4A3BK

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
molecule tags Transcription
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3bK00
4XLNA 3S2DK 3RZDK 3M4OK 4YFKA 3PO3C 1ZYRA 2NVTK 1WCMC 2Y0SD 4A3EK 4BY7K 4A3KC 4A93K 1XPPA 3GTMC 1I50K 4KMUA 4QIWD 4A3LC 4G7HA 3S14C 3HOXC 4A3MC 3S17C 4C3HK 1Y1VK 1Y1WK 1I6VA 4OINA 4Q5SA 3I4NC 4XLPA 5C44C 2YU9K 5M5YK 3GTPK 3H3VL 4A3BK 2A69A 1TWGC 2VUMC 2WB1D 5IYCK 5IP9K 1BDFA 2R93K 3S16C 4X6AC 4GZYA 1TWAC 3HOUK 4NOIA 4C2MK 2JA6C 2PPBA 3GTQK 3GTKK 3GTJC 4BBRC 3HOVK 5C4JK 3EQLA 4Y52K 2WAQD 3CQZC 4BY1C 4MQ9A 1TWHC 1TWCK 3S1RC 1SFOC 2E2IK 5TMCA 4G7OA 3HOWC 4A3GC 3S1NK 3HOZK 4AYBD 2NVQK 3S15K 4KN4A 4BBSC 5TMFA 3S2DC 3S1MK 1IW7A 1R9TC 4YG2A 3M4OC 5IP7C 2NVTC 1WCMK 4OIOA 3GTOK 4BY7C 4A3KK 4A3DC 1SMYA 3GTLK 3GTMK 2NVXC 4A3LK 3S14K 3H0GK 4A3JK 2JA7K 3WODA 4LLGA 3I4NK 2YU9C 2PA8D 5C44K 2Y0SL 3GTPC 4MEYA 1I3QC 2R92K 4A3BC 1TWGK 2VUMK 5C3EC 3DXJA 4KN7A 5IYCC 2R93C 3S16K 2E2JK 3I4MC 3FKIC 5IYBC 1TWFK 4YFXA 2JA6K 3M3YC 5M3MK 4BBRK 1I6HC 3HOVC 4ZH4A 3K7AK 4Y52C 4G7ZA 4A3FK 2JA8K 3CQZK 5FLMC 2WAQL 4LK1A 1TWCC 1TWHK 4BY1K 2BE5A 4C3IK 2E2IC 2B63K 3HOWK 4A3GK 3S2HK 4JK1A 2NVYC 4A3IC 4BXXC 2R7ZK 4AYBL 3S1QK 4Y7NK 2A68A 2E2HK 2JA5K 1R9TK 3HOYK 3RZOC 1HQMA 3PO2K 4OIRA 5IP7K 3S1MC 5IYDK 1K83C 3GTGK 3GTOC 2PMZD 5C4XK 4A3DK 3GTLC 4MEXA 5M5XK 3RZDC 2NVXK 2PA8L 3PO3K 3H0GC 4YFNA 4A3JC 2JA7C 2A6EA 2O5IA 4A3EC 3H3VD 3HKZL 2WB1L 4A93C 1I50C 1I3QK 2R92C 4A3CC 5C3EK 5D4DA 3HOXK 4A3MK 3S17K 1YNNA 4OIPA 1Y1VC 1Y1WC 4C3JK 2CW0A 2E2JC 4LK0A 1YNJA 3FKIK 5IYBK 3I4MK 1TWFC 3M3YK 2O5JA 1I6HK 4QJVB 5IP9C 4XSXA 3K7AC 4QJVA 4X6AK 4A3FC 2JA8C 1TWAK 3HOUC 5FLMK 4OIQA 4XSZA 3GTQC 2A6HA 5FJ8K 4Q4ZA 3GTJK 2PMZL 2B63C 3GTKC 3S2HC 4BXXK 2NVYK 4A3IK 5C4JC 2R7ZC 3HKZD 3S1QC 4Y7NC 5M3FK 4LJZA 2JA5C 2E2HC 1SFOK 3S1RK 3HOYC 3RZOK 3PO2C 5IYDC 4A3CK 5M5WK 3S1NC 3HOZC 4QIWL 1K83K 3GTGC 5C4XC 2NVQC 3S15C 4BBSK
chains in the Genus database with same CATH superfamily
