4A3BK

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3bK00
5C3EC 4A3GC 5IP9K 2JA8K 4QJVB 3PO3C 5FJ8K 4X6AK 2E2JK 3EQLA 4A3JK 4A3FC 3S1RK 1TWFK 2JA6C 3H0GK 4YG2A 2R7ZC 2Y0SL 2PMZD 3H3VL 1HQMA 3HOUK 4QIWD 3S15C 5IP9C 5IP7C 4Y7NK 2VUMC 5M5XK 1I50C 5IYDC 3GTJC 2E2JC 3M3YK 3S1RC 1TWFC 2WB1D 3H0GC 2JA5C 3HOUC 5TMFA 3S17K 3HOZK 3WODA 5D4DA 4C2MK 3HOXK 3GTPC 4LK0A 4G7HA 4KN7A 3M4OK 4A3IK 4KN4A 5IYCK 3GTQK 2A6HA 4LJZA 3K7AC 3M3YC 3GTLK 3S1MC 4A3DC 4BY1C 4YFNA 3S17C 3HOZC 2NVYK 5C3EK 3HOXC 3S1NK 4BBSC 2E2IC 2NVTC 3PO3K 3GTLC 4G7ZA 2JA6K 4QIWL 5C4JC 2R7ZK 2NVYC 3S15K 2O5IA 1TWAK 3S2HC 3S1NC 5IP7K 2VUMK 4Y52C 1I50K 5IYDK 4OIPA 2WB1L 4QJVA 5M5YK 3GTJK 4A3LK 3HOWC 1TWCK 2JA5K 3GTOC 5C4XK 1TWAC 3GTGC 3GTPK 2PA8D 4BBRK 4OIQA 3S1MK 3GTMC 1WCMC 3K7AK 4A3LC 2R92C 1TWCC 4BY1K 3GTKC 1Y1WC 4C3HK 4JK1A 5C4XC 3I4MK 3S1QC 4BBSK 4BXXK 3HKZD 4BBRC 2E2IK 4LK1A 2NVTK 4OIOA 4AYBL 1I6VA 5C4JK 4GZYA 5TMCA 3I4MC 3S16K 3S2HK 1I6HC 4BXXC 1I3QK 4Y52K 2E2HC 4MEYA 3RZDK 1SMYA 2PMZL 4MQ9A 4XLPA 2NVQC 3GTOK 3HOWK 4MEXA 2PA8L 3GTGK 3S16C 1R9TC 1ZYRA 3CQZC 1I3QC 3DXJA 5IYBC 5M3FK 4A3KK 5FLMC 3I4NC 4Q4ZA 4BY7C 1SFOC 1WCMK 2A6EA 3RZDC 3GTMK 2R92K 3HOYC 4A3DK 3GTKK 1Y1WK 3RZOC 4C3IK 3S1QK 4A3CC 2JA7C 2Y0SD 4OIRA 2B63C 4A3MC 4XSZA 1K83C 2NVXK 4LLGA 2YU9C 3PO2C 1I6HK 2R93K 2PPBA 2BE5A 4YFXA 2E2HK 2NVXC 4OINA 1TWGC 5M5WK 3HOVK 2NVQK 5C44C 2WAQD 4A3BK 3S14C 1TWHC 4KMUA 3CQZK 5IYBK 4A3EC 1YNNA 1R9TK 2R93C 5FLMK 2O5JA 3I4NK 4BY7K 1Y1VC 1SFOK 3HOVC 3HOYK 3FKIK 4XSXA 4G7OA 4A3KC 1IW7A 3RZOK 4A3BC 1XPPA 4A3CK 2JA7K 2A69A 4A3MK 2B63K 2JA8C 1K83K 4NOIA 1BDFA 3FKIC 4X6AC 4YFKA 2CW0A 4A3JC 2YU9K 4ZH4A 3PO2K 3HKZL 3H3VD 4A93K 4Y7NC 2A68A 1TWGK 2WAQL 5C44K 4XLNA 3S2DK 3S14K 1TWHK 5M3MK 4A3EK 4A93C 4A3GK 3M4OC 4A3IC 4Q5SA 5IYCC 1Y1VK 3GTQC 4C3JK 1YNJA 4AYBD 4A3FK 3S2DC
chains in the Genus database with same CATH superfamily
2EBBA 3QX3A 1DD5A 5IP9K 2V6TA 3GTOA 1O27A 3PO3C 3GTGA 1EQRA 2Y3PA 2JA6C 3H3VL 3H0GK 1WSVA 3HOUK 2PMZD 1IBAA 4KMAA 3MMLB 4G0UA 2R92A 3FHZA 5IP7C 2VUMC 1Y1WA 1I50C 3GTJC 3M3YK 2JA5C 5TMFA 3S17K 3HOZK 4C2MK 4LK0A 3M4OK 1PJ6A 3S1MC 2A6HA 3AD9C 3GTLK 3BUEA 4BY1C 2FQTA 3CQZA 1UV7A 3TFHA 2R7ZK 3S1NC 3S2HC 3L4JA 1J6WA 3LPXA 4Y52C 4P9SA 1O2FB 