4A3CH

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 22
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3cH00
3PGZA 4LFAQ 3S16H 4PZ7A 5C44G 1HR0Q 3L7ZC 4JG2A 1B8AA 1YI2A 1KAWA 4ALPA 4BY7H 2JA7G 2OCEA 4POGA 1HNXL 1VQ4A 3S2DH 4A4IA 2EXDA 2I5LX 4LF8Q 3CCRA 1XMQQ 3K80C 4IOCA 4K0KQ 1LUZA 4DPGA 3W1GA 1VQEA 5C0XJ 3GTLH 1XTDA 4IO9A 3BU2A 3Q8DA 5IT9c 2OTLA 2WB1G 3AFQA 2UXBQ 1EQQA 1V1QA 5M3MG 3AYHB 2DGYA 2Z6KC 3U50C 1X3FA 1LTLA 1HJPA 4DV0L 1N34L 3VDYA 4B3RL 4HIKA 4JI8Q 2EQSA 4P74A 4A3FH 2CQOA 4A3FG 3HOWH 1VQJA 4OO1I 1L2FA 5C3EH 3DLLA 3J80i 1VQNA 4JBWA 4OXPA 4A3BG 4KHPQ 2NZOA 3EIVA 5BR8Q 4DR6Q 1Z9FA 4IPDA 2KCMA 1NBWA 4X62L 5C4JH 2VQEQ 1PH7A 2VQEL 4UPAA 4DAMA 2D62A 4LF5L 2R92H 3F2CA 2V1CC 3U58A 4OX9L 2PQAA 1G51A 4DK6C 4J15A 4DUZQ 4DV5L 3GTMH 3I4NG 4GNXC 4GNXB 1YHBA 2YTYA 2JA6G 4A75A 3NENA 2NVXH 1UE5A 4QGUA 3W5OA 5C44H 4JYAL 1GKHA 1Q1BA 1N34Q 3T1YQ 3L0OA 2QGQA 4JI4L 1CKOA 2JEBI 3H3VI 1YJWA 1TWHH 1J5EL 3ERSX 3ULJA 4DR6L 4LUZA 1OTCA 3S1MH 1MIUA 4GOPA 1L0WA 4X6AH 2HHHQ 2IX0A 2A8VA 5IE8A 4K0KL 1XMQL 1JJ2A 4A3KG 4HJ8A 3B6YA 1HNXQ 2YYZA 4R4TA 2R6GA 4B3RQ 4EQ5A 4YWKA 4DKAC 4YHHL 4YCWA 1HR0L 5IYDH 5ELOA 2GVBA 3K7UC 3HOVH 1EOVA 4WJ3M 1Z47A 3HKZG 1XPOA 3TEHB 4NXMQ 1XJVA 3PUYA 1PYSB 2Q2IA 1XPRA 1OXXK 2ZTEA 1X6OA 4JI1L 4JI1Q 1B70B 3D31A 4C3IH 3STBD 3S1NH 3HOYH 3PO2G 1BBUA 1IBLQ 2H5XA 3M4PA 3CMAA 5IYCG 3CXCA 3I7FA 1CSPA 3CP0A 1SMXA 4B3SQ 1HZAA 5E7NA 3OTOQ 4PZ8A 3S2HH 2KENA 1U5KA 3PV0A 2RCNA 1UE1A 1VQ8A 1N9WA 4BBRH 4DV2Q 2A19A 2VS1A 4GN3B 3KFUA 3I55A 4GKJQ 1Q46A 2JK8A 4GKKQ 4LWCA 2HHHL 3TS0A 1QVGA 1EQRA 4LF9Q 2RHQB 3H3VH 4GLAC 3F2BA 1J5EQ 5M5YH 4DAYB 5C0XG 4JI4Q 2B63G 4GS3A 3FKIG 1VQCA 3G71A 4JI6L 3RZDH 2ZTDA 3JC66 3K81C 1VQAA 1MJCA 5M5XH 2B3GA 1YEZA 3MXNB 1K73C 4DUZL 4X65Q 1XNRL 1WJJA 4NB3A 1XMOQ 4A3GG 2JJQA 2N3SA 4LF5Q 4HJ5A 4DR1L 1A8VA 2E2IH 3BZKA 1AE2A 3CAMA 1V9PA 1VQMA 2R7ZH 2R7ZG 4A3LG 3CCVA 4HJ7A 4PMWA 4RG1A 3M9BA 2PI2A 1CKNA 1VQKA 4KHPL 5IYBH 4A3DG 5IYBG 1JMCA 5C3EG 1K8GA 1U0LA 3KLWA 4LF7Q 2Q2UA 5AJ3Q 4JI8L 2IHFA 2MO1A 3D0FA 1BKBA 2GN5A 3BZCA 3EBEA 3E9IA 3K7AH 4QY7A 4X66Q 3J81i 5LMNL 1XNQL 1XPUA 1EUJA 4WJ4A 1Y1WH 5GROA 1WFQA 2UXBL 3RN2A 3ULPA 2WAQE 3CC4A 1YBYA 5M5WH 4AQYL 4A93H 3G48A 5GAGC 3FHWA 4LF8L 1PH5A 4JI7L 3NELA 4GLVB 3GDEA 2R7FA 3J81j 2JA7H 5LMUQ 2ZJRA 1VQIA 2RHSB 2NN6I 4IJLA 4B3ML 3UDGA 1EYGA 5GAHC 2KHIA 3NBHB 3ZJYC 2IX1A 3PCOB 4LFCQ 5M3FH 1PH1A 2UUAL 3PIOA 3PIPA 4IOAA 1R9TH 1YZ6A 3ER0A 3H0GH 1PH8A 1WYDA 4JV5L 2K5NA 4DR4L 3CC7A 2UUBL 2K5HA 1YHQA 4GOPB 4MZ9A 1CKNB 4B3TQ 4BXXH 4R4QA 2CCZA 5C0XI 1JB7A 4OO1G 3A5UA 2PMZE 3PUXA 4A3JH 1UE7A 4HJAA 1CKMA 1SR3A 1T9HA 2CFMA 5LMNW 4KLKA 3KJOA 4BY1G 4Y52H 3M3YH 1A62A 1G6PA 3PUVA 1DGSA 4YCUA 4DV4L 3A74A 3MEFA 1HNZL 4GN4B 2ZM6L 1D7QA 3UE0A 4O0AA 4LUVA 3CCMA 3KF6B 4GN5A 2VZAA 2Y0SE 2NVQH 2K50A 3AEVA 1BVSA 5IYCH 3I4NH 5JJLA 1JT8A 3UDXA 2ZJPA 2UXCQ 2KHJA 4TVAB 4DUYL 1HH2P 3J7ZC 4JI2L 1SLJA 1C9OA 3CCEA 4LF6Q 4OONA 1Q81C 3RR5A 1FVIA 3F1ZA 3STBC 5J3BA 3DM3A 3SGIA 4DV3L 4HIOA 4DR3L 2R93H 2JA5G 2I0QA 2CKZB 2HT1A 1PH3A 5JJIA 4JCVE 3GTOH 2FXQA 2UUCL 2ATWA 1NE3A 5IYDG 1EWIA 5HY6A 1PV4A 4LUOA 1I50H 2KCTA 5FJ8H 4DR5L 1OXSC 3K8AA 4FDBA 5C4XH 5FLXc 4DR2L 4YY3Q 4RMFA 2VW9A 1B7YB 2PQAB 3HOUG 1Y1VG 4XIGS 4Y7NH 1VQOA 1PFSA 1A0IA 4KHZA 1KHIA 4ME3A 1N32Q 4NXNL 3AQQA 4JI0Q 4A3GH 1NTGA 3PO3H 2F4VL 4L5RC 3CC2A 2JA9A 1Q86C 1IBKL 2LSSA 1SROA 2LXJA 2UU9Q 4UP8A 1YIJA 1LM0A 1J6QA 2E2JH 1EIYB 2AMCB 2LXKA 3KDFA 4HIDA 1W3SA 4JI3L 3GTPH 5IWAL 1VQGA 1LYLA 2I5HA 3NEMA 1GD7A 3PUWA 3PUZA 3U4VA 4NPSA 1VQPA 3F2DA 1N36Q 2A1AA 3AFPA 4HJ9A 2VQFL 4JI0L 3KOJA 4QJFA 3UE1A 2MO0A 1P8LA 4EX5A 3CMEA 2ASBA 2BH2A 1JE5A 1RL2A 1IXRA 2B29A 2D0PA 2AWNA 1D8LA 3KYHC 1HZ9A 4LFBQ 1HNWL 1UEBA 4L5SA 2NVYH 1FJGQ 4MTNA 1L1OB 2AHOB 3T1HQ 1NJIC 2ZJQA 1X55A 4UP9A 4A76A 3GTKH 1VQDA 1IBML 3GTGH 1ASZA 5IP7G 1PH2A 4C3HH 3I4MG 4HIMA 3BJUA 2UUCQ 3GO5A 3PF4A 1E3PA 4YWLA 5FLMG 1KQSA 1X9NA 1WCMG 1I94Q 1E7ZA 1Q1EA 4DR7L 1PH9A 4JI5Q 2Z0SA 3CF5A 1X56A 5IP9G 5IP9H 4L5TA 2E5LL 2RF4A 4DV6Q 4QQBX 4DV1Q 4POFA 2AWOA 3CW2C 2K5VA 3L2PA 4JBJA 3H0GG 4JI2Q 3TREA 4A3IG 4DV1L 1VQLA 1WI5A 4BBSG 1S3OA 3HKZE 2MNAA 3HOWG 4JI5L 1N33L 2QA4A 4P75A 3ULLA 2VUMH 1I94L 3K0XA 3CCSA 1X3EA 4A3BH 4MNOA 4BA2I 3KDFB 2UXDQ 1AH9A 1N33Q 5H1SE 1HNZQ 1TWGH 1I6HH 3I4OA 1Q82C 1OXVA 2L15A 1NY4A 2D0OA 3FKIH 1PH6A 1P16A 1MKHA 5JJKA 1K0RA 1SN8A 2BA0A 3F8TA 4IFDI 4DV6L 3T1HL 1IZ6A 2E5LQ 2OWOA 3S17H 3M7NA 4DV7Q 4LFBL 1EFWA 1QUQA 2Q2HA 1Q12A 2XTIA 4P71A 2AKWB 4LF4L 4APVA 1E22A 2IHEA 3J7A5 2WFWA 2HIVA 4C3JH 1KD1C 4B3TL 4DK3C 4TQUS 1VQ7A 3HOXH 3CCLA 2JA8H 4BY7G 4JV5Q 1N36L 1Q7YC 3M4OH 5FLMH 1MJEA 4X64Q 2ES2A 1QVCA 1VQ6A 2YTXA 2GVAA 5M3FG 4LFCL 1SE8A 1K8AC 4LW1A 4GOPC 1IBKQ 4H02A 4IPHA 4IPGA 4KI0A 4NXNQ 2VQFQ 3KF8B 4IPCA 1C7YA 4JOIA 3G4SA 5LMUL 4BXXG 1N32L 2OQKA 1KC8C 3UDIA 4JI7Q 4P73A 4A3JG 1SFOH 4JI3Q 1X65A 2K75A 1WOCA 1OXTA 3KF6A 4YY3L 4X64L 1YITA 3GTQH 4P72A 4DR5Q 3TRZA 4BA1I 1Y1WG 4R4OA 4AYBG 1TWAH 3KJPA 5LMNQ 1XNQQ 2XGTA 1L1OC 3ICEA 3FP9A 1E24A 5AJ3L 3HOYG 3PO3G 1HZBA 3U4ZA 2N49A 2VL6A 4LF4Q 4A93G 4DV3Q 4PG3A 2IT1A 5JEAJ 4DV7L 4XTCS 1O7IA 1K9MC 2E2HH 4QL5A 1ASYA 2BH8A 2F52A 1G291 4A3KH 1SRUA 1V43A 1X54A 2E8GA 2Z6KA 4DUYQ 1PH4A 2NVTH 1S40A 1QVFA 2YV5A 4X65L 1E1OA 1X3GA 2JA5H 2UXDL 1Y14B 3PSIA 2CWPA 4UP7A 3UDFA 4A3MH 4A3MG 4A3DH 5DLQE 2C35B 4DR3Q 2ZM6Q 3W1BA 4YWMA 2HQLA 3A0JA 4OWXB 4O2DA 4PZ6A 2R92G 4A3LH 4LF6L 1N8RC 3CCJA 4LNQA 4A3CG 4A3CH 1VCIA 3PF5A 1M1KC 1VQ9A 5IP7H 2JE6I 2F3IA 1Q8KA 4A3EG 5GQOA 4A3EH 1Y1VH 1KL9A 4DR7Q 3CQZH 3JAMc 4LF9L 2JEAI 1QUQB 2ID0A 4GLXA 1WCMH 3HOUH 2NZHA 2K14A 1KXLA 2JA6H 4DV4Q 4DR4Q 4DV2L 3H15A 3I56A 3S1RH 1VQBA 2WB1E 1IBMQ 4OWTB 4IFDG 3RLOA 2MQHA 4A3IH 2EIFA 1FJGL 1NMFA 4B3SL 1I5FA 1YHAA 1HNWQ 2R93G 1CSQA 1YVCA 3I2ZA 5M3MH 2VUMG 1I3QH 1VS0A 3RLNA 4YCVA 2QEXA 1IBLL 4B3MQ 3S14H 1KIXA 2UUBQ 5IY0A 1IL2A 5EAYA 2N78A 2WAQG 1H95A 1HR0W 3CPWA 5IWAQ 4AQYQ 4C2MH 1YNXA 2BA1A 3JAMi 2I5MX 3HOVG 2K52A 2R7DA 1GM5A 2UU9L 1AE3A 1FL0A 3M85A 2F4VQ 1L1OA 3IRBA 5FJ8G 4YHHQ 3LGJA 4R4IA 4JBKA 3HOXG 1PA6A 2B63H 1TXYA 1BBWA 1E1TA 5GADC 2OQ0A 1IYJB 1TWCH 4IJHA 4AH6A 1PYBA 1RIPA 1W2BA 3GTJH 1M90C 1C0AA 4DR2Q 1QZHA 2OTJA 4BBRG 2ZTCA 1VQFA 3E9HA 1A63A 1TWFH 1YJ9A 2HIXA 3T1YL 1CUKA 4X66L 1XMOL 1K83H 1XNRQ 4L5QA 1PVOA 4JYAQ 2JQOA 1GO3E 4R1JA 3G6EA 4LF7L 1OXUA 2K4KA 3J80c 4BBSH 4JC0A 2IY5B 1EIFA 2KBNA 2N8NA 3TS2A 5GAEC 3GD7A 3CCUA 4DV5Q 4AYBE 2MFIA 4OX9Q 1JJCB 5HGQA 3RN5A 2CWAA 2PNHA 4DR1Q 3RNUA 2VY3A 4AIMA 5JEAG 4X62Q 3A5ZB 2UXCL 1FGUA 5C4XG 1VQ5A 1GVPA 5BR8L 5K36G 2YTVA 1VQHA 1UWVA 2DUDA 3HFZB 3TQYA 3OW2A 3S1QH 4GNXA 4IFDJ 1JJGA 3CPFA 3HKSA 4JI6Q 3HOZG 3I4MH 3HOZH 1KRSA 2PI2E 1PHJA 4UY8C 4DV0Q 1HZCA 2JA8G 3PO2H 4JBMA 3RLFA 4OWWB 3RZOH 2ALYB 1KRTA 2NN6G 1K3RA 1NMGA 2YU9H 5ELNA 1UE6A 4R4CA 2Q2TA 4GKKL 3S15H 4GKJL 3WWVA 3E0EA 1S72A 4JOIC 2Y0SG 3J81c 3S24A 1YJNA 3EN2A 2VNUD 3M4QA 3CD6A 3OYYA 4QIWE 4DNIA 3OTOL 2UUAQ 4BY1H 1QZGA 4LFAL 4NXML 3CCQA 2WP8J
chains in the Genus database with same CATH superfamily
3PGZA 1NSNS 4BBSB 4DK1A 4LFAQ 5C44G 2RDHA 2C9OA 4G57A 1JQYD 4ZUJA 2JA7G 1VQ4A 3S2DH 2K5QA 4N8FA 5EKKA 5JJZA 4IOCA 4K0KQ 5EPKA 4DPGA 4IO9A 3BU2A 2SNSA 1CQVA 2WB1G 1EQQA 5M3MG 2Z6KC 1XX8A 1X3FA 1N34L 4C2MB 2CQOA 3HOWH 2Q8TA 3DWQA 4DR6Q 2KCMA 5DM73 1PH7A 2VQEL 4DAMA 2D62A 4OHJA 2R92H 1Q3LA 3GTMH 4FXGC 4DV5L 1XWEA 2IL8A 3MA2B 1EY8A 1IKLA 2JA6G 2V4DA 5FKAC 2BE5C 1PTOC 1UE5A 4QGUA 1JOOA 2PPBC 3HS0C 4DAPA 3L0OA 2QGQA 3X3MA 1BCPF 2JA7B 1I6VC 1OTCA 3S1MH 3LWEA 4I65A 2KEDA 1W6JA 2F0HA 4RKLA 2IX0A 2HHHQ 1XTCD 3B6YA 1HNXQ 2YYZA 3J7AF 4YWKA 4B08A 2D5DA 3X3NA 1EOVA 1JWMD 1RF2D 3HKZG 3TEHB 4Z9CB 1PFNA 5I4DA 2Q2IA 2F1MA 1EOTA 1X6OA 2WB1B 2MUYA 5EJWA 3J80E 1F9SA 1B70B 3STBD 1RD9D 3PMFA 3KK7A 1KLUD 3HOZB 3CXCA 3CP0A 4B3SQ 1Q90A 2ENBA 3PV0A 4BBRH 4GN3B 3I55A 1KTKA 3MAQA 1Q46A 2JK8A 4LWCA 3GTKB 1QVGA 4RGOS 4XT1B 3J7AV 5IT9L 4H7BA 4GS3A 3FKIG 4KD4A 2ZTDA 3EQLC 3J7YW 5M5XH 4I7AA 4EQNA 4C3JG 4X65Q 1EL0A 3K59A 3M4OB 4NB3A 4A3GG 2N3SA 4QF4A 4KY6A 4HJ5A 2E2IH 2G9HD 1AE2A 1VQMA 2QILA 4RG1A 4KHPL 1NR4A 4O1NA 5C3EG 2CW0D 1K8GA 3BZCA 3RD4A 2F0WA 2GN5A 3EBEA 3K7AH 1XNQL 1EUJA 1TWGB 2UXBL 2GA4B 2WACA 3G48A 1EY6A 4LF8L 1GXDC 1UNSA 3I72A 4GLVB 3T53B 2R7FA 3R2IA 5JEAH 3T13A 1GHKA 5EKIA 1VQIA 2KQ3A 2NN6I 4B3ML 3MZ5A 4TKOB 3UDGA 1EYGA 1JOQA 1XXGA 1GUNA 1BQQT 3NTIA 5GAHC 1V1PA 1EWCA 2VB2X 3ZJYC 3PCOB 5M3FH 1PH1A 3I4LA 3H0GH 4C3IB 4BS9A 4JV5L 3CC7A 5M5WB 1SAPA 4CJ2C 2NYZD 4BXXH 4OO1G 4IURA 3NTKA 5C4JB 1T5XD 1XYIA 3TMEA 1CKMA 3TDQA 1HFGA 1SR3A 1PRTF 5LMNW 1STAA 2MHVA 4K5VA 4KLKA 4RGTA 1I3QB 2VUMB 5BN3A 1DOKA 1A62A 1DGSA 1HNZL 5NUCA 4GN4B 5D65A 3UE0A 4XDXA 4GN5A 2PMZB 2XWBB 3I4NH 2HD3A 2F0IA 1BVSA 2K50A 4QB4A 1DXMA 2JP1A 3BDLA 2KHJA 4TVAB 3M3YB 3RZDB 2MJ8A 4OONA 5KNDA 3RR5A 1L0XB 3GV3A 3STBC 4AYBB 3DM3A 1ILPA 3SGIA 4DV3L 4DR3L 1SNQA 5C6AA 3R8BA 2CKZB 5IOCA 2HT1A 4JCVE 1PLFA 2RDFA 5FJ8H 4DR5L 3K8AA 4HCSA 2PQAB 1UEAB 3Q22A 5I2YA 1VF5C 1F2MA 1KHIA 2EYJA 4A3DB 1TY0A 1SYGA 2PW7A 4NXNL 4KKTA 1SMYC 4JI0Q 4A3GH 2QEJC 1DD2A 2F4VL 1LLRD 3E6ZX 2UU9Q 1YIJA 1LM0A 2E2JH 1EIYB 2AMCB 5IGEA 3VA5A 3PUWA 3SHLA 1N36Q 3QJYA 1DOLA 5DM63 4HJ9A 2EY6A 3KOJA 3K58A 1R4PB 4A3BB 4EX5A 3KYHC 2MPMA 1D8LA 2CQAA 2NVYH 1L1OB 2AHOB 4UP9A 3SVMA 3GTGH 1ASZA 2C5CA 2SNMA 1LTID 2EOTA 