L;  3K6O A;  2C35 B;  2KCN A;  4KD4 A;  1NBW A;  2F0Q A;  2XNA C;  2TSS A;  4A3D B;  4K14 A;  4MNO A;  2ZXP A;  4LF4 Q;  3HOZ H;  1AW7 A;  3VR4 A;  5H1S E;  1U9R A;  2K01 A;  2MHV A;  5IGC A;  1ENF A;  4X3S A;  1YJW A;  4JI4 Q;  1EOV A;  1SSO A;  3NTI A;  4H0L C;  4IOC A;  2VW9 A;  4KHZ A;  5DNF A;  1P16 A;  4BY1 B;  2BA0 A;  1TWA B;  1E22 A;  1K8M A;  4CJ0 B;  4YWM A;  3GTL B;  1MSG A;  1F9P A;  1MKH A;  4CDE C;  1JIC A;  3OPO A;  1X3P A;  1LT3 D;  4KKT A;  1Q82 C;  3W1B A;  4FVM A;  3HOV G;  3J7A 5;  2EVB A;  4IO9 A;  3G4S A;  1WTO A;  1J5E L;  1IL2 A;  2OCE A;  3L7Z C;  4A3J H;  4GNX C;  5IP9 H;  1NMF A;  4BWG B;  1EEF D;  2E2I H;  4HCE A;  3GD7 A;  3UDI A;  2RCN A;  4KN4 C;  4UP9 A;  1M8A A;  3OYY A;  2C5C A;  3ULL A;  1TS4 A;  2CWA A;  4L8J A;  3JAM i;  2ICI A;  3C46 A;  1XMO Q;  3RNU A;  5ELO A;  3BZK A;  2R93 G;  2EE1 A;  3H3V C;  4X64 Q;  1STB A;  2RSO A;  1EWH A;  4X66 L;  3HOW H;  1QWY A;  2X69 A;  2CWP A;  3BS1 A;  3GTP H;  4A3F G;  2D0O A;  4PV1 C;  3L9A X;  2I46 A;  4LF7 L;  3S2D H;  4ABN A;  3CU7 A;  4GOP A;  3I72 A;  1V8Q A;  3PO2 B;  1Z9F A;  2P5Z X;  1QVG A;  2CVR A;  4LAA A;  1XPU A;  4BBS H;  1Z6H A;  4FXG C;  4JI5 L;  4K5W A;  1C8C A;  1Q46 A;  4Q0F A;  4GLA C;  4A3E G;  1PFM A;  1QJO A;  2D9U A;  4J8Q A;  3H91 A;  4DAV A;  2JEB I;  1JOK A;  2E2J B;  1SYD A;  3W3A A;  5C4X B;  3F2D A;  1HR0 W;  2R7D A;  4R4C A;  1HNW Q;  4GN4 B;  4GNX B;  1RDP D;  3QJY A;  4K2L A;  1ENA A;  4DXF A;  3DM3 A;  1MI2 A;  2PNR C;  1KAA A;  3AU7 A;  3CHB D;  2L0C A;  1RTN A;  5J1Z A;  3FMC A;  2IHF A;  1HQR D;  1M4V A;  3ERO A;  2B2T A;  3GTM B;  3K81 C;  2BE5 C;  1HHV A;  1QUQ A;  3S14 B;  4NXN L;  3TZD A;  4DUZ Q;  1YIT A;  3KF8 A;  1F9S A;  4KI0 A;  1EYD A;  4B3R Q;  1BUV T;  1YNJ C;  2K6A A;  2OXP A;  4JBJ A;  2NVY B;  5C4J B;  4JYA L;  1VQP A;  4C3I B;  2YTV A;  5GAH C;  5JOB A;  3AMU A;  2EYH A;  3E0J A;  4XQQ A;  2JA7 H;  4O2D A;  1X32 A;  2K7V A;  5AJ3 Q;  1KHI A;  4JI7 L;  1X65 A;  4ZKB B;  2PNH A;  4JG2 A;  1OXU A;  1WTW A;  2B39 A;  3RUZ A;  3ULJ A;  4QQB X;  5JJI A;  4JC0 A;  1Y1W H;  4RG1 A;  5IWA L;  1LT5 D;  1XPO A;  4R8N A;  2GA4 B;  3DWP A;  3CPF A;  1UE1 A;  3K0X A;  3G6E A;  4POG A;  4UY8 C;  3P7J A;  2EJG C;  2KEC A;  1IBK Q;  5I9P A;  2MJ8 A;  1VQ6 A;  1GUO A;  1V1P A;  3GTJ B;  1C7Y A;  5FLX L;  4DV6 L;  3HZX A;  1VF5 C;  4HJ7 A;  1B53 A;  1LAB A;  3U9S A;  1A8V A;  5CV4 A;  3K5M A;  1XYI A;  1ET9 A;  2L11 A;  1PA6 A;  1K9M C;  4KY6 A;  1D5X C;  2B3G A;  3E9H A;  