4A3CH

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 22
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3cH00
5BR8Q 4YY3Q 4GLVB 3M4PA 3S1RH 4LF5Q 4DR5Q 5IYCH 3I55A 1E7ZA 1Q81C 3CC2A 1N32Q 1SROA 3Q8DA 1BVSA 3G71A 1Q8KA 4GS3A 1MJCA 3H0GH 1B8AA 5M5XH 5FLMH 1WYDA 4HJ8A 1W3SA 1HNXL 3J81c 3CC7A 1H95A 3S17H 1NMFA 4HIDA 2JA5H 1N8RC 2GVAA 4LFAL 1Z9FA 1HZCA 4PZ7A 4A3IG 1CKNB 2E2JH 4FDBA 1VQCA 3KDFB 4JI1Q 3STBD 4ME3A 1VQMA 4BY1H 4A3DG 1G6PA 4JC0A 3EN2A 2MO1A 3RLFA 3K81C 1TWFH 1P8LA 1TXYA 4C3IH 2ASBA 3ULJA 4QIWE 3HOVG 4B3RQ 1B70B 3F1ZA 4DUZL 1Z47A 1Q86C 4A3BG 3TS2A 4IFDG 3S14H 4JI7Q 4A3EH 3HOUH 1K8GA 4LWCA 3T1YL 1JJGA 4IPHA 3UDIA 3MXNB 3FKIH 4Y52H 1YHQA 3CW2C 4JI8Q 1SMXA 4HIMA 1YJ9A 3JAMc 1R9TH 1VQ7A 4NXNQ 2VUMH 3PUYA 1UWVA 3CCJA 3AFQA 4X64Q 2UXDQ 1OXUA 4JOIA 1KRSA 3PCOB 2CKZB 3I56A 1VQLA 4JBWA 2PQAA 3A74A 4K0KL 2MQHA 3A5UA 2I0QA 5LMNW 3ICEA 4JV5L 3M85A 5C4XH 5LMUL 2E5LL 1X3GA 4GLAC 2HHHQ 4QGUA 4JI2L 3UDGA 3CCUA 1QUQA 2N3SA 2I5MX 2D0OA 4GOPB 1YVCA 4LF6L 4H02A 3GTQH 1YBYA 5LMNL 1QVGA 2VNUD 3CP0A 3H15A 4UY8C 2HQLA 1UE5A 1LM0A 5IWAQ 3PIPA 1W2BA 2RHSB 1HR0W 3HOVH 3S16H 1U5KA 1I50H 1Q12A 4A3LG 4DV7L 4AQYL 4A3BH 1FL0A 2Q2UA 2ZTCA 5C3EG 3H3VH 1VQHA 4DV5L 4DR2Q 3NEMA 4OONA 3U4ZA 2YV5A 4GLXA 4AYBE 1EQRA 2R6GA 2ZM6L 4OX9L 4O2DA 2JK8A 1LTLA 4R4CA 4JOIC 5M5YH 5IP7G 3CCSA 1QVCA 2CCZA 2LSSA 1OXVA 2Z6KC 1EYGA 1YZ6A 1CKMA 1A62A 5M5WH 4B3SQ 4KLKA 3AFPA 3G48A 3HKZG 1IZ6A 3B6YA 3KJOA 3S2HH 5IE8A 1NE3A 1Q1BA 4XTCS 4YCVA 2VS1A 3GTOH 2R7ZG 2K75A 2YTVA 4DUYL 4K0KQ 4ALPA 5M3MG 4JBKA 3PIOA 3GTKH 2Y0SE 4XIGS 2ZJQA 3PO2G 4BY7G 4JV5Q 5BR8L 4YY3L 4DR4L 2E2HH 3TQYA 2NVXH 4DR7L 4JYAQ 5JJLA 