2BDOA 4C3HH 1F2LA 5FLMG 3GTLB 4HCEA 1I4GA 1E7ZA 2EJMA 4BY7B 5IP9H 4DV6Q 1WCMB 2PO4A 2KCCA 2XSCA 2K5VA 4JBJA 3H0GG 4JI2Q 4DV1L 5ELBA 1S3OA 3HKZE 2MNAA 3ZYYX 1N33L 1WTWA 4QUCA 3K0XA 1X3EA 4A3BH 1EIHA 4FVMA 1AH9A 1NCVA 5FO8B 1I6HH 3I4OA 1D2BA 3S15B 2D0OA 1MKHA 2BA0A 3F8TA 2F0DA 1EWHA 4DV7Q 4HEDA 3T4AC 2Q2HA 1Q12A 2XTIA 3BYTB 1NUCA 4APVA 1HHVA 2IHEA 3J7A5 2E74C 2HIVA 4PNYA 1KD1C 1QCBD 4TQUS 3HOXH 3CCLA 3EFXD 1H9SA 1A3UA 3QWNA 1A2UA 1N36L 1X3PA 3RUZA 1VQ6A 3HZXA 2NZ1D 2YTXA 1I4XA 2K05A 4LFCL 1SE8A 2DNCA 1K8AC 5C4XB 3OMGA 2PZUA 4K5XA 1LTRD 4CJ0B 1Y69U 4KI0A 2VQFQ 1C7YA 4JOIA 3G4SA 1CA6A 4P73A 1SFOH 1X65A 2K75A 4S3SA 1MSGA 4YY3L 2B2TC 4KN7C 4X64L 3D3RA 4DR5Q 1Y1WG 4R4OA 2K6AA 4IUQA 3TP5A 1TWAH 4AYBG 5CGKA 5JPMC 3GTJB 3J80L 5AJ3L 2E2HB 5M3MB 3D6CA 3L9AX 1TY2A 4XTCS 1O7IA 2WINB 2E2HH 1MGSA 2BH8A 2LFNA 1V43A 1X54A 2AUJD 5L37A 2E8GA 2NVTH 1QE6A 1S40A 1E1OA 1YNJC 2JA5H 2UXDL 3PSIA 5DLQE 2WAQB 3P20A 4YWMA 2RSOA 2R92G 3NPPA 4LF6L 4CGYB 3PF5A 2L12A 2KCNA 5IP7H 2FMCA 4C1NI 5JOBA 2L11A 4A3EH 3DWAA 1W6KA 3JAMc 4LF9L 2G5DA 1SSOA 4CKCA 2F0PA 2K14A 3S1RB 3KLRA 1KXLA 2PZWA 2HCCA 2JXMB 3NE5B 3FMCA 5IGFA 3I56A 3S1RH 2FFKB 1AEXA 1TWCB 3RLOA 2MQHA 2NVQB 1D6EC 4HR7B 1AZPA 1I5FA 1YHAA 4XXEA 1HNWQ 1YVCA 1SDFA 3S17B 3RLNA 4YCVA 3N6RA 1IL2A 2CW0C 5EAYA 1DCZA 1HR0W 5KYLA 3JAMi 2I5MX 3HOVG 5DAUA 2UU9L 1BXTA 1D1IA 1SJHD 1JOKA 3M85A 2L1BA 3IRBA 1G6ZA 4JBKA 3K57A 2E2IB 1BBWA 1RTNA 1E1TA 2OQ0A 2G9DA 3K0YA 1IYJB 3FDTA 1RIPA 1C0AA 3HEJA 2R61A 2K32A 1YJ9A 2HIXA 2EXZA 3R2TA 1PVOA 1KNEA 2JQOA 3G6JB 4LF7L 2F3WA 3F2UA 1EIFA 5CYUA 4EQOA 4DFAA 1QOHA 3TZUA 3CCUA 4AYBE 2MFIA 2I07B 1MI2A 2EJGC 3SK5A 3RN5A 2CWAA 4DR1Q 5JEAG 4KKSA 3K5OA 5C4XG 1VQ5A 1VQHA 3S1QH 4CBVA 4JI6Q 3HOZH 3I4MH 2PI2E 3S1NB 4MIUA 2JA8G 4M8AA 3RLFA 4OWWB 4ZKCB 2L5TA 1UE6A 3FKIB 4RHSA 3ERQA 1SYEA 2H1EA 3MXPA 3BVZA 3J81c 2K03A 2RDGA 3AB9A 4A3EB 1B50A 4DNIA 3S9WA 3EJIA 1PYWD 4G7ZC 3S16H 3E3XA 3OIQA 4BY7H 3SK4A 4A4IA 2I5LX 5K36H 3CCRA 2SEBD 5C0XJ 3S2HB 3GTLH 1FNVA 5KRUA 1XTDA 3BZDB 1PXUA 3P1HA 2UXBQ 1GHJA 2DGYA 3HOYB 4DV0L 2FINB 4B3RL 1RDPD 2EQSA 3KLSA 4P74A 3MFGA 5C3EH 2L0CA 1F2YA 3E5SA 1EFID 1NBWA 1SEBD 4UPAA 4R9WA 4ZLTF 3U58A 4DK6C 4GNXC 4GNXB 1YHBA 1STGA 2XIWA 2YTYA 4F7XA 1ESFA 2NVXH 5C44H 3W5OA 4JK1C 4XYOA 2KUMA 1CKOA 4C56C 3H3VI 2NVXB 3MXGA 1STNA 5E4XA 1IYVA 1B9NA 4CJ1B 4QUFA 5C4ZA 2NBFA 4XQQA 2A8VA 5KYIA 1KDBA 1SNOA 4R4TA 4B3RQ 1CTMA 1A3TA 5ELOA 3AU7A 4ME5A 2WV6D 3HOVH 2XRSD 3IAYA 1I6HB 1Z47A 4MN3A 4NXMQ 1XPOA 2B39A 3VR6A 3OWEB 1JICA 1PYSB 2F3VA 1OXXK 1S4ZA 1LT6D 1NNXA 1JC7A 4RWSC 2SDFA 1PTOB 4K5WA 3HOYH 3OHXC 1TIID 5IYCG 3I7FA 2HCIA 1CZWA 1HZAA 3OTOQ 3S2HH 1U5KA 3NUCA 1EIGA 1UE1A 4L8JA 3QOJA 2A6ED 1KNAA 2HHHL 3R93A 5I6WA 1X3QA 1GUWA 3C3LA 2RHQB 3H3VH 4GLAC 3F2BA 1VQCA 5HGTA 1SNDA 4JI6L 3FPUB 4YIJA 1VQAA 1MJCA 4OELB 1PFBA 3MXNB 4K8IA 3J81E 1AP0A 1XNRL 3A8JE 1XMOQ 3KF8A 1A8VA 3CAMA 1KABA 3CCVA 4PMWA 3DXJC 3M9BA 1VQKA 1C4QA 1HTLD 2H4OA 1UUPA 2LMCB 5IYBH 1JMCA 1KLGD 3MWYW 4LF7Q 1RKNA 3J81i 1CFMA 5I6YA 5CORA 4EVOA 1WD0A 1Y1WH 4FXKC 4WJ4A 2LKVA 5KNBA 3CC4A 1YBYA 4J6HA 1PH5A 3NELA 3DHQA 3OMCA 4J8QA 3J81j 2JA7H 4RGMA 1SE3A 1PFMA 3C46A 2KHIA 3NBHB 4KTAA 4M1UB 4LFCQ 4IUUA 3PIOA 3PIPA 1R9TH 4HTHA 2EY2A 4ZRZA 4DR4L 1NR2A 3GTOB 1YHQA 2K04A 2JN4A 3TZDA 2R92B 3DWPA 5C0XI 3NSWA 1C48A 3DEOA 4HJAA 4XYQA 1H9JA 4HMIA 4PMBA 1WTOA 3KJOA 4BY1G 1O78A 1G6PA 3A74A 3CHBD 2B8GA 1SYDA 3CCMA 1HXYD 2NVQH 2VZAA 5FOBB 5JJLA 1FR3A 5IYCH 1V1OA 2UXCQ 4DUYL 2A74C 3J7ZC 4RCOA 3CCEA 1Q81C 4OL7A 1FVIA 3F1ZA 5C5LA 1CI3M 2PYKA 4U68A 4HIOA 4K14A 2R93H 4QCLA 1L0YB 5JJIA 3KBXA 2ATWA 1GUOA 3BS1A 4FF2A 1I50H 3SK6A 4DR2L 1CHQD 3HOUG 1A6XA 2DJGC 2QDBA 4B9XA 1N32Q 4F88A 1LTBD 3PO3H 1Q86C 1D5MC 4JPBW 1SROA 2LXJA 2J0TD 4UP8A 3PO3B 1SNCA 3KDFA 2F0NA 2B2UA 4HIDA 1W3SA 4PMCA 1MBYA 2I5HA 3PUZA 3U4VA 1VQPA 4NPSA 1Y1WB 1A15A 4C1NK 1LT4D 1EYCA 4QJFA 3BVGA 3UE1A 1WTPA 2MO0A 2ICIA 2ASBA 5EBCA 3T56B 1HZ9A 2PZTA 4LFBQ 4KMUC 3T1HQ 1JR0D 4A76A 1VQDA 1IKMA 5IP7G 2RA4A 2ZXOA 3TBIB 4C3HG 4HIMA 3I4MG 1S5BD 4YWLA 5M3FB 1WCMG 1I94Q 2KECA 3NWTA 3CF5A 2ZT9C 3URYA 2E5LL 3L2PA 4LJZC 3WOEA 4A3IG 3HGBA 1VQLA 1WI5A 4BBSG 1CK1A 5DEHA 4KD3A 3HOWG 5DNFA 1I94L 1SYFA 2O4XA 3CCSA 4BA2I 1SMYD 3K7AB 4MNOA 3HKZB 1HNZQ 1TWGH 1IW7C 5JJKA 1K0RA 4DV6L 2OWOA 2F0SA 4DNRB 1STEA 1DOMA 5C5MA 4LFBL 4HAEA 3OIPA 1BBXC 2AKWB 2WFWA 1S5DD 2O5JC 1VQ7A 2EY1A 1E2WA 5EPLA 1R4QB 4WRDA 4BY7G 1ILQA 4JV5Q 1AW7A 4PV1C 2GVAA 2KVMA 5M3FG 4GOPC 1Y1VB 3G7LA 3A55A 2XNAC 4H02A 2K7VA 4IPHA 3EVQA 1SFOB 4IPCA 2B2VC 1EY9A 3QR8A 4BXXG 2OQKA 1KC8C 5A35A 5C4HA 1GOZA 2F0OA 3DEPA 3H94A 5G3LD 1G2SA 4TSSA 3TRZA 3VYUA 4BA1I 5IIFA 1WTVA 4V190 3KJPA 2XGTA 1L1OC 2K01A 4OEMB 1O7LA 3PO3G 1CT1D 3U4ZA 3LNNA 4LF4Q 4PG3A 3HP3A 5K5PA 2F0MA 4A3KH 1SRUA 2HDLA 1A2TA 2Z6KA 4CKBA 2EY5A 1PH4A 4H0LC 3NK9A 4X65L 1X3GA 3VR3A 1Y14B 3QG1A 2CWPA 2EVBA 3UDFA 4CDCC 4A3MH 2LY7A 4A3DH 4DR3Q 3A0JA 4OWXB 4PZ6A 4A3CH 4DN4M 1M1KC 2JE6I 1SE2A 2K28A 5GQOA 1KL9A 4C3IG 3CQZH 4GLXA 1SXTA 1WCMH 2DNEA 2EE1A 3J81L 4DR4Q 2IWHA 2RSNA 3T16A 3SR1A 4IFDG 4OIKA 2EIFA 4CDFC 1NMFA 4A3IH 4B3SL 1AFPA 1CSQA 3GTGB 1B53A 2PQEA 3I2ZA 2VUMG 1I3QH 1IBLL 3ONAB 1EYAA 5M9OA 2WAQG 4FO2A 1ZYRD 5IWAQ 1AZQA 3K5LA 2K52A 1QB5D 2R7DA 4WORA 1ENAA 1L1OA 5COYA 4YHHQ 4CHTB 3BDOA 1PA6A 3U9SA 1VF7A 1HQRD 3H6MA 1F2ZA 5FLXL 3TN2A 1M90C 4X3TA 4KK7A 2OTJA 4LAAA 1PMRA 4HMJA 4BBRG 2ZTCA 1VQFA 1U4RA 1A63A 3PIO3 3PIP3 2RQXA 1XNRQ 3HOXB 2F0JA 1RODA 4JYAQ 1F9QA 1GO3E 3LWUA 2K4KA 4JC0A 2KBNA 2Z1CA 2BOSA 3NTHA 4DV5Q 3R3OA 4OX9Q 3KLSX 1FNWA 4KN4C 1JE4A 4X62Q 2UXCL 3A5ZB 5JVG3 1BCPD 1EU4A 3VR4A 1UWVA 1SE4A 1GJXA 5ELFA 1MSHA 4IUNA 3HOZG 1KRSA 4FF1A 1K3BC 4C3JB 1LTAD 1HZCA 4JBMA 4J1MA 3TP6A 1HUNA 2ALYB 1O7ZA 2HUGA 1KRTA 1K3RA 2YU9H 1V1PB 3JAML 4GKKL 3WWVA 5CBAE 1S72A 3S24A 3BG3A 2B8FA 2F0LA 4QIWE 4BY1H 1QZGA 1I50B 4LFAL 4NXML 3CCQA 2FHTA 3T51B 4DGZA 1BO0A 4PZ7A 2L9HA 1MD2D 1B8AA 1FD7D 4DAYA 1KAWA 4ALPA 4POGA 4ILWA 1G8ZD 1XMQQ 3K80C 3PO2B 3W1GA 1Q8IA 1PTOF 4KKUA 5IT9c 2OTLA 4RHRA 2EYFA 2AQ2B 1HJPA 2B2WA 4HIKA 4JI8Q 4FF4A 4A3FH 1VQJA 4U673 3DLLA 4MHEA 1WTHA 4OXPA 4HSVA 1SJED 4A3BG 1HA6A 2CHBD 3EIVA 5BR8Q 1Z9FA 2N55A 4IPDA 3ND8A 4DK0A 4QIWB 2NVTB 4X62L 1I4QA 3W3AA 4LF5L 3D8GA 2Z6BA 3F2CA 4OX9L 2PQAA 4J15A 5CV4A 3I4NG 4E6IA 2M2LA 1ZEQX 4JYAL 4IFDH 1B2TA 1B3QA 2X69A 1TWHH 1YJWA 1J5EL 2JA6B 5FO7B 4DR6L 3QB3A 4GOPA 3HOUB 5D3DA 4X6AH 3NBIA 3GTMB 1FYCA 5IE8A 1JJ2A 4ODGA 4A3KG 4GZYC 1NAPA 1HPCA 2R6GA 4DKAC 4YHHL 4YCWA 1HR0L 5IYDH 2GVBA 5EGTA 4WJ3M 4HN7A 1XJVA 2E2JB 1XPRA 2ZTEA 3HOWB 4JI1L 1JCKB 1C8CA 3D31A 3H0GB 4C3IH 3S1NH 1BCPC 1WD1A 1BBUA 1IBLQ 3PO2G 2KEEA 2F0EA 3M4PA 3I70A 1LO5D 2OF1A 3VR5A 1BCPB 1HTPA 1LABA 2IX3A 4PZ8A 2F0GA 2DY8A 2ZXPA 2MGSA 2X6LA 1N9WA 4DV2Q 2VS1A 3KFUA 2EDGA 1BF4A 4GKJQ 4GKKQ 2FJ2A 3FRPB 4F87A 5C0XG 4JI4Q 2B63G 1DZ1A 1SNMA 3G71A 2HDMA 1K0SA 3RZDH 3VR2A 2NTTA 3SDZA 5J22A 2E76C 4DUZL 1VMCA 1E2VA 1V8QA 2JJQA 1GUSA 2R7ZH 4A3LH 3BZKA 1V9PA 5CBEE 3OWFA 4HJ7A 5FK9C 2RKSA 2PI2A 1CKNA 1TS2A 5ELEA 5IYBG 5ISRA 1U0LA 3HOVB 4JW0A 2Q2UA 3D0FA 3VYRA 3E9IA 1STHA 5KNCA 3RN2A 1GUGA 3IFTA 5M5WH 2E75C 1S5ED 5GAGC 3FHWA 1T5EA 4IUTA 1PZID 5LMUQ 2ZJRA 2RHSB 4IJLA 2A68D 1D1KA 3BVMA 2IX1A 1M8AA 4IOAA 2D9UA 2B63B 1YZ6A 2A6EC 1PH8A 1WYDA 4NMZA 3Q24A 2K5HA 1CKNB 2EYPA 4G4KA 2CCZA 3QO2A 4OO1H 3KUPA 5LL6X 2PMZE 3PUXA 3FVQA 1UE7A 3EA6A 3P75A 1J9OA 1ZKOA 4XQNA 2XRQD 2WKCA 1T9HA 4R8NA 3E0JA 4Y52H 3M3YH 3PUVA 4DV4L 4YCUA 2LS01 3N52A 1PTOH 4LUVA 3KF6B 4DXGA 1G2TA 5C3WA 2O2LD 2BDNA 1O7YA 1HH2P 2F0FA 2XN9C 3GTQB 1SLJA 1LTTD 1BR9A 1EY0A 4UHVA 4L63B 3IFDA 5J3BA 2OXPA 2B2UC 2TSSA 1EY5A 2NWGA 1B3AA 2FXQA 2NVYB 5IYDG 1EWIA 5HY6A 4LUOA 2KCTA 5FLXc 5C4XH 3SEBA 1BNZA 3MXUA 4RMFA 4YY3Q 1B7YB 1FGBD 2FMMA 1PFSA 1A0IA 4KHZA 3K5MA 3M7GA 4L5RC 2ZXRA 2E2DC 1J6QA 3GTPH 1GUTA 1VQGA 1LYLA 1YNND 3NEMA 2P5ZX 1LTGD 1STYA 3F2DA 2CH4W 1B44D 5C3XA 5BN5A 1P8LA 3CMEA 1ZXTA 4A3JB 1JE5A 2QF7A 1IXRA 2B29A 2D0PA 2QKIC 4RFBA 4DU9A 1HNWL 1HQMC 1UEBA 2AUKA 3GV6A 2ZJQA 1X55A 5J39A 2EJFC 1PH2A 3S1MB 3VYTA 2UUCQ 3GO5A 1E3PA 1WVLA 1KQSA 1X9NA 2PCFB 3FEWX 2A6HC 1PH9A 4JI5Q 5BN4A 5CMDA 1EQTA 5IP9G 2B2YC 4L5TA 4F8MA 2RF4A 4QQBX 1PRTD 4DV1Q 1TVXA 4POFA 1B1ZA 4G7OC 1F9RA 3TREA 4UAIA 1HCZA 2A68C 4JI5L 2N88A 2VUMH 3ULLA 2UXDQ 4LMQD 3EROA 5H1SE 2RCFA 5I9PA 1HRJA 2AQ1B 3O13A 2IW3A 2L15A 3FKIH 1NY4A 1QILA 1PH6A 1O80A 1P16A 2R3ZA 3BDCA 1SN8A 1IZ6A 2E5LQ 3S17H 3M7NA 5IGCA 5D3IB 4P71A 3NHHA 3W2DA 4A3KB 1E22A 3I73A 1DONA 3M4YA 4B3TL 2B2WC 2JA8H 2EYLA 5FLMH 2ES2A 4X64Q 3S1QB 1QVCA 1ET6A 1BOSA 2RVLA 3S2DB 4LW1A 3A8KE 4IPGA 4NXNQ 3KF8B 3OPOA 2JYOA 3UDIA 4JI7Q 1JB3A 5JAVA 4JI3Q 1Y8NB 3NBHA 1WOCA 1OXTA 2NUCA 3ITPA 3KF6A 2JA5B 1YITA 3GTQH 4KV6A 1I4HA 2A73B 5LMNQ 1U9RA 5CV6A 3A54A 3ICEA 4X3UA 1HZBA 4DV3Q 5CV7A 4DV7L 3A7LA 5IGBA 4QL5A 3NXWA 4L6TB 4I7ZC 1SNPA 1QVFA 2YV5A 2XWJB 4UP7A 1IL8A 4A3MG 3IKJA 3W1BA 2HQLA 2BE5D 3NP8A 4R8IA 4K6DA 1YNNC 1N8RC 3CCJA 1VQ9A 1DYQA 4Q5VA 1IW7D 1E2ZA 4A3EG 2R93B 1LV9A 3V05A 3D4RA 4N9PA 2EYMA 2JEAI 1QUQB 2ID0A 2NZHA 4P2CB 4NDXA 3TP8A 1M4VA 4WJWA 1ICFB 2WB1E 4OWTB 2JA8B 1ONLA 1JORA 3CKIB 3H09A 2A6HD 4BY1B 3BYYB 4CKEA 1VS0A 1HFNA 2QEXA 1H9MA 4B3MQ 3S14H 1KIXA 2A5HA 2UUBQ 2NTSA 2N78A 1H95A 1D5XC 2KHSA 2B2YA 3IL8A 3CU7A 2QCPX 2BA1A 1GM5A 5HURA 1AE3A 1QG7A 