3HKS A;  2CHB D;  1S5B D;  2LS0 1;  1N34 Q;  4NPS A;  4DV5 L;  1LTT D;  3K0Y A;  3WWV A;  2PQE A;  1SE2 A;  5LMN L;  4OX9 Q;  1HZB A;  5IYD G;  4ZKC B;  4BA1 I;  1BBW A;  4QJF A;  1I6V C;  4IUT A;  3RLN A;  1GHK A;  4BY7 G;  2CH4 W;  4HMJ A;  1W6J A;  1AZQ A;  3CC2 A;  1SRU A;  4J1M A;  1JQY D;  4WRD A;  2DJG C;  5AFW A;  2NN6 H;  3HOY G;  1E24 A;  4HSP A;  1WTQ A;  1JMC A;  1Q1E A;  3K7A B;  5DEH A;  4LF6 L;  3HOZ G;  4AYB E;  1O78 A;  5EBD A;  4HN7 A;  4L5T A;  3BU2 A;  2LFN A;  5IGD A;  4ILW A;  4DAY B;  2CW0 C;  1Y1V G;  1BVS A;  1LTS D;  5M5W B;  3U4Z A;  1TWC H;  1X3G A;  1H9R A;  3RMH A;  2K14 A;  2VL6 A;  3SK6 A;  1EU4 A;  4LF5 Q;  2JA5 H;  2OQ0 A;  1RL2 A;  2JJQ A;  2BDO A;  1CSP A;  1ML0 D;  2Z9H A;  3LX0 A;  1X9N A;  2O5J C;  1STH A;  2K32 A;  2VQF Q;  1BBX C;  3D6W A;  3TP8 A;  3S16 B;  2EXZ A;  4O1N A;  4DNR B;  1EEI D;  3FKI G;  4DV4 L;  4C3J B;  5I9O A;  5IP9 G;  4Q5V A;  1TKW B;  3OWF A;  2LKV A;  2OT2 A;  3D4W A;  3I4O A;  4DNT B;  1A3V A;  1DOK A;  2ZM6 Q;  1Q81 C;  3HRZ C;  3C3L A;  4RCN A;  3MFG A;  4LFC L;  3U58 A;  3ERQ A;  3H09 A;  4NW2 A;  4ZK9 B;  1MHW C;  3LNN A;  4MHE A;  1BQQ T;  2AWO A;  2XGT A;  3GTO H;  1C9O A;  2RHQ B;  3GDE A;  3A8K E;  1YJN A;  1TT2 A;  5M5X B;  4KHP L;  3P20 A;  2A19 A;  1STA A;  3HOW G;  1OXT A;  1HR0 Q;  2H4O A;  2L1B A;  1GUT A;  4LNQ A;  3CC4 A;  1SRO A;  5LHY 1;  3NBH B;  2EZV A;  1EY5 A;  5M3F H;  2IY5 B;  3FHW A;  3BJU A;  3CP0 A;  2K52 A;  1XMQ L;  1CSQ A;  2Z6K C;  1K0R A;  2JXM B;  3DHQ A;  5JVG 3;  1NMG A;  5JEA J;  4C3H H;  5IOD A;  1CKO A;  2EYM A;  1FR3 A;  1GJX A;  1FNV A;  3K8A A;  3FPU B;  4LK1 C;  5I6W A;  2R7Z B;  1SJH D;  4MN3 A;  1PYS B;  3OIQ A;  3EIV A;  2K4K A;  5CV7 A;  1OXX K;  4IZ8 A;  4QUF A;  2K75 A;  2O5I C;  1YEZ A;  5T1G A;  4C3H B;  2B2Y A;  4LW1 A;  4X65 Q;  1A62 A;  2R93 B;  3EA6 A;  2EPB A;  3HS0 C;  3GO5 A;  1Y69 U;  3K5N A;  3TS0 A;  1WTP A;  4XYQ A;  4GKJ Q;  1G2S A;  1G29 1;  4DGZ A;  2PYK A;  4UHV A;  1G2T A;  2RDF A;  1YIJ A;  2F52 A;  5C4H A;  5CMD A;  2NVQ B;  3WOF A;  4QL5 A;  5CGK A;  2KOL A;  1NSN S;  3PIO 3;  4CDD C;  2F0T A;  4DUY Q;  1G6P A;  2JA6 G;  1GUG A;  1KRS A;  3S1M H;  1VDZ A;  2R7F A;  2F3I A;  3F1Z A;  3AEV A;  2IWH A;  3Q6S A;  1J8I A;  2EY1 A;  1A3T A;  5A35 A;  3K59 A;  1LLR D;  5CV9 A;  1FGU A;  3DLL A;  1PH8 A;  4OWX B;  4A3L H;  2L9H A;  4KV6 A;  2RF4 A;  1ZKO A;  2ID0 A;  1EWI A;  2EIF A;  2A6E D;  4LUZ A;  5LMU L;  2Y0S B;  2JYO A;  4AYB G;  3CF5 A;  2HT1 A;  3QWN A;  