1USOA 4YFKA 1O24A 2Y0SD 4BY7K 3AQPA 3LAJA 5JFEA 1Y1WA 4A3BK 3H3VL 3MMLB 2CFAA 3GEEA 4X6AC 1JQWA 1XZPB 1TWAC 3HOUK 2JA6C 2ZUFA 3GTKK 3GTJC 3HOVK 4G0UA 5C4JK 3EQLA 4BKWA 1ZXOA 4KM8A 4BY1C 4MQ9A 1SFOC 1WOPA 4G7OA 4M1XA 2W7VA 3TTGA 4AYBD 2NVXA 1VGXA 1J6XA 4KN4A 1J6VA 2XCQA 1IW7A 4P5BA 5IOTA 3M4OC 1WCMK 4A3DC 3T02A 3H0GK 2JA7K 2YU9C 1WSVA 1WCMA 3GTPC 1TWGK 4KAWX 1L0WA 1WQFA 3I4MC 3AH5A 1TWFK 3H0GA 4DDQA 1ISEA 2V6TA 4ZH4A 3IPJA 1TWGA 4WJ3M 2WAQL 4LK1A 5HL8A 1TWHK 3S0XA 2E2IC 2NVYC 2R7ZK 4KMDA 1BGWA 4BLAA 1ZQ1C 4KMHA 2JA5K 3S1MC 1R9TK 4A3CC 5EGEA 2FQTA 1K83C 5CJ9A 1O29A 3GTOC 3NUHA 3BP8C 5JVOA 1JOEA 4A3JC 4YFNA 3N3YA 2JA7C 3PO3K 1F9NA 2VUMA 1WSRA 5C3EK 5D4DA 4A3MK 4KB2A 1Y1VC 2O5JA 1I6HK 4KC6A 4XSXA 5IP9C 2E2IA 4OIQA 4XCHA 4XSZA 3GTKC 1XXAA 4G0WA 1JVIA 2R7ZC 3AD8C 2RGRA 4Y7NC 5M3FK 4LJZA 3S1QC 1SFOK 4WILA 3RZOK 3PO2C 5IYDC 1TWHA 5M5WK 4BBSK 2B63A 4XLNA 3M4OK 2YU9A 3PO3C 5IOSA 1ZYRA 2NVTK 3GTPA 1WCMC 3TFHA 4A3EK 3SZZA 1BJTA 1F93A 3G4AA 3T00A 1O2FB 1O26A 4A3MC 4C3HK 1XXCA 1Y1WK 1VLOA 1XXBA 1WQHA 3HXAA 4XLPA 5C44C 2YU9K 5M5YK 2A69A 4GFQA 4KB4A 2VUMC 1I50A 3S16C 3OEPA 2P8TA 1XZPA 2V6UA 3GTQK 1WORA 4ILDA 2WAQD 1INNA 3CQZC 4GTCA 4FZBA 1TWCK 1TWHC 3S1RC 2E2IK 5IORA 3HOWC 3S1NK 3HOZK 2R7ZA 2NVQK 4GTEA 4C45A 3S15K 3S2DC 3S1MK 4YG2A 3LAPA 1YCLA 2JH3A 1TWCA 2P5MA 3A8KA 3GEIA 1SMYA 1C0AA 4A3JK 3WODA 4J3NA 4MEYA 1I3QC 3CQZA 3LPXA 3DXJA 4KN7A 2KWAA 4GTFA 3AD7C 5M3MK 2E2HA 3L4JA 3K7AK 4Y52C 4G7ZA 5TJ3A 5FLMC 1DCPA 4BY1K 3G4CA 4PABA 4A3GK 4JK1A 1EQRA 4AYBL 3HOYK 1HQMA 3PO2K 2GAHC 2R93A 1O2AA 3GTJA 1O27A 2JA6A 3H0GC 1PJ5A 1I3QK 2R92C 1GE9A 1O28A 4OIPA 2E2JC 3BP3A 4LR2A 3GTKA 1ZBSA 1TWFC 3M3YK 4QJVB 3FOFA 3JSTA 1EH1A 1IS1A 5L46A 2A6HA 4RMFA 1PJ7A 3A8JA 4A3IK 3HKZD 3S1RK 1IL2A 3HOZC 3GTGC 4GTAA 1PJ6A 4A3KC 4A93K 4KMUA 4FM9A 3OREA 4A3LC 3S14C 3HOXC 3S17C 1Y1VK 4OINA 1TWFA 1R9TA 1TWGC 2WB1D 5IYCK 3L4KA 1BDFA 4GZYA 4PAAA 4GTBA 4NOIA 1EI6A 2ZFZA 4C3IC 4GT9A 4A3GC 4WJ4A 1DD5A 4BBSC 5TMFA 3ERED 2NVTC 2ZUEA 4OIOA 4BY7C 3OPFA 3GTLK 3GTMA 2NVXC 3S14K 5EGHA 4LLGA 3I4NK 2PA8D 5C44K 5C3EC 2R92A 3GTLA 5IYCC 2E2JK 3GEHA 4YFXA 5CHPA 2JA6K 3M3YC 1I6HC 3HOVC 3BUEA 4A3FK 3N0BA 2EBBA 1TWCC 1V5VA 3HOWK 4BXXC 4A3IC 3S1QK 4Y7NK 3T01A 3AD9C 5IP7K 1G51A 3GTGK 1ZVUA 4A3DK 1Y1VA 3GTLC 4MEXA 5M5XK 3RZDC 4BLBA 3CAGA 2PA8L 3H3VD 2JA5A 1DCHA 2PHCB 4A93C 2WB1L 1I50C 1IQ0A 3FHZA 1WQGA 3HOXK 3GTOA 1K83A 3QX3A 2GSNA 2CW0A 4C3JK 4LK0A 1YNJA 3FKIK 5IYBK 2XCOA 4QJVA 4X6AK 2JA8C 1TWAK 4LOWA 5FLMK 3HOUC 1WIHA 5FJ8K 3GTJK 3GDZA 2B63C 