2F4VQ 2A69C 1JWSD 2O5IC 4FYDA 5E4WC 1TXYA 2R7ZB 4AH6A 1W2BA 3GTJH 1KDAA 5CV5A 3I8ZA 4Y7NB 3MHBA 4G7HC 1TR5A 3E9HA 1TWFH 3T1YL 4X66L 1K83H 4L5QA 4R1JA 1OXUA 5I9OA 3GD7A 5I2XA 5HGQA 3C1FA 2VY3A 4AIMA 3SXHA 4IUPA 3D4DA 1GVPA 5K36G 2YTVA 1PRTB 2DUDA 3HFZB 1JJGA 3OW2A 1WTRA 2QDLA 1PTOD 4K8JA 3CPFA 2VB3X 3I90A 4UY8C 4DV0Q 3PO2H 5LL6S 3RZOH 1TU2B 1WTXA 2IPKD 2NN6H 4RH6A 1DJRD 1NMGA 5ELNA 2XVSA 4R4CA 2Q2TA 3S15H 4WFN3 4IUVA 2B2VA 2Y0SG 2VNUD 3EN2A 2K1BA 3M4QA 1F9PA 3OYYA 3OTOL 3SE0A 2WP8J 5LHY1 3OSOA 4A3IB 2RBMA 2AQ3B 2HQEA 2SOBA 5IGGA 1HR0Q 3L7ZC 4JG2A 1EQVA 1YI2A 4ULLA 5EQ0A 2OCEA 1HNXL 2EXDA 2Q8RE 4DXFA 4LF8Q 1KDCA 1LUZA 1VQEA 5T1IA 3Q8DA 4C3HB 4ZCKA 3AFQA 1V1QA 4A93B 3AYHB 1RTOA 3V2TA 3I4NB 3U50C 1LTLA 3VDYA 5F2DA 1EYDA 4ZK9B 1TWAB 2Z4HA 5TSSA 3CRKC 3QOLA 4A3FG 1L2FA 4OO1I 3J80i 1QJOA 1VQNA 4JBWA 4KHPQ 4UDUC 3HG9A 1BDOA 2NZOA 5JPNC 1PRTC 2KA7A 3DM1A 5C4JH 1I4RA 1Y8PB 2VQEQ 4A3FB 1HUMA 5D14A 1X32A 2V1CC 2PW5A 1I4PA 1G51A 4QMGA 5T1GA 4DUZQ 5EBDA 4A75A 3NENA 1GKHA 1Q1BA 4BWGB 2A69D 1N34Q 3T1YQ 4JI4L 4OGQC 2JEBI 3ERSX 3ULJA 3NQTA 4LUZA 2TMPA 1MIUA 1L0WA 1U4PA 5C44B 4K0KL 5M5YB 4EQPA 1XMQL 2F0KA 4HJ8A 1S5FD 3K6OA 4EQ5A 4FF3A 2I46A 3TSSA 1TQOA 3K7UC 2Y0SB 1ESRA 3D4WA 3TP7A 3NWSA 1JWUD 2J4XA 3PUYA 3MC0B 3ND9A 5IGDA 1A3VA 4JI1Q 1STBA 2NB0A 2WKDA 2H5XA 2F0TA 3CMAA 1CSPA 1LT3D 1SMXA 2Z8LA 5IODA 5E7NA 2KENA 3I3CA 4FP5D 2RCNA 1VQ8A 3CQZB 3GQBA 2A19A 1VDZA 4RKBA 4DA2A 4NKLA 3VA7A 3KBGA 3TS0A 2DJFC 1EQRA 4LF9Q 4X3SA 4ZUIA 1J5EQ 5M5YH 4DAYB 2F0UA 1PZKD 4EGVA 4K2LA 4O42A 3JC66 3K81C 4BBRB 5JVH3 1RHPA 5CV8A 2B3GA 1YEZA 1B4OA 1K73C 4DF7A 1RCVD 4DAVA 1WJJA 2F03A 1WTQA 4LF5Q 4DR1L 2R7ZG 4A3LG 1EY4A 1II3A 3H3VC 1ENFA 2F0VA 1QNKA 3HRZC 4A3DG 3KLWA 2KOLA 5AJ3Q 4JI8L 2IHFA 2MO1A 1BKBA 4QY7A 1FNUA 4X66Q 1TT2A 5LMNL 1XPUA 5GROA 1WFQA 3WDNA 3ULPA 2WAQE 1CQFA 4ZQ3A 4AQYL 4A93H 1SYBA 3PQIA 2Q8IB 4JI7L 4TRDA 1RJTA 3GDEA 3NQIA 1R9TB 4B9WA 1EEFD 4KJOA 4K2KA 1TWHB 1KAAA 2UUAL 2F0QA 3ER0A 1CA5A 2K5NA 2UUBL 1EZ8A 3MTSA 4GOPB 4MZ9A 4B3TQ 3GP7A 3CRLC 4R4QA 3C2PA 1JB7A 5FO9B 3A5UA 1OO9B 4A3JH 4KJNA 2CFMA 4H13C 3MEFA 2ZM6L 3GTPB 3A7AB 1D7QA 1YNJD 1TS5A 4O0AA 3AEVA 5KIXA 2Y0SE 1JT8A 5FLXE 3UDXA 2ZJPA 1B9MA 4JI2L 1MHWC 1C9OA 4LF6Q 4K6LA 1K28A 5A2QE 2JA5G 2X6GA 2I0QA 2K5WA 1PH3A 3GTOH 1E0BA 2UUCL 1NE3A 1PV4A 1OXSC 4FDBA 4FNFA 2VW9A 5ELCA 1Z6HA 1Y1VG 4ZAIA 4XIGS 1F77A 5EKLA 4Y7NH 5C3EB 1VQOA 1TS4A 4ME3A 4X3KA 3K5NA 2YU9B 3AQQA 1TS3A 1NTGA 3LX0A 2JA9A 3CC2A 1IBKL 2LSSA 4IZ8A 2F4IA 2LXKA 2VXWA 4JI3L 2MP1A 3UI2A 5IWAL 1GD7A 2A1AA 3AFPA 2VQFL 1HA5A 4JI0L 1H9RA 2BCOA 2BH2A 2J7ZA 3L3OC 1RL2A 2KJXA 2AWNA 3Q0AA 4RAUC 1EU3A 4L5SA 1FJGQ 4MTNA 1NJIC 4XT3B 3GTKH 1IBML 4V0BA 1CHPD 1Y8OB 3BJUA 3PF4A 4RA8A 2DN8A 1J8IA 2EYOA 5G3LF 4LK1C 1Q1EA 4DR7L 1Z7TA 2Z0SA 4Q0FA 1X56A 2ICEC 5EPJA 3RZOB 2AWOA 3CW2C 1QNUA 3MVVA 1IYUA 1BUVT 1ZYRC 3I4MB 2EYHA 2QA4A 4P75A 3KDFB 1N33Q 2K5DA 1H9SB 1Q82C 1OXVA 5KEEA 4IFDI 3T1HL 2WIIB 1EFWA 3U9OA 1QUQA 4LF4L 4C3JH 4PQXA 4DK3C 1IHZA 3RMHA 1LT5D 4FXDA 5CC4A 4IN3A 4CDDC 1Q7YC 3M4OH 1MJEA 3OOCA 5CV9A 1U4MA 1ET9A 1IBKQ 3VYSA 4ZYSA 2L4NA 2CH4A 1N32L 5LMUL 2OEOA 2QW7A 4A3JG 1K8OA 5KGUA 2D2CC 4H44C 3DUZA 1U4LA 4P72A 3MXNA 5E1FA 4N8X1 2Z4IA 1S5CD 1XNQQ 2DY7A 3FP9A 1E24A 3HOYG 4A93G 2N49A 2VL6A 2IT1A 5JEAJ 3DMUA 4MTKA 1K9MC 1ASYA 1QWYA 2F52A 1G291 2M00A 3A8IE 4DUYQ 3P7JA 5CR3A 2OT2A 2C35B 1CZGA 2ZM6Q 4O2DA 2EPBA 4IALA 4LNQA 1LTSD 4A3CG 5C0XH 1VCIA 3QIAA 4ZKBB 2F3IA 1Q8KA 1AN8A 1D5ZC 1Y1VH 4DR7Q 1K83B 3HOUH 1TWFB 4ABNA 1DM0B 2JA6H 4DV4Q 1LACA 3C1EA 4DV2L 3H15A 1VQBA 4RGNA 1IBMQ 4N9TA 1FJGL 3S16B 4KY7A 4CDEC 2R93G 4NP5A 5M3MH 2M9VA 3FPPA 1VMPA 3I91A 3OW7A 3JAME 1UAPA 5IY0A 3AMUA 4HSPA 1SYCA 4XQJA 5IT9E 3CPWA 4A3MB 4AQYQ 4C2MH 1YNXA 4KY5A 3S14B 5ELDA 1CM9A 1FL0A 3MFYA 1PZJD 3Q6SA 5FJ8G 3LGJA 4R4IA 3HOXG 2B63H 4IQZA 2Z9HA 3WOFA 2JSOA 3H91A 4KHVA 3SK8A 5GADC 4A3GB 1SBBB 1TWCH 4IJHA 1EEID 1PYBA 3Q23A 1H9KA 4DR2Q 1QZHA 3MEHA 2PNRC 2EZVA 3A56A 1CUKA 1EZ6A 1ML0D 2IJ0A 1XMOL 3G6EA 4BBSH 3J80c 5E3FA 2N8NA 2IY5B 3TS2A 5GAEC 1ICWA 1JJCB 2PNHA 1K8MA 3RNUA 1FGUA 4ID6A 5BR8L 4OIJA 3TQYA 5AFWA 4IFDJ 4GNXA 4JVZA 2K33A 1TKWB 5J1ZA 3HKSA 1PHJA 2CVRA 2B2TA 4RCNA 2NN6G 5A2QL 4DNTB 4GKJL 5M5XB 3D6WA 1EY7A 3E0EA 1G91A 4JOIC 1YJNA 4NW2A 3CD6A 1ENCA 2L55A 2UUAQ 3V96A 1PDQA
chains in the Genus database with same CATH topology
3PGZA 4LFAQ 3S16H 4PZ7A 5C44G 1HR0Q 3L7ZC 4JG2A 1B8AA 1YI2A 1KAWA 4ALPA 4BY7H 2JA7G 2OCEA 4POGA 1HNXL 1VQ4A 3S2DH 4A4IA 2EXDA 2I5LX 4LF8Q 3CCRA 1XMQQ 3K80C 4IOCA 4K0KQ 1LUZA 4DPGA 3W1GA 1VQEA 5C0XJ 3GTLH 1XTDA 4IO9A 3BU2A 3Q8DA 5IT9c 2OTLA 2WB1G 3AFQA 2UXBQ 1EQQA 1V1QA 5M3MG 3AYHB 2DGYA 2Z6KC 3U50C 1X3FA 1LTLA 1HJPA 4DV0L 1N34L 3VDYA 4B3RL 4HIKA 4JI8Q 2EQSA 4P74A 4A3FH 2CQOA 4A3FG 3HOWH 1VQJA 4OO1I 1L2FA 5C3EH 3DLLA 3J80i 1VQNA 4JBWA 4OXPA 4A3BG 4KHPQ 2NZOA 3EIVA 5BR8Q 4DR6Q 1Z9FA 4IPDA 2KCMA 1NBWA 4X62L 5C4JH 2VQEQ 1PH7A 2VQEL 4UPAA 4DAMA 2D62A 4LF5L 2R92H 3F2CA 2V1CC 3U58A 4OX9L 2PQAA 1G51A 4DK6C 4J15A 4DUZQ 4DV5L 3GTMH 3I4NG 4GNXC 4GNXB 1YHBA 2YTYA 2JA6G 4A75A 3NENA 2NVXH 1UE5A 4QGUA 3W5OA 5C44H 4JYAL 1GKHA 1Q1BA 1N34Q 3T1YQ 3L0OA 2QGQA 4JI4L 1CKOA 2JEBI 3H3VI 1YJWA 1TWHH 1J5EL 3ERSX 3ULJA 4DR6L 4LUZA 1OTCA 3S1MH 1MIUA 4GOPA 1L0WA 4X6AH 2HHHQ 2IX0A 2A8VA 5IE8A 4K0KL 1XMQL 1JJ2A 4A3KG 4HJ8A 3B6YA 1HNXQ 2YYZA 4R4TA 2R6GA 4B3RQ 4EQ5A 4YWKA 4DKAC 4YHHL 4YCWA 1HR0L 5IYDH 5ELOA 2GVBA 3K7UC 3HOVH 1EOVA 4WJ3M 1Z47A 3HKZG 1XPOA 3TEHB 4NXMQ 1XJVA 3PUYA 1PYSB 2Q2IA 1XPRA 1OXXK 2ZTEA 1X6OA 4JI1L 4JI1Q 1B70B 3D31A 4C3IH 3STBD 3S1NH 3HOYH 3PO2G 1BBUA 1IBLQ 2H5XA 3M4PA 3CMAA 5IYCG 3CXCA 3I7FA 1CSPA 3CP0A 1SMXA 4B3SQ 1HZAA 5E7NA 3OTOQ 4PZ8A 3S2HH 2KENA 1U5KA 3PV0A 2RCNA 1UE1A 1VQ8A 1N9WA 4BBRH 4DV2Q 2A19A 2VS1A 4GN3B 3KFUA 3I55A 4GKJQ 1Q46A 2JK8A 4GKKQ 4LWCA 2HHHL 3TS0A 1QVGA 1EQRA 4LF9Q 2RHQB 3H3VH 4GLAC 3F2BA 1J5EQ 5M5YH 4DAYB 5C0XG 4JI4Q 2B63G 4GS3A 3FKIG 1VQCA 3G71A 4JI6L 3RZDH 2ZTDA 3JC66 3K81C 1VQAA 1MJCA 5M5XH 2B3GA 1YEZA 3MXNB 1K73C 4DUZL 4X65Q 1XNRL 1WJJA 4NB3A 1XMOQ 4A3GG 2JJQA 2N3SA 4LF5Q 4HJ5A 4DR1L 1A8VA 2E2IH 3BZKA 1AE2A 3CAMA 1V9PA 1VQMA 2R7ZH 2R7ZG 4A3LG 3CCVA 4HJ7A 4PMWA 4RG1A 3M9BA 2PI2A 1CKNA 1VQKA 4KHPL 5IYBH 4A3DG 5IYBG 1JMCA 5C3EG 1K8GA 1U0LA 3KLWA 4LF7Q 2Q2UA 5AJ3Q 4JI8L 2IHFA 2MO1A 3D0FA 1BKBA 2GN5A 3BZCA 3EBEA 3E9IA 3K7AH 4QY7A 4X66Q 3J81i 5LMNL 1XNQL 1XPUA 1EUJA 4WJ4A 1Y1WH 5GROA 1WFQA 2UXBL 3RN2A 3ULPA 2WAQE 3CC4A 1YBYA 5M5WH 4AQYL 4A93H 3G48A 5GAGC 3FHWA 4LF8L 1PH5A 4JI7L 3NELA 4GLVB 3GDEA 2R7FA 3J81j 2JA7H 5LMUQ 2ZJRA 1VQIA 2RHSB 2NN6I 4IJLA 4B3ML 3UDGA 1EYGA 5GAHC 2KHIA 3NBHB 3ZJYC 2IX1A 3PCOB 4LFCQ 5M3FH 1PH1A 2UUAL 3PIOA 3PIPA 4IOAA 1R9TH 1YZ6A 3ER0A 3H0GH 1PH8A 1WYDA 4JV5L 2K5NA 4DR4L 3CC7A 2UUBL 2K5HA 1YHQA 4GOPB 4MZ9A 1CKNB 4B3TQ 4BXXH 4R4QA 2CCZA 5C0XI 1JB7A 4OO1G 3A5UA 2PMZE 3PUXA 4A3JH 1UE7A 4HJAA 1CKMA 1SR3A 1T9HA 2CFMA 5LMNW 4KLKA 3KJOA 4BY1G 4Y52H 3M3YH 1A62A 1G6PA 3PUVA 1DGSA 4YCUA 4DV4L 3A74A 3MEFA 1HNZL 4GN4B 2ZM6L 1D7QA 3UE0A 4O0AA 4LUVA 3CCMA 3KF6B 4GN5A 2VZAA 2Y0SE 2NVQH 2K50A 3AEVA 1BVSA 5IYCH 3I4NH 5JJLA 1JT8A 3UDXA 2ZJPA 2UXCQ 2KHJA 4TVAB 4DUYL 1HH2P 3J7ZC 4JI2L 1SLJA 1C9OA 3CCEA 4LF6Q 4OONA 1Q81C 3RR5A 1FVIA 3F1ZA 3STBC 5J3BA 3DM3A 3SGIA 4DV3L 4HIOA 4DR3L 2R93H 2JA5G 2I0QA 2CKZB 2HT1A 1PH3A 5JJIA 4JCVE 3GTOH 2FXQA 2UUCL 2ATWA 1NE3A 5IYDG 1EWIA 5HY6A 1PV4A 4LUOA 1I50H 2KCTA 5FJ8H 4DR5L 1OXSC 3K8AA 4FDBA 5C4XH 5FLXc 4DR2L 4YY3Q 4RMFA 2VW9A 1B7YB 2PQAB 3HOUG 1Y1VG 4XIGS 4Y7NH 1VQOA 1PFSA 1A0IA 4KHZA 1KHIA 4ME3A 1N32Q 4NXNL 3AQQA 4JI0Q 4A3GH 1NTGA 3PO3H 2F4VL 4L5RC 3CC2A 2JA9A 1Q86C 1IBKL 2LSSA 1SROA 2LXJA 2UU9Q 4UP8A 1YIJA 1LM0A 1J6QA 2E2JH 1EIYB 2AMCB 2LXKA 3KDFA 4HIDA 1W3SA 4JI3L 3GTPH 5IWAL 1VQGA 1LYLA 2I5HA 3NEMA 1GD7A 3PUWA 3PUZA 3U4VA 4NPSA 1VQPA 3F2DA 1N36Q 2A1AA 3AFPA 4HJ9A 2VQFL 4JI0L 3KOJA 4QJFA 3UE1A 2MO0A 1P8LA 4EX5A 3CMEA 2ASBA 2BH2A 1JE5A 1RL2A 1IXRA 2B29A 2D0PA 2AWNA 1D8LA 3KYHC 1HZ9A 4LFBQ 1HNWL 1UEBA 4L5SA 2NVYH 1FJGQ 4MTNA 1L1OB 2AHOB 3T1HQ 1NJIC 2ZJQA 1X55A 4UP9A 4A76A 3GTKH 1VQDA 1IBML 3GTGH 1ASZA 5IP7G 1PH2A 4C3HH 3I4MG 4HIMA 3BJUA 2UUCQ 3GO5A 3PF4A 1E3PA 4YWLA 5FLMG 1KQSA 1X9NA 1WCMG 1I94Q 1E7ZA 1Q1EA 4DR7L 1PH9A 4JI5Q 2Z0SA 3CF5A 1X56A 5IP9G 5IP9H 4L5TA 2E5LL 2RF4A 4DV6Q 4QQBX 4DV1Q 4POFA 2AWOA 3CW2C 2K5VA 3L2PA 4JBJA 3H0GG 4JI2Q 3TREA 4A3IG 4DV1L 1VQLA 1WI5A 4BBSG 1S3OA 3HKZE 2MNAA 3HOWG 4JI5L 1N33L 2QA4A 4P75A 3ULLA 2VUMH 1I94L 3K0XA 3CCSA 1X3EA 4A3BH 4MNOA 4BA2I 3KDFB 2UXDQ 1AH9A 1N33Q 5H1SE 1HNZQ 1TWGH 1I6HH 3I4OA 1Q82C 1OXVA 2L15A 1NY4A 2D0OA 3FKIH 1PH6A 1P16A 1MKHA 5JJKA 1K0RA 1SN8A 2BA0A 3F8TA 4IFDI 4DV6L 3T1HL 1IZ6A 2E5LQ 2OWOA 3S17H 3M7NA 4DV7Q 4LFBL 1EFWA 1QUQA 2Q2HA 1Q12A 2XTIA 4P71A 2AKWB 4LF4L 4APVA 1E22A 2IHEA 3J7A5 2WFWA 2HIVA 4C3JH 1KD1C 4B3TL 4DK3C 4TQUS 1VQ7A 3HOXH 3CCLA 2JA8H 4BY7G 4JV5Q 1N36L 1Q7YC 3M4OH 5FLMH 1MJEA 4X64Q 2ES2A 1QVCA 1VQ6A 2YTXA 2GVAA 5M3FG 4LFCL 1SE8A 1K8AC 4LW1A 4GOPC 1IBKQ 4H02A 4IPHA 4IPGA 4KI0A 4NXNQ 2VQFQ 3KF8B 4IPCA 1C7YA 4JOIA 3G4SA 5LMUL 4BXXG 1N32L 2OQKA 1KC8C 3UDIA 4JI7Q 4P73A 4A3JG 1SFOH 4JI3Q 1X65A 2K75A 1WOCA 1OXTA 3KF6A 4YY3L 4X64L 1YITA 3GTQH 4P72A 4DR5Q 3TRZA 4BA1I 1Y1WG 4R4OA 4AYBG 1TWAH 3KJPA 5LMNQ 1XNQQ 2XGTA 1L1OC 3ICEA 3FP9A 1E24A 5AJ3L 3HOYG 3PO3G 1HZBA 