5EJW A;  1LTL A;  3R3O A;  2NTT A;  1S5D D;  2FIN B;  3FVQ A;  4C1N I;  2K5V A;  1H9S A;  4DV2 L;  3VA5 A;  2RDG A;  1DZ1 A;  1Y8O B;  2WV6 D;  1KTK A;  2J4X A;  3F2U A;  1SNP A;  1IBL L;  3I4N G;  3CRK C;  1J5E Q;  1B4O A;  1PYW D;  1EIG A;  4JV5 Q;  1GD7 A;  4H13 C;  1BKB A;  3Q23 A;  1KNA A;  4BA2 I;  1N36 L;  5G3L F;  3KF6 A;  4XIG S;  4GN5 A;  2B63 B;  3SR1 A;  1HUN A;  5ISR A;  3ERS X;  1S5C D;  2NN6 G;  4IN3 A;  4R1J A;  1Q8K A;  4G4K A;  3HOV H;  1BCP C;  1XJV A;  1YNJ D;  1VCI A;  3CKI B;  3NE5 B;  3W5O A;  4C2M H;  2FXQ A;  4DR6 Q;  4JBM A;  4DR1 Q;  2L15 A;  1QIL A;  1PRT F;  2VB3 X;  1U0L A;  1XNR Q;  3EBE A;  4N9P A;  4DV1 L;  2AMC B;  2O2L D;  3LWU A;  2F3W A;  3S1N H;  1X3F A;  2R92 G;  3PCO B;  3L3O C;  3M7G A;  4IPC A;  5K36 G;  4DR4 Q;  4J6H A;  4K8J A;  3GTQ B;  3MC0 B;  3CMA A;  4LF9 Q;  2B8F A;  4BY7 B;  1BOS A;  2KJX A;  2MPM A;  2ZTC A;  4A3F H;  1JE4 A;  3RZD H;  2F0V A;  1FD7 D;  3J7A V;  2HCC A;  4OL7 A;  2V1C C;  3D6C A;  2Z8L A;  4JI3 Q;  4JBW A;  3Q24 A;  4IJL A;  4U68 A;  1I4X A;  2K5H A;  3HOZ B;  4CBV A;  4A3E H;  3AQQ A;  4WFN 3;  3X3M A;  4ME3 A;  4JBK A;  1B3A A;  2RDH A;  1UEA B;  2PZT A;  4LFB L;  1CQV A;  1BCP B;  5EBC A;  1V9P A;  4A93 G;  1O80 A;  1DM0 B;  4CKE A;  2L12 A;  2YU9 H;  4X6A H;  4B3M L;  3J81 j;  3GTK H;  4JYA Q;  3KLS X;  1W3S A;  1ASY A;  2AWN A;  1HJP A;  1EFI D;  3ER0 A;  2F0M A;  4JOI A;  5M3F G;  3I4L A;  1N33 L;  3RLO A;  1PTO F;  1QB5 D;  2I5L X;  5C3E G;  3KBX A;  2CW0 D;  4A75 A;  4P71 A;  5IWA Q;  3CCQ A;  4A3J B;  1VMP A;  3CCR A;  4LWC A;  1I4Q A;  1VQI A;  2VY3 A;  2JA8 G;  1G91 A;  1UWV A;  3TEH B;  4R4I A;  1DD2 A;  1IYV A;  1HTP A;  1ESF A;  1VS0 A;  2WB1 B;  3CC7 A;  2UU9 L;  2EY5 A;  5J22 A;  1II3 A;  1PZI D;  4LF8 Q;  1LTI D;  1EZ8 A;  2UUB L;  3N52 A;  2IL8 A;  1DON A;  3VYS A;  4BS9 A;  3KJO A;  3K58 A;  3HOU H;  2LSS A;  3CQZ B;  5EQ0 A;  4GOP C;  4XQJ A;  1CA5 A;  4EQ5 A;  1IXR A;  3GTG B;  3GTP B;  3CAM A;  4EX5 A;  2B2U A;  2HD3 A;  1R4P B;  1JWU D;  4OWT B;  3NTK A;  3G6J B;  4A3K G;  3S2D B;  1EUJ A;  5I4D A;  2Z0S A;  4Y7N H;  1J9O A;  1I3Q H;  2KCM A;  1CKN B;  1TY0 A;  2PQA A;  3VR6 A;  4BBS B;  2HQE A;  5JEA G;  2N55 A;  4M1U B;  2E2H B;  4KK7 A;  1CHP D;  2IPK D;  4KMU C;  5CYU A;  1NE3 A;  3IL8 A;  3K5O A;  3I90 A;  2QCP X;  1NY4 A;  1VQ4 A;  4A3L G;  1SDF A;  2K5Q A;  1F77 A;  2MGS A;  4ID6 A;  5KYI A;  4J15 A;  1VQJ A;  1PH1 A;  3R8B A;  3BDC A;  1TS5 A;  2B2T C;  2R6G A;  4NXM Q;  3PF4 A;  3I70 