1QUQB 1VCIA 2VY3A 1N32L 1PH5A 4A3LH 4X65L 4LF6Q 4AH6A 4KHPQ 1VQ8A 3I4NG 3U50C 2KCTA 2ES2A 1VQGA 5C3EH 3TS0A 5IYCG 2MNAA 2A19A 1UE1A 2CQOA 2QGQA 5AJ3L 4AQYQ 3BZCA 4R4IA 3PO3G 2UXCL 1YHAA 3F8TA 5FLMG 2NVTH 1VQKA 3UDXA 4DV5Q 1GO3E 3F2BA 2ZM6Q 1L1OC 3U58A 3FHWA 4IJLA 1K9MC 2WAQE 4RMFA 2AKWB 1HNZL 1PH3A 2A1AA 1G51A 2RCNA 2C35B 4B3RL 3D31A 1JB7A 1X65A 1X6OA 2GVBA 3L2PA 4JBMA 4JI7L 4KHZA 4IOAA 1BBWA 1L1OB 3A0JA 1TWGH 5M3MH 4A76A 4MTNA 4DR1Q 3GTPH 4BY7H 4O0AA 4DKAC 1VQPA 1OTCA 3JC66 4NXNL 4LFCQ 2UUBQ 1NTGA 3KF6A 3I2ZA 4X64L 1QZHA 4HJ9A 1KC8C 3VDYA 4DPGA 3S1MH 4DR4Q 1E3PA 1VQ9A 3I4NH 2VUMG 3LGJA 4DR7Q 1VQOA 1PH4A 3I4MH 1Q1EA 1JT8A 3RLOA 2N78A 1UE6A 1L0WA 2VQEL 2OWOA 4X65Q 1WFQA 2HHHL 1EOVA 1YHBA 2AWOA 2N49A 3K7UC 4DV0Q 4B3MQ 3HOWG 3TRZA 3PO3H 1VQDA 3JAMi 3ZJYC 2NZHA 1EUJA 5C4XG 1HJPA 1YJWA 2K5HA 5C0XI 5AJ3Q 2IY5B 4YCUA 5IWAL 1PH1A 2UXCQ 1OXXK 1TWAH 4A3JH 1C0AA 4IO9A 3OTOL 4R4QA 1KIXA 4L5SA 2UU9L 3J81j 4DR2L 2L15A 2PMZE 1Y14B 5C44G 3T1HL 1X3FA 1HNZQ 5GAEC 2LXKA 4POGA 4A3MG 1RL2A 2OTLA 2IX1A 1V9PA 4HJ7A 2V1CC 2R92G 2B3GA 4B3SL 3RZOH 1A63A 2RF4A 1J6QA 2JA6G 1IBMQ 3DM3A 1XNQQ 1CKOA 5JEAJ 1D8LA 4P72A 1N36L 3HOWH 4X62Q 1LUZA 2NVQH 1VQBA 2K5NA 3M7NA 2CWAA 5M3FH 2IX0A 5C0XJ 2VQEQ 1T9HA 4JYAL 2KCMA 2DGYA 2JQOA 4IPCA 4LF9Q 2R93H 1PVOA 2DUDA 2N8NA 3ERSX 2CFMA 1YI2A 4R4OA 4BXXG 1XNRL 4BA1I 3CPFA 1GVPA 3HKSA 1EQQA 1E22A 4KHPL 3AQQA 1CSPA 4UP9A 2QEXA 1VQAA 4IOCA 1VQFA 3PV0A 4AYBG 3SGIA 1Q82C 5C44H 4DV4Q 1SE8A 3FP9A 4A3MH 3GTMH 1Q46A 1XTDA 3HOXH 1JMCA 1K83H 1SLJA 3OTOQ 2ATWA 4X66Q 3L0OA 1KRTA 4JI6L 2UU9Q 3KF8B 1D7QA 1YNXA 3T1HQ 2R92H 5IP9G 1VQEA 4DR3Q 4LFBQ 2AMCB 3TEHB 3W1BA 1WJJA 2HT1A 