5IYDK 3HOWC 2B63A 1DCOA 4WJ3M 1F9NA 1YCLA 4OIQA 3GTMC 4A3LC 3HXAA 3GTKC 4C3HK 5E68A 3AD7C 4BBRC 4LK1A 3AH5A 4OIOA 2R93A 4C45A 4GZYA 4BLBA 1Y1VA 5TMCA 3I4MC 1I3QK 3JSTA 2E2HC 1DCPA 2PMZL 3GTOK 2V6SA 4MEXA 2PA8L 3GTGK 3S16C 3DXJA 5IYBC 5M3FK 4FZBA 3I4NC 2R92K 1Y1WK 4C3IK 5EGEA 2JA7C 1O2BA 1K83C 4LLGA 1EI6A 3PO2C 1BJTA 3GTQA 3AQOA 1EFWA 4OINA 1TWGC 5M5WK 3G4AA 3GIRA 4GTCA 5C44C 1TWHC 3CQZK 4PABA 3HOVC 4XSXA 4A3KC 4RMFA 1XPPA 1IQ0A 2W7VA 2P8TA 1B4BA 3H0GA 4A3MK 1WIHA 2B63K 1O26A 1F7VA 3GTPA 4A3JC 3H3VD 1ZXOA 4GTDA 4Y7NC 5L46A 3FOEA 1XZQB 4LOWA 4GFQA 4P5AA 1X31C 3S14K 3GTLA 1O28A 1VRQC 1Y1VK 3TFIA 1XXAA 5TJ3A 5C3EC 1ZBSA 2GAGC 3GEEA 2JA8K 3T01A 5HL8A 4X6AK 4YG2A 1HQMA 1VGXA 2GAHC 3WODA 4A3IK 4KN4A 3GTQK 3K7AC 1XZQA 3S1NK 4BBSC 2E2IC 1I3QA 4QIWL 2NVYC 3S15K 3V4GA 4GTEA 3ERED 4OIPA 2WB1L 4A3LK 5IORA 3GTPK 2PA8D 2YU9A 4BBRK 1WCMC 5IOSA 1TWCC 4KAWX 4JK1A 3I4MK 1O29A 4GTLA 2NVTK 1I6VA 5C4JK 3S16K 1I6HC 4BXXC 4ILDA 4MEYA 4G0WA 4XLPA 3GDZA 4O2DA 1R9TC 1SFOC 3HOYC 1VLOA 1XXCA 3S1QK 2Y0SD 3T02A 5JVOA 2JH3A 3HOVK 1B4AA 3BP8C 2NVQK 4KC6A 3GEHA 4GTBA 1WOPA 4KMUA 1YNNA 1ZVUA 5FLMK 2O5JA 2JA6A 4P5BA 4BY7K 2VUMA 1BS2A 1I50A 3RZOK 4A3BC 3GTJA 4A3CK 2JA5A 4KB2A 3FKIC 4YFKA 2YU9K 4KASA 4ZH4A 1O25A 1G51A 3A8IA 4XLNA 4A3EK 4C2MC 4A93C 3GEIA 3M4OC 4Q5SA 4BKWA 1DCHA 3S2DC 1YX2A 1AB4A 4A3GC 4XCHA 4QJVB 3L4KA 2D6FC 1ZQ1C 4C3JC 5FJ8K 4KATA 4A3FC 2R7ZC 2Y0SL 3GTMA 4QIWD 3GTKA 4PAAA 5M5XK 5IYDC 2E2JC 3S1RC 1TWFC 2WB1D 5D4DA 1EH1A 4KN7A 4G7HA 5IYCK 4LJZA 4A3DC 2E2HA 2NVYK 3HOXC 1J6XA 1F93A 1WORA 1VJEA 3PO3K 4G7ZA 2JA6K 4GTFA 1INNA 3FKIA 3SZZA 5IP7K 2VUMK 2ZUEA 1I50K 4QJVA 5M5YK 3GTJK 2JA7A 3IPJA 1TWCK 4AH6A 2JA5K 3GTOC 1K83A 3GTGC 1TWAC 5EGHA 3S1MK 2R92C 4BY1K 1Y1WC 5C4XC 1TWGA 4J3NA 4C3IC 5CHPA 4BXXK 2ZUFA 4KM9A 1TWHA 4KMDA 1C0AA 2CFAB 3S2HK 3GSIA 4Y52K 1ISEA 4MQ9A 3HOWK 3SZYA 2GSOA 1ZYRA 3CQZC 4GT9A 1L0WA 1XXBA 1TWFA 3GTMK 3RZDC 1WQGA 3GTKK 1WQFA 2B63C 4A3MC 4XSZA 4KMHA 3A8JA 4WJ4A 1IE0A 2BE5A 3OEPA 4YFXA 4KM8A 2E2HK 2NVXC 2GSNA 1HI9A 4A3BK 3S14C 2R93C 2CFAA 5IYBK 3I4NK 1Y1VC 1TWAA 3FKIK 4G7OA 1USOA 1IW7A 4FM9A 1GE9A 2JA7K 3NUHA 4LQYA 2JA8C 1K83K 1BDFA 2FQOA 4X6AC 3PO2K 3OPFA 4A93K 1JOEA 2A68A 4DDQA 1TWGK 1USMA 2WAQL 2E2IA 5C44K 3S2DK 