4BXXK 2D6FC 1VH2A 1KQ4A 1J6WA 3AQOA 3HOYC 3S1NC 4QIWL 4AH6A 3V4GA 2NVQC 3S15C 3S2DK 3RZDK 1EFWA 3TFIA 1XPPA 1O25A 1XZQB 1I50K 2Y3PA 3GTMC 4QIWD 4G7HA 3N0CA 1I6VA 4Q5SA 4KASA 1IE0A 2GAGC 3I4NC 2RH6A 3GTPK 1BS2A 2CFAB 5IP9K 2R93K 1XZQA 1EK8A 1UV7A 4C2MK 2PPBA 3FKIA 2JA7A 4BBRC 4LQYA 4Y52K 1I3QA 1TWAA 5TMCA 4KMAA 4KDDA 1R9TC 2NVYA 5IP7C 3TFJA 3GTOK 4KATA 4A3KK 3GTMK 4A3LK 4P5AA 4C3HC 3FOEA 4GTLA 5IOQA 1B4BA 2Y0SL 4GTDA 1VRQC 4A3BC 2R92K 2VUMK 4O2DA 1IBAA 4KM9A 3ADAC 3GTGA 1HI9A 2R93C 3S16K 4C3JC 2XCRB 3FKIC 5IYBC 4BBRK 1RU0A 4G0VA 2JA8K 3CQZK 5E68A 2BE5A 3A8IA 4C3IK 3Q3QA 2B63K 3GTQA 3S2HK 1J98A 4P9SA 2FQOA 3GIRA 2A68A 2E2HK 2GSOA 3RZOC 1SFOA 4OIRA 5IYDK 1WOOA 2PMZD 5C4XK 2NVXK 1YX2A 2A6EA 2O5IA 4A3EC 2V6SA 1VJEA 3HKZL 1O2BA 4KARA 1WOSA 3S17K 1USMA 1YNNA 1DCOA 1Y1WC 3I4MK 3VA7A 3K7AC 3SZYA 1F7VA 4A3FC 1B4AA 1X31C 4C2MC 3GTQC 1F7UA 4Q4ZA 2PMZL 3S2HC 1AB4A 2NVYK 5C4JC 3GSIA 2JA5C 2E2HC 4A3CK 1K83K 5C4XC 2GSUA
chains in the Genus database with same CATH topology
4XLNA 3S2DK 3RZDK 3M4OK 4YFKA 3PO3C 1ZYRA 2NVTK 1WCMC 2Y0SD 4A3EK 4BY7K 4A3KC 4A93K 1XPPA 3GTMC 1I50K 4KMUA 4QIWD 4A3LC 4G7HA 3S14C 3HOXC 4A3MC 3S17C 4C3HK 1Y1VK 1Y1WK 1I6VA 4OINA 4Q5SA 3I4NC 4XLPA 5C44C 2YU9K 5M5YK 3GTPK 3H3VL 4A3BK 2A69A 1TWGC 2VUMC 2WB1D 5IYCK 5IP9K 1BDFA 2R93K 3S16C 4X6AC 4GZYA 1TWAC 3HOUK 4NOIA 4C2MK 2JA6C 2PPBA 3GTQK 3GTKK 3GTJC 4BBRC 3HOVK 5C4JK 3EQLA 4Y52K 2WAQD 3CQZC 4BY1C 4MQ9A 1TWHC 1TWCK 3S1RC 1SFOC 2E2IK 5TMCA 4G7OA 3HOWC 4A3GC 3S1NK 3HOZK 4AYBD 2NVQK 3S15K 4KN4A 4BBSC 5TMFA 3S2DC 3S1MK 1IW7A 1R9TC 4YG2A 3M4OC 5IP7C 2NVTC 1WCMK 4OIOA 3GTOK 4BY7C 4A3KK 4A3DC 1SMYA 3GTLK 3GTMK 2NVXC 4A3LK 3S14K 3H0GK 4A3JK 2JA7K 3WODA 4LLGA 3I4NK 2YU9C 2PA8D 5C44K 2Y0SL 3GTPC 4MEYA 1I3QC 2R92K 4A3BC 1TWGK 2VUMK 5C3EC 3DXJA 4KN7A 5IYCC 2R93C 3S16K 2E2JK 3I4MC 3FKIC 5IYBC 1TWFK 4YFXA 2JA6K 3M3YC 5M3MK 4BBRK 1I6HC 3HOVC 4ZH4A 3K7AK 4Y52C 4G7ZA 4A3FK 2JA8K 3CQZK 5FLMC 2WAQL 4LK1A 1TWCC 1TWHK 4BY1K 2BE5A 4C3IK 2E2IC 2B63K 3HOWK 4A3GK 3S2HK 4JK1A 2NVYC 4A3IC 4BXXC 2R7ZK 4AYBL 3S1QK 4Y7NK 2A68A 2E2HK 2JA5K 1R9TK 3HOYK 3RZOC 1HQMA 3PO2K 4OIRA 5IP7K 3S1MC 5IYDK 1K83C 3GTGK 3GTOC 2PMZD 5C4XK 4A3DK 3GTLC 4MEXA 5M5XK 3RZDC 2NVXK 2PA8L 3PO3K 3H0GC 4YFNA 4A3JC 2JA7C 