4A3BK

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3bK00
4LLGA 4A3IC 1YNNA 3HKZD 5IYBC 4A3KK 5FLMK 2JA6K 4MEXA 3DXJA 1SFOC 4A3DC 4C2MK 4OIQA 1I50C 2A69A 3S1RC 5IP7C 3S16K 1TWGK 3PO2K 3GTLK 5D4DA 1TWCC 4OINA 3HOZC 3GTQK 4MEYA 1TWFK 3I4MC 1YNJA 3K7AK 4Y7NC 4A3BK 1R9TC 4KN7A 4X6AC 5C4XC 4KMUA 4A3MK 3RZOC 5IP9C 3S2HK 4JK1A 4BXXK 2E2HK 3S1MC 2R93K 5IYCC 3M3YK 2PMZL 4MQ9A 3I4NC 3CQZC 5C4JC 1K83C 2WAQL 3GTOK 4BBSK 2O5IA 3S1NK 2NVYC 3GTGC 2A68A 2R7ZC 2A6HA 4LJZA 5C44K 2E2JK 4A3CK 3HOYC 1I6HC 4A3KC 5FLMC 2JA6C 1Y1WC 4BY7C 1TWHC 3HOXC 1I3QC 3HOUK 3S15C 2PMZD 5IYDC 1TWGC 2YU9K 4GZYA 2JA7C 3PO2C 2WAQD 2O5JA 1XPPA 1WCMC 3GTPK 5C3EC 3GTQC 4A93K 1TWFC 3S14K 4YFXA 2PPBA 1Y1VC 2NVTK 3K7AC 2JA5K 4A3BC 4QIWL 4A3MC 2VUMK 4BBRK 2E2IK 4BY1C 4BXXC 3GTJK 3HOVK 4G7OA 2A6EA 2B63C 3GTKC 4A3LK 3GTOC 4BBSC 3S1NC 1TWAK 4KN4A 2JA8C 5C44C 2E2JC 4C3HK 4QJVB 4QIWD 1HQMA 4A3FK 3RZDK 3S1QK 1IW7A 4Q4ZA 3HOUC 2YU9C 3M4OK 4A3JK 4A3IK 5IYBK 5TMFA 3S16C 4C3IK 3GTPC 4A93C 1I50K 3S1RK 2JA5C 3GTLC 5TMCA 4OIOA 3GTMK 3H0GK 2VUMC 2WB1L 2E2IC 5M5YK 4XLNA 4Y52K 4A3GK 1ZYRA 5M5WK 3HOZK 3GTJC 4OIRA 4YG2A 4OIPA 3PO3K 3S2HC 1R9TK 4A3LC 4X6AK 2E2HC 3S17K 2R93C 5IP9K 3FKIK 2NVXK 2NVQK 1TWAC 2R92K 3M3YC 4A3EK 5M3MK 5M3FK 2BE5A 4XLPA 4A3CC 2WB1D 1I6VA 3CQZK 5M5XK 5C4JK 2Y0SL 3HOWK 4YFKA 3S2DK 3EQLA 2R7ZK 1SMYA 2PA8L 4A3JC 1I6HK 4ZH4A 1BDFA 4LK0A 4G7HA 4C3JK 1Y1WK 4BY7K 1TWHK 3HOXK 4XSXA 1I3QK 4YFNA 3WODA 5FJ8K 3S15K 5IYDK 1SFOK 2JA7K 4A3DK 3GTMC 3H0GC 4AYBL 2Y0SD 4Y52C 3S14C 4NOIA 4LK1A 2NVTC 1WCMK 5IP7K 5C3EK 2PA8D 4A3GC 4G7ZA 1Y1VK 2CW0A 4BBRC 3PO3C 1TWCK 3S17C 3H3VL 4BY1K 3FKIC 2NVXC 2NVQC 2R92C 3HOVC 3I4MK 4Y7NK 5C4XK 4A3EC 4Q5SA 3HKZL 3RZOK 2B63K 4AYBD 3GTKK 3HOWC 3S1MK 3S2DC 5IYCK 4QJVA 2JA8K 3I4NK 3RZDC 4A3FC 3S1QC 4XSZA 1K83K 2NVYK 3GTGK 3H3VD 3M4OC 3HOYK
chains in the Genus database with same CATH superfamily
4MEXA 3GTOA 1VGXA 4C2MK 2D6FC 1J6WA 1AB4A 1TWCC 4OINA 3I4MC 3GTPA 1WOPA 2ZUEA 2R93K 3AD9C 4GTBA 2PMZL 3M3YK 2WAQL 2VUMA 3LAPA 3GTOK 2O5IA 1BS2A 2NVYC 3GTGC 2A68A 3HOYC 2R92A 1INNA 1I6HC 5FLMC 3GDZA 3CAGA 1Y1WC 1XXCA 4BY7C 1O25A 3HOXC 3S15C 3HOUK 1TWGC 3BP8C 4WILA 2EBBA 3GTPK 3G4CA 3L4KA 3GTQC 5IOQA 3S14K 1EH1A 1Y1VC 3K7AC 4BKWA 3FOFA 