1TWHK 5M3MK 2KWAA 4A3GK 2XCOA 2P5MA 3FOFA 2NVYA 4A3IC 3GTQC 4C3JK 4AYBD 3CAGA 4KB4A 4A3FK 4A3KK 3ADAC 3AQPA 1RU0A 2E2JK 3TFJA 3EQLA 4A3JK 3S1RK 1TWFK 3TTGA 3S15C 1WCMA 1TWCA 5IP9C 4Y7NK 1IS1A 1PJ7A 3N0CA 2ZFZA 4A3DK 3H0GC 3HOUC 2NVXA 3GTPC 3HOXK 1O2AA 3M3YC 4YFNA 3S17C 3HOZC 5C3EK 2NVTC 1R9TA 3GTLC 5C4JC 1F7UA 1SFOA 2O5IA 1TWAK 4KARA 3N3YA 5C4XK 3LAPA 2GSUA 1O24A 3A8KA 3T00A 3K7AK 4M1XA 1VH2A 4BBSK 3S1QC 3HKZD 2E2IK 4GTAA 4AYBL 1WQHA 4C3HC 1V5VA 1BGWA 1PJ5A 1JVIA 1EK8A 3OREA 2XCRB 3RZDK 1SMYA 4G0VA 5IOTA 2NVQC 1KQ4A 2PHCB 1I3QC 5FLMC 4Q4ZA 4BY7C 1WCMK 2A6EA 3RZOC 1J6VA 3LAJA 4A3CC 1XZPB 4OIRA 2NVXK 2RGRA 4WILA 2YU9C 3BP3A 5IOQA 2RH6A 1I6HK 2R93K 2PPBA 3VA7A 1WOOA 2WAQD 4A3EC 1R9TK 4LR2A 2R7ZA 1SFOK 3HOYK 2V6UA 3S0XA 5CJ9A 2A69A 3Q3QA 4NOIA 5JFEA 1WSRA 2CW0A 1IL2A 1JQWA 3HKZL 1XZPA 4KDDA 3AD8C 4BLAA 3N0BA 2XCQA 3G4CA 1WOSA 5IYCC 1J98A 1YNJA
chains in the Genus database with same CATH topology
5C3EC 4A3GC 5IP9K 2JA8K 4QJVB 3PO3C 5FJ8K 4X6AK 2E2JK 3EQLA 4A3JK 4A3FC 3S1RK 1TWFK 2JA6C 3H0GK 4YG2A 2R7ZC 2Y0SL 2PMZD 3H3VL 1HQMA 3HOUK 4QIWD 3S15C 5IP9C 5IP7C 4Y7NK 2VUMC 5M5XK 1I50C 5IYDC 3GTJC 2E2JC 3M3YK 3S1RC 1TWFC 2WB1D 3H0GC 2JA5C 3HOUC 5TMFA 3S17K 3HOZK 3WODA 5D4DA 4C2MK 3HOXK 3GTPC 4LK0A 4G7HA 4KN7A 3M4OK 4A3IK 4KN4A 5IYCK 3GTQK 2A6HA 4LJZA 3K7AC 3M3YC 3GTLK 3S1MC 4A3DC 4BY1C 4YFNA 3S17C 3HOZC 2NVYK 5C3EK 3HOXC 3S1NK 4BBSC 2E2IC 2NVTC 3PO3K 3GTLC 4G7ZA 2JA6K 4QIWL 5C4JC 2R7ZK 2NVYC 3S15K 2O5IA 1TWAK 3S2HC 3S1NC 5IP7K 2VUMK 4Y52C 1I50K 5IYDK 4OIPA 2WB1L 4QJVA 5M5YK 3GTJK 4A3LK 3HOWC 1TWCK 2JA5K 3GTOC 5C4XK 1TWAC 3GTGC 3GTPK 2PA8D 4BBRK 4OIQA 3S1MK 3GTMC 1WCMC 3K7AK 4A3LC 2R92C 1TWCC 4BY1K 3GTKC 1Y1WC 4C3HK 4JK1A 5C4XC 3I4MK 3S1QC 4BBSK 4BXXK 3HKZD 4BBRC 2E2IK 4LK1A 2NVTK 4OIOA 4AYBL 1I6VA 5C4JK 4GZYA 5TMCA 3I4MC 3S16K 3S2HK 1I6HC 4BXXC 1I3QK 4Y52K 2E2HC 4MEYA 3RZDK 1SMYA 2PMZL 4MQ9A 4XLPA 2NVQC 3GTOK 3HOWK 4MEXA 2PA8L 3GTGK 3S16C 1R9TC 1ZYRA 3CQZC 1I3QC 3DXJA 5IYBC 5M3FK 4A3KK 5FLMC 3I4NC 4Q4ZA 4BY7C 1SFOC 1WCMK 2A6EA 3RZDC 3GTMK 2R92K 3HOYC 4A3DK 3GTKK 1Y1WK 3RZOC 4C3IK 3S1QK 4A3CC 2JA7C 2Y0SD 4OIRA 2B63C 4A3MC 4XSZA 1K83C 2NVXK 4LLGA 2YU9C 3PO2C 1I6HK 2R93K 2PPBA 2BE5A 4YFXA 2E2HK 2NVXC 4OINA 1TWGC 