2A6EA 2O5IA 4A3EC 3H3VD 3HKZL 2WB1L 4A93C 1I50C 1I3QK 2R92C 4A3CC 5C3EK 5D4DA 3HOXK 4A3MK 3S17K 1YNNA 4OIPA 1Y1VC 1Y1WC 4C3JK 2CW0A 2E2JC 4LK0A 1YNJA 3FKIK 5IYBK 3I4MK 1TWFC 3M3YK 2O5JA 1I6HK 4QJVB 5IP9C 4XSXA 3K7AC 4QJVA 4X6AK 4A3FC 2JA8C 1TWAK 3HOUC 5FLMK 4OIQA 4XSZA 3GTQC 2A6HA 5FJ8K 4Q4ZA 3GTJK 2PMZL 2B63C 3GTKC 3S2HC 4BXXK 2NVYK 4A3IK 5C4JC 2R7ZC 3HKZD 3S1QC 4Y7NC 5M3FK 4LJZA 2JA5C 2E2HC 1SFOK 3S1RK 3HOYC 3RZOK 3PO2C 5IYDC 4A3CK 5M5WK 3S1NC 3HOZC 4QIWL 1K83K 3GTGC 5C4XC 2NVQC 3S15C 4BBSK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLN A;  3S2D K;  3RZD K;  3M4O K;  4YFK A;  3PO3 C;  1ZYR A;  2NVT K;  1WCM C;  2Y0S D;  4A3E K;  4BY7 K;  4A3K C;  4A93 K;  1XPP A;  3GTM C;  1I50 K;  4KMU A;  4QIW D;  4A3L C;  4G7H A;  3S14 C;  3HOX C;  4A3M C;  3S17 C;  4C3H K;  1Y1V K;  1Y1W K;  1I6V A;  4OIN A;  4Q5S A;  3I4N C;  4XLP A;  5C44 C;  2YU9 K;  5M5Y K;  3GTP K;  3H3V L;  4A3B K;  2A69 A;  1TWG C;  2VUM C;  2WB1 D;  5IYC K;  5IP9 K;  1BDF A;  2R93 K;  3S16 C;  4X6A C;  4GZY A;  1TWA C;  3HOU K;  4NOI A;  4C2M K;  2JA6 C;  2PPB A;  3GTQ K;  3GTK K;  3GTJ C;  4BBR C;  3HOV K;  5C4J K;  3EQL A;  4Y52 K;  2WAQ D;  3CQZ C;  4BY1 C;  4MQ9 A;  1TWH C;  1TWC K;  3S1R C;  1SFO C;  2E2I K;  5TMC A;  4G7O A;  3HOW C;  4A3G C;  3S1N K;  3HOZ K;  4AYB D;  2NVQ K;  3S15 K;  4KN4 A;  4BBS C;  5TMF A;  3S2D C;  3S1M K;  1IW7 A;  1R9T C;  4YG2 A;  3M4O C;  5IP7 C;  2NVT C;  1WCM K;  4OIO A;  3GTO K;  4BY7 C;  4A3K K;  4A3D C;  1SMY A;  3GTL K;  3GTM K;  2NVX C;  4A3L K;  3S14 K;  3H0G K;  4A3J K;  2JA7 K;  3WOD A;  4LLG A;  3I4N K;  2YU9 C;  2PA8 D;  5C44 K;  2Y0S L;  3GTP C;  4MEY A;  1I3Q C;  2R92 K;  4A3B C;  1TWG K;  2VUM K;  5C3E C;  3DXJ A;  4KN7 A;  5IYC C;  2R93 C;  3S16 K;  2E2J K;  3I4M C;  3FKI C;  5IYB C;  1TWF K;  4YFX A;  2JA6 K;  3M3Y C;  5M3M K;  4BBR K;  1I6H C;  3HOV C;  4ZH4 A;  3K7A K;  4Y52 C;  4G7Z A;  4A3F K;  2JA8 K;  3CQZ K;  5FLM C;  2WAQ L;  4LK1 A;  1TWC C;  1TWH K;  4BY1 K;  2BE5 A;  4C3I K;  2E2I C;  2B63 K;  3HOW K;  4A3G K;  3S2H K;  4JK1 A;  2NVY C;  4A3I C;  4BXX C;  2R7Z K;  4AYB L;  3S1Q K;  4Y7N K;  2A68 A;  2E2H K;  2JA5 K;  1R9T K;  3HOY K;  3RZO C;  1HQM A;  3PO2 K;  4OIR A;  5IP7 K;  