4A3BC 4WJ3M 2VUMK 3HOVK 1IE0A 1C0AA 2A6EA 4KAWX 4O2DA 3GTKC 3H0GA 2PHCB 1UV7A 1F7VA 1O27A 2E2JC 4C3HK 1VH2A 3RZDK 1EI6A 4Q4ZA 3M4OK 5IORA 2NVYA 3GTGA 3MMLB 3GTMK 3H0GK 2GSUA 2WB1L 2E2IC 1Y1WA 5JVOA 1IS1A 1G51A 4YG2A 1O26A 4A3LC 1YCLA 1O2FB 1ZBSA 2XCOA 1Y1VA 3AD8C 4A3CC 3HOWK 4G0UA 4KM9A 1I6HK 4GTLA 3GTKA 1BDFA 1Y1WK 4BY7K 4KMDA 3HOXK 4YFNA 3S15K 2JH3A 3GEIA 3VA7A 1PJ7A 4NOIA 3A8IA 4KB4A 4GTDA 1Y1VK 4BBRC 4WJ4A 3FKIC 5C4XK 3N0BA 3HKZL 3RZOK 3GTKK 1XZQB 3S2DC 2E2IA 3GEEA 1F9NA 3I4NK 4A3FC 3S1QC 1WQFA 3H3VD 3FOEA 5EGHA 4P5AA 4LLGA 2P8TA 5IYBC 4FZBA 1BJTA 4A3KK 1SFOC 3TFIA 4C3IC 4A3DC 4OIQA 2A69A 3S1RC 4LR2A 3PO2K 1X31C 1L0WA 2YU9A 4Y7NC 4X6AC 5IP9C 3QX3A 4JK1A 3S1MC 3S0XA 4KATA 4MQ9A 5C4JC 4A3CK 2A6HA 1WOOA 5C44K 5IOSA 1O28A 1J6XA 4KMAA 2JA6C 4C3JC 1PJ5A 1TWHC 1DD5A 1WQGA 1XZPB 4KM8A 2YU9K 2ZUFA 4PABA 3SZYA 3BP3A 4A93K 1RU0A 1TWFC 4KDDA 2PPBA 5EGEA 4A3MC 1USOA 4BBRK 4BY1C 4BXXC 3ADAC 2V6UA 4BBSC 3S1NC 1F7UA 1EFWA 4QJVB 4QIWD 1HQMA 4A3FK 3S1QK 3OEPA 2NVXA 1IW7A 5IYBK 5TMFA 3S16C 4C3IK 3S1RK 2JA5C 3GTLC 2FQOA 3TTGA 1B4BA 2FQTA 5M5YK 4A3GK 1ZYRA 1TWHA 3GTJC 5L46A 1ZQ1C 4X6AK 3GIRA 5IP9K 4KB2A 2NVXK 2NVQK 1TWAC 2R92K 5M3FK 1TWCA 5C4JK 5M5XK 1IBAA 1SMYA 2PA8L 4A3JC 1IQ0A 4C3JK 1TWHK 2GAGC 1KQ4A 2W7VA 1JVIA 2Y0SD 4KMHA 4Y52C 4LK1A 4G7ZA 1GE9A 3PO3C 5HL8A 1TWCK 3S17C 3BUEA 4BY1K 3I4MK 1TWGA 4Q5SA 4A3EC 3GTLA 1ISEA 4AYBD 3GTQA 4G0VA 1VLOA 2NVYK 3GTGK 4KARA 3HOYK 1TWAA 3T02A 1YNNA 5FLMK 3DXJA 3T01A 1DCHA 2V6SA 3S16K 5IP7C 1B4AA 1TWGK 3T00A 3GTLK 4C45A 2CFAA 3HOZC 1VRQC 3GTQK 1YNJA 3K7AK 4A3BK 1USMA 5IYCC 3LPXA 4KASA 1K83C 3GSIA 1WSRA 2R7ZC 4LJZA 2E2JK 4C2MC 3AQPA 4GZYA 2PMZD 2O5JA 2WAQD 1DCOA 4P9SA 1WCMC 3AQOA 4YFXA 2RGRA 4XCHA 1EK8A 2E2IK 1F93A 3AH5A 2Y3PA 4M1XA 4LOWA 1WIHA 2KWAA 4G7OA 2B63C 4A3LK 3GTOC 2P5MA 1WOSA 3A8JA 3N0CA 4DDQA 4KN4A 2JA8C 1VJEA 3FKIA 5JFEA 3HOUC 4RMFA 3GTPC 3JSTA 1V5VA 2R7ZA 1HI9A 4OIOA 2VUMC 3HOZK 1IL2A 3S2HC 1SFOA 2E2HC 3FKIK 1WCMA 5M3MK 3TFJA 4XLPA 3GEHA 1ZXOA 1I6VA 2WB1D 2ZFZA 3S2DK 4YFKA 5IOTA 3EQLA 1ZVUA 2R7ZK 1PJ6A 2B63A 4ZH4A 4LK0A 4XSXA 5FJ8K 3HXAA 1SFOK 3G4AA 4A3DK 4BLBA 3AD7C 3H0GC 1EQRA 3GTMC 2GSNA 4GFQA 2NVTC 1WCMK 2CW0A 1JQWA 2JA6A 3V4GA 3H3VL 4P5BA 4Y7NK 5TJ3A 2B63K 3Q3QA 3HOWC 