3U4ZA 2N49A 2VL6A 4LF4Q 4A93G 4DV3Q 4PG3A 2IT1A 5JEAJ 4DV7L 4XTCS 1O7IA 1K9MC 2E2HH 4QL5A 1ASYA 2BH8A 2F52A 1G291 4A3KH 1SRUA 1V43A 1X54A 2E8GA 2Z6KA 4DUYQ 1PH4A 2NVTH 1S40A 1QVFA 2YV5A 4X65L 1E1OA 1X3GA 2JA5H 2UXDL 1Y14B 3PSIA 2CWPA 4UP7A 3UDFA 4A3MH 4A3MG 4A3DH 5DLQE 2C35B 4DR3Q 2ZM6Q 3W1BA 4YWMA 2HQLA 3A0JA 4OWXB 4O2DA 4PZ6A 2R92G 4A3LH 4LF6L 1N8RC 3CCJA 4LNQA 4A3CG 4A3CH 1VCIA 3PF5A 1M1KC 1VQ9A 5IP7H 2JE6I 2F3IA 1Q8KA 4A3EG 5GQOA 4A3EH 1Y1VH 1KL9A 4DR7Q 3CQZH 3JAMc 4LF9L 2JEAI 1QUQB 2ID0A 4GLXA 1WCMH 3HOUH 2NZHA 2K14A 1KXLA 2JA6H 4DV4Q 4DR4Q 4DV2L 3H15A 3I56A 3S1RH 1VQBA 2WB1E 1IBMQ 4OWTB 4IFDG 3RLOA 2MQHA 4A3IH 2EIFA 1FJGL 1NMFA 4B3SL 1I5FA 1YHAA 1HNWQ 2R93G 1CSQA 1YVCA 3I2ZA 5M3MH 2VUMG 1I3QH 1VS0A 3RLNA 4YCVA 2QEXA 1IBLL 4B3MQ 3S14H 1KIXA 2UUBQ 5IY0A 1IL2A 5EAYA 2N78A 2WAQG 1H95A 1HR0W 3CPWA 5IWAQ 4AQYQ 4C2MH 1YNXA 2BA1A 3JAMi 2I5MX 3HOVG 2K52A 2R7DA 1GM5A 2UU9L 1AE3A 1FL0A 3M85A 2F4VQ 1L1OA 3IRBA 5FJ8G 4YHHQ 3LGJA 4R4IA 4JBKA 3HOXG 1PA6A 2B63H 1TXYA 1BBWA 1E1TA 5GADC 2OQ0A 1IYJB 1TWCH 4IJHA 4AH6A 1PYBA 1RIPA 1W2BA 3GTJH 1M90C 1C0AA 4DR2Q 1QZHA 2OTJA 4BBRG 2ZTCA 1VQFA 3E9HA 1A63A 1TWFH 1YJ9A 2HIXA 3T1YL 1CUKA 4X66L 1XMOL 1K83H 1XNRQ 4L5QA 1PVOA 4JYAQ 2JQOA 1GO3E 4R1JA 3G6EA 4LF7L 1OXUA 2K4KA 3J80c 4BBSH 4JC0A 2IY5B 1EIFA 2KBNA 2N8NA 3TS2A 5GAEC 3GD7A 3CCUA 4DV5Q 4AYBE 2MFIA 4OX9Q 1JJCB 5HGQA 3RN5A 2CWAA 2PNHA 4DR1Q 3RNUA 2VY3A 4AIMA 5JEAG 4X62Q 3A5ZB 2UXCL 1FGUA 5C4XG 1VQ5A 1GVPA 5BR8L 5K36G 2YTVA 1VQHA 1UWVA 2DUDA 3HFZB 3TQYA 3OW2A 3S1QH 4GNXA 4IFDJ 1JJGA 3CPFA 3HKSA 4JI6Q 3HOZG 3I4MH 3HOZH 1KRSA 2PI2E 1PHJA 4UY8C 4DV0Q 1HZCA 2JA8G 3PO2H 4JBMA 3RLFA 4OWWB 3RZOH 2ALYB 1KRTA 2NN6G 1K3RA 1NMGA 2YU9H 5ELNA 1UE6A 4R4CA 2Q2TA 4GKKL 3S15H 4GKJL 3WWVA 3E0EA 1S72A 4JOIC 2Y0SG 3J81c 3S24A 1YJNA 3EN2A 2VNUD 3M4QA 3CD6A 3OYYA 4QIWE 4DNIA 3OTOL 2UUAQ 4BY1H 1QZGA 4LFAL 4NXML 3CCQA 2WP8J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PGZ A;  4LFA Q;  3S16 H;  4PZ7 A;  5C44 G;  1HR0 Q;  3L7Z C;  4JG2 A;  1B8A A;  1YI2 A;  1KAW A;  4ALP A;  4BY7 H;  2JA7 G;  2OCE A;  4POG A;  1HNX L;  1VQ4 A;  3S2D H;  4A4I A;  2EXD A;  2I5L X;  4LF8 Q;  3CCR A;  1XMQ Q;  3K80 C;  4IOC A;  4K0K Q;  1LUZ A;  4DPG A;  3W1G A;  1VQE A;  5C0X J;  3GTL H;  1XTD A;  4IO9 A;  3BU2 A;  3Q8D A;  5IT9 c;  2OTL A;  2WB1 G;  3AFQ A;  2UXB Q;  1EQQ A;  1V1Q A;  5M3M G;  3AYH B;  2DGY A;  2Z6K C;  3U50 C;  1X3F A;  1LTL A;  1HJP A;  4DV0 L;  1N34 L;  3VDY A;  4B3R L;  4HIK A;  4JI8 Q;  2EQS A;  4P74 A;  4A3F H;  2CQO A;  4A3F G;  3HOW H;  1VQJ A;  4OO1 I;  1L2F A;  5C3E H;  3DLL A;  3J80 i;  1VQN A;  4JBW A;  4OXP A;  4A3B G;  4KHP Q;  2NZO A;  3EIV A;  5BR8 Q;  4DR6 Q;  1Z9F A;  4IPD A;  2KCM A;  1NBW A;  4X62 L;  5C4J H;  2VQE Q;  1PH7 A;  2VQE L;  4UPA A;  4DAM A;  2D62 A;  4LF5 L;  2R92 H;  3F2C A;  2V1C C;  3U58 A;  4OX9 L;  2PQA A;  1G51 A;  4DK6 C;  4J15 A;  4DUZ Q;  4DV5 L;  3GTM H;  3I4N G;  4GNX C;  4GNX B;  1YHB A;  2YTY A;  2JA6 G;  4A75 A;  3NEN A;  2NVX H;  1UE5 A;  4QGU A;  3W5O A;  5C44 H;  4JYA L;  1GKH A;  1Q1B A;  1N34 Q;  3T1Y Q;  3L0O A;  2QGQ A;  4JI4 L;  1CKO A;  2JEB I;  3H3V I;  1YJW A;  1TWH H;  1J5E L;  3ERS X;  3ULJ A;  4DR6 L;  4LUZ A;  1OTC A;  3S1M H;  1MIU A;  4GOP A;  1L0W A;  4X6A H;  2HHH Q;  2IX0 A;  2A8V A;  5IE8 A;  4K0K L;  1XMQ L;  1JJ2 A;  4A3K G;  4HJ8 A;  3B6Y A;  1HNX Q;  2YYZ A;  4R4T A;  2R6G A;  4B3R Q;  4EQ5 A;  4YWK A;  4DKA C;  4YHH L;  4YCW A;  1HR0 L;  5IYD H;  5ELO A;  2GVB A;  3K7U C;  3HOV H;  1EOV A;  4WJ3 M;  1Z47 A;  3HKZ G;  1XPO A;  3TEH B;  4NXM Q;  1XJV A;  3PUY A;  1PYS B;  2Q2I A;  1XPR A;  1OXX K;  2ZTE A;  1X6O A;  4JI1 L;  4JI1 Q;  1B70 B;  3D31 A;  4C3I H;  3STB D;  3S1N H;  3HOY H;  3PO2 G;  1BBU A;  1IBL Q;  2H5X A;  3M4P A;  3CMA A;  5IYC G;  3CXC A;  3I7F A;  1CSP A;  3CP0 A;  1SMX A;  4B3S Q;  1HZA A;  5E7N A;  3OTO Q;  4PZ8 A;  3S2H H;  2KEN A;  1U5K A;  3PV0 A;  2RCN A;  1UE1 A;  1VQ8 A;  1N9W A;  4BBR H;  4DV2 Q;  2A19 A;  2VS1 A;  4GN3 B;  3KFU A;  3I55 A;  4GKJ Q;  1Q46 A;  2JK8 A;  4GKK Q;  4LWC A;  2HHH L;  3TS0 A;  1QVG A;  1EQR A;  4LF9 Q;  2RHQ B;  3H3V H;  4GLA C;  3F2B A;  1J5E Q;  5M5Y H;  4DAY B;  5C0X G;  4JI4 Q;  2B63 G;  4GS3 A;  3FKI G;  1VQC A;  3G71 A;  4JI6 L;  3RZD H;  2ZTD A;  3JC6 6;  3K81 C;  1VQA A;  1MJC A;  5M5X H;  2B3G A;  1YEZ A;  3MXN B;  1K73 C;  4DUZ L;  4X65 Q;  1XNR L;  1WJJ A;  4NB3 A;  1XMO Q;  4A3G G;  2JJQ A;  2N3S A;  4LF5 Q;  4HJ5 A;  4DR1 L;  1A8V A;  2E2I H;  3BZK A;  1AE2 A;  3CAM A;  1V9P A;  1VQM A;  2R7Z H;  2R7Z G;  4A3L G;  3CCV A;  4HJ7 A;  4PMW A;  4RG1 A;  3M9B A;  2PI2 A;  1CKN A;  1VQK A;  4KHP L;  5IYB H;  4A3D G;  5IYB G;  1JMC A;  5C3E G;  1K8G A;  1U0L A;  3KLW A;  4LF7 Q;  2Q2U A;  5AJ3 Q;  4JI8 L;  2IHF A;  2MO1 A;  3D0F A;  1BKB A;  2GN5 A;  3BZC A;  3EBE A;  3E9I A;  3K7A H;  4QY7 A;  4X66 Q;  3J81 i;  5LMN L;  1XNQ L;  1XPU A;  1EUJ A;  4WJ4 A;  1Y1W H;  5GRO A;  1WFQ A;  2UXB L;  3RN2 A;  3ULP A;  2WAQ E;  3CC4 A;  1YBY A;  5M5W H;  4AQY L;  4A93 H;  3G48 A;  5GAG C;  3FHW A;  4LF8 L;  1PH5 A;  4JI7 L;  3NEL A;  4GLV B;  3GDE A;  2R7F A;  3J81 j;  2JA7 H;  5LMU Q;  2ZJR A;  1VQI A;  2RHS B;  2NN6 I;  4IJL A;  4B3M L;  3UDG A;  1EYG A;  5GAH C;  2KHI A;  3NBH B;  3ZJY C;  2IX1 A;  3PCO B;  4LFC Q;  5M3F H;  1PH1 A;  2UUA L;  3PIO A;  3PIP A;  4IOA A;  1R9T H;  1YZ6 A;  3ER0 A;  3H0G H;  1PH8 A;  1WYD A;  4JV5 L;  2K5N A;  4DR4 L;  3CC7 A;  2UUB L;  2K5H A;  1YHQ A;  4GOP B;  4MZ9 A;  1CKN B;  4B3T Q;  4BXX H;  4R4Q A;  2CCZ A;  5C0X I;  1JB7 A;  4OO1 G;  3A5U A;  2PMZ E;  3PUX A;  4A3J H;  1UE7 A;  4HJA A;  1CKM A;  1SR3 A;  1T9H A;  2CFM A;  5LMN W;  4KLK A;  3KJO A;  4BY1 G;  4Y52 H;  3M3Y H;  1A62 A;  1G6P A;  3PUV A;  1DGS A;  4YCU A;  4DV4 L;  3A74 A;  3MEF A;  1HNZ L;  4GN4 B;  2ZM6 L;  1D7Q A;  3UE0 A;  4O0A A;  4LUV A;  3CCM A;  3KF6 B;  4GN5 A;  2VZA A;  2Y0S E;  2NVQ H;  2K50 A;  3AEV A;  1BVS A;  5IYC H;  3I4N H;  5JJL A;  1JT8 A;  3UDX A;  2ZJP A;  2UXC Q;  2KHJ A;  4TVA B;  4DUY L;  1HH2 P;  3J7Z C;  4JI2 L;  1SLJ A;  1C9O A;  3CCE A;  4LF6 Q;  4OON A;  1Q81 C;  3RR5 A;  1FVI A;  3F1Z A;  3STB C;  5J3B A;  3DM3 A;  3SGI A;  4DV3 L;  4HIO A;  4DR3 L;  2R93 H;  2JA5 G;  2I0Q A;  2CKZ B;  2HT1 A;  1PH3 A;  5JJI A;  4JCV E;  3GTO H;  2FXQ A;  2UUC L;  2ATW A;  1NE3 A;  5IYD G;  1EWI A;  5HY6 A;  1PV4 A;  4LUO A;  1I50 H;  2KCT A;  5FJ8 H;  4DR5 L;  1OXS C;  3K8A A;  4FDB A;  5C4X H;  5FLX c;  4DR2 L;  4YY3 Q;  4RMF A;  2VW9 A;  1B7Y B;  2PQA B;  3HOU G;  1Y1V G;  4XIG S;  4Y7N H;  1VQO A;  1PFS A;  1A0I A;  4KHZ A;  1KHI A;  4ME3 A;  1N32 Q;  4NXN L;  3AQQ A;  4JI0 Q;  4A3G H;  1NTG A;  3PO3 H;  2F4V L;  4L5R C;  3CC2 A;  2JA9 A;  1Q86 C;  1IBK L;  2LSS A;  1SRO A;  2LXJ A;  2UU9 Q;  4UP8 A;  1YIJ A;  1LM0 A;  1J6Q A;  2E2J H;  1EIY B;  2AMC B;  2LXK A;  3KDF A;  4HID A;  1W3S A;  4JI3 L;  3GTP H;  5IWA L;  1VQG A;  1LYL A;  2I5H A;  3NEM A;  1GD7 A;  3PUW A;  3PUZ A;  3U4V A;  4NPS A;  1VQP A;  3F2D A;  1N36 Q;  2A1A A;  3AFP A;  4HJ9 A;  2VQF L;  4JI0 L;  3KOJ A;  4QJF A;  3UE1 A;  2MO0 A;  1P8L A;  4EX5 A;  3CME A;  2ASB A;  2BH2 A;  1JE5 A;  1RL2 A;  1IXR A;  2B29 A;  2D0P A;  2AWN A;  1D8L A;  3KYH C;  1HZ9 A;  4LFB Q;  1HNW L;  1UEB A;  4L5S A;  2NVY H;  1FJG Q;  4MTN A;  1L1O B;  2AHO B;  3T1H Q;  1NJI C;  2ZJQ A;  1X55 A;  4UP9 A;  4A76 A;  3GTK H;  1VQD A;  1IBM L;  3GTG H;  1ASZ A;  5IP7 G;  1PH2 A;  4C3H H;  3I4M G;  4HIM A;  3BJU A;  2UUC Q;  3GO5 A;  3PF4 A;  1E3P A;  4YWL A;  5FLM G;  1KQS A;  1X9N A;  1WCM G;  1I94 Q;  1E7Z A;  1Q1E A;  4DR7 L;  1PH9 A;  4JI5 Q;  2Z0S A;  3CF5 A;  1X56 A;  5IP9 G;  5IP9 H;  4L5T A;  2E5L L;  2RF4 A;  4DV6 Q;  4QQB X;  4DV1 Q;  4POF A;  2AWO A;  3CW2 C;  2K5V A;  3L2P A;  4JBJ A;  3H0G G;  4JI2 Q;  3TRE A;  4A3I G;  4DV1 L;  1VQL A;  1WI5 A;  4BBS G;  1S3O A;  3HKZ E;  2MNA A;  3HOW G;  4JI5 L;  1N33 L;  2QA4 A;  4P75 A;  3ULL A;  2VUM H;  1I94 L;  3K0X A;  3CCS A;  1X3E A;  4A3B H;  4MNO A;  4BA2 I;  3KDF B;  2UXD Q;  1AH9 A;  1N33 Q;  5H1S E;  1HNZ Q;  1TWG H;  1I6H H;  3I4O A;  1Q82 C;  1OXV A;  2L15 A;  1NY4 A;  2D0O A;  3FKI H;  1PH6 A;  1P16 A;  1MKH A;  5JJK A;  1K0R A;  1SN8 A;  2BA0 A;  3F8T A;  4IFD I;  4DV6 L;  3T1H L;  1IZ6 A;  2E5L Q;  2OWO A;  3S17 H;  3M7N A;  4DV7 Q;  4LFB L;  1EFW A;  1QUQ A;  2Q2H A;  1Q12 A;  2XTI A;  4P71 A;  2AKW B;  4LF4 L;  4APV A;  1E22 A;  2IHE A;  3J7A 5;  2WFW A;  2HIV A;  4C3J H;  1KD1 C;  4B3T L;  4DK3 C;  4TQU S;  1VQ7 A;  3HOX H;  3CCL A;  2JA8 H;  4BY7 G;  4JV5 Q;  1N36 L;  1Q7Y C;  3M4O H;  5FLM H;  1MJE A;  4X64 Q;  2ES2 A;  1QVC A;  1VQ6 A;  2YTX A;  2GVA A;  5M3F G;  4LFC L;  1SE8 A;  1K8A C;  4LW1 A;  4GOP C;  1IBK Q;  4H02 A;  4IPH A;  4IPG A;  4KI0 A;  4NXN Q;  2VQF Q;  3KF8 B;  4IPC A;  1C7Y A;  4JOI A;  3G4S A;  5LMU L;  4BXX G;  1N32 L;  2OQK A;  1KC8 C;  3UDI A;  4JI7 Q;  4P73 A;  4A3J G;  1SFO H;  4JI3 Q;  1X65 A;  2K75 A;  1WOC A;  1OXT A;  3KF6 A;  4YY3 L;  4X64 L;  1YIT A;  3GTQ H;  4P72 A;  4DR5 Q;  3TRZ A;  4BA1 I;  1Y1W G;  4R4O A;  4AYB G;  1TWA H;  3KJP A;  5LMN Q;  1XNQ Q;  2XGT A;  1L1O C;  3ICE