A;  3V05 A;  4HMI A;  3MEH A;  4H7B A;  1GO3 E;  5ELC A;  3HOY H;  5IYC G;  3RZO H;  1SE8 A;  4UAI A;  4BBR H;  5FOB B;  2HHH L;  1C48 A;  3SK4 A;  4EVO A;  2RSN A;  1I94 Q;  1DOL A;  4IPH A;  5F2D A;  1Y1V H;  1K8G A;  1XPR A;  4DV4 Q;  4A3I H;  3TME A;  4RKB A;  1FVI A;  4GOP B;  2JA7 B;  1L0Y B;  4F8M A;  1HZ9 A;  1FNU A;  2KVM A;  4NDX A;  4E6I A;  1Y1W B;  3NQT A;  1ROD A;  4PMC A;  2QF7 A;  1LUZ A;  3U9O A;  2VQE L;  1Q12 A;  1NNX A;  3FKI H;  2PW5 A;  4IFD I;  5DM7 3;  1CFM A;  4AQY Q;  3T1Y L;  3NEL A;  1D2B A;  3TSS A;  3EQL C;  4JI0 Q;  2J0T D;  2QA4 A;  4PMB A;  2F0L A;  5M5Y H;  2UXB L;  1CKM A;  1F2Z A;  3D4R A;  2K28 A;  3KLS A;  3TS2 A;  2Q2T A;  1TWG B;  3GV6 A;  1I5F A;  2F0S A;  2I5H A;  2JK8 A;  2KQ3 A;  2F0E A;  2XN9 C;  3MAQ A;  3S17 H;  3UDX A;  4DR2 Q;  1XMQ Q;  4JI6 L;  2KEN A;  1FJG Q;  1B9N A;  1B70 B;  4QY7 A;  3KF8 B;  3EN2 A;  3KLR A;  2V4D A;  4XYO A;  1E3P A;  4JI1 Q;  4U67 3;  2KCC A;  4L63 B;  1GOZ A;  2I5M X;  3S1R H;  3A5U A;  4RGT A;  2LMC B;  4ZUJ A;  1O7Z A;  3PSI A;  2TMP A;  3I56 A;  2WIN B;  2Z4H A;  2A6E C;  4DN4 M;  1U4P A;  1IYJ B;  5FO8 B;  3CCS A;  1KL9 A;  1EOT A;  1E7Z A;  1TWF H;  1HPC A;  4P2C B;  3F2B A;  4A3M H;  3T1H Q;  2PCF B;  3MFY A;  4TVA B;  4K5X A;  1VQB A;  4DNI A;  4HID A;  1JJ2 A;  1U5K A;  1TWC B;  3CRL C;  3H6M A;  1UE6 A;  3ITP A;  3R2I A;  4RKL A;  4RH6 A;  1KLG D;  2WAQ B;  4DK1 A;  2JA5 B;  3ND9 A;  1BCP D;  4YCV A;  4DV3 L;  5IT9 E;  2F0I A;  1E2W A;  1EY8 A;  3HKZ E;  4OGQ C;  2UXC Q;  2GN5 A;  2RKS A;  5IIF A;  2A1A A;  5E7N A;  1QVF A;  1DXM A;  4LUV A;  1BNZ A;  1AE3 A;  4AIM A;  1I4G A;  4DR5 Q;  3S24 A;  2KEE A;  2E5L Q;  3T56 B;  1QE6 A;  4GKK L;  2K5N A;  1RCV D;  3N6R A;  1YNX A;  2YV5 A;  4DR7 L;  1STY A;  1BO0 A;  1XTD A;  3D8G A;  2G9H D;  4HIO A;  4F88 A;  4YHH Q;  2NZ1 D;  1VQN A;  4QIW E;  3CPW A;  1AN8 A;  3ONA B;  4A3G H;  2CFM A;  2RQX A;  4I7A A;  3K5L A;  2AQ3 B;  1STN A;  5KGU A;  3E5S A;  4DV7 L;  2DN8 A;  1XNQ Q;  2JA6 H;  5LMU Q;  3KBG A;  3LGJ A;  2ZJP A;  2N88 A;  3GTO B;  4BY1 H;  1A2T A;  1LTA D;  4FP5 D;  4DU9 A;  4I65 A;  2UUA Q;  3HOU G;  1B3Q A;  3URY A;  1G51 A;  3D0F A;  1O7Y A;  2KA7 A;  4CDC C;  4MIU A;  3GTL H;  1ILP A;  2QDB A;  4RHS A;  2VZA A;  4ME5 A;  2YTY A;  2CQO A;  3U50 C;  4C1N K;  1W2B A;  5DLQ E;  5C3W A;  5M3F B;  1N36 Q;  1PFN A;  4O42 A;  1D7Q A;  3BZD B;  1TVX A; 
#chains in the Genus database with same CATH homology