3S1M C;  5IYD K;  1K83 C;  3GTG K;  3GTO C;  2PMZ D;  5C4X K;  4A3D K;  3GTL C;  4MEX A;  5M5X K;  3RZD C;  2NVX K;  2PA8 L;  3PO3 K;  3H0G C;  4YFN A;  4A3J C;  2JA7 C;  2A6E A;  2O5I A;  4A3E C;  3H3V D;  3HKZ L;  2WB1 L;  4A93 C;  1I50 C;  1I3Q K;  2R92 C;  4A3C C;  5C3E K;  5D4D A;  3HOX K;  4A3M K;  3S17 K;  1YNN A;  4OIP A;  1Y1V C;  1Y1W C;  4C3J K;  2CW0 A;  2E2J C;  4LK0 A;  1YNJ A;  3FKI K;  5IYB K;  3I4M K;  1TWF C;  3M3Y K;  2O5J A;  1I6H K;  4QJV B;  5IP9 C;  4XSX A;  3K7A C;  4QJV A;  4X6A K;  4A3F C;  2JA8 C;  1TWA K;  3HOU C;  5FLM K;  4OIQ A;  4XSZ A;  3GTQ C;  2A6H A;  5FJ8 K;  4Q4Z A;  3GTJ K;  2PMZ L;  2B63 C;  3GTK C;  3S2H C;  4BXX K;  2NVY K;  4A3I K;  5C4J C;  2R7Z C;  3HKZ D;  3S1Q C;  4Y7N C;  5M3F K;  4LJZ A;  2JA5 C;  2E2H C;  1SFO K;  3S1R K;  3HOY C;  3RZO K;  3PO2 C;  5IYD C;  4A3C K;  5M5W K;  3S1N C;  3HOZ C;  4QIW L;  1K83 K;  3GTG C;  5C4X C;  2NVQ C;  3S15 C;  4BBS K; 
#chains in the Genus database with same CATH topology
 1USO A;  4YFK A;  1O24 A;  2Y0S D;  4BY7 K;  3AQP A;  3LAJ A;  5JFE A;  1Y1W A;  4A3B K;  3H3V L;  3MML B;  2CFA A;  3GEE A;  4X6A C;  1JQW A;  1XZP B;  1TWA C;  3HOU K;  2JA6 C;  2ZUF A;  3GTK K;  3GTJ C;  3HOV K;  4G0U A;  5C4J K;  3EQL A;  4BKW A;  1ZXO A;  4KM8 A;  4BY1 C;  4MQ9 A;  1SFO C;  1WOP A;  4G7O A;  4M1X A;  2W7V A;  3TTG A;  4AYB D;  2NVX A;  1VGX A;  1J6X A;  4KN4 A;  1J6V A;  2XCQ A;  1IW7 A;  4P5B A;  5IOT A;  3M4O C;  1WCM K;  4A3D C;  3T02 A;  3H0G K;  2JA7 K;  2YU9 C;  1WSV A;  1WCM A;  3GTP C;  1TWG K;  4KAW X;  1L0W A;  1WQF A;  3I4M C;  3AH5 A;  1TWF K;  3H0G A;  4DDQ A;  1ISE A;  2V6T A;  4ZH4 A;  3IPJ A;  1TWG A;  4WJ3 M;  2WAQ L;  4LK1 A;  5HL8 A;  1TWH K;  3S0X A;  2E2I C;  2NVY C;  2R7Z K;  4KMD A;  1BGW A;  4BLA A;  1ZQ1 C;  4KMH A;  2JA5 K;  3S1M C;  1R9T K;  4A3C C;  5EGE A;  2FQT A;  1K83 C;  5CJ9 A;  1O29 A;  3GTO C;  3NUH A;  3BP8 C;  5JVO A;  1JOE A;  4A3J C;  4YFN A;  3N3Y A;  2JA7 C;  3PO3 K;  1F9N A;  2VUM A;  1WSR A;  5C3E K;  5D4D A;  4A3M K;  4KB2 A;  1Y1V C;  2O5J A;  1I6H K;  4KC6 A;  4XSX A;  5IP9 C;  2E2I A;  4OIQ A;  4XCH A;  4XSZ A;  3GTK C;  1XXA A;  4G0W A;  1JVI A;  2R7Z C;  3AD8 C;  2RGR A;  4Y7N C;  5M3F