A;  3FP9 A;  1E24 A;  5AJ3 L;  3HOY G;  3PO3 G;  1HZB A;  3U4Z A;  2N49 A;  2VL6 A;  4LF4 Q;  4A93 G;  4DV3 Q;  4PG3 A;  2IT1 A;  5JEA J;  4DV7 L;  4XTC S;  1O7I A;  1K9M C;  2E2H H;  4QL5 A;  1ASY A;  2BH8 A;  2F52 A;  1G29 1;  4A3K H;  1SRU A;  1V43 A;  1X54 A;  2E8G A;  2Z6K A;  4DUY Q;  1PH4 A;  2NVT H;  1S40 A;  1QVF A;  2YV5 A;  4X65 L;  1E1O A;  1X3G A;  2JA5 H;  2UXD L;  1Y14 B;  3PSI A;  2CWP A;  4UP7 A;  3UDF A;  4A3M H;  4A3M G;  4A3D H;  5DLQ E;  2C35 B;  4DR3 Q;  2ZM6 Q;  3W1B A;  4YWM A;  2HQL A;  3A0J A;  4OWX B;  4O2D A;  4PZ6 A;  2R92 G;  4A3L H;  4LF6 L;  1N8R C;  3CCJ A;  4LNQ A;  4A3C G;  4A3C H;  1VCI A;  3PF5 A;  1M1K C;  1VQ9 A;  5IP7 H;  2JE6 I;  2F3I A;  1Q8K A;  4A3E G;  5GQO A;  4A3E H;  1Y1V H;  1KL9 A;  4DR7 Q;  3CQZ H;  3JAM c;  4LF9 L;  2JEA I;  1QUQ B;  2ID0 A;  4GLX A;  1WCM H;  3HOU H;  2NZH A;  2K14 A;  1KXL A;  2JA6 H;  4DV4 Q;  4DR4 Q;  4DV2 L;  3H15 A;  3I56 A;  3S1R H;  1VQB A;  2WB1 E;  1IBM Q;  4OWT B;  4IFD G;  3RLO A;  2MQH A;  4A3I H;  2EIF A;  1FJG L;  1NMF A;  4B3S L;  1I5F A;  1YHA A;  1HNW Q;  2R93 G;  1CSQ A;  1YVC A;  3I2Z A;  5M3M H;  2VUM G;  1I3Q H;  1VS0 A;  3RLN A;  4YCV A;  2QEX A;  1IBL L;  4B3M Q;  3S14 H;  1KIX A;  2UUB Q;  5IY0 A;  1IL2 A;  5EAY A;  2N78 A;  2WAQ G;  1H95 A;  1HR0 W;  3CPW A;  5IWA Q;  4AQY Q;  4C2M H;  1YNX A;  2BA1 A;  3JAM i;  2I5M X;  3HOV G;  2K52 A;  2R7D A;  1GM5 A;  2UU9 L;  1AE3 A;  1FL0 A;  3M85 A;  2F4V Q;  1L1O A;  3IRB A;  5FJ8 G;  4YHH Q;  3LGJ A;  4R4I A;  4JBK A;  3HOX G;  1PA6 A;  2B63 H;  1TXY A;  1BBW A;  1E1T A;  5GAD C;  2OQ0 A;  1IYJ B;  1TWC H;  4IJH A;  4AH6 A;  1PYB A;  1RIP A;  1W2B A;  3GTJ H;  1M90 C;  1C0A A;  4DR2 Q;  1QZH A;  2OTJ A;  4BBR G;  2ZTC A;  1VQF A;  3E9H A;  1A63 A;  1TWF H;  1YJ9 A;  2HIX A;  3T1Y L;  1CUK A;  4X66 L;  1XMO L;  1K83 H;  1XNR Q;  4L5Q A;  1PVO A;  4JYA Q;  2JQO A;  1GO3 E;  4R1J A;  3G6E A;  4LF7 L;  1OXU A;  2K4K A;  3J80 c;  4BBS H;  4JC0 A;  2IY5 B;  1EIF A;  2KBN A;  2N8N A;  3TS2 A;  5GAE C;  3GD7 A;  3CCU A;  4DV5 Q;  4AYB E;  2MFI A;  4OX9 Q;  1JJC B;  5HGQ A;  3RN5 A;  2CWA A;  2PNH A;  4DR1 Q;  3RNU A;  2VY3 A;  4AIM A;  5JEA G;  4X62 Q;  3A5Z B;  2UXC L;  1FGU A;  5C4X G;  1VQ5 A;  1GVP A;  5BR8 L;  5K36 G;  2YTV A;  1VQH A;  1UWV A;  2DUD A;  3HFZ B;  3TQY A;  3OW2 A;  3S1Q H;  4GNX A;  4IFD J;  1JJG A;  3CPF A;  3HKS A;  4JI6 Q;  3HOZ G;  3I4M H;  3HOZ H;  1KRS A;  2PI2 E;  1PHJ A;  4UY8 C;  4DV0 Q;  1HZC A;  2JA8 G;  3PO2 H;  4JBM A;  3RLF A;  4OWW B;  3RZO H;  2ALY B;  1KRT A;  2NN6 G;  1K3R A;  1NMG A;  2YU9 H;  5ELN A;  1UE6 A;  4R4C A;  2Q2T A;  4GKK L;  3S15 H;  4GKJ L;  3WWV A;  3E0E A;  1S72 A;  4JOI C;  2Y0S G;  3J81 c;  3S24 A;  1YJN A;  3EN2 A;  2VNU D;  3M4Q A;  3CD6 A;  3OYY A;  4QIW E;  4DNI A;  3OTO L;  2UUA Q;  4BY1 H;  1QZG A;  4LFA L;  4NXM L;  3CCQ A;  2WP8 J; 
#chains in the Genus database with same CATH topology
 3PGZ A;  1NSN S;  4BBS B;  4DK1 A;  4LFA Q;  5C44 G;  2RDH A;  2C9O A;  4G57 A;  1JQY D;  4ZUJ A;  2JA7 G;  1VQ4 A;  3S2D H;  2K5Q A;  4N8F A;  5EKK A;  5JJZ A;  4IOC A;  4K0K Q;  5EPK A;  4DPG A;  4IO9 A;  3BU2 A;  2SNS A;  1CQV A;  2WB1 G;  1EQQ A;  5M3M G;  2Z6K C;  1XX8 A;  1X3F A;  1N34 L;  4C2M B;  2CQO A;  3HOW H;  2Q8T A;  3DWQ A;  4DR6 Q;  2KCM A;  5DM7 3;  1PH7 A;  2VQE L;  4DAM A;  2D62 A;  4OHJ A;  2R92 H;  1Q3L A;  3GTM H;  4FXG C;  4DV5 L;  1XWE A;  2IL8 A;  3MA2 B;  1EY8 A;  1IKL A;  2JA6 G;  2V4D A;  5FKA C;  2BE5 C;  1PTO C;  1UE5 A;  4QGU A;  1JOO A;  2PPB C;  3HS0 C;  4DAP A;  3L0O A;  2QGQ A;  3X3M A;  1BCP F;  2JA7 B;  1I6V C;  1OTC A;  3S1M H;  3LWE A;  4I65 A;  2KED A;  1W6J A;  2F0H A;  4RKL A;  2IX0 A;  2HHH Q;  1XTC D;  3B6Y A;  1HNX Q;  2YYZ A;  3J7A F;  4YWK A;  4B08 A;  2D5D A;  3X3N A;  1EOV A;  1JWM D;  1RF2 D;  3HKZ G;  3TEH B;  4Z9C B;  1PFN A;  5I4D A;  2Q2I A;  2F1M A;  1EOT A;  1X6O A;  2WB1 B;  2MUY A;  5EJW A;  3J80 E;  1F9S A;  1B70 B;  3STB D;  1RD9 D;  3PMF A;  3KK7 A;  1KLU D;  3HOZ B;  3CXC A;  3CP0 A;  4B3S Q;  1Q90 A;  2ENB A;  3PV0 A;  4BBR H;  4GN3 B;  3I55 A;  1KTK A;  3MAQ A;  1Q46 A;  2JK8 A;  4LWC A;  3GTK B;  1QVG A;  4RGO S;  4XT1 B;  3J7A V;  5IT9 L;  4H7B A;  4GS3 A;  3FKI G;  4KD4 A;  2ZTD A;  3EQL C;  3J7Y W;  5M5X H;  4I7A A;  4EQN A;  4C3J G;  4X65 Q;  1EL0 A;  3K59 A;  3M4O B;  4NB3 A;  4A3G G;  2N3S A;  4QF4 A;  4KY6 A;  4HJ5 A;  2E2I H;  2G9H D;  1AE2 A;  1VQM A;  2QIL A;  4RG1 A;  4KHP L;  1NR4 A;  4O1N A;  5C3E G;  2CW0 D;  1K8G A;  3BZC A;  3RD4 A;  2F0W A;  2GN5 A;  3EBE A;  3K7A H;  1XNQ L;  1EUJ A;  1TWG B;  2UXB L;  2GA4 B;  2WAC A;  3G48 A;  1EY6 A;  4LF8 L;  1GXD C;  1UNS A;  3I72 A;  4GLV B;  3T53 B;  2R7F A;  3R2I A;  5JEA H;  3T13 A;  1GHK A;  5EKI A;  1VQI A;  2KQ3 A;  2NN6 I;  4B3M L;  3MZ5 A;  4TKO B;  3UDG A;  1EYG A;  1JOQ A;  1XXG A;  1GUN A;  1BQQ T;  3NTI A;  5GAH C;  1V1P A;  1EWC A;  2VB2 X;  3ZJY C;  3PCO B;  5M3F H;  1PH1 A;  3I4L A;  3H0G H;  4C3I B;  4BS9 A;  4JV5 L;  3CC7 A;  5M5W B;  1SAP A;  4CJ2 C;  2NYZ D;  4BXX H;  4OO1 G;  4IUR A;  3NTK A;  5C4J B;  1T5X D;  1XYI A;  3TME A;  1CKM A;  3TDQ A;  1HFG A;  1SR3 A;  1PRT F;  5LMN W;  1STA A;  2MHV A;  4K5V A;  4KLK A;  4RGT A;  1I3Q B;  2VUM B;  5BN3 A;  1DOK A;  1A62 A;  1DGS A;  1HNZ L;  5NUC A;  4GN4 B;  5D65 A;  3UE0 A;  4XDX A;  4GN5 A;  2PMZ B;  2XWB B;  3I4N H;  2HD3 A;  2F0I A;  1BVS A;  2K50 A;  4QB4 A;  1DXM A;  2JP1 A;  3BDL A;  2KHJ A;  4TVA B;  3M3Y B;  3RZD B;  2MJ8 A;  4OON A;  5KND A;  3RR5 A;  1L0X B;  3GV3 A;  3STB C;  4AYB B;  3DM3 A;  1ILP A;  3SGI A;  4DV3 L;  4DR3 L;  1SNQ A;  5C6A A;  3R8B A;  2CKZ B;  5IOC A;  2HT1 A;  4JCV E;  1PLF A;  2RDF A;  5FJ8 H;  4DR5 L;  3K8A A;  4HCS A;  2PQA B;  1UEA B;  3Q22 A;  5I2Y A;  1VF5 C;  1F2M A;  1KHI A;  2EYJ A;  4A3D B;  1TY0 A;  1SYG A;  2PW7 A;  4NXN L;  4KKT A;  1SMY C;  4JI0 Q;  4A3G H;  2QEJ C;  1DD2 A;  2F4V L;  1LLR D;  3E6Z X;  2UU9 Q;  1YIJ A;  1LM0 A;  2E2J H;  1EIY B;  2AMC B;  5IGE A;  3VA5 A;  3PUW A;  3SHL A;  1N36 Q;  3QJY A;  1DOL A;  5DM6 3;  4HJ9 A;  2EY6 A;  3KOJ A;  3K58 A;  1R4P B;  4A3B B;  4EX5 A;  3KYH C;  2MPM A;  1D8L A;  2CQA A;  2NVY H;  1L1O B;  2AHO B;  4UP9 A;  3SVM A;  3GTG H;  1ASZ A;  2C5C A;  2SNM A;  1LTI D;  2EOT A;  2BDO A;  4C3H H;  1F2L A;  5FLM G;  3GTL B;  4HCE A;  1I4G A;  1E7Z A;  2EJM A;  4BY7 B;  5IP9 H;  4DV6 Q;  1WCM B;  2PO4 A;  2KCC A;  2XSC A;  2K5V A;  4JBJ A;  3H0G G;  4JI2 Q;  4DV1 L;  5ELB A;  1S3O A;  3HKZ E;  2MNA A;  3ZYY X;  1N33 L;  1WTW A;  4QUC A;  3K0X A;  1X3E A;  4A3B H;  1EIH A;  4FVM A;  1AH9 A;  1NCV A;  5FO8 B;  1I6H H;  3I4O A;  1D2B A;  3S15 B;  2D0O A;  1MKH A;  2BA0 A;  3F8T A;  2F0D A;  1EWH A;  4DV7 Q;  4HED A;  3T4A C;  2Q2H A;  1Q12 A;  2XTI A;  3BYT B;  1NUC A;  4APV A;  1HHV A;  2IHE A;  3J7A 5;  2E74 C;  2HIV A;  4PNY A;  1KD1 C;  1QCB D;  4TQU S;  3HOX H;  3CCL A;  3EFX D;  1H9S A;  1A3U A;  3QWN A;  1A2U A;  1N36 L;  1X3P A;  3RUZ A;  1VQ6 A;  3HZX A;  2NZ1 D;  2YTX A;  1I4X A;  2K05 A;  4LFC L;  1SE8 A;  2DNC A;  1K8A C;  5C4X B;  3OMG A;  2PZU A;  4K5X A;  1LTR D;  4CJ0 B;  1Y69 U;  4KI0 A;  2VQF Q;  1C7Y A;  4JOI A;  3G4S A;  1CA6 A;  4P73 A;  1SFO H;  1X65 A;  2K75 A;  4S3S A;  1MSG A;  4YY3 L;  2B2T C;  4KN7 C;  4X64 L;  3D3R A;  4DR5 Q;  1Y1W G;  4R4O A;  2K6A A;  4IUQ A;  3TP5 A;  1TWA H;  4AYB G;  5CGK A;  5JPM C;  3GTJ B;  3J80 L;  5AJ3 L;  2E2H B;  5M3M B;  3D6C A;  3L9A X;  1TY2 A;  4XTC S;  1O7I A;  2WIN B;  2E2H H;  1MGS A;  2BH8 A;  2LFN A;  1V43 A;  1X54 A;  2AUJ D;  5L37 A;  2E8G A;  2NVT H;  1QE6 A;  1S40 A;  1E1O A;  1YNJ C;  2JA5 H;  2UXD L;  3PSI A;  5DLQ E;  2WAQ B;  3P20 A;  4YWM A;  2RSO A;  2R92 G;  3NPP A;  4LF6 L;  4CGY B;  3PF5 A;  2L12 A;  2KCN A;  5IP7 H;  2FMC A;  4C1N I;  5JOB A;  2L11 A;  4A3E H;  3DWA A;  1W6K A;  3JAM c;  4LF9 L;  2G5D A;  1SSO A;  4CKC A;  2F0P A;  2K14 A;  3S1R B;  3KLR A;  1KXL A;  2PZW A;  2HCC A;  2JXM B;  3NE5 B;  3FMC A;  5IGF A;  3I56 A;  3S1R H;  2FFK B;  1AEX A;  1TWC B;  3RLO A;  2MQH A;  2NVQ B;  1D6E C;  4HR7 B;  1AZP A;  1I5F A;  1YHA A;  4XXE A;  1HNW Q;  1YVC A;  1SDF A;  3S17 B;  3RLN A;  4YCV A;  3N6R A;  1IL2 A;  2CW0 C;  5EAY A;  1DCZ A;  1HR0 W;  5KYL A;  3JAM i;  2I5M X;  3HOV G;  5DAU A;  2UU9 L;  1BXT A;  1D1I A;  1SJH D;  1JOK A;  3M85 A;  2L1B A;  3IRB A;  1G6Z A;  4JBK A;  3K57 A;  2E2I B;  1BBW A;  1RTN A;  1E1T A;  2OQ0 A;  2G9D A;  3K0Y A;  1IYJ B;  3FDT A;  1RIP A;  1C0A A;  3HEJ A;  2R61 A;  2K32 A;  1YJ9 A;  2HIX A;  2EXZ A;  3R2T A;  1PVO A;  1KNE A;  2JQO A;  3G6J B;  4LF7 L;  2F3W A;  3F2U A;  1EIF A;  5CYU A;  4EQO A;  4DFA A;  1QOH A;  3TZU A;  3CCU A;  4AYB E;  2MFI A;  2I07 B;  1MI2 A;  2EJG C;  3SK5 A;  3RN5 A;  2CWA A;  4DR1 Q;  5JEA G;  4KKS A;  3K5O A;  5C4X G;  1VQ5 A;  1VQH A;  3S1Q H;  4CBV A;  4JI6 Q;  3HOZ H;  3I4M H;  2PI2 E;  3S1N B;  4MIU A;  2JA8 G;  4M8A A;  3RLF A;  4OWW B;  4ZKC B;  2L5T A;  1UE6 A;  3FKI B;  4RHS A;  3ERQ A;  1SYE A;  2H1E A;  3MXP A;  3BVZ A;  3J81 c;  2K03 A;  2RDG A;  3AB9 A;  4A3E B;  1B50 A;  4DNI A;  3S9W A;  3EJI A;  1PYW D;  4G7Z