 4LW1 A;  4GKK Q;  4X65 Q;  1WOC A;  4WJ4 A;  3RN5 A;  1A62 A;  2JQO A;  3TQY A;  3L2P A;  4DR7 Q;  1M90 C;  2UUC L;  1WYD A;  3GO5 A;  4KHP Q;  2QEX A;  4MTN A;  1OTC A;  3TRZ A;  3K7U C;  3TS0 A;  3I4N H;  1N8R C;  3A0J A;  1VQH A;  3D31 A;  3KDF A;  4GKJ Q;  1SLJ A;  4OXP A;  3H0G G;  3I7F A;  2HQL A;  1G29 1;  1CKN A;  2KHI A;  4DV7 Q;  2PI2 E;  1YIJ A;  2ES2 A;  2F52 A;  1IZ6 A;  1QUQ B;  4XTC S;  5M3M H;  1DGS A;  1L1O A;  4H02 A;  3MXN B;  1MJE A;  2OTL A;  4PZ6 A;  1T9H A;  5GAD C;  1HZA A;  4QL5 A;  4JV5 L;  1YHA A;  3F8T A;  3ULP A;  1J6Q A;  3I55 A;  1KD1 C;  2R7Z G;  2NN6 I;  4BBR G;  3BZC A;  3CCE A;  4DUY Q;  1JB7 A;  1KRT A;  1G6P A;  5FLM G;  1KRS A;  4QGU A;  3RN2 A;  2JA6 G;  3S1M H;  4OO1 I;  2R7F A;  1L1O C;  2F3I A;  1YI2 A;  1KAW A;  1O7I A;  3F1Z A;  1UEB A;  3AEV A;  4DK6 C;  3MEF A;  3OTO L;  1YJ9 A;  2WP8 J;  2VUM H;  2MO1 A;  4KLK A;  3KFU A;  4A3I G;  1NJI C;  1HNZ L;  2LXK A;  1FGU A;  3DLL A;  1EYG A;  1PH8 A;  4FDB A;  4OWX B;  5C0X J;  4A3L H;  3PUW A;  3F2C A;  2IX0 A;  4HJ5 A;  1IBM Q;  2YYZ A;  2LXJ A;  2NZO A;  2RF4 A;  3PV0 A;  3PO2 H;  5IYB H;  2XTI A;  1UE5 A;  1JE5 A;  2R92 H;  2KCT A;  4DR6 L;  2DGY A;  1EQR A;  2ID0 A;  1EWI A;  4UPA A;  2EIF A;  4DR1 L;  3VDY A;  4LUZ A;  4DR3 L;  3CQZ H;  4APV A;  5LMU L;  2UUC Q;  2ZJQ A;  1VQL A;  1VQ7 A;  1XNR L;  3A74 A;  1RIP A;  3GTG H;  3PUZ A;  4A3B G;  1HZC A;  1VQK A;  1CUK A;  1QVC A;  1HNX L;  4AYB G;  3CF5 A;  2B63 H;  2HT1 A;  1LTL A;  2B29 A;  1HH2 P;  2F4V L;  3M9B A;  2CCZ A;  2K5V A;  1N9W A;  2PI2 A;  4P72 A;  5EAY A;  3AFP A;  4DV2 L;  4O0A A;  3OW2 A;  4GLX A;  2WB1 E;  4JI8 L;  2A8V A;  4DKA C;  1IBL L;  3I4N G;  2VNU D;  3ICE A;  1X3E A;  4DR4 L;  1J5E Q;  2PMZ E;  3J7Z C;  4B3T L;  4R4O A;  3M3Y H;  4LF4 L;  4JV5 Q;  2E2H H;  1GD7 A;  4JI4 L;  4IOA A;  4LF9 L;  1BKB A;  4JI2 Q;  4YY3 L;  4BA2 I;  1WCM H;  2N49 A;  4ALP A;  3KF6 A;  1N36 L;  4XIG S;  1Y14 B;  4GN5 A;  3S14 H;  1L0W A;  3PO3 H;  3KOJ A;  3ERS X;  3KDF B;  3HOX H;  1LM0 A;  3CXC A;  2NN6 G;  4R1J A;  2HIV A;  1PFS A;  1WI5 A;  4YCW A;  3STB D;  1YZ6 A;  4AH6 A;  3CCV A;  3HFZ B;  2KHJ A;  4OO1 G;  1Q8K A;  4JI3 L;  5HY6 A;  1HNZ Q;  3HOV H;  4A93 G;  3RLF A;  3M4P A;  4L5R C;  1XJV A;  2I0Q A;  1VQD A;  1VCI A;  1L1O B;  4A93 H;  3W5O A;  4IPD A;  1V43 A;  4C2M H;  3G48 A;  1GKH A;  2FXQ A;  2JE6 I;  2Y0S G;  4DR6 Q;  5IYD H;  4JBM A;  1AE2 A;  1Q86 C;  5C44 G;  4DR1 Q;  2VUM G;  4A3D H;  2L15 A;  4DR3 Q;  1VQG A;  3GTQ H;  1U0L A;  4IFD J;  1XNR Q;  4Y52 H;  3EBE