3S1MK 1TWFA 4BLAA 1DCPA 4GT9A 1XXAA 2JA8K 4XSZA 4AH6A 2E2HA 4A3IC 3HKZD 2JA6K 1I50C 5D4DA 4FM9A 4MEYA 1TWFK 5C4XC 1R9TC 4KN7A 4KMUA 4A3MK 3RZOC 3S2HK 4BXXK 3GTMA 1J98A 2E2HK 4ILDA 2JA5A 3I4NC 3CQZC 4GTAA 4BBSK 3S1NK 3GTJA 2RH6A 5E68A 4A3KC 3NUHA 1I3QC 5IYDC 1O29A 2JA7C 4KC6A 3PO2C 1XPPA 2V6TA 5C3EC 1BGWA 2NVTK 2JA5K 4QIWL 1I50A 3GTJK 3A8KA 2XCRB 1XZQA 1TWAK 5C44C 3LAJA 2GSOA 1R9TA 1JOEA 2YU9C 4A3JK 4A3IK 3CQZA 1XXBA 4A93C 1WQHA 1I50K 1J6VA 3N3YA 5TMCA 3FHZA 5CJ9A 4Y52K 4XLNA 1O2BA 5M5WK 3IPJA 2CFAB 1I3QA 3TFHA 4OIRA 4OIPA 3PO3K 1WSVA 1R9TK 2JA7A 4GTEA 3ERED 2GAHC 3S17K 2R93C 3M3YC 4A3EK 2BE5A 4GTCA 3CQZK 2Y0SL 1YX2A 1XZPA 4G7HA 3WODA 1I3QK 2XCQA 5IYDK 3OREA 1K83A 2JA7K 4AYBL 3S14C 4A3GC 5IP7K 5C3EK 2PA8D 3SZZA 1WORA 4PAAA 3HOVC 2NVXC 2NVQC 2R92C 4GTFA 1O2AA 5CHPA 4C3HC 5IYCK 1O24A 3OPFA 4QJVA 3L4JA 4LQYA 3RZDC 4G0WA 1K83K 4J3NA 2R93A 3M4OC
chains in the Genus database with same CATH topology
4LLGA 4A3IC 1YNNA 3HKZD 5IYBC 4A3KK 5FLMK 2JA6K 4MEXA 3DXJA 1SFOC 4A3DC 4C2MK 4OIQA 1I50C 2A69A 3S1RC 5IP7C 3S16K 1TWGK 3PO2K 3GTLK 5D4DA 1TWCC 4OINA 3HOZC 3GTQK 4MEYA 1TWFK 3I4MC 1YNJA 3K7AK 4Y7NC 4A3BK 1R9TC 4KN7A 4X6AC 5C4XC 4KMUA 4A3MK 3RZOC 5IP9C 3S2HK 4JK1A 4BXXK 2E2HK 3S1MC 2R93K 5IYCC 3M3YK 2PMZL 4MQ9A 3I4NC 3CQZC 5C4JC 1K83C 2WAQL 3GTOK 4BBSK 2O5IA 3S1NK 2NVYC 3GTGC 2A68A 2R7ZC 2A6HA 4LJZA 5C44K 2E2JK 4A3CK 3HOYC 1I6HC 4A3KC 5FLMC 2JA6C 1Y1WC 4BY7C 1TWHC 3HOXC 1I3QC 3HOUK 3S15C 2PMZD 5IYDC 1TWGC 2YU9K 4GZYA 2JA7C 3PO2C 2WAQD 2O5JA 1XPPA 1WCMC 3GTPK 5C3EC 3GTQC 4A93K 1TWFC 3S14K 4YFXA 2PPBA 1Y1VC 2NVTK 3K7AC 2JA5K 4A3BC 4QIWL 4A3MC 2VUMK 4BBRK 2E2IK 4BY1C 4BXXC 3GTJK 3HOVK 4G7OA 2A6EA 2B63C 3GTKC 4A3LK 3GTOC 4BBSC 3S1NC 1TWAK 4KN4A 2JA8C 5C44C 2E2JC 4C3HK 4QJVB 4QIWD 1HQMA 4A3FK 3RZDK 3S1QK 1IW7A 4Q4ZA 3HOUC 2YU9C 3M4OK 4A3JK 4A3IK 5IYBK 5TMFA 3S16C 4C3IK 3GTPC 4A93C 1I50K 3S1RK 2JA5C 3GTLC 5TMCA 4OIOA 3GTMK 3H0GK 2VUMC 2WB1L 2E2IC 5M5YK 4XLNA 4Y52K 4A3GK 1ZYRA 5M5WK 3HOZK 3GTJC 4OIRA 4YG2A 4OIPA 3PO3K 3S2HC 1R9TK 4A3LC 4X6AK 2E2HC 3S17K 2R93C 5IP9K 3FKIK 2NVXK 2NVQK 1TWAC 2R92K 3M3YC 4A3EK 5M3MK 5M3FK 2BE5A 4XLPA 4A3CC 2WB1D 1I6VA 3CQZK 5M5XK 5C4JK 2Y0SL 3HOWK 4YFKA 3S2DK 3EQLA 2R7ZK 1SMYA 2PA8L 4A3JC 