4DV1L 2OTJA 1XPUA 1M90C 2JA6H 4BBSH 1VS0A 1IL2A 2JA8G 4JCVE 1I94L 3TREA 2YYZA 2D62A 5GQOA 4C3HH 2XGTA 4R1JA 2Y0SG 5GAHC 4DR1L 1XMQL 1MKHA 4OO1I 1GKHA 4LFCL 2UUBL 3W5OA 2XTIA 5FJ8H 5GROA 1N36Q 2PQAB 4BXXH 1OXTA 1MJEA 3HOUG 3I4MG 1X9NA 3NBHB 4L5TA 1WCMG 4LW1A 3S1NH 1ASYA 4HIOA 3PUXA 1CUKA 2WFWA 3CXCA 1YEZA 4PG3A 1RIPA 5GAGC 4EQ5A 1XNRQ 4DV0L 4B3ML 4GKJL 4DV3L 3S1QH 3OYYA 3UE1A 1YITA 2HIXA 4GNXA 4LUZA 2UXBL 1E1TA 1PYSB 5IP9H 1DGSA 1NBWA 2WAQG 2WB1E 2Q2TA 4LF4Q 5ELOA 1LYLA 1AH9A 1K0RA 4JI6Q 2JA8H 1FVIA 4MNOA 1KXLA 1SR3A 3HKZE 1QVFA 2KHJA 4PZ6A 4DAYB 1SFOH 4GN3B 2JA7G 3PUVA 2JA9A 4DV1Q 3RLNA 1K73C 2JEAI 5IYDG 4A3JG 1V1QA 1I94Q 5H1SE 1CSQA 2PI2A 4NPSA 1VQIA 3J81i 5ELNA 1XMQQ 1PYBA 3GTJH 4OWTB 1C7YA 2PI2E 1WCMH 4B3TL 1XPOA 1FJGL 1S3OA 2F4VQ 4AIMA 1VQ5A 3J80c 1PH9A 1IBML 1HZ9A 5JJIA 1XNQL 5JJKA 4IPGA 1CKNA 1FGUA 2JE6I 2ZTEA 3KOJA 3KDFA 3CCLA 4X6AH 4JI4Q 3BJUA 4X62L 4YHHQ 4LNQA 2YTXA 4GNXC 4L5QA 1X3EA 2LXJA 1JJ2A 3E9HA 4KI0A 4LF9L 2K50A 3F2CA 4A93H 4OXPA 1I5FA 4DK3C 4DV3Q 1QZGA 3RN5A 1AE2A 1GD7A 4GKJQ 1TWCH 1S40A 2UXBQ 5M3FG 4OO1G 1M1KC 5FLXc 4A3GH 3CF5A 4QJFA 4IFDJ 2R93G 2JA7H 1IXRA 1VQ4A 3CD6A 1HNWL 2UUCL 4BA2I 3J7A5 5C4JH 4DV4L 4JI5L 5IYDH 3ULLA 4P75A 3PF5A 3K80C 1J5EL 1HH2P 4X66L 1TWHH 2CWPA 1BKBA 3G6EA 2JEBI 2NVYH 4P73A 1K8AC 1PFSA 1PV4A 3G4SA 2IT1A 4DR3L 1JE5A 4NXML 4LFBL 3S24A 3HOXG 4GKKQ 4A75A 5GADC 1EFWA 3OW2A 1SRUA 1HZAA 1WI5A 2MFIA 4GOPA 2E8GA 3BU2A 1FJGQ 3CMEA 4B3TQ 3UDFA 4YCWA 3WWVA 4UP7A 3NELA 3CMAA 1VQJA 3KF6B 4YWMA 4DNIA 2I5HA 2OQKA 3CQZH 2PNHA 4NB3A 1IBLL 4BBSG 1KAWA 2ZTDA 3AYHB 4J15A 4OWXB 2EQSA 2HIVA 3HOYH 4DV6Q 4A3FH 4JI0Q 3M4QA 1U0LA 2VZAA 2NN6I 