C;  3S16 H;  3E3X A;  3OIQ A;  4BY7 H;  3SK4 A;  4A4I A;  2I5L X;  5K36 H;  3CCR A;  2SEB D;  5C0X J;  3S2H B;  3GTL H;  1FNV A;  5KRU A;  1XTD A;  3BZD B;  1PXU A;  3P1H A;  2UXB Q;  1GHJ A;  2DGY A;  3HOY B;  4DV0 L;  2FIN B;  4B3R L;  1RDP D;  2EQS A;  3KLS A;  4P74 A;  3MFG A;  5C3E H;  2L0C A;  1F2Y A;  3E5S A;  1EFI D;  1NBW A;  1SEB D;  4UPA A;  4R9W A;  4ZLT F;  3U58 A;  4DK6 C;  4GNX C;  4GNX B;  1YHB A;  1STG A;  2XIW A;  2YTY A;  4F7X A;  1ESF A;  2NVX H;  5C44 H;  3W5O A;  4JK1 C;  4XYO A;  2KUM A;  1CKO A;  4C56 C;  3H3V I;  2NVX B;  3MXG A;  1STN A;  5E4X A;  1IYV A;  1B9N A;  4CJ1 B;  4QUF A;  5C4Z A;  2NBF A;  4XQQ A;  2A8V A;  5KYI A;  1KDB A;  1SNO A;  4R4T A;  4B3R Q;  1CTM A;  1A3T A;  5ELO A;  3AU7 A;  4ME5 A;  2WV6 D;  3HOV H;  2XRS D;  3IAY A;  1I6H B;  1Z47 A;  4MN3 A;  4NXM Q;  1XPO A;  2B39 A;  3VR6 A;  3OWE B;  1JIC A;  1PYS B;  2F3V A;  1OXX K;  1S4Z A;  1LT6 D;  1NNX A;  1JC7 A;  4RWS C;  2SDF A;  1PTO B;  4K5W A;  3HOY H;  3OHX C;  1TII D;  5IYC G;  3I7F A;  2HCI A;  1CZW A;  1HZA A;  3OTO Q;  3S2H H;  1U5K A;  3NUC A;  1EIG A;  1UE1 A;  4L8J A;  3QOJ A;  2A6E D;  1KNA A;  2HHH L;  3R93 A;  5I6W A;  1X3Q A;  1GUW A;  3C3L A;  2RHQ B;  3H3V H;  4GLA C;  3F2B A;  1VQC A;  5HGT A;  1SND A;  4JI6 L;  3FPU B;  4YIJ A;  1VQA A;  1MJC A;  4OEL B;  1PFB A;  3MXN B;  4K8I A;  3J81 E;  1AP0 A;  1XNR L;  3A8J E;  1XMO Q;  3KF8 A;  1A8V A;  3CAM A;  1KAB A;  3CCV A;  4PMW A;  3DXJ C;  3M9B A;  1VQK A;  1C4Q A;  1HTL D;  2H4O A;  1UUP A;  2LMC B;  5IYB H;  1JMC A;  1KLG D;  3MWY W;  4LF7 Q;  1RKN A;  3J81 i;  1CFM A;  5I6Y A;  5COR A;  4EVO A;  1WD0 A;  1Y1W H;  4FXK C;  4WJ4 A;  2LKV A;  5KNB A;  3CC4 A;  1YBY A;  4J6H A;  1PH5 A;  3NEL A;  3DHQ A;  3OMC A;  4J8Q A;  3J81 j;  2JA7 H;  4RGM A;  1SE3 A;  1PFM A;  3C46 A;  2KHI A;  3NBH B;  4KTA A;  4M1U B;  4LFC Q;  4IUU A;  3PIO A;  3PIP A;  1R9T H;  4HTH A;  2EY2 A;  4ZRZ A;  4DR4 L;  1NR2 A;  3GTO B;  1YHQ A;  2K04 A;  2JN4 A;  3TZD A;  2R92 B;  3DWP A;  5C0X I;  3NSW A;  1C48 A;  3DEO A;  4HJA A;  4XYQ A;  1H9J A;  4HMI A;  4PMB A;  1WTO A;  3KJO A;  4BY1 G;  1O78 A;  1G6P A;  3A74 A;  3CHB D;  2B8G A;  1SYD A;  3CCM A;  1HXY D;  2NVQ H;  2VZA A;  5FOB B;  5JJL A;  1FR3 A;  5IYC H;  1V1O A;  2UXC Q;  4DUY L;  2A74 C;  3J7Z C;  4RCO A;  3CCE A;  1Q81 C;  4OL7 A;  1FVI A;  3F1Z A;  5C5L A;  1CI3 M;  2PYK A;  4U68 A;  4HIO A;  4K14 A;  2R93 H;  4QCL A;  1L0Y B;  5JJI A;  3KBX A;  2ATW A;  1GUO A;  3BS1 A;  4FF2 A;  1I50 H;  3SK6 A;  4DR2 L;  1CHQ D;  3HOU G;  1A6X A;  2DJG C;  2QDB A;  4B9X A;  1N32 Q;  4F88 A;  1LTB D;  3PO3 H;  1Q86 C;  1D5M C;  4JPB W;  1SRO A;  2LXJ A;  2J0T D;  4UP8 A;  3PO3 B;  1SNC A;  3KDF A;  2F0N A;  2B2U A;  4HID A;  1W3S A;  4PMC A;  1MBY A;  2I5H A;  3PUZ A;  3U4V A;  1VQP A;  4NPS A;  1Y1W B;  1A15 A;  4C1N K;  1LT4 D;  1EYC A;  4QJF A;  3BVG A;  3UE1 A;  1WTP A;  2MO0 A;  2ICI A;  2ASB A;  5EBC A;  3T56 B;  1HZ9 A;  2PZT A;  4LFB Q;  4KMU C;  3T1H Q;  1JR0 D;  4A76 A;  1VQD A;  1IKM A;  5IP7 G;  2RA4 A;  2ZXO A;  3TBI B;  4C3H G;  4HIM A;  3I4M G;  1S5B D;  4YWL A;  5M3F B;  1WCM G;  1I94 Q;  2KEC A;  3NWT A;  3CF5 A;  2ZT9 C;  3URY A;  2E5L L;  3L2P A;  4LJZ C;  3WOE A;  4A3I G;  3HGB A;  1VQL A;  1WI5 A;  4BBS G;  1CK1 A;  5DEH A;  4KD3 A;  3HOW G;  5DNF A;  1I94 L;  1SYF A;  2O4X A;  3CCS A;  4BA2 I;  1SMY D;  3K7A B;  4MNO A;  3HKZ B;  1HNZ Q;  1TWG H;  1IW7 C;  5JJK A;  1K0R A;  4DV6 L;  2OWO A;  2F0S A;  4DNR B;  1STE A;  1DOM A;  5C5M A;  4LFB L;  4HAE A;  3OIP A;  1BBX C;  2AKW B;  2WFW A;  1S5D D;  2O5J C;  1VQ7 A;  2EY1 A;  1E2W A;  5EPL A;  1R4Q B;  4WRD A;  4BY7 G;  1ILQ A;  4JV5 Q;  1AW7 A;  4PV1 C;  2GVA A;  2KVM A;  5M3F G;  4GOP C;  1Y1V B;  3G7L A;  3A55 A;  2XNA C;  4H02 A;  2K7V A;  4IPH A;  3EVQ A;  1SFO B;  4IPC A;  2B2V C;  1EY9 A;  3QR8 A;  4BXX G;  2OQK A;  1KC8 C;  5A35 A;  5C4H A;  1GOZ A;  2F0O A;  3DEP A;  3H94 A;  5G3L D;  1G2S A;  4TSS A;  3TRZ A;  3VYU A;  4BA1 I;  5IIF A;  1WTV A;  4V19 0;  3KJP A;  2XGT A;  1L1O C;  2K01 A;  4OEM B;  1O7L A;  3PO3 G;  1CT1 D;  3U4Z A;  3LNN A;  4LF4 Q;  4PG3 A;  3HP3 A;  5K5P A;  2F0M A;  4A3K H;  1SRU A;  2HDL A;  1A2T A;  2Z6K A;  4CKB A;  2EY5 A;  1PH4 A;  4H0L C;  3NK9 A;  4X65 L;  1X3G A;  3VR3 A;  1Y14 B;  3QG1 A;  2CWP A;  2EVB A;  3UDF A;  4CDC C;  4A3M H;  2LY7 A;  4A3D H;  4DR3 Q;  3A0J A;  4OWX B;  4PZ6 A;  4A3C H;  4DN4 M;  1M1K C;  2JE6 I;  1SE2 A;  2K28 A;  5GQO A;  1KL9 A;  4C3I G;  3CQZ H;  4GLX A;  1SXT A;  1WCM H;  2DNE A;  2EE1 A;  3J81 L;  4DR4 Q;  2IWH A;  2RSN A;  3T16 A;  3SR1 A;  4IFD G;  4OIK A;  2EIF A;  4CDF C;  1NMF A;  4A3I H;  4B3S L;  1AFP A;  1CSQ A;  3GTG B;  1B53 A;  2PQE A;  3I2Z A;  2VUM G;  1I3Q H;  1IBL L;  3ONA B;  1EYA A;  5M9O A;  2WAQ G;  4FO2 A;  1ZYR D;  5IWA Q;  1AZQ A;  3K5L A;  2K52 A;  1QB5 D;  2R7D A;  4WOR A;  1ENA A;  1L1O A;  5COY A;  4YHH Q;  4CHT B;  3BDO A;  1PA6 A;  3U9S A;  1VF7 A;  1HQR D;  3H6M A;  1F2Z A;  5FLX L;  3TN2 A;  1M90 C;  4X3T A;  4KK7 A;  2OTJ A;  4LAA A;  1PMR A;  4HMJ A;  4BBR G;  2ZTC A;  1VQF A;  1U4R A;  1A63 A;  3PIO 3;  3PIP 3;  2RQX A;  1XNR Q;  3HOX B;  2F0J A;  1ROD A;  4JYA Q;  1F9Q A;  1GO3 E;  3LWU A;  2K4K A;  4JC0 A;  2KBN A;  2Z1C A;  2BOS A;  3NTH A;  4DV5 Q;  3R3O A;  4OX9 Q;  3KLS X;  1FNW A;  4KN4 C;  1JE4 A;  4X62 Q;  2UXC L;  3A5Z B;  5JVG 3;  1BCP D;  1EU4 A;  3VR4 A;  1UWV A;  1SE4 A;  1GJX A;  5ELF A;  1MSH A;  4IUN A;  3HOZ G;  1KRS A;  4FF1 A;  1K3B C;  4C3J B;  1LTA D;  1HZC A;  4JBM A;  4J1M A;  3TP6 A;  1HUN A;  2ALY B;  1O7Z A;  2HUG A;  1KRT A;  1K3R A;  2YU9 H;  1V1P B;  3JAM L;  4GKK L;  3WWV A;  5CBA E;  1S72 A;  3S24 A;  3BG3 A;  2B8F A;  2F0L A;  4QIW E;  4BY1 H;  1QZG A;  1I50 B;  4LFA L;  4NXM L;  3CCQ A;  2FHT A;  3T51 B;  4DGZ A;  1BO0 A;  4PZ7 A;  2L9H A;  1MD2 D;  1B8A A;  1FD7 D;  4DAY A;  1KAW A;  4ALP A;  4POG A;  4ILW A;  1G8Z D;  1XMQ Q;  3K80 C;  3PO2 B;  3W1G A;  1Q8I A;  1PTO F;  4KKU A;  5IT9 c;  2OTL A;  4RHR A;  2EYF A;  2AQ2 B;  1HJP A;  2B2W A;  4HIK A;  4JI8 Q;  4FF4 A;  4A3F H;  1VQJ A;  4U67 3;  3DLL A;  4MHE A;  1WTH A;  4OXP A;  4HSV A;  1SJE D;  4A3B G;  1HA6 A;  2CHB D;  3EIV A;  5BR8 Q;  1Z9F A;  2N55 A;  4IPD A;  3ND8 A;  4DK0 A;  4QIW B;  2NVT B;  4X62 L;  1I4Q A;  3W3A A;  4LF5 L;  3D8G A;  2Z6B A;  3F2C A;  4OX9 L;  2PQA A;  4J15 A;  5CV4 A;  3I4N G;  4E6I A;  2M2L A;  1ZEQ X;  4JYA L;  4IFD H;  1B2T A;  1B3Q A;  2X69 A;  1TWH H;  1YJW A;  1J5E L;  2JA6 B;  5FO7 B;  4DR6 L;  3QB3 A;  4GOP A;  3HOU B;  5D3D A;  4X6A H;  3NBI A;  3GTM B;  1FYC A;  5IE8 A;  1JJ2 A;  4ODG A;  4A3K G;  4GZY C;  1NAP A;  1HPC A;  2R6G A;  4DKA C;  4YHH L;  4YCW A;  1HR0 L;  5IYD H;  2GVB A;  5EGT A;  4WJ3 M;  4HN7 A;  1XJV A;  2E2J B;  1XPR A;  2ZTE A;  3HOW B;  4JI1 L;  1JCK B;  1C8C A;  3D31 A;  3H0G B;  4C3I H;  3S1N H;  1BCP C;  1WD1 A;  1BBU A;  1IBL Q;  3PO2 G;  2KEE A;  2F0E A;  3M4P A;  3I70 A;  1LO5 D;  2OF1 A;  3VR5 A;  1BCP B;  1HTP A;  1LAB A;  2IX3 A;  4PZ8 A;  2F0G A;  2DY8 A;  2ZXP A;  2MGS A;  2X6L A;  1N9W A;  4DV2 Q;  2VS1 A;  3KFU A;  2EDG A;  1BF4 A;  4GKJ Q;  4GKK Q;  2FJ2 A;  3FRP B;  4F87 A;  5C0X G;  4JI4 Q;  2B63 G;  1DZ1 A;  1SNM A;  3G71 A;  2HDM A;  1K0S A;  3RZD H;  3VR2 A;  2NTT A;  3SDZ A;  5J22 A;  2E76 C;  4DUZ L;  1VMC A;  1E2V A;  1V8Q A;  2JJQ A;  1GUS A;  2R7Z H;  4A3L H;  3BZK A;  1V9P A;  5CBE E;  3OWF A;  4HJ7 A;  5FK9 C;  2RKS A;  2PI2 A;  1CKN A;  1TS2 A;  5ELE A;  5IYB G;  5ISR A;  1U0L A;  3HOV B;  4JW0 A;  2Q2U A;  3D0F A;  3VYR A;  3E9I A;  1STH A;  5KNC A;  3RN2 A;  1GUG A;  3IFT A;  5M5W H;  2E75 C;  1S5E D;  5GAG C;  3FHW A;  1T5E A;  4IUT A;  1PZI D;  5LMU Q;  2ZJR A;  2RHS B;  4IJL A;  2A68 D;  1D1K A;  3BVM A;  2IX1 A;  1M8A A;  4IOA A;  2D9U A;  2B63 B;  1YZ6 A;  2A6E C;  1PH8 A;  1WYD A;  4NMZ A;  3Q24 A;  2K5H A;  1CKN B;  2EYP A;  4G4K A;  2CCZ A;  3QO2 A;  4OO1 H;  3KUP A;  5LL6 X;  2PMZ E;  3PUX A;  3FVQ A;  1UE7 A;  3EA6 A;  3P75 A;  1J9O A;  1ZKO A;  4XQN A;  2XRQ D;  2WKC A;  1T9H A;  4R8N A;  3E0J A;  4Y52 H;  3M3Y H;  3PUV A;  4DV4 L;  4YCU A;  2LS0 1;  3N52 A;  1PTO H;  4LUV A;  3KF6 B;  4DXG A;  1G2T A;  5C3W A;  2O2L D;  2BDN A;  1O7Y A;  1HH2 P;  2F0F A;  2XN9 C;  3GTQ B;  1SLJ A;  1LTT D;  1BR9 A;  1EY0 A;  4UHV A;  4L63 B;  3IFD A;  5J3B A;  2OXP A;  2B2U C;  2TSS A;  1EY5 A;  2NWG A;  1B3A A;  2FXQ A;  2NVY B;  5IYD G;  1EWI A;  5HY6 A;  4LUO A;  2KCT A;  5FLX c;  5C4X H;  3SEB A;  1BNZ A;  3MXU A;  4RMF A;  4YY3 Q;  1B7Y B;  1FGB D;  2FMM A;  1PFS A;  1A0I A;  4KHZ A;  3K5M A;  3M7G A;  4L5R C;  2ZXR A;  2E2D C;  1J6Q A;  3GTP H;  1GUT A;  1VQG A;  1LYL A;  1YNN D;  3NEM A;  2P5Z X;  1LTG D;  1STY A;  3F2D A;  2CH4 W;  1B44 D;  5C3X A;  5BN5 A;  1P8L A;  3CME A;  1ZXT A;  4A3J B;  1JE5 A;  2QF7 A;  1IXR A;  2B29 A;  2D0P A;  2QKI C;  4RFB A;  4DU9 A;  1HNW L;  1HQM C;  1UEB A;  2AUK A;  3GV6 A;  2ZJQ A;  1X55 A;  5J39 A;  2EJF C;  1PH2 A;  3S1M B;  3VYT A;  2UUC Q;  3GO5 A;  1E3P A;  1WVL A;  1KQS A;  1X9N A;  2PCF B;  3FEW X;  2A6H C;  1PH9 A;  4JI5 Q;  5BN4 A;  5CMD A;  