1I6HK 4ZH4A 1BDFA 4LK0A 4G7HA 4C3JK 1Y1WK 4BY7K 1TWHK 3HOXK 4XSXA 1I3QK 4YFNA 3WODA 5FJ8K 3S15K 5IYDK 1SFOK 2JA7K 4A3DK 3GTMC 3H0GC 4AYBL 2Y0SD 4Y52C 3S14C 4NOIA 4LK1A 2NVTC 1WCMK 5IP7K 5C3EK 2PA8D 4A3GC 4G7ZA 1Y1VK 2CW0A 4BBRC 3PO3C 1TWCK 3S17C 3H3VL 4BY1K 3FKIC 2NVXC 2NVQC 2R92C 3HOVC 3I4MK 4Y7NK 5C4XK 4A3EC 4Q5SA 3HKZL 3RZOK 2B63K 4AYBD 3GTKK 3HOWC 3S1MK 3S2DC 5IYCK 4QJVA 2JA8K 3I4NK 3RZDC 4A3FC 3S1QC 4XSZA 1K83K 2NVYK 3GTGK 3H3VD 3M4OC 3HOYK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LLG A;  4A3I C;  1YNN A;  3HKZ D;  5IYB C;  4A3K K;  5FLM K;  2JA6 K;  4MEX A;  3DXJ A;  1SFO C;  4A3D C;  4C2M K;  4OIQ A;  1I50 C;  2A69 A;  3S1R C;  5IP7 C;  3S16 K;  1TWG K;  3PO2 K;  3GTL K;  5D4D A;  1TWC C;  4OIN A;  3HOZ C;  3GTQ K;  4MEY A;  1TWF K;  3I4M C;  1YNJ A;  3K7A K;  4Y7N C;  4A3B K;  1R9T C;  4KN7 A;  4X6A C;  5C4X C;  4KMU A;  4A3M K;  3RZO C;  5IP9 C;  3S2H K;  4JK1 A;  4BXX K;  2E2H K;  3S1M C;  2R93 K;  5IYC C;  3M3Y K;  2PMZ L;  4MQ9 A;  3I4N C;  3CQZ C;  5C4J C;  1K83 C;  2WAQ L;  3GTO K;  4BBS K;  2O5I A;  3S1N K;  2NVY C;  3GTG C;  2A68 A;  2R7Z C;  2A6H A;  4LJZ A;  5C44 K;  2E2J K;  4A3C K;  3HOY C;  1I6H C;  4A3K C;  5FLM C;  2JA6 C;  1Y1W C;  4BY7 C;  1TWH C;  3HOX C;  1I3Q C;  3HOU K;  3S15 C;  2PMZ D;  5IYD C;  1TWG C;  2YU9 K;  4GZY A;  2JA7 C;  3PO2 C;  2WAQ D;  2O5J A;  1XPP A;  1WCM C;  3GTP K;  5C3E C;  3GTQ C;  4A93 K;  1TWF C;  3S14 K;  4YFX A;  2PPB A;  1Y1V C;  2NVT K;  3K7A C;  2JA5 K;  4A3B C;  4QIW L;  4A3M C;  2VUM K;  4BBR K;  2E2I K;  4BY1 C;  4BXX C;  3GTJ K;  3HOV K;  4G7O A;  2A6E A;  2B63 C;  3GTK C;  4A3L K;  3GTO C;  4BBS C;  3S1N C;  1TWA K;  4KN4 A;  2JA8 C;  5C44 C;  2E2J C;  4C3H K;  4QJV B;  4QIW D;  1HQM A;  4A3F K;  3RZD K;  3S1Q K;  1IW7 A;  4Q4Z A;  3HOU C;  2YU9 C;  3M4O K;  4A3J K;  4A3I K;  5IYB K;  5TMF A;  3S16 C;  4C3I K;  3GTP C;  4A93 C;  1I50 K;  3S1R K;  2JA5 C;  3GTL C;  5TMC A;  4OIO A;  3GTM K;  3H0G K;  2VUM C;  2WB1 L;  2E2I C;  5M5Y K;  4XLN A;  4Y52 K;  4A3G K;  1ZYR A;  5M5W K;  3HOZ K;  3GTJ C;  4OIR A;  4YG2 A;  4OIP A;  3PO3 K;  3S2H C;  1R9T K;  4A3L C;  4X6A K;  2E2H C;  3S17 K;  2R93 C;  5IP9 K;  3FKI K;  2NVX K;  2NVQ K;  1TWA