1EIYB 2R7DA 1B7YB 1VQNA 1N33L 2NZOA 5FJ8G 1L2FA 2BH8A 1N34Q 4EX5A 3L7ZC 4C2MH 3F2DA 1JJCB 3CCQA 1KHIA 4LF8Q 1X56A 2IHFA 3E9IA 3CCVA 4A3KH 3MEFA 3GDEA 3NENA 5K36G 1X54A 4GN5A 3K0XA 2VQFL 3S2DH 1HNWQ 3PF4A 3CCRA 2UUCQ 4LF7Q 4QQBX 3CAMA 1N9WA 2R7FA 4JI5Q 4JI3L 1IBKL 4A3CG 4LF4L 2Z6KA 1J5EQ 2UUAL 3GTLH 2MO0A 4GOPC 1P16A 3HOZG 4DAMA 2E2IH 3ER0A 5IY0A 2OQ0A 3ULPA 4NXMQ 3D0FA 3W1GA 1XPRA 1PH2A 1UEBA 4PMWA 3A5ZB 3PUWA 4POFA 4A3IH 2D0PA 2RHQB 4UP8A 2F52A 2B63G 4A3DH 5JEAG 4Y7NH 1VQ6A 1ASZA 2VL6A 2A8VA 3CC4A 2QA4A 5IT9c 1PH6A 1HNXQ 1PHJA 2YU9H 4OWWB 2FXQA 3EIVA 1NY4A 4R4TA 1XJVA 4WJ4A 3GO5A 3KJPA 4LFAQ 1IBLQ 3EBEA 5C0XG 1KL9A 3CPWA 2F4VL 1WOCA 4P74A 3CCMA 5J3BA 2Q2HA 3M9BA 4LUOA 4DR6L 1O7IA 1S72A 1G291 1XMOL 3RZDH 3M3YH 3I4OA 1UE7A 1PA6A 3KFUA 1A8VA 4JI4L 4YHHL 1N33Q 2WP8J 1PH7A 1KQSA 4DUZQ 4GN4B 4JBJA 1HR0L 4APVA 2ZJPA 3RR5A 3T1YQ 2WB1G 2JJQA 3PUZA 4A3CH 1K3RA 2VW9A 3KLWA 1E24A 1GM5A 1L1OA 2VQFQ 4WJ3M 3HOZH 3J80i 3E0EA 2ALYB 4HJ5A 4IPDA 4TVAB 1YJNA 1IBKQ 4JI3Q 1EWIA 4IJHA 4DV2L 1Y1VG 4A93G 1SN8A 1Y1WG 2UUAQ 1Q7YC 2BH2A 1NMGA 2B63H 1KD1C 2AWNA 2I5LX 2KENA 3IRBA 4A3GG 1X55A 3I7FA 5DLQE 1V43A 4L5RC 5IYBG 4P71A 1NJIC 2F3IA 2NN6G 2Z0SA 5LMUQ 3GD7A 5HY6A 4JI2Q 4BBRG 4DR5L 2K5VA 2E5LQ 4LF5L 3J7ZC 4IFDI 2GN5A 2BA1A 3HFZB 4RG1A 4YWKA 4GKKL 3H3VI 3CCEA 2BA0A 2IHEA 3RNUA 4DK6C 1A0IA 5LMNQ 3S15H 3UE0A 4UPAA 3U4VA 4MZ9A 4PZ8A 3PGZA 3PSIA 1HZBA 4QL5A 2EIFA 4HJAA 4LUVA 4C3JH 4DV7Q 3H0GG 4DR6Q 2K52A 3KYHC 5IP7H 1OXSC 1XMOQ 1YIJA 3K8AA 4JI1L 1E1OA 3DLLA 1PH8A 4DV6L 2K14A 3GTGH 4JI0L 4YWLA 3RN2A 2JA5G 4OX9Q 2KBNA 5HGQA 1HR0Q 2B29A 2EXDA 3K7AH 5EAYA 4HIKA 2YTYA 4BY1G 1N34L 3BZKA 2R7ZH 1C9OA 