K;  4LJZ A;  3S1Q C;  1SFO K;  4WIL A;  3RZO K;  3PO2 C;  5IYD C;  1TWH A;  5M5W K;  4BBS K;  2B63 A;  4XLN A;  3M4O K;  2YU9 A;  3PO3 C;  5IOS A;  1ZYR A;  2NVT K;  3GTP A;  1WCM C;  3TFH A;  4A3E K;  3SZZ A;  1BJT A;  1F93 A;  3G4A A;  3T00 A;  1O2F B;  1O26 A;  4A3M C;  4C3H K;  1XXC A;  1Y1W K;  1VLO A;  1XXB A;  1WQH A;  3HXA A;  4XLP A;  5C44 C;  2YU9 K;  5M5Y K;  2A69 A;  4GFQ A;  4KB4 A;  2VUM C;  1I50 A;  3S16 C;  3OEP A;  2P8T A;  1XZP A;  2V6U A;  3GTQ K;  1WOR A;  4ILD A;  2WAQ D;  1INN A;  3CQZ C;  4GTC A;  4FZB A;  1TWC K;  1TWH C;  3S1R C;  2E2I K;  5IOR A;  3HOW C;  3S1N K;  3HOZ K;  2R7Z A;  2NVQ K;  4GTE A;  4C45 A;  3S15 K;  3S2D C;  3S1M K;  4YG2 A;  3LAP A;  1YCL A;  2JH3 A;  1TWC A;  2P5M A;  3A8K A;  3GEI A;  1SMY A;  1C0A A;  4A3J K;  3WOD A;  4J3N A;  4MEY A;  1I3Q C;  3CQZ A;  3LPX A;  3DXJ A;  4KN7 A;  2KWA A;  4GTF A;  3AD7 C;  5M3M K;  2E2H A;  3L4J A;  3K7A K;  4Y52 C;  4G7Z A;  5TJ3 A;  5FLM C;  1DCP A;  4BY1 K;  3G4C A;  4PAB A;  4A3G K;  4JK1 A;  1EQR A;  4AYB L;  3HOY K;  1HQM A;  3PO2 K;  2GAH C;  2R93 A;  1O2A A;  3GTJ A;  1O27 A;  2JA6 A;  3H0G C;  1PJ5 A;  1I3Q K;  2R92 C;  1GE9 A;  1O28 A;  4OIP A;  2E2J C;  3BP3 A;  4LR2 A;  3GTK A;  1ZBS A;  1TWF C;  3M3Y K;  4QJV B;  3FOF A;  3JST A;  1EH1 A;  1IS1 A;  5L46 A;  2A6H A;  4RMF A;  1PJ7 A;  3A8J A;  4A3I K;  3HKZ D;  3S1R K;  1IL2 A;  3HOZ C;  3GTG C;  4GTA A;  1PJ6 A;  4A3K C;  4A93 K;  4KMU A;  4FM9 A;  3ORE A;  4A3L C;  3S14 C;  3HOX C;  3S17 C;  1Y1V K;  4OIN A;  1TWF A;  1R9T A;  1TWG C;  2WB1 D;  5IYC K;  3L4K A;  1BDF A;  4GZY A;  4PAA A;  4GTB A;  4NOI A;  1EI6 A;  2ZFZ A;  4C3I C;  4GT9 A;  4A3G C;  4WJ4 A;  1DD5 A;  4BBS C;  5TMF A;  3ERE D;  2NVT C;  2ZUE A;  4OIO A;  4BY7 C;  3OPF A;  3GTL K;  3GTM A;  2NVX C;  3S14 K;  5EGH A;  4LLG A;  3I4N K;  2PA8 D;  5C44 K;  5C3E C;  2R92 A;  3GTL A;  5IYC C;  2E2J K;  3GEH A;  4YFX A;  5CHP A;  2JA6 K;  3M3Y C;  1I6H C;  3HOV C;  3BUE A;  4A3F K;  3N0B A;  2EBB A;  1TWC C;  1V5V A;  3HOW K;  4BXX C;  4A3I C;  3S1Q K;  4Y7N K;  3T01 A;  3AD9 C;  5IP7 K;  1G51 A;  3GTG K;  1ZVU A;  4A3D K;  1Y1V A;  3GTL C;  4MEX A;  5M5X K;  3RZD C;  4BLB A;  3CAG A;  2PA8 L;  3H3V D;  2JA5 