5M5WK 3HOVK 2NVQK 5C44C 2WAQD 4A3BK 3S14C 1TWHC 4KMUA 3CQZK 5IYBK 4A3EC 1YNNA 1R9TK 2R93C 5FLMK 2O5JA 3I4NK 4BY7K 1Y1VC 1SFOK 3HOVC 3HOYK 3FKIK 4XSXA 4G7OA 4A3KC 1IW7A 3RZOK 4A3BC 1XPPA 4A3CK 2JA7K 2A69A 4A3MK 2B63K 2JA8C 1K83K 4NOIA 1BDFA 3FKIC 4X6AC 4YFKA 2CW0A 4A3JC 2YU9K 4ZH4A 3PO2K 3HKZL 3H3VD 4A93K 4Y7NC 2A68A 1TWGK 2WAQL 5C44K 4XLNA 3S2DK 3S14K 1TWHK 5M3MK 4A3EK 4A93C 4A3GK 3M4OC 4A3IC 4Q5SA 5IYCC 1Y1VK 3GTQC 4C3JK 1YNJA 4AYBD 4A3FK 3S2DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3E C;  4A3G C;  5IP9 K;  2JA8 K;  4QJV B;  3PO3 C;  5FJ8 K;  4X6A K;  2E2J K;  3EQL A;  4A3J K;  4A3F C;  3S1R K;  1TWF K;  2JA6 C;  3H0G K;  4YG2 A;  2R7Z C;  2Y0S L;  2PMZ D;  3H3V L;  1HQM A;  3HOU K;  4QIW D;  3S15 C;  5IP9 C;  5IP7 C;  4Y7N K;  2VUM C;  5M5X K;  1I50 C;  5IYD C;  3GTJ C;  2E2J C;  3M3Y K;  3S1R C;  1TWF C;  2WB1 D;  3H0G C;  2JA5 C;  3HOU C;  5TMF A;  3S17 K;  3HOZ K;  3WOD A;  5D4D A;  4C2M K;  3HOX K;  3GTP C;  4LK0 A;  4G7H A;  4KN7 A;  3M4O K;  4A3I K;  4KN4 A;  5IYC K;  3GTQ K;  2A6H A;  4LJZ A;  3K7A C;  3M3Y C;  3GTL K;  3S1M C;  4A3D C;  4BY1 C;  4YFN A;  3S17 C;  3HOZ C;  2NVY K;  5C3E K;  3HOX C;  3S1N K;  4BBS C;  2E2I C;  2NVT C;  3PO3 K;  3GTL C;  4G7Z A;  2JA6 K;  4QIW L;  5C4J C;  2R7Z K;  2NVY C;  3S15 K;  2O5I A;  1TWA K;  3S2H C;  3S1N C;  5IP7 K;  2VUM K;  4Y52 C;  1I50 K;  5IYD K;  4OIP A;  2WB1 L;  4QJV A;  5M5Y K;  3GTJ K;  4A3L K;  3HOW C;  1TWC K;  2JA5 K;  3GTO C;  5C4X K;  1TWA C;  3GTG C;  3GTP K;  2PA8 D;  4BBR K;  4OIQ A;  3S1M K;  3GTM C;  1WCM C;  3K7A K;  4A3L C;  2R92 C;  1TWC C;  4BY1 K;  3GTK C;  1Y1W C;  4C3H K;  4JK1 A;  5C4X C;  3I4M K;  3S1Q C;  4BBS K;  4BXX K;  3HKZ D;  4BBR C;  2E2I K;  4LK1 A;  2NVT K;  4OIO A;  4AYB L;  1I6V A;  5C4J K;  4GZY A;  5TMC A;  3I4M C;  3S16 K;  3S2H K;  1I6H C;  4BXX C;  1I3Q K;  4Y52 K;  2E2H C;  4MEY A;  3RZD K;  1SMY A;  2PMZ L;  4MQ9 A;  4XLP A;  2NVQ C;  3GTO K;  3HOW K;  4MEX A;  2PA8 L;  3GTG K;  3S16 C;  1R9T C;  1ZYR A;  3CQZ C;  1I3Q C;  3DXJ A;  5IYB C;  5M3F K;  4A3K K;  5FLM C;  3I4N C;  4Q4Z A;  4BY7 C;  1SFO C;  1WCM K;  2A6E A;  3RZD C;  3GTM K;  2R92 K;  3HOY C;  4A3D K;  3GTK K;  1Y1W K;  3RZO C;  4C3I