A;  4DV1 L;  2AMC B;  3J81 i;  4BY7 H;  3UE0 A;  1HNX Q;  1VQC A;  5IYB G;  1X3F A;  3KYH C;  3S1N H;  5C3E H;  4K0K L;  1TWA H;  2R92 G;  3PCO B;  2F4V Q;  2C35 B;  4L5Q A;  1NTG A;  5J3B A;  4DV2 Q;  2UUB Q;  3GTJ H;  1NBW A;  4IPC A;  1KC8 C;  4JI8 Q;  5K36 G;  1IBL Q;  4YWL A;  4A3M G;  3CCJ A;  1S72 A;  2JA8 H;  4DR4 Q;  4MNO A;  4LF4 Q;  1SMX A;  2B63 G;  3HOZ H;  1EIY B;  5H1S E;  1WFQ A;  1TXY A;  1YJW A;  4JI4 Q;  2N3S A;  3CMA A;  4LF9 Q;  1EOV A;  4IOC A;  2VW9 A;  4KHZ A;  5HGQ A;  1P16 A;  2K50 A;  2ZTC A;  4A3F H;  1PH6 A;  4DPG A;  3RZD H;  1IBM L;  1JJC B;  1VQF A;  2BA0 A;  4LFA Q;  2ALY B;  1E22 A;  4X64 L;  3M4Q A;  2V1C C;  1E1O A;  4YWM A;  4P75 A;  3W1G A;  4JI3 Q;  2E8G A;  1Q1B A;  4JBW A;  3IRB A;  4IJL A;  2K5H A;  3PO3 G;  3H15 A;  4A3E H;  3AQQ A;  1MKH A;  1E1T A;  2DUD A;  4GNX A;  2D0P A;  1MJC A;  4ME3 A;  4JBK A;  4LF8 L;  1YHB A;  2MQH A;  4LFB L;  1VQA A;  4YWK A;  1VQM A;  1Q82 C;  3W1B A;  2BH8 A;  3HOV G;  3J7A 5;  1YVC A;  3J80 i;  4DV1 Q;  4A3K H;  1R9T H;  1Z47 A;  4IO9 A;  3G4S A;  1TWG H;  1V9P A;  1J5E L;  2OCE A;  3L7Z C;  3JAM c;  3CCM A;  4GNX C;  4A3J H;  3UE1 A;  1IL2 A;  5IP9 H;  2YU9 H;  4K0K Q;  1NMF A;  5ELN A;  3J81 j;  4B3M L;  3KJP A;  4X6A H;  3GTK H;  4A3G G;  4JYA Q;  2KBN A;  2HIX A;  1W3S A;  2WFW A;  2BA1 A;  4JI2 L;  1ASY A;  2AWN A;  2E2I H;  3GD7 A;  4B3S Q;  3M4O H;  1HJP A;  3UDI A;  2RCN A;  2OWO A;  2VS1 A;  3ER0 A;  4JOI A;  5M3F G;  4UP9 A;  1N33 L;  3RLO A;  3M7N A;  4BY1 G;  5LMN W;  2I5L X;  5C3E G;  1A63 A;  1H95 A;  3CME A;  1TWH H;  3OYY A;  3ULL A;  4A75 A;  2CWA A;  4P71 A;  4MZ9 A;  5IWA Q;  3JAM i;  3CCQ A;  1OXV A;  4GLV B;  4UP7 A;  3RNU A;  1XMO Q;  4BXX H;  5ELO A;  3BZK A;  2R93 G;  4JOI C;  3CCR A;  4LWC A;  1VQI A;  2VY3 A;  2JA8 G;  2N8N A;  2MO0 A;  4X64 Q;  1UWV A;  4A3C H;  1N32 Q;  2Q2I A;  1KQS A;  3TEH B;  1MIU A;  4R4I A;  4X66 L;  3HOW H;  2CWP A;  4DUZ L;  1VS0 A;  3CW2 C;  4RMF A;  2NVT H;  3GTP H;  5IYC H;  3CC7 A;  4A3F G;  2D62 A;  2UU9 L;  2D0O A;  3AFQ A;  2E2J H;  5C4X H;  4A76 A;  4LF7 L;  4IJH A;  1GVP A;  4LUO A;  3S2D H;  3I4M G;  4B3R L;  4LF8 Q;  4NXM L;  1JJG A;  4GOP A;  4JCV E;  3RR5 A;  2UUB L;  4LFB Q;  2VQE Q;  4C3J H;  2CKZ B;  1UE7 A;  1Z9F A;  1YHQ A;  1QVG A;  5BR8 Q;  3K80 C;  5JJL A;  1JT8 A;  1XPU A;  5AJ3 L;  3KJO A;  4BBS H;  1D7Q A;  4JI5 L;  3G71 A;  1Q46 A;  4A3E G;  4GLA C;  3HOU H;  2LSS A;  4B3M Q;  4GOP C;  4EQ5 A;  1IXR A;  3CAM A;  3GTM H;  5IT9 c;  4EX5 