1Y1VH 3HOYG 4A3FG 1Y1WH 1I3QH 1IYJB 2Q2IA 4GNXB 4LF8L 2H5XA 4JI8L 1EIFA 2KHIA 3PO2H 4JG2A 1I6HH 2AHOB 2ZJRA 5IYBH 4A4IA 3M4OH 4QY7A 1BBUA 2K4KA 2OCEA 4TQUS 4BBRH 1MIUA 4DUYQ 4DV2Q 2ID0A 4A3EG 3STBC 4LF7L 3AEVA 2UXDL 3FKIG 4A3KG 1AE3A 5E7NA
chains in the Genus database with same CATH superfamily
1Z6HA 5BR8Q 2R7ZB 4DK1A 1KABA 4GLVB 4IN3A 5M3MB 4R9WA 4LF5Q 3I72A 3CC2A 3I55A 1I6HB 1N32Q 2OT2A 1SROA 5LL6S 4M1UB 4GS3A 4UDUC 3H0GH 5I2YA 5M5XH 3S1MB 4IZ8A 2NWGA 1NMFA 1N8RC 2GVAA 1HZCA 1A2TA 1CKNB 1LTTD 4A3DG 5EKKA 1G2TA 1ZYRD 2EYLA 3PO3B 2F0LA 3BYTB 1PZJD 4C3IH 5IGBA 2ASBA 1TVXA 3F1ZA 1Z47A 1HUMA 3OW7A 2J0TD 3R93A 1SMXA 4HIMA 4NXNQ 3JAMc 2QCPX 2ICIA 3PUYA 4G4KA 4H44C 1PMRA 3VYUA 1HPCA 1OXUA 1ZKOA 5E4XA 3I56A 4H13C 2PQAA 3A74A 3S14B 1EY6A 1CFMA 1E0BA 4H7BA 4F88A 1TY2A 1CA5A 2C9OA 5LMUL 1X3GA 2NZ1D 2HHHQ 2N3SA 4GOPB 2F0WA 1YVCA 3CHBD 3D6CA 1YBYA 2HUGA 3HOWB 2VNUD 2MHVA 4QB4A 2HQLA 1UE5A 4CDDC 1ICFB 3PIPA 1W2BA 1O7LA 5C4XB 1Q12A 2EYPA 3OMCA 4AQYL 5IODA 4A3BH 4IFDH 4FXDA 2F3WA 2ZTCA 3K0YA 3H3VH 4DV5L 4OONA 3U4ZA 4AYBE 1EQRA 1W6KA 4O2DA 3A56A 3CCSA 4WORA 2JP1A 3PMFA 2CCZA 1ENCA 1K83B 5M5WH 1GUSA 3AFPA 3ONAB 1SNMA 4PMCA 1K0SA 2JN4A 2Z4IA 3C2PA 1B2TA 1F77A 4DR4L 1SE4A 1F9RA 3QOLA 1RF2D 2NVXH 1TQOA 3H6MA 5CR3A 3BS1A 2B2VC 2XWBB 1QUQB 1VCIA 2VY3A 4R8IA 4LF6Q 5IOCA 3Q0AA 3I4NG 1BQQT 1VQGA 5C3EH 1SYFA 3L3OC 3NXWA 2QGQA 1GJXA 4DA2A 1VQKA 2XSCA 2J7ZA 2QF7A 2AQ3B 1GUNA 3U58A 1K9MC 4FF2A 1PH3A 2M00A 2A1AA 1G51A 3SHLA 1JB7A 3L2PA 4IOAA 4OL7A 1L1OB 1TWGH 2NVTB 4O0AA 1S5BD 2R61A 3JC66 4LFCQ 2UUBQ 3A7AB 2Y0SB 3KF6A 4X64L 1KC8C 1NR2A 3VDYA 1SNOA 1CQFA 3RUZA 1HTPA 1OO9B 1AEXA 3LGJA 3GTPB