K;  3S1Q K;  4A3C C;  2JA7 C;  2Y0S D;  4OIR A;  2B63 C;  4A3M C;  4XSZ A;  1K83 C;  2NVX K;  4LLG A;  2YU9 C;  3PO2 C;  1I6H K;  2R93 K;  2PPB A;  2BE5 A;  4YFX A;  2E2H K;  2NVX C;  4OIN A;  1TWG C;  5M5W K;  3HOV K;  2NVQ K;  5C44 C;  2WAQ D;  4A3B K;  3S14 C;  1TWH C;  4KMU A;  3CQZ K;  5IYB K;  4A3E C;  1YNN A;  1R9T K;  2R93 C;  5FLM K;  2O5J A;  3I4N K;  4BY7 K;  1Y1V C;  1SFO K;  3HOV C;  3HOY K;  3FKI K;  4XSX A;  4G7O A;  4A3K C;  1IW7 A;  3RZO K;  4A3B C;  1XPP A;  4A3C K;  2JA7 K;  2A69 A;  4A3M K;  2B63 K;  2JA8 C;  1K83 K;  4NOI A;  1BDF A;  3FKI C;  4X6A C;  4YFK A;  2CW0 A;  4A3J C;  2YU9 K;  4ZH4 A;  3PO2 K;  3HKZ L;  3H3V D;  4A93 K;  4Y7N C;  2A68 A;  1TWG K;  2WAQ L;  5C44 K;  4XLN A;  3S2D K;  3S14 K;  1TWH K;  5M3M K;  4A3E K;  4A93 C;  4A3G K;  3M4O C;  4A3I C;  4Q5S A;  5IYC C;  1Y1V K;  3GTQ C;  4C3J K;  1YNJ A;  4AYB D;  4A3F K;  3S2D C; 
#chains in the Genus database with same CATH topology
 2EBB A;  3QX3 A;  1DD5 A;  5IP9 K;  2V6T A;  3GTO A;  1O27 A;  3PO3 C;  3GTG A;  1EQR A;  2Y3P A;  2JA6 C;  3H3V L;  3H0G K;  1WSV A;  3HOU K;  2PMZ D;  1IBA A;  4KMA A;  3MML B;  4G0U A;  2R92 A;  3FHZ A;  5IP7 C;  2VUM C;  1Y1W A;  1I50 C;  3GTJ C;  3M3Y K;  2JA5 C;  5TMF A;  3S17 K;  3HOZ K;  4C2M K;  4LK0 A;  3M4O K;  1PJ6 A;  3S1M C;  2A6H A;  3AD9 C;  3GTL K;  3BUE A;  4BY1 C;  2FQT A;  3CQZ A;  1UV7 A;  3TFH A;  2R7Z K;  3S1N C;  3S2H C;  3L4J A;  1J6W A;  3LPX A;  4Y52 C;  4P9S A;  1O2F B;  5IYD K;  3HOW C;  2B63 A;  1DCO A;  4WJ3 M;  1F9N A;  1YCL A;  4OIQ A;  3GTM C;  4A3L C;  3HXA A;  3GTK C;  4C3H K;  5E68 A;  3AD7 C;  4BBR C;  4LK1 A;  3AH5 A;  4OIO A;  2R93 A;  4C45 A;  4GZY A;  4BLB A;  1Y1V A;  5TMC A;  3I4M C;  1I3Q K;  3JST A;  2E2H C;  1DCP A;  2PMZ L;  3GTO K;  2V6S A;  4MEX A;  2PA8 L;  3GTG K;  3S16 C;  3DXJ A;  5IYB C;  5M3F K;  4FZB A;  3I4N C;  2R92 K;  1Y1W K;  4C3I K;  5EGE A;  2JA7 C;  1O2B A;  1K83 C;  4LLG A;  1EI6 A;  3PO2 C;  1BJT A;  3GTQ A;  3AQO A;  1EFW A;  4OIN A;  1TWG C;  5M5W K;  3G4A A;  3GIR A;  4GTC A;  5C44 C;  1TWH C;  3CQZ K;  4PAB A;  3HOV C;  4XSX A;  4A3K C;  4RMF A;  1XPP A;  1IQ0 A;  2W7V A;  2P8T A;  1B4B A;  3H0G A;  4A3M K;  1WIH A;  