A;  2JEB I;  1GM5 A;  1I94 L;  4OWT B;  2NZH A;  3T1Y Q;  3F2D A;  1HR0 W;  2R7D A;  5M3M G;  4A3K G;  1EUJ A;  4LFA L;  3CCL A;  4R4C A;  1V1Q A;  2Z0S A;  4PG3 A;  4Y7N H;  4A3J G;  1N33 Q;  1S40 A;  4GN4 B;  3J81 c;  3Q8D A;  2IHE A;  4GNX B;  1IBK L;  1I3Q H;  1HNW Q;  2KCM A;  1CKN B;  1A0I A;  2PQA A;  3DM3 A;  5C4J H;  2IX1 A;  3H3V H;  2NVY H;  5IP7 H;  4C3I H;  5JEA G;  2ZTD A;  2EQS A;  2IHF A;  2WB1 G;  3E9I A;  1K73 C;  3K81 C;  1NE3 A;  4L5S A;  1QUQ A;  4X66 Q;  4HJ8 A;  2WAQ E;  4NXN L;  1K3R A;  1NY4 A;  1VQ4 A;  1N34 L;  4DUZ Q;  3H0G H;  4A3L G;  3STB C;  3HKZ G;  3B6Y A;  4J15 A;  1VQJ A;  3UDG A;  1PH1 A;  4X62 Q;  2UU9 Q;  1YIT A;  3PO2 G;  4BXX G;  4LF7 Q;  4KI0 A;  4OX9 L;  4B3R Q;  2R6G A;  4NXM Q;  1AH9 A;  4HIM A;  4JBJ A;  4JYA L;  5GAE C;  3PF4 A;  1L2F A;  4AQY L;  1VQP A;  4HJ9 A;  2YTV A;  5GAH C;  4B3S L;  3PUY A;  2JA7 H;  4O2D A;  1KXL A;  1GO3 E;  5AJ3 Q;  4DV0 Q;  1KHI A;  5IYC G;  1PH7 A;  4JI0 L;  1SE8 A;  4JI5 Q;  4JI7 L;  3L0O A;  3HOY H;  1X65 A;  3RZO H;  4BBR H;  2PNH A;  4JG2 A;  1OXU A;  1QZH A;  5FLM H;  2HHH L;  3PIO A;  3ULJ A;  4QQB X;  5JJI A;  4R4T A;  4JC0 A;  1Y1W H;  4RG1 A;  5IWA L;  1I94 Q;  4IPH A;  1XPO A;  1XMO L;  3CPF A;  1PH4 A;  1UE1 A;  3K0X A;  1Y1V H;  3G6E A;  1K8G A;  4DR2 L;  4POG A;  1XPR A;  4UY8 C;  4BBS G;  5JJK A;  4DV4 Q;  1FL0 A;  1WJJ A;  4IPG A;  4A3I H;  1FJG L;  3J80 c;  1N32 L;  1IBK Q;  1VQ6 A;  1K8A C;  4A4I A;  1FVI A;  4P74 A;  4GOP B;  4JI1 L;  1M1K C;  1C7Y A;  1EFW A;  4DV6 L;  4HJ7 A;  4WJ3 M;  1WCM G;  1ASZ A;  1A8V A;  1HZ9 A;  3HOX G;  1PA6 A;  1K9M C;  2EXD A;  4A3B H;  1LUZ A;  2VQE L;  1Q12 A;  2B3G A;  3E9H A;  4NXN Q;  3HKS A;  5BR8 L;  1N34 Q;  4NPS A;  3KF6 B;  3FKI H;  4DV5 L;  4LF5 L;  3WWV A;  5C0X G;  3PF5 A;  1VQ8 A;  4OX9 Q;  5LMN L;  4IFD I;  1HZB A;  5IYD G;  2BH2 A;  4A3D G;  3SGI A;  3JC6 6;  3K7A H;  4UP8 A;  4BA1 I;  2VQF L;  1BBW A;  4QJF A;  4AQY Q;  2Q2H A;  2PQA B;  3U4V A;  4R4Q A;  3T1H L;  3T1Y L;  3S1Q H;  3RLN A;  3NEL A;  3I2Z A;  4JI0 Q;  5GQO A;  4JI7 Q;  4BY7 G;  2QA4 A;  5M5Y H;  2YTX A;  1EQQ A;  5FJ8 H;  1HNW L;  2UXB L;  4DAM A;  3CC2 A;  1CKM A;  1SRU A;  2HHH Q;  4GN3 B;  2UXD Q;  3TS2 A;  5M5W H;  3M85 A;  2Q2T A;  1VQE A;  1I5F A;  2I5H A;  2JK8 A;  1PH3 A;  2JA7 G;  3S17 H;  3S2H H;  3UDX A;  4HJA A;  1E24 A;  4DR2 Q;  1XMQ Q;  4JI6 L;  2KEN A;  3HOY G;  2IT1 A;  1FJG Q;  2ZM6 L;  1B70 B;  1Q1E A;  4QY7 A;  2ZJR A;  3KF8 B;  3EN2 A;  3PIP A;  1PH5 A;  