C;  2R92 K;  3M3Y C;  4A3E K;  5M3M K;  5M3F K;  2BE5 A;  4XLP A;  4A3C C;  2WB1 D;  1I6V A;  3CQZ K;  5M5X K;  5C4J K;  2Y0S L;  3HOW K;  4YFK A;  3S2D K;  3EQL A;  2R7Z K;  1SMY A;  2PA8 L;  4A3J C;  1I6H K;  4ZH4 A;  1BDF A;  4LK0 A;  4G7H A;  4C3J K;  1Y1W K;  4BY7 K;  1TWH K;  3HOX K;  4XSX A;  1I3Q K;  4YFN A;  3WOD A;  5FJ8 K;  3S15 K;  5IYD K;  1SFO K;  2JA7 K;  4A3D K;  3GTM C;  3H0G C;  4AYB L;  2Y0S D;  4Y52 C;  3S14 C;  4NOI A;  4LK1 A;  2NVT C;  1WCM K;  5IP7 K;  5C3E K;  2PA8 D;  4A3G C;  4G7Z A;  1Y1V K;  2CW0 A;  4BBR C;  3PO3 C;  1TWC K;  3S17 C;  3H3V L;  4BY1 K;  3FKI C;  2NVX C;  2NVQ C;  2R92 C;  3HOV C;  3I4M K;  4Y7N K;  5C4X K;  4A3E C;  4Q5S A;  3HKZ L;  3RZO K;  2B63 K;  4AYB D;  3GTK K;  3HOW C;  3S1M K;  3S2D C;  5IYC K;  4QJV A;  2JA8 K;  3I4N K;  3RZD C;  4A3F C;  3S1Q C;  4XSZ A;  1K83 K;  2NVY K;  3GTG K;  3H3V D;  3M4O C;  3HOY K; 
#chains in the Genus database with same CATH topology
 4MEX A;  3GTO A;  1VGX A;  4C2M K;  2D6F C;  1J6W A;  1AB4 A;  1TWC C;  4OIN A;  3I4M C;  3GTP A;  1WOP A;  2ZUE A;  2R93 K;  3AD9 C;  4GTB A;  2PMZ L;  3M3Y K;  2WAQ L;  2VUM A;  3LAP A;  3GTO K;  2O5I A;  1BS2 A;  2NVY C;  3GTG C;  2A68 A;  3HOY C;  2R92 A;  1INN A;  1I6H C;  5FLM C;  3GDZ A;  3CAG A;  1Y1W C;  1XXC A;  4BY7 C;  1O25 A;  3HOX C;  3S15 C;  3HOU K;  1TWG C;  3BP8 C;  4WIL A;  2EBB A;  3GTP K;  3G4C A;  3L4K A;  3GTQ C;  5IOQ A;  3S14 K;  1EH1 A;  1Y1V C;  3K7A C;  4BKW A;  3FOF A;  4A3B C;  4WJ3 M;  2VUM K;  3HOV K;  1IE0 A;  1C0A A;  2A6E A;  4KAW X;  4O2D A;  3GTK C;  3H0G A;  2PHC B;  1UV7 A;  1F7V A;  1O27 A;  2E2J C;  4C3H K;  1VH2 A;  3RZD K;  1EI6 A;  4Q4Z A;  3M4O K;  5IOR A;  2NVY A;  3GTG A;  3MML B;  3GTM K;  3H0G K;  2GSU A;  2WB1 L;  2E2I C;  1Y1W A;  5JVO A;  1IS1 A;  1G51 A;  4YG2 A;  1O26 A;  4A3L C;  1YCL A;  1O2F B;  1ZBS A;  2XCO A;  1Y1V A;  3AD8 C;  4A3C C;  3HOW K;  4G0U A;  4KM9 A;  1I6H K;  4GTL A;  3GTK A;  1BDF A;  1Y1W K;  4BY7 K;  4KMD A;  3HOX K;  4YFN A;  3S15 K;  2JH3 A;  3GEI A;  3VA7 A;  1PJ7 A;  4NOI A;  3A8I A;  4KB4 A;  4GTD A;  1Y1V K;  4BBR C;  4WJ4 A;  3FKI C;  5C4X K;  3N0B A;  3HKZ L;  3RZO K;  3GTK K;  1XZQ B;  3S2D C;  2E2I A;  