2B63 K;  1O26 A;  1F7V A;  3GTP A;  4A3J C;  3H3V D;  1ZXO A;  4GTD A;  4Y7N C;  5L46 A;  3FOE A;  1XZQ B;  4LOW A;  4GFQ A;  4P5A A;  1X31 C;  3S14 K;  3GTL A;  1O28 A;  1VRQ C;  1Y1V K;  3TFI A;  1XXA A;  5TJ3 A;  5C3E C;  1ZBS A;  2GAG C;  3GEE A;  2JA8 K;  3T01 A;  5HL8 A;  4X6A K;  4YG2 A;  1HQM A;  1VGX A;  2GAH C;  3WOD A;  4A3I K;  4KN4 A;  3GTQ K;  3K7A C;  1XZQ A;  3S1N K;  4BBS C;  2E2I C;  1I3Q A;  4QIW L;  2NVY C;  3S15 K;  3V4G A;  4GTE A;  3ERE D;  4OIP A;  2WB1 L;  4A3L K;  5IOR A;  3GTP K;  2PA8 D;  2YU9 A;  4BBR K;  1WCM C;  5IOS A;  1TWC C;  4KAW X;  4JK1 A;  3I4M K;  1O29 A;  4GTL A;  2NVT K;  1I6V A;  5C4J K;  3S16 K;  1I6H C;  4BXX C;  4ILD A;  4MEY A;  4G0W A;  4XLP A;  3GDZ A;  4O2D A;  1R9T C;  1SFO C;  3HOY C;  1VLO A;  1XXC A;  3S1Q K;  2Y0S D;  3T02 A;  5JVO A;  2JH3 A;  3HOV K;  1B4A A;  3BP8 C;  2NVQ K;  4KC6 A;  3GEH A;  4GTB A;  1WOP A;  4KMU A;  1YNN A;  1ZVU A;  5FLM K;  2O5J A;  2JA6 A;  4P5B A;  4BY7 K;  2VUM A;  1BS2 A;  1I50 A;  3RZO K;  4A3B C;  3GTJ A;  4A3C K;  2JA5 A;  4KB2 A;  3FKI C;  4YFK A;  2YU9 K;  4KAS A;  4ZH4 A;  1O25 A;  1G51 A;  3A8I A;  4XLN A;  4A3E K;  4C2M C;  4A93 C;  3GEI A;  3M4O C;  4Q5S A;  4BKW A;  1DCH A;  3S2D C;  1YX2 A;  1AB4 A;  4A3G C;  4XCH A;  4QJV B;  3L4K A;  2D6F C;  1ZQ1 C;  4C3J C;  5FJ8 K;  4KAT A;  4A3F C;  2R7Z C;  2Y0S L;  3GTM A;  4QIW D;  3GTK A;  4PAA A;  5M5X K;  5IYD C;  2E2J C;  3S1R C;  1TWF C;  2WB1 D;  5D4D A;  1EH1 A;  4KN7 A;  4G7H A;  5IYC K;  4LJZ A;  4A3D C;  2E2H A;  2NVY K;  3HOX C;  1J6X A;  1F93 A;  1WOR A;  1VJE A;  3PO3 K;  4G7Z A;  2JA6 K;  4GTF A;  1INN A;  3FKI A;  3SZZ A;  5IP7 K;  2VUM K;  2ZUE A;  1I50 K;  4QJV A;  5M5Y K;  3GTJ K;  2JA7 A;  3IPJ A;  1TWC K;  4AH6 A;  2JA5 K;  3GTO C;  1K83 A;  3GTG C;  1TWA C;  5EGH A;  3S1M K;  2R92 C;  4BY1 K;  1Y1W C;  5C4X C;  1TWG A;  4J3N A;  4C3I C;  5CHP A;  4BXX K;  2ZUF A;  4KM9 A;  1TWH A;  4KMD A;  1C0A A;  2CFA B;  3S2H K;  3GSI A;  4Y52 K;  1ISE A;  4MQ9 A;  3HOW K;  3SZY A;  2GSO A;  1ZYR A;  3CQZ C;  4GT9 A;  1L0W A;  1XXB A;  1TWF A;  3GTM K;  3RZD C;  1WQG A;  3GTK K;  1WQF A;  2B63 C;  4A3M C;  4XSZ A;  4KMH A;  3A8J A;  4WJ4 A;  1IE0 A;  2BE5 