1JMC A;  4AYB E;  4LF6 L;  3HOZ G;  2UXC L;  1E3P A;  1X6O A;  2AHO B;  3AYH B;  1Y1W G;  1PH9 A;  4JI1 Q;  4HIK A;  4DV6 Q;  2RHS B;  4DR5 L;  4L5T A;  2I5M X;  3S1R H;  3BU2 A;  1KIX A;  3S15 H;  2E5L L;  4DAY B;  3A5U A;  2Q2U A;  3S16 H;  2GVB A;  4X62 L;  3PGZ A;  5C44 H;  1Y1V G;  1BVS A;  1OXS C;  2MNA A;  1SR3 A;  1PVO A;  3U4Z A;  2OTJ A;  3PSI A;  1TWC H;  4YHH L;  1B8A A;  3I56 A;  1X3G A;  1HR0 L;  4DV0 L;  2K14 A;  2VL6 A;  4DV5 Q;  3KLW A;  4LF5 Q;  1IYJ B;  3CCS A;  1Q7Y C;  2OQ0 A;  2ZTE A;  1KL9 A;  1RL2 A;  2JA5 H;  5LMN Q;  1E7Z A;  2JJQ A;  1XNQ L;  2MFI A;  2OQK A;  1CSP A;  1P8L A;  1TWF H;  1X9N A;  4TQU S;  5IY0 A;  3F2B A;  2VQF Q;  4P73 A;  2JA9 A;  2NVX H;  4A3M H;  3T1H Q;  3FP9 A;  4TVA B;  3NEN A;  1VQB A;  1SN8 A;  3FKI G;  2UUA L;  4DNI A;  4DV4 L;  4HID A;  1JJ2 A;  4IFD G;  1U5K A;  1QZG A;  2UXB Q;  3TRE A;  1I50 H;  1UE6 A;  5IP9 G;  4NB3 A;  3A5Z B;  2Y0S E;  5M5X H;  3E0E A;  3I4O A;  1BBU A;  2ATW A;  3H3V I;  4YCV A;  4DV3 L;  4JI6 Q;  1X56 A;  1X54 A;  2ZM6 Q;  1Q81 C;  3HKZ E;  5C0X I;  4DK3 C;  4POF A;  5FJ8 G;  4LF6 Q;  1LYL A;  2GN5 A;  2N78 A;  2A1A A;  5E7N A;  2UXC Q;  4GS3 A;  1PV4 A;  4LFC L;  4LUV A;  3U58 A;  1QVF A;  3CD6 A;  1AE3 A;  4AIM A;  4DR5 Q;  3S24 A;  3OTO Q;  2E5L Q;  2AWO A;  4YCU A;  2XGT A;  3PUV A;  4GKK L;  4X65 L;  1C9O A;  2K5N A;  3GTO H;  2RHQ B;  3GDE A;  1YNX A;  2YV5 A;  1YJN A;  4DR7 L;  4A3C G;  1XTD A;  4HIO A;  4KHP L;  2A19 A;  4YHH Q;  1PH2 A;  3HOW G;  1I6H H;  4PZ8 A;  1OXT A;  4GKJ L;  1VQN A;  1HR0 Q;  4QIW E;  2GVA A;  1PYB A;  3CPW A;  2R7Z H;  1X55 A;  2CFM A;  4A3G H;  4LNQ A;  3UDF A;  2Z6K A;  1YBY A;  4DV7 L;  5C4X G;  1PHJ A;  3CC4 A;  1SRO A;  3ZJY C;  3NBH B;  3CCU A;  1XNQ Q;  2JA6 H;  5LMU Q;  3LGJ A;  2UXD L;  4PZ7 A;  1SFO H;  1K83 H;  2QGQ A;  5M3F H;  2ZJP A;  2IY5 B;  3FHW A;  3BJU A;  3CP0 A;  4BY1 H;  4PMW A;  2K52 A;  5GAG C;  1XMQ L;  1D8L A;  2AKW B;  1CSQ A;  2WAQ G;  2Z6K C;  1K0R A;  3NEM A;  1VQO A;  2UUA Q;  1NMG A;  5JEA J;  4C3H H;  1G51 A;  5FLX c;  1CKO A;  4DUY L;  2JA5 G;  3D0F A;  3HOU G;  1C0A A;  2H5X A;  5GRO A;  2R93 H;  3GTL H;  3K8A A;  1VQ5 A;  2VZA A;  4B3T Q;  4DV3 Q;  1VQ9 A;  2JEA I;  4OWW B;  1PYS B;  1EIF A;  2YTY A;  2CQO A;  3EIV A;  3U50 C;  2K4K A;  1B7Y B;  1OXX K;  4YY3 Q;  5DLQ E;  2K75 A;  1W2B A;  1N36 Q;  4LFC Q;  1YEZ A;  4OON A;  5IE8 A;  3PUX A;  2ASB A;  1S3O A;  2NVQ H;  3I4M H;  5IP7 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...