A;  1DCH A;  2PHC B;  4A93 C;  2WB1 L;  1I50 C;  1IQ0 A;  3FHZ A;  1WQG A;  3HOX K;  3GTO A;  1K83 A;  3QX3 A;  2GSN A;  2CW0 A;  4C3J K;  4LK0 A;  1YNJ A;  3FKI K;  5IYB K;  2XCO A;  4QJV A;  4X6A K;  2JA8 C;  1TWA K;  4LOW A;  5FLM K;  3HOU C;  1WIH A;  5FJ8 K;  3GTJ K;  3GDZ A;  2B63 C;  4BXX K;  2D6F C;  1VH2 A;  1KQ4 A;  1J6W A;  3AQO A;  3HOY C;  3S1N C;  4QIW L;  4AH6 A;  3V4G A;  2NVQ C;  3S15 C;  3S2D K;  3RZD K;  1EFW A;  3TFI A;  1XPP A;  1O25 A;  1XZQ B;  1I50 K;  2Y3P A;  3GTM C;  4QIW D;  4G7H A;  3N0C A;  1I6V A;  4Q5S A;  4KAS A;  1IE0 A;  2GAG C;  3I4N C;  2RH6 A;  3GTP K;  1BS2 A;  2CFA B;  5IP9 K;  2R93 K;  1XZQ A;  1EK8 A;  1UV7 A;  4C2M K;  2PPB A;  3FKI A;  2JA7 A;  4BBR C;  4LQY A;  4Y52 K;  1I3Q A;  1TWA A;  5TMC A;  4KMA A;  4KDD A;  1R9T C;  2NVY A;  5IP7 C;  3TFJ A;  3GTO K;  4KAT A;  4A3K K;  3GTM K;  4A3L K;  4P5A A;  4C3H C;  3FOE A;  4GTL A;  5IOQ A;  1B4B A;  2Y0S L;  4GTD A;  1VRQ C;  4A3B C;  2R92 K;  2VUM K;  4O2D A;  1IBA A;  4KM9 A;  3ADA C;  3GTG A;  1HI9 A;  2R93 C;  3S16 K;  4C3J C;  2XCR B;  3FKI C;  5IYB C;  4BBR K;  1RU0 A;  4G0V A;  2JA8 K;  3CQZ K;  5E68 A;  2BE5 A;  3A8I A;  4C3I K;  3Q3Q A;  2B63 K;  3GTQ A;  3S2H K;  1J98 A;  4P9S A;  2FQO A;  3GIR A;  2A68 A;  2E2H K;  2GSO A;  3RZO C;  1SFO A;  4OIR A;  5IYD K;  1WOO A;  2PMZ D;  5C4X K;  2NVX K;  1YX2 A;  2A6E A;  2O5I A;  4A3E C;  2V6S A;  1VJE A;  3HKZ L;  1O2B A;  4KAR A;  1WOS A;  3S17 K;  1USM A;  1YNN A;  1DCO A;  1Y1W C;  3I4M K;  3VA7 A;  3K7A C;  3SZY A;  1F7V A;  4A3F C;  1B4A A;  1X31 C;  4C2M C;  3GTQ C;  1F7U A;  4Q4Z A;  2PMZ L;  3S2H C;  1AB4 A;  2NVY K;  5C4J C;  3GSI A;  2JA5 C;  2E2H C;  4A3C K;  1K83 K;  5C4X C;  2GSU A; 
#chains in the Genus database with same CATH homology
 4XLN A;  3S2D K;  3RZD K;  3M4O K;  4YFK A;  3PO3 C;  1ZYR A;  2NVT K;  1WCM C;  2Y0S D;  4A3E K;  4BY7 K;  4A3K C;  4A93 K;  1XPP A;  3GTM C;  1I50 K;  4KMU A;  4QIW D;  4A3L C;  4G7H A;  3S14 C;  3HOX C;  4A3M C;  3S17 C;  4C3H K;  1Y1V K;  1Y1W K;  1I6V A;  4OIN A;  4Q5S A;  3I4N C;  4XLP A;  5C44 C;  2YU9 K;  5M5Y K;  3GTP K;  3H3V L;  4A3B K;  2A69 A;  1TWG C;  2VUM C;  2WB1 D;  5IYC K;  5IP9 K;  1BDF A;  2R93 K;  