A;  3OEP A;  4YFX A;  4KM8 A;  2E2H K;  2NVX C;  2GSN A;  1HI9 A;  4A3B K;  3S14 C;  2R93 C;  2CFA A;  5IYB K;  3I4N K;  1Y1V C;  1TWA A;  3FKI K;  4G7O A;  1USO A;  1IW7 A;  4FM9 A;  1GE9 A;  2JA7 K;  3NUH A;  4LQY A;  2JA8 C;  1K83 K;  1BDF A;  2FQO A;  4X6A C;  3PO2 K;  3OPF A;  4A93 K;  1JOE A;  2A68 A;  4DDQ A;  1TWG K;  1USM A;  2WAQ L;  2E2I A;  5C44 K;  3S2D K;  1TWH K;  5M3M K;  2KWA A;  4A3G K;  2XCO A;  2P5M A;  3FOF A;  2NVY A;  4A3I C;  3GTQ C;  4C3J K;  4AYB D;  3CAG A;  4KB4 A;  4A3F K;  4A3K K;  3ADA C;  3AQP A;  1RU0 A;  2E2J K;  3TFJ A;  3EQL A;  4A3J K;  3S1R K;  1TWF K;  3TTG A;  3S15 C;  1WCM A;  1TWC A;  5IP9 C;  4Y7N K;  1IS1 A;  1PJ7 A;  3N0C A;  2ZFZ A;  4A3D K;  3H0G C;  3HOU C;  2NVX A;  3GTP C;  3HOX K;  1O2A A;  3M3Y C;  4YFN A;  3S17 C;  3HOZ C;  5C3E K;  2NVT C;  1R9T A;  3GTL C;  5C4J C;  1F7U A;  1SFO A;  2O5I A;  1TWA K;  4KAR A;  3N3Y A;  5C4X K;  3LAP A;  2GSU A;  1O24 A;  3A8K A;  3T00 A;  3K7A K;  4M1X A;  1VH2 A;  4BBS K;  3S1Q C;  3HKZ D;  2E2I K;  4GTA A;  4AYB L;  1WQH A;  4C3H C;  1V5V A;  1BGW A;  1PJ5 A;  1JVI A;  1EK8 A;  3ORE A;  2XCR B;  3RZD K;  1SMY A;  4G0V A;  5IOT A;  2NVQ C;  1KQ4 A;  2PHC B;  1I3Q C;  5FLM C;  4Q4Z A;  4BY7 C;  1WCM K;  2A6E A;  3RZO C;  1J6V A;  3LAJ A;  4A3C C;  1XZP B;  4OIR A;  2NVX K;  2RGR A;  4WIL A;  2YU9 C;  3BP3 A;  5IOQ A;  2RH6 A;  1I6H K;  2R93 K;  2PPB A;  3VA7 A;  1WOO A;  2WAQ D;  4A3E C;  1R9T K;  4LR2 A;  2R7Z A;  1SFO K;  3HOY K;  2V6U A;  3S0X A;  5CJ9 A;  2A69 A;  3Q3Q A;  4NOI A;  5JFE A;  1WSR A;  2CW0 A;  1IL2 A;  1JQW A;  3HKZ L;  1XZP A;  4KDD A;  3AD8 C;  4BLA A;  3N0B A;  2XCQ A;  3G4C A;  1WOS A;  5IYC C;  1J98 A;  1YNJ A; 
#chains in the Genus database with same CATH homology
 5C3E C;  4A3G C;  5IP9 K;  2JA8 K;  4QJV B;  3PO3 C;  5FJ8 K;  4X6A K;  2E2J K;  3EQL A;  4A3J K;  4A3F C;  3S1R K;  1TWF K;  2JA6 C;  3H0G K;  4YG2 A;  2R7Z C;  2Y0S L;  2PMZ D;  3H3V L;  1HQM A;  3HOU K;  4QIW D;  3S15 C;  5IP9 C;  5IP7 C;  4Y7N K;  2VUM C;  5M5X K;  1I50 C;  5IYD C;  3GTJ C;  2E2J C;  3M3Y K;  3S1R C;  1TWF C;  2WB1 D;  3H0G C;  2JA5 C;  3HOU C;  5TMF A;  3S17 K;  3HOZ K;  3WOD A;  5D4D A;  4C2M K;  3HOX K;  