3GEE A;  1F9N A;  3I4N K;  4A3F C;  3S1Q C;  1WQF A;  3H3V D;  3FOE A;  5EGH A;  4P5A A;  4LLG A;  2P8T A;  5IYB C;  4FZB A;  1BJT A;  4A3K K;  1SFO C;  3TFI A;  4C3I C;  4A3D C;  4OIQ A;  2A69 A;  3S1R C;  4LR2 A;  3PO2 K;  1X31 C;  1L0W A;  2YU9 A;  4Y7N C;  4X6A C;  5IP9 C;  3QX3 A;  4JK1 A;  3S1M C;  3S0X A;  4KAT A;  4MQ9 A;  5C4J C;  4A3C K;  2A6H A;  1WOO A;  5C44 K;  5IOS A;  1O28 A;  1J6X A;  4KMA A;  2JA6 C;  4C3J C;  1PJ5 A;  1TWH C;  1DD5 A;  1WQG A;  1XZP B;  4KM8 A;  2YU9 K;  2ZUF A;  4PAB A;  3SZY A;  3BP3 A;  4A93 K;  1RU0 A;  1TWF C;  4KDD A;  2PPB A;  5EGE A;  4A3M C;  1USO A;  4BBR K;  4BY1 C;  4BXX C;  3ADA C;  2V6U A;  4BBS C;  3S1N C;  1F7U A;  1EFW A;  4QJV B;  4QIW D;  1HQM A;  4A3F K;  3S1Q K;  3OEP A;  2NVX A;  1IW7 A;  5IYB K;  5TMF A;  3S16 C;  4C3I K;  3S1R K;  2JA5 C;  3GTL C;  2FQO A;  3TTG A;  1B4B A;  2FQT A;  5M5Y K;  4A3G K;  1ZYR A;  1TWH A;  3GTJ C;  5L46 A;  1ZQ1 C;  4X6A K;  3GIR A;  5IP9 K;  4KB2 A;  2NVX K;  2NVQ K;  1TWA C;  2R92 K;  5M3F K;  1TWC A;  5C4J K;  5M5X K;  1IBA A;  1SMY A;  2PA8 L;  4A3J C;  1IQ0 A;  4C3J K;  1TWH K;  2GAG C;  1KQ4 A;  2W7V A;  1JVI A;  2Y0S D;  4KMH A;  4Y52 C;  4LK1 A;  4G7Z A;  1GE9 A;  3PO3 C;  5HL8 A;  1TWC K;  3S17 C;  3BUE A;  4BY1 K;  3I4M K;  1TWG A;  4Q5S A;  4A3E C;  3GTL A;  1ISE A;  4AYB D;  3GTQ A;  4G0V A;  1VLO A;  2NVY K;  3GTG K;  4KAR A;  3HOY K;  1TWA A;  3T02 A;  1YNN A;  5FLM K;  3DXJ A;  3T01 A;  1DCH A;  2V6S A;  3S16 K;  5IP7 C;  1B4A A;  1TWG K;  3T00 A;  3GTL K;  4C45 A;  2CFA A;  3HOZ C;  1VRQ C;  3GTQ K;  1YNJ A;  3K7A K;  4A3B K;  1USM A;  5IYC C;  3LPX A;  4KAS A;  1K83 C;  3GSI A;  1WSR A;  2R7Z C;  4LJZ A;  2E2J K;  4C2M C;  3AQP A;  4GZY A;  2PMZ D;  2O5J A;  2WAQ D;  1DCO A;  4P9S A;  1WCM C;  3AQO A;  4YFX A;  2RGR A;  4XCH A;  1EK8 A;  2E2I K;  1F93 A;  3AH5 A;  2Y3P A;  4M1X A;  4LOW A;  1WIH A;  2KWA A;  4G7O A;  2B63 C;  4A3L K;  3GTO C;  2P5M A;  1WOS A;  3A8J A;  3N0C A;  4DDQ A;  4KN4 A;  2JA8 C;  1VJE A;  3FKI A;  5JFE A;  3HOU C;  4RMF A;  3GTP C;  3JST A;  1V5V A;  2R7Z A;  1HI9 A;  4OIO A;  2VUM C;  3HOZ K;  1IL2 A;  3S2H C;  1SFO A;  2E2H C;  3FKI K;  1WCM A;  5M3M K;  3TFJ A;  4XLP