3S16 C;  4X6A C;  4GZY A;  1TWA C;  3HOU K;  4NOI A;  4C2M K;  2JA6 C;  2PPB A;  3GTQ K;  3GTK K;  3GTJ C;  4BBR C;  3HOV K;  5C4J K;  3EQL A;  4Y52 K;  2WAQ D;  3CQZ C;  4BY1 C;  4MQ9 A;  1TWH C;  1TWC K;  3S1R C;  1SFO C;  2E2I K;  5TMC A;  4G7O A;  3HOW C;  4A3G C;  3S1N K;  3HOZ K;  4AYB D;  2NVQ K;  3S15 K;  4KN4 A;  4BBS C;  5TMF A;  3S2D C;  3S1M K;  1IW7 A;  1R9T C;  4YG2 A;  3M4O C;  5IP7 C;  2NVT C;  1WCM K;  4OIO A;  3GTO K;  4BY7 C;  4A3K K;  4A3D C;  1SMY A;  3GTL K;  3GTM K;  2NVX C;  4A3L K;  3S14 K;  3H0G K;  4A3J K;  2JA7 K;  3WOD A;  4LLG A;  3I4N K;  2YU9 C;  2PA8 D;  5C44 K;  2Y0S L;  3GTP C;  4MEY A;  1I3Q C;  2R92 K;  4A3B C;  1TWG K;  2VUM K;  5C3E C;  3DXJ A;  4KN7 A;  5IYC C;  2R93 C;  3S16 K;  2E2J K;  3I4M C;  3FKI C;  5IYB C;  1TWF K;  4YFX A;  2JA6 K;  3M3Y C;  5M3M K;  4BBR K;  1I6H C;  3HOV C;  4ZH4 A;  3K7A K;  4Y52 C;  4G7Z A;  4A3F K;  2JA8 K;  3CQZ K;  5FLM C;  2WAQ L;  4LK1 A;  1TWC C;  1TWH K;  4BY1 K;  2BE5 A;  4C3I K;  2E2I C;  2B63 K;  3HOW K;  4A3G K;  3S2H K;  4JK1 A;  2NVY C;  4A3I C;  4BXX C;  2R7Z K;  4AYB L;  3S1Q K;  4Y7N K;  2A68 A;  2E2H K;  2JA5 K;  1R9T K;  3HOY K;  3RZO C;  1HQM A;  3PO2 K;  4OIR A;  5IP7 K;  3S1M C;  5IYD K;  1K83 C;  3GTG K;  3GTO C;  2PMZ D;  5C4X K;  4A3D K;  3GTL C;  4MEX A;  5M5X K;  3RZD C;  2NVX K;  2PA8 L;  3PO3 K;  3H0G C;  4YFN A;  4A3J C;  2JA7 C;  2A6E A;  2O5I A;  4A3E C;  3H3V D;  3HKZ L;  2WB1 L;  4A93 C;  1I50 C;  1I3Q K;  2R92 C;  4A3C C;  5C3E K;  5D4D A;  3HOX K;  4A3M K;  3S17 K;  1YNN A;  4OIP A;  1Y1V C;  1Y1W C;  4C3J K;  2CW0 A;  2E2J C;  4LK0 A;  1YNJ A;  3FKI K;  5IYB K;  3I4M K;  1TWF C;  3M3Y K;  2O5J A;  1I6H K;  4QJV B;  5IP9 C;  4XSX A;  3K7A C;  4QJV A;  4X6A K;  4A3F C;  2JA8 C;  1TWA K;  3HOU C;  5FLM K;  4OIQ A;  4XSZ A;  3GTQ C;  2A6H A;  5FJ8 K;  4Q4Z A;  3GTJ K;  2PMZ L;  2B63 C;  3GTK C;  3S2H C;  4BXX K;  2NVY K;  4A3I K;  5C4J C;  2R7Z C;  3HKZ D;  3S1Q C;  4Y7N C;  5M3F K;  4LJZ A;  2JA5 C;  2E2H C;  1SFO K;  3S1R K;  3HOY C;  3RZO K;  3PO2 C;  5IYD C;  4A3C K;  5M5W K;  3S1N C;  3HOZ C;  4QIW L;  1K83 K;  3GTG C;  5C4X C;  2NVQ C;  3S15 C;  4BBS K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...