1EQT A;  5IP9 G;  2B2Y C;  4L5T A;  4F8M A;  2RF4 A;  4QQB X;  1PRT D;  4DV1 Q;  1TVX A;  4POF A;  1B1Z A;  4G7O C;  1F9R A;  3TRE A;  4UAI A;  1HCZ A;  2A68 C;  4JI5 L;  2N88 A;  2VUM H;  3ULL A;  2UXD Q;  4LMQ D;  3ERO A;  5H1S E;  2RCF A;  5I9P A;  1HRJ A;  2AQ1 B;  3O13 A;  2IW3 A;  2L15 A;  3FKI H;  1NY4 A;  1QIL A;  1PH6 A;  1O80 A;  1P16 A;  2R3Z A;  3BDC A;  1SN8 A;  1IZ6 A;  2E5L Q;  3S17 H;  3M7N A;  5IGC A;  5D3I B;  4P71 A;  3NHH A;  3W2D A;  4A3K B;  1E22 A;  3I73 A;  1DON A;  3M4Y A;  4B3T L;  2B2W C;  2JA8 H;  2EYL A;  5FLM H;  2ES2 A;  4X64 Q;  3S1Q B;  1QVC A;  1ET6 A;  1BOS A;  2RVL A;  3S2D B;  4LW1 A;  3A8K E;  4IPG A;  4NXN Q;  3KF8 B;  3OPO A;  2JYO A;  3UDI A;  4JI7 Q;  1JB3 A;  5JAV A;  4JI3 Q;  1Y8N B;  3NBH A;  1WOC A;  1OXT A;  2NUC A;  3ITP A;  3KF6 A;  2JA5 B;  1YIT A;  3GTQ H;  4KV6 A;  1I4H A;  2A73 B;  5LMN Q;  1U9R A;  5CV6 A;  3A54 A;  3ICE A;  4X3U A;  1HZB A;  4DV3 Q;  5CV7 A;  4DV7 L;  3A7L A;  5IGB A;  4QL5 A;  3NXW A;  4L6T B;  4I7Z C;  1SNP A;  1QVF A;  2YV5 A;  2XWJ B;  4UP7 A;  1IL8 A;  4A3M G;  3IKJ A;  3W1B A;  2HQL A;  2BE5 D;  3NP8 A;  4R8I A;  4K6D A;  1YNN C;  1N8R C;  3CCJ A;  1VQ9 A;  1DYQ A;  4Q5V A;  1IW7 D;  1E2Z A;  4A3E G;  2R93 B;  1LV9 A;  3V05 A;  3D4R A;  4N9P A;  2EYM A;  2JEA I;  1QUQ B;  2ID0 A;  2NZH A;  4P2C B;  4NDX A;  3TP8 A;  1M4V A;  4WJW A;  1ICF B;  2WB1 E;  4OWT B;  2JA8 B;  1ONL A;  1JOR A;  3CKI B;  3H09 A;  2A6H D;  4BY1 B;  3BYY B;  4CKE A;  1VS0 A;  1HFN A;  2QEX A;  1H9M A;  4B3M Q;  3S14 H;  1KIX A;  2A5H A;  2UUB Q;  2NTS A;  2N78 A;  1H95 A;  1D5X C;  2KHS A;  2B2Y A;  3IL8 A;  3CU7 A;  2QCP X;  2BA1 A;  1GM5 A;  5HUR A;  1AE3 A;  1QG7 A;  2F4V Q;  2A69 C;  1JWS D;  2O5I C;  4FYD A;  5E4W C;  1TXY A;  2R7Z B;  4AH6 A;  1W2B A;  3GTJ H;  1KDA A;  5CV5 A;  3I8Z A;  4Y7N B;  3MHB A;  4G7H C;  1TR5 A;  3E9H A;  1TWF H;  3T1Y L;  4X66 L;  1K83 H;  4L5Q A;  4R1J A;  1OXU A;  5I9O A;  3GD7 A;  5I2X A;  5HGQ A;  3C1F A;  2VY3 A;  4AIM A;  3SXH A;  4IUP A;  3D4D A;  1GVP A;  5K36 G;  2YTV A;  1PRT B;  2DUD A;  3HFZ B;  1JJG A;  3OW2 A;  1WTR A;  2QDL A;  1PTO D;  4K8J A;  3CPF A;  2VB3 X;  3I90 A;  4UY8 C;  4DV0 Q;  3PO2 H;  5LL6 S;  3RZO H;  1TU2 B;  1WTX A;  2IPK D;  2NN6 H;  4RH6 A;  1DJR D;  1NMG A;  5ELN A;  2XVS A;  4R4C A;  2Q2T A;  3S15 H;  4WFN 3;  4IUV A;  2B2V A;  2Y0S G;  2VNU D;  3EN2 A;  2K1B A;  3M4Q A;  1F9P A;  3OYY A;  3OTO L;  3SE0 A;  2WP8 J;  5LHY 1;  3OSO A;  4A3I B;  2RBM A;  2AQ3 B;  2HQE A;  2SOB A;  5IGG A;  1HR0 Q;  3L7Z C;  4JG2 A;  1EQV A;  1YI2 A;  4ULL A;  5EQ0 A;  2OCE A;  1HNX L;  2EXD A;  2Q8R E;  4DXF A;  4LF8 Q;  1KDC A;  1LUZ A;  1VQE A;  5T1I A;  3Q8D A;  4C3H B;  4ZCK A;  3AFQ A;  1V1Q A;  4A93 B;  3AYH B;  1RTO A;  3V2T A;  3I4N B;  3U50 C;  1LTL A;  3VDY A;  5F2D A;  1EYD A;  4ZK9 B;  1TWA B;  2Z4H A;  5TSS A;  3CRK C;  3QOL A;  4A3F G;  1L2F A;  4OO1 I;  3J80 i;  1QJO A;  1VQN A;  4JBW A;  4KHP Q;  4UDU C;  3HG9 A;  1BDO A;  2NZO A;  5JPN C;  1PRT C;  2KA7 A;  3DM1 A;  5C4J H;  1I4R A;  1Y8P B;  2VQE Q;  4A3F B;  1HUM A;  5D14 A;  1X32 A;  2V1C C;  2PW5 A;  1I4P A;  1G51 A;  4QMG A;  5T1G A;  4DUZ Q;  5EBD A;  4A75 A;  3NEN A;  1GKH A;  1Q1B A;  4BWG B;  2A69 D;  1N34 Q;  3T1Y Q;  4JI4 L;  4OGQ C;  2JEB I;  3ERS X;  3ULJ A;  3NQT A;  4LUZ A;  2TMP A;  1MIU A;  1L0W A;  1U4P A;  5C44 B;  4K0K L;  5M5Y B;  4EQP A;  1XMQ L;  2F0K A;  4HJ8 A;  1S5F D;  3K6O A;  4EQ5 A;  4FF3 A;  2I46 A;  3TSS A;  1TQO A;  3K7U C;  2Y0S B;  1ESR A;  3D4W A;  3TP7 A;  3NWS A;  1JWU D;  2J4X A;  3PUY A;  3MC0 B;  3ND9 A;  5IGD A;  1A3V A;  4JI1 Q;  1STB A;  2NB0 A;  2WKD A;  2H5X A;  2F0T A;  3CMA A;  1CSP A;  1LT3 D;  1SMX A;  2Z8L A;  5IOD A;  5E7N A;  2KEN A;  3I3C A;  4FP5 D;  2RCN A;  1VQ8 A;  3CQZ B;  3GQB A;  2A19 A;  1VDZ A;  4RKB A;  4DA2 A;  4NKL A;  3VA7 A;  3KBG A;  3TS0 A;  2DJF C;  1EQR A;  4LF9 Q;  4X3S A;  4ZUI A;  1J5E Q;  5M5Y H;  4DAY B;  2F0U A;  1PZK D;  4EGV A;  4K2L A;  4O42 A;  3JC6 6;  3K81 C;  4BBR B;  5JVH 3;  1RHP A;  5CV8 A;  2B3G A;  1YEZ A;  1B4O A;  1K73 C;  4DF7 A;  1RCV D;  4DAV A;  1WJJ A;  2F03 A;  1WTQ A;  4LF5 Q;  4DR1 L;  2R7Z G;  4A3L G;  1EY4 A;  1II3 A;  3H3V C;  1ENF A;  2F0V A;  1QNK A;  3HRZ C;  4A3D G;  3KLW A;  2KOL A;  5AJ3 Q;  4JI8 L;  2IHF A;  2MO1 A;  1BKB A;  4QY7 A;  1FNU A;  4X66 Q;  1TT2 A;  5LMN L;  1XPU A;  5GRO A;  1WFQ A;  3WDN A;  3ULP A;  2WAQ E;  1CQF A;  4ZQ3 A;  4AQY L;  4A93 H;  1SYB A;  3PQI A;  2Q8I B;  4JI7 L;  4TRD A;  1RJT A;  3GDE A;  3NQI A;  1R9T B;  4B9W A;  1EEF D;  4KJO A;  4K2K A;  1TWH B;  1KAA A;  2UUA L;  2F0Q A;  3ER0 A;  1CA5 A;  2K5N A;  2UUB L;  1EZ8 A;  3MTS A;  4GOP B;  4MZ9 A;  4B3T Q;  3GP7 A;  3CRL C;  4R4Q A;  3C2P A;  1JB7 A;  5FO9 B;  3A5U A;  1OO9 B;  4A3J H;  4KJN A;  2CFM A;  4H13 C;  3MEF A;  2ZM6 L;  3GTP B;  3A7A B;  1D7Q A;  1YNJ D;  1TS5 A;  4O0A A;  3AEV A;  5KIX A;  2Y0S E;  1JT8 A;  5FLX E;  3UDX A;  2ZJP A;  1B9M A;  4JI2 L;  1MHW C;  1C9O A;  4LF6 Q;  4K6L A;  1K28 A;  5A2Q E;  2JA5 G;  2X6G A;  2I0Q A;  2K5W A;  1PH3 A;  3GTO H;  1E0B A;  2UUC L;  1NE3 A;  1PV4 A;  1OXS C;  4FDB A;  4FNF A;  2VW9 A;  5ELC A;  1Z6H A;  1Y1V G;  4ZAI A;  4XIG S;  1F77 A;  5EKL A;  4Y7N H;  5C3E B;  1VQO A;  1TS4 A;  4ME3 A;  4X3K A;  3K5N A;  2YU9 B;  3AQQ A;  1TS3 A;  1NTG A;  3LX0 A;  2JA9 A;  3CC2 A;  1IBK L;  2LSS A;  4IZ8 A;  2F4I A;  2LXK A;  2VXW A;  4JI3 L;  2MP1 A;  3UI2 A;  5IWA L;  1GD7 A;  2A1A A;  3AFP A;  2VQF L;  1HA5 A;  4JI0 L;  1H9R A;  2BCO A;  2BH2 A;  2J7Z A;  3L3O C;  1RL2 A;  2KJX A;  2AWN A;  3Q0A A;  4RAU C;  1EU3 A;  4L5S A;  1FJG Q;  4MTN A;  1NJI C;  4XT3 B;  3GTK H;  1IBM L;  4V0B A;  1CHP D;  1Y8O B;  3BJU A;  3PF4 A;  4RA8 A;  2DN8 A;  1J8I A;  2EYO A;  5G3L F;  4LK1 C;  1Q1E A;  4DR7 L;  1Z7T A;  2Z0S A;  4Q0F A;  1X56 A;  2ICE C;  5EPJ A;  3RZO B;  2AWO A;  3CW2 C;  1QNU A;  3MVV A;  1IYU A;  1BUV T;  1ZYR C;  3I4M B;  2EYH A;  2QA4 A;  4P75 A;  3KDF B;  1N33 Q;  2K5D A;  1H9S B;  1Q82 C;  1OXV A;  5KEE A;  4IFD I;  3T1H L;  2WII B;  1EFW A;  3U9O A;  1QUQ A;  4LF4 L;  4C3J H;  4PQX A;  4DK3 C;  1IHZ A;  3RMH A;  1LT5 D;  4FXD A;  5CC4 A;  4IN3 A;  4CDD C;  1Q7Y C;  3M4O H;  1MJE A;  3OOC A;  5CV9 A;  1U4M A;  1ET9 A;  1IBK Q;  3VYS A;  4ZYS A;  2L4N A;  2CH4 A;  1N32 L;  5LMU L;  2OEO A;  2QW7 A;  4A3J G;  1K8O A;  5KGU A;  2D2C C;  4H44 C;  3DUZ A;  1U4L A;  4P72 A;  3MXN A;  5E1F A;  4N8X 1;  2Z4I A;  1S5C D;  1XNQ Q;  2DY7 A;  3FP9 A;  1E24 A;  3HOY G;  4A93 G;  2N49 A;  2VL6 A;  2IT1 A;  5JEA J;  3DMU A;  4MTK A;  1K9M C;  1ASY A;  1QWY A;  2F52 A;  1G29 1;  2M00 A;  3A8I E;  4DUY Q;  3P7J A;  5CR3 A;  2OT2 A;  2C35 B;  1CZG A;  2ZM6 Q;  4O2D A;  2EPB A;  4IAL A;  4LNQ A;  1LTS D;  4A3C G;  5C0X H;  1VCI A;  3QIA A;  4ZKB B;  2F3I A;  1Q8K A;  1AN8 A;  1D5Z C;  1Y1V H;  4DR7 Q;  1K83 B;  3HOU H;  1TWF B;  4ABN A;  1DM0 B;  2JA6 H;  4DV4 Q;  1LAC A;  3C1E A;  4DV2 L;  3H15 A;  1VQB A;  4RGN A;  1IBM Q;  4N9T A;  1FJG L;  3S16 B;  4KY7 A;  4CDE C;  2R93 G;  4NP5 A;  5M3M H;  2M9V A;  3FPP A;  1VMP A;  3I91 A;  3OW7 A;  3JAM E;  1UAP A;  5IY0 A;  3AMU A;  4HSP A;  1SYC A;  4XQJ A;  5IT9 E;  3CPW A;  4A3M B;  4AQY Q;  4C2M H;  1YNX A;  4KY5 A;  3S14 B;  5ELD A;  1CM9 A;  1FL0 A;  3MFY A;  1PZJ D;  3Q6S A;  5FJ8 G;  3LGJ A;  4R4I A;  3HOX G;  2B63 H;  4IQZ A;  2Z9H A;  3WOF A;  2JSO A;  3H91 A;  4KHV A;  3SK8 A;  5GAD C;  4A3G B;  1SBB B;  1TWC H;  4IJH A;  1EEI D;  1PYB A;  3Q23 A;  1H9K A;  4DR2 Q;  1QZH A;  3MEH A;  2PNR C;  2EZV A;  3A56 A;  1CUK A;  1EZ6 A;  1ML0 D;  2IJ0 A;  1XMO L;  3G6E A;  4BBS H;  3J80 c;  5E3F A;  2N8N A;  2IY5 B;  3TS2 A;  5GAE C;  1ICW A;  1JJC B;  2PNH A;  1K8M A;  3RNU A;  1FGU A;  4ID6 A;  5BR8 L;  4OIJ A;  3TQY A;  5AFW A;  4IFD J;  4GNX A;  4JVZ A;  2K33 A;  1TKW B;  5J1Z A;  3HKS A;  1PHJ A;  2CVR A;  2B2T A;  4RCN A;  2NN6 G;  5A2Q L;  4DNT B;  4GKJ L;  5M5X B;  3D6W A;  1EY7 A;  3E0E A;  1G91 A;  4JOI C;  1YJN A;  4NW2 A;  3CD6 A;  1ENC A;  2L55 A;  2UUA Q;  3V96 A;  1PDQ A; 
#chains in the Genus database with same CATH homology