3GTP C;  4LK0 A;  4G7H A;  4KN7 A;  3M4O K;  4A3I K;  4KN4 A;  5IYC K;  3GTQ K;  2A6H A;  4LJZ A;  3K7A C;  3M3Y C;  3GTL K;  3S1M C;  4A3D C;  4BY1 C;  4YFN A;  3S17 C;  3HOZ C;  2NVY K;  5C3E K;  3HOX C;  3S1N K;  4BBS C;  2E2I C;  2NVT C;  3PO3 K;  3GTL C;  4G7Z A;  2JA6 K;  4QIW L;  5C4J C;  2R7Z K;  2NVY C;  3S15 K;  2O5I A;  1TWA K;  3S2H C;  3S1N C;  5IP7 K;  2VUM K;  4Y52 C;  1I50 K;  5IYD K;  4OIP A;  2WB1 L;  4QJV A;  5M5Y K;  3GTJ K;  4A3L K;  3HOW C;  1TWC K;  2JA5 K;  3GTO C;  5C4X K;  1TWA C;  3GTG C;  3GTP K;  2PA8 D;  4BBR K;  4OIQ A;  3S1M K;  3GTM C;  1WCM C;  3K7A K;  4A3L C;  2R92 C;  1TWC C;  4BY1 K;  3GTK C;  1Y1W C;  4C3H K;  4JK1 A;  5C4X C;  3I4M K;  3S1Q C;  4BBS K;  4BXX K;  3HKZ D;  4BBR C;  2E2I K;  4LK1 A;  2NVT K;  4OIO A;  4AYB L;  1I6V A;  5C4J K;  4GZY A;  5TMC A;  3I4M C;  3S16 K;  3S2H K;  1I6H C;  4BXX C;  1I3Q K;  4Y52 K;  2E2H C;  4MEY A;  3RZD K;  1SMY A;  2PMZ L;  4MQ9 A;  4XLP A;  2NVQ C;  3GTO K;  3HOW K;  4MEX A;  2PA8 L;  3GTG K;  3S16 C;  1R9T C;  1ZYR A;  3CQZ C;  1I3Q C;  3DXJ A;  5IYB C;  5M3F K;  4A3K K;  5FLM C;  3I4N C;  4Q4Z A;  4BY7 C;  1SFO C;  1WCM K;  2A6E A;  3RZD C;  3GTM K;  2R92 K;  3HOY C;  4A3D K;  3GTK K;  1Y1W K;  3RZO C;  4C3I K;  3S1Q K;  4A3C C;  2JA7 C;  2Y0S D;  4OIR A;  2B63 C;  4A3M C;  4XSZ A;  1K83 C;  2NVX K;  4LLG A;  2YU9 C;  3PO2 C;  1I6H K;  2R93 K;  2PPB A;  2BE5 A;  4YFX A;  2E2H K;  2NVX C;  4OIN A;  1TWG C;  5M5W K;  3HOV K;  2NVQ K;  5C44 C;  2WAQ D;  4A3B K;  3S14 C;  1TWH C;  4KMU A;  3CQZ K;  5IYB K;  4A3E C;  1YNN A;  1R9T K;  2R93 C;  5FLM K;  2O5J A;  3I4N K;  4BY7 K;  1Y1V C;  1SFO K;  3HOV C;  3HOY K;  3FKI K;  4XSX A;  4G7O A;  4A3K C;  1IW7 A;  3RZO K;  4A3B C;  1XPP A;  4A3C K;  2JA7 K;  2A69 A;  4A3M K;  2B63 K;  2JA8 C;  1K83 K;  4NOI A;  1BDF A;  3FKI C;  4X6A C;  4YFK A;  2CW0 A;  4A3J C;  2YU9 K;  4ZH4 A;  3PO2 K;  3HKZ L;  3H3V D;  4A93 K;  4Y7N C;  2A68 A;  1TWG K;  2WAQ L;  5C44 K;  4XLN A;  3S2D K;  3S14 K;  1TWH K;  5M3M K;  4A3E K;  4A93 C;  4A3G K;  3M4O C;  4A3I C;  4Q5S A;  5IYC C;  1Y1V K;  3GTQ C;  4C3J K;  1YNJ A;  4AYB D;  4A3F K;  3S2D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...