A;  3GEH A;  1ZXO A;  1I6V A;  2WB1 D;  2ZFZ A;  3S2D K;  4YFK A;  5IOT A;  3EQL A;  1ZVU A;  2R7Z K;  1PJ6 A;  2B63 A;  4ZH4 A;  4LK0 A;  4XSX A;  5FJ8 K;  3HXA A;  1SFO K;  3G4A A;  4A3D K;  4BLB A;  3AD7 C;  3H0G C;  1EQR A;  3GTM C;  2GSN A;  4GFQ A;  2NVT C;  1WCM K;  2CW0 A;  1JQW A;  2JA6 A;  3V4G A;  3H3V L;  4P5B A;  4Y7N K;  5TJ3 A;  2B63 K;  3Q3Q A;  3HOW C;  3S1M K;  1TWF A;  4BLA A;  1DCP A;  4GT9 A;  1XXA A;  2JA8 K;  4XSZ A;  4AH6 A;  2E2H A;  4A3I C;  3HKZ D;  2JA6 K;  1I50 C;  5D4D A;  4FM9 A;  4MEY A;  1TWF K;  5C4X C;  1R9T C;  4KN7 A;  4KMU A;  4A3M K;  3RZO C;  3S2H K;  4BXX K;  3GTM A;  1J98 A;  2E2H K;  4ILD A;  2JA5 A;  3I4N C;  3CQZ C;  4GTA A;  4BBS K;  3S1N K;  3GTJ A;  2RH6 A;  5E68 A;  4A3K C;  3NUH A;  1I3Q C;  5IYD C;  1O29 A;  2JA7 C;  4KC6 A;  3PO2 C;  1XPP A;  2V6T A;  5C3E C;  1BGW A;  2NVT K;  2JA5 K;  4QIW L;  1I50 A;  3GTJ K;  3A8K A;  2XCR B;  1XZQ A;  1TWA K;  5C44 C;  3LAJ A;  2GSO A;  1R9T A;  1JOE A;  2YU9 C;  4A3J K;  4A3I K;  3CQZ A;  1XXB A;  4A93 C;  1WQH A;  1I50 K;  1J6V A;  3N3Y A;  5TMC A;  3FHZ A;  5CJ9 A;  4Y52 K;  4XLN A;  1O2B A;  5M5W K;  3IPJ A;  2CFA B;  1I3Q A;  3TFH A;  4OIR A;  4OIP A;  3PO3 K;  1WSV A;  1R9T K;  2JA7 A;  4GTE A;  3ERE D;  2GAH C;  3S17 K;  2R93 C;  3M3Y C;  4A3E K;  2BE5 A;  4GTC A;  3CQZ K;  2Y0S L;  1YX2 A;  1XZP A;  4G7H A;  3WOD A;  1I3Q K;  2XCQ A;  5IYD K;  3ORE A;  1K83 A;  2JA7 K;  4AYB L;  3S14 C;  4A3G C;  5IP7 K;  5C3E K;  2PA8 D;  3SZZ A;  1WOR A;  4PAA A;  3HOV C;  2NVX C;  2NVQ C;  2R92 C;  4GTF A;  1O2A A;  5CHP A;  4C3H C;  5IYC K;  1O24 A;  3OPF A;  4QJV A;  3L4J A;  4LQY A;  3RZD C;  4G0W A;  1K83 K;  4J3N A;  2R93 A;  3M4O C; 
#chains in the Genus database with same CATH homology
 4LLG A;  4A3I C;  1YNN A;  3HKZ D;  5IYB C;  4A3K K;  5FLM K;  2JA6 K;  4MEX A;  3DXJ A;  1SFO C;  4A3D C;  4C2M K;  4OIQ A;  1I50 C;  2A69 A;  3S1R C;  5IP7 C;  3S16 K;  1TWG K;  3PO2 K;  3GTL K;  5D4D A;  1TWC C;  4OIN A;  3HOZ C;  3GTQ K;  4MEY A;  1TWF K;  3I4M C;  1YNJ A;  3K7A K;  4Y7N C;  4A3B K;  1R9T C;  4KN7 A;  4X6A C;  5C4X C;  4KMU A;  4A3M K;  3RZO C;  5IP9 C;  3S2H K;  4JK1 A;  4BXX K;  2E2H K;  3S1M C;  2R93 K;  