 3PGZ A;  4LFA Q;  3S16 H;  4PZ7 A;  5C44 G;  1HR0 Q;  3L7Z C;  4JG2 A;  1B8A A;  1YI2 A;  1KAW A;  4ALP A;  4BY7 H;  2JA7 G;  2OCE A;  4POG A;  1HNX L;  1VQ4 A;  3S2D H;  4A4I A;  2EXD A;  2I5L X;  4LF8 Q;  3CCR A;  1XMQ Q;  3K80 C;  4IOC A;  4K0K Q;  1LUZ A;  4DPG A;  3W1G A;  1VQE A;  5C0X J;  3GTL H;  1XTD A;  4IO9 A;  3BU2 A;  3Q8D A;  5IT9 c;  2OTL A;  2WB1 G;  3AFQ A;  2UXB Q;  1EQQ A;  1V1Q A;  5M3M G;  3AYH B;  2DGY A;  2Z6K C;  3U50 C;  1X3F A;  1LTL A;  1HJP A;  4DV0 L;  1N34 L;  3VDY A;  4B3R L;  4HIK A;  4JI8 Q;  2EQS A;  4P74 A;  4A3F H;  2CQO A;  4A3F G;  3HOW H;  1VQJ A;  4OO1 I;  1L2F A;  5C3E H;  3DLL A;  3J80 i;  1VQN A;  4JBW A;  4OXP A;  4A3B G;  4KHP Q;  2NZO A;  3EIV A;  5BR8 Q;  4DR6 Q;  1Z9F A;  4IPD A;  2KCM A;  1NBW A;  4X62 L;  5C4J H;  2VQE Q;  1PH7 A;  2VQE L;  4UPA A;  4DAM A;  2D62 A;  4LF5 L;  2R92 H;  3F2C A;  2V1C C;  3U58 A;  4OX9 L;  2PQA A;  1G51 A;  4DK6 C;  4J15 A;  4DUZ Q;  4DV5 L;  3GTM H;  3I4N G;  4GNX C;  4GNX B;  1YHB A;  2YTY A;  2JA6 G;  4A75 A;  3NEN A;  2NVX H;  1UE5 A;  4QGU A;  3W5O A;  5C44 H;  4JYA L;  1GKH A;  1Q1B A;  1N34 Q;  3T1Y Q;  3L0O A;  2QGQ A;  4JI4 L;  1CKO A;  2JEB I;  3H3V I;  1YJW A;  1TWH H;  1J5E L;  3ERS X;  3ULJ A;  4DR6 L;  4LUZ A;  1OTC A;  3S1M H;  1MIU A;  4GOP A;  1L0W A;  4X6A H;  2HHH Q;  2IX0 A;  2A8V A;  5IE8 A;  4K0K L;  1XMQ L;  1JJ2 A;  4A3K G;  4HJ8 A;  3B6Y A;  1HNX Q;  2YYZ A;  4R4T A;  2R6G A;  4B3R Q;  4EQ5 A;  4YWK A;  4DKA C;  4YHH L;  4YCW A;  1HR0 L;  5IYD H;  5ELO A;  2GVB A;  3K7U C;  3HOV H;  1EOV A;  4WJ3 M;  1Z47 A;  3HKZ G;  1XPO A;  3TEH B;  4NXM Q;  1XJV A;  3PUY A;  1PYS B;  2Q2I A;  1XPR A;  1OXX K;  2ZTE A;  1X6O A;  4JI1 L;  4JI1 Q;  1B70 B;  3D31 A;  4C3I H;  3STB D;  3S1N H;  3HOY H;  3PO2 G;  1BBU A;  1IBL Q;  2H5X A;  3M4P A;  3CMA A;  5IYC G;  3CXC A;  3I7F A;  1CSP A;  3CP0 A;  1SMX A;  4B3S Q;  1HZA A;  5E7N A;  3OTO Q;  4PZ8 A;  3S2H H;  2KEN A;  1U5K A;  3PV0 A;  2RCN A;  1UE1 A;  1VQ8 A;  1N9W A;  4BBR H;  4DV2 Q;  2A19 A;  2VS1 A;  4GN3 B;  3KFU A;  3I55 A;  4GKJ Q;  1Q46 A;  2JK8 A;  4GKK Q;  4LWC A;  2HHH L;  3TS0 A;  1QVG A;  1EQR A;  4LF9 Q;  2RHQ B;  3H3V H;  4GLA C;  3F2B A;  1J5E Q;  5M5Y H;  4DAY B;  5C0X G;  4JI4 Q;  2B63 G;  4GS3 A;  3FKI G;  1VQC A;  3G71 A;  4JI6 L;  3RZD H;  2ZTD A;  3JC6 6;  3K81 C;  1VQA A;  1MJC A;  5M5X H;  2B3G A;  1YEZ A;  3MXN B;  1K73 C;  4DUZ L;  4X65 Q;  1XNR L;  1WJJ A;  4NB3 A;  1XMO Q;  4A3G G;  2JJQ A;  2N3S A;  4LF5 Q;  4HJ5 A;  4DR1 L;  1A8V A;  2E2I H;  3BZK A;  1AE2 A;  3CAM A;  1V9P A;  1VQM A;  2R7Z H;  2R7Z G;  4A3L G;  3CCV A;  4HJ7 A;  4PMW A;  4RG1 A;  3M9B A;  2PI2 A;  1CKN A;  1VQK A;  4KHP L;  5IYB H;  4A3D G;  5IYB G;  1JMC A;  5C3E G;  1K8G A;  1U0L A;  3KLW A;  4LF7 Q;  2Q2U A;  5AJ3 Q;  4JI8 L;  2IHF A;  2MO1 A;  3D0F A;  1BKB A;  2GN5 A;  3BZC A;  3EBE A;  3E9I A;  3K7A H;  4QY7 A;  4X66 Q;  3J81 i;  5LMN L;  1XNQ L;  1XPU A;  1EUJ A;  4WJ4 A;  1Y1W H;  5GRO A;  1WFQ A;  2UXB L;  3RN2 A;  3ULP A;  2WAQ E;  3CC4 A;  1YBY A;  5M5W H;  4AQY L;  4A93 H;  3G48 A;  5GAG C;  3FHW A;  4LF8 L;  1PH5 A;  4JI7 L;  3NEL A;  4GLV B;  3GDE A;  2R7F A;  3J81 j;  2JA7 H;  5LMU Q;  2ZJR A;  1VQI A;  2RHS B;  2NN6 I;  4IJL A;  4B3M L;  3UDG A;  1EYG A;  5GAH C;  2KHI A;  3NBH B;  3ZJY C;  2IX1 A;  3PCO B;  4LFC Q;  5M3F H;  1PH1 A;  2UUA L;  3PIO A;  3PIP A;  4IOA A;  1R9T H;  1YZ6 A;  3ER0 A;  3H0G H;  1PH8 A;  1WYD A;  4JV5 L;  2K5N A;  4DR4 L;  3CC7 A;  2UUB L;  2K5H A;  1YHQ A;  4GOP B;  4MZ9 A;  1CKN B;  4B3T Q;  4BXX H;  4R4Q A;  2CCZ A;  5C0X I;  1JB7 A;  4OO1 G;  3A5U A;  2PMZ E;  3PUX A;  4A3J H;  1UE7 A;  4HJA A;  1CKM A;  1SR3 A;  1T9H A;  2CFM A;  5LMN W;  4KLK A;  3KJO A;  4BY1 G;  4Y52 H;  3M3Y H;  1A62 A;  1G6P A;  3PUV A;  1DGS A;  4YCU A;  4DV4 L;  3A74 A;  3MEF A;  1HNZ L;  4GN4 B;  2ZM6 L;  1D7Q A;  3UE0 A;  4O0A A;  4LUV A;  3CCM A;  3KF6 B;  4GN5 A;  2VZA A;  2Y0S E;  2NVQ H;  2K50 A;  3AEV A;  1BVS A;  5IYC H;  3I4N H;  5JJL A;  1JT8 A;  3UDX A;  2ZJP A;  2UXC Q;  2KHJ A;  4TVA B;  4DUY L;  1HH2 P;  3J7Z C;  4JI2 L;  1SLJ A;  1C9O A;  3CCE A;  4LF6 Q;  4OON A;  1Q81 C;  3RR5 A;  1FVI A;  3F1Z A;  3STB C;  5J3B A;  3DM3 A;  3SGI A;  4DV3 L;  4HIO A;  4DR3 L;  2R93 H;  2JA5 G;  2I0Q A;  2CKZ B;  2HT1 A;  1PH3 A;  5JJI A;  4JCV E;  3GTO H;  2FXQ A;  2UUC L;  2ATW A;  1NE3 A;  5IYD G;  1EWI A;  5HY6 A;  1PV4 A;  4LUO A;  1I50 H;  2KCT A;  5FJ8 H;  4DR5 L;  1OXS C;  3K8A A;  4FDB A;  5C4X H;  5FLX c;  4DR2 L;  4YY3 Q;  4RMF A;  2VW9 A;  1B7Y B;  2PQA B;  3HOU G;  1Y1V G;  4XIG S;  4Y7N H;  1VQO A;  1PFS A;  1A0I A;  4KHZ A;  1KHI A;  4ME3 A;  1N32 Q;  4NXN L;  3AQQ A;  4JI0 Q;  4A3G H;  1NTG A;  3PO3 H;  2F4V L;  4L5R C;  3CC2 A;  2JA9 A;  1Q86 C;  1IBK L;  2LSS A;  1SRO A;  2LXJ A;  2UU9 Q;  4UP8 A;  1YIJ A;  1LM0 A;  1J6Q A;  2E2J H;  1EIY B;  2AMC B;  2LXK A;  3KDF A;  4HID A;  1W3S A;  4JI3 L;  3GTP H;  5IWA L;  1VQG A;  1LYL A;  2I5H A;  3NEM A;  1GD7 A;  3PUW A;  3PUZ A;  3U4V A;  4NPS A;  1VQP A;  3F2D A;  1N36 Q;  2A1A A;  3AFP A;  4HJ9 A;  2VQF L;  4JI0 L;  3KOJ A;  4QJF A;  3UE1 A;  2MO0 A;  1P8L A;  4EX5 A;  3CME A;  2ASB A;  2BH2 A;  1JE5 A;  1RL2 A;  1IXR A;  2B29 A;  2D0P A;  2AWN A;  1D8L A;  3KYH C;  1HZ9 A;  4LFB Q;  1HNW L;  1UEB A;  4L5S A;  2NVY H;  1FJG Q;  4MTN A;  1L1O B;  2AHO B;  3T1H Q;  1NJI C;  2ZJQ A;  1X55 A;  4UP9 A;  4A76 A;  3GTK H;  1VQD A;  1IBM L;  3GTG H;  1ASZ A;  5IP7 G;  1PH2 A;  4C3H H;  3I4M G;  4HIM A;  3BJU A;  2UUC Q;  3GO5 A;  3PF4 A;  1E3P A;  4YWL A;  5FLM G;  1KQS A;  1X9N A;  1WCM G;  1I94 Q;  1E7Z A;  1Q1E A;  4DR7 L;  1PH9 A;  4JI5 Q;  2Z0S A;  3CF5 A;  1X56 A;  5IP9 G;  5IP9 H;  4L5T A;  2E5L L;  2RF4 A;  4DV6 Q;  4QQB X;  4DV1 Q;  4POF A;  2AWO A;  3CW2 C;  2K5V A;  3L2P A;  4JBJ A;  3H0G G;  4JI2 Q;  3TRE A;  4A3I G;  4DV1 L;  1VQL A;  1WI5 A;  4BBS G;  1S3O A;  3HKZ E;  2MNA A;  3HOW G;  4JI5 L;  1N33 L;  2QA4 A;  4P75 A;  3ULL A;  2VUM H;  1I94 L;  3K0X A;  3CCS A;  1X3E A;  4A3B H;  4MNO A;  4BA2 I;  3KDF B;  2UXD Q;  1AH9 A;  1N33 Q;  5H1S E;  1HNZ Q;  1TWG H;  1I6H H;  3I4O A;  1Q82 C;  1OXV A;  2L15 A;  1NY4 A;  2D0O A;  3FKI H;  1PH6 A;  1P16 A;  1MKH A;  5JJK A;  1K0R A;  1SN8 A;  2BA0 A;  3F8T A;  4IFD I;  4DV6 L;  3T1H L;  1IZ6 A;  2E5L Q;  2OWO A;  3S17 H;  3M7N A;  4DV7 Q;  4LFB L;  1EFW A;  1QUQ A;  2Q2H A;  1Q12 A;  2XTI A;  4P71 A;  2AKW B;  4LF4 L;  4APV A;  1E22 A;  2IHE A;  3J7A 5;  2WFW A;  2HIV A;  4C3J H;  1KD1 C;  4B3T L;  4DK3 C;  4TQU S;  1VQ7 A;  3HOX H;  3CCL A;  2JA8 H;  4BY7 G;  4JV5 Q;  1N36 L;  1Q7Y C;  3M4O H;  5FLM H;  1MJE A;  4X64 Q;  2ES2 A;  1QVC A;  1VQ6 A;  2YTX A;  2GVA A;  5M3F G;  4LFC L;  1SE8 A;  1K8A C;  4LW1 A;  4GOP C;  1IBK Q;  4H02 A;  4IPH A;  4IPG A;  4KI0 A;  4NXN Q;  2VQF Q;  3KF8 B;  4IPC A;  1C7Y A;  4JOI A;  3G4S A;  5LMU L;  4BXX G;  1N32 L;  2OQK A;  1KC8 C;  3UDI A;  4JI7 Q;  4P73 A;  4A3J G;  1SFO H;  4JI3 Q;  1X65 A;  2K75 A;  1WOC A;  1OXT A;  3KF6 A;  4YY3 L;  4X64 L;  1YIT A;  3GTQ H;  4P72 A;  4DR5 Q;  3TRZ A;  4BA1 I;  1Y1W G;  4R4O A;  4AYB G;  1TWA H;  3KJP A;  5LMN Q;  1XNQ Q;  2XGT A;  1L1O C;  3ICE A;  3FP9 A;  1E24 A;  5AJ3 L;  3HOY G;  3PO3 G;  1HZB A;  3U4Z A;  2N49 A;  2VL6 A;  4LF4 Q;  4A93 G;  4DV3 Q;  4PG3 A;  2IT1 A;  5JEA J;  4DV7 L;  4XTC S;  1O7I A;  1K9M C;  2E2H H;  4QL5 A;  1ASY A;  2BH8 A;  2F52 A;  1G29 1;  4A3K H;  1SRU A;  1V43 A;  1X54 A;  2E8G A;  2Z6K A;  4DUY Q;  1PH4 A;  2NVT H;  1S40 A;  1QVF A;  2YV5 A;  4X65 L;  1E1O A;  1X3G A;  2JA5 H;  2UXD L;  1Y14 B;  3PSI A;  2CWP A;  4UP7 A;  3UDF A;  4A3M H;  4A3M G;  4A3D H;  5DLQ E;  2C35 B;  4DR3 Q;  2ZM6 Q;  3W1B A;  4YWM A;  2HQL A;  3A0J A;  4OWX B;  4O2D A;  4PZ6 A;  2R92 G;  4A3L H;  4LF6 L;  1N8R C;  3CCJ A;  4LNQ A;  4A3C G;  4A3C H;  1VCI A;  3PF5 A;  1M1K C;  1VQ9 A;  5IP7 H;  2JE6 I;  2F3I A;  1Q8K A;  4A3E G;  5GQO A;  4A3E H;  1Y1V H;  1KL9 A;  4DR7 Q;  3CQZ H;  3JAM c;  4LF9 L;  2JEA I;  1QUQ B;  2ID0 A;  4GLX A;  1WCM H;  3HOU H;  2NZH A;  2K14 A;  1KXL A;  2JA6 H;  4DV4 Q;  4DR4 Q;  4DV2 L;  3H15 A;  3I56 A;  3S1R H;  1VQB A;  2WB1 E;  1IBM Q;  4OWT B;  4IFD G;  3RLO A;  2MQH A;  4A3I H;  2EIF A;  1FJG L;  1NMF A;  4B3S L;  1I5F A;  1YHA A;  1HNW Q;  2R93 G;  1CSQ A;  1YVC A;  3I2Z A;  5M3M H;  2VUM G;  1I3Q H;  1VS0 A;  3RLN A;  4YCV A;  2QEX A;  1IBL L;  4B3M Q;  3S14 H;  1KIX A;  2UUB Q;  5IY0 A;  1IL2 A;  5EAY A;  2N78 A;  2WAQ G;  1H95 A;  1HR0 W;  3CPW A;  5IWA Q;  4AQY Q;  4C2M H;  1YNX A;  2BA1 A;  3JAM i;  2I5M X;  3HOV G;  2K52 A;  2R7D A;  1GM5 A;  2UU9 L;  1AE3 A;  1FL0 A;  3M85 A;  2F4V Q;  1L1O A;  3IRB A;  5FJ8 G;  4YHH Q;  3LGJ A;  4R4I A;  4JBK A;  3HOX G;  1PA6 A;  2B63 H;  1TXY A;  1BBW A;  1E1T A;  5GAD C;  2OQ0 A;  1IYJ B;  1TWC H;  4IJH A;  4AH6 A;  1PYB A;  1RIP A;  1W2B A;  3GTJ H;  1M90 C;  1C0A A;  4DR2 Q;  1QZH A;  2OTJ A;  4BBR G;  2ZTC A;  1VQF A;  3E9H A;  1A63 A;  1TWF H;  1YJ9 A;  2HIX A;  3T1Y L;  1CUK A;  4X66 L;  1XMO L;  1K83 H;  1XNR Q;  4L5Q A;  1PVO A;  4JYA Q;  2JQO A;  1GO3 E;  4R1J A;  3G6E A;  4LF7 L;  1OXU A;  2K4K A;  3J80 c;  4BBS H;  4JC0 A;  2IY5 B;  1EIF A;  2KBN A;  2N8N A;  3TS2 A;  5GAE C;  3GD7 A;  3CCU A;  4DV5 Q;  4AYB E;  2MFI A;  4OX9 Q;  1JJC B;  5HGQ A;  3RN5 A;  2CWA A;  2PNH A;  4DR1 Q;  3RNU A;  2VY3 A;  4AIM A;  5JEA G;  4X62 Q;  3A5Z B;  2UXC L;  1FGU A;  5C4X G;  1VQ5 A;  1GVP A;  5BR8 L;  5K36 G;  2YTV A;  1VQH A;  1UWV A;  2DUD A;  3HFZ B;  3TQY A;  3OW2 A;  3S1Q H;  4GNX A;  4IFD J;  1JJG A;  3CPF A;  3HKS A;  4JI6 Q;  3HOZ G;  3I4M H;  3HOZ H;  1KRS A;  2PI2 E;  1PHJ A;  4UY8 C;  4DV0 Q;  1HZC A;  2JA8 G;  3PO2 H;  4JBM A;  3RLF A;  4OWW B;  3RZO H;  2ALY B;  1KRT A;  2NN6 G;  1K3R A;  1NMG A;  2YU9 H;  5ELN A;  1UE6 A;  4R4C A;  2Q2T A;  4GKK L;  3S15 H;  4GKJ L;  3WWV A;  3E0E A;  1S72 A;  4JOI C;  2Y0S G;  3J81 c;  3S24 A;  1YJN A;  3EN2 A;  2VNU D;  3M4Q A;  3CD6 A;  3OYY A;  4QIW E;  4DNI A;  3OTO L;  2UUA Q;  4BY1 H;  1QZG A;  4LFA L;  4NXM L;  3CCQ A;  2WP8 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...