5IYC C;  3M3Y K;  2PMZ L;  4MQ9 A;  3I4N C;  3CQZ C;  5C4J C;  1K83 C;  2WAQ L;  3GTO K;  4BBS K;  2O5I A;  3S1N K;  2NVY C;  3GTG C;  2A68 A;  2R7Z C;  2A6H A;  4LJZ A;  5C44 K;  2E2J K;  4A3C K;  3HOY C;  1I6H C;  4A3K C;  5FLM C;  2JA6 C;  1Y1W C;  4BY7 C;  1TWH C;  3HOX C;  1I3Q C;  3HOU K;  3S15 C;  2PMZ D;  5IYD C;  1TWG C;  2YU9 K;  4GZY A;  2JA7 C;  3PO2 C;  2WAQ D;  2O5J A;  1XPP A;  1WCM C;  3GTP K;  5C3E C;  3GTQ C;  4A93 K;  1TWF C;  3S14 K;  4YFX A;  2PPB A;  1Y1V C;  2NVT K;  3K7A C;  2JA5 K;  4A3B C;  4QIW L;  4A3M C;  2VUM K;  4BBR K;  2E2I K;  4BY1 C;  4BXX C;  3GTJ K;  3HOV K;  4G7O A;  2A6E A;  2B63 C;  3GTK C;  4A3L K;  3GTO C;  4BBS C;  3S1N C;  1TWA K;  4KN4 A;  2JA8 C;  5C44 C;  2E2J C;  4C3H K;  4QJV B;  4QIW D;  1HQM A;  4A3F K;  3RZD K;  3S1Q K;  1IW7 A;  4Q4Z A;  3HOU C;  2YU9 C;  3M4O K;  4A3J K;  4A3I K;  5IYB K;  5TMF A;  3S16 C;  4C3I K;  3GTP C;  4A93 C;  1I50 K;  3S1R K;  2JA5 C;  3GTL C;  5TMC A;  4OIO A;  3GTM K;  3H0G K;  2VUM C;  2WB1 L;  2E2I C;  5M5Y K;  4XLN A;  4Y52 K;  4A3G K;  1ZYR A;  5M5W K;  3HOZ K;  3GTJ C;  4OIR A;  4YG2 A;  4OIP A;  3PO3 K;  3S2H C;  1R9T K;  4A3L C;  4X6A K;  2E2H C;  3S17 K;  2R93 C;  5IP9 K;  3FKI K;  2NVX K;  2NVQ K;  1TWA C;  2R92 K;  3M3Y C;  4A3E K;  5M3M K;  5M3F K;  2BE5 A;  4XLP A;  4A3C C;  2WB1 D;  1I6V A;  3CQZ K;  5M5X K;  5C4J K;  2Y0S L;  3HOW K;  4YFK A;  3S2D K;  3EQL A;  2R7Z K;  1SMY A;  2PA8 L;  4A3J C;  1I6H K;  4ZH4 A;  1BDF A;  4LK0 A;  4G7H A;  4C3J K;  1Y1W K;  4BY7 K;  1TWH K;  3HOX K;  4XSX A;  1I3Q K;  4YFN A;  3WOD A;  5FJ8 K;  3S15 K;  5IYD K;  1SFO K;  2JA7 K;  4A3D K;  3GTM C;  3H0G C;  4AYB L;  2Y0S D;  4Y52 C;  3S14 C;  4NOI A;  4LK1 A;  2NVT C;  1WCM K;  5IP7 K;  5C3E K;  2PA8 D;  4A3G C;  4G7Z A;  1Y1V K;  2CW0 A;  4BBR C;  3PO3 C;  1TWC K;  3S17 C;  3H3V L;  4BY1 K;  3FKI C;  2NVX C;  2NVQ C;  2R92 C;  3HOV C;  3I4M K;  4Y7N K;  5C4X K;  4A3E C;  4Q5S A;  3HKZ L;  3RZO K;  2B63 K;  4AYB D;  3GTK K;  3HOW C;  3S1M K;  3S2D C;  5IYC K;  4QJV A;  2JA8 K;  3I4N K;  3RZD C;  4A3F C;  3S1Q C;  4XSZ A;  1K83 K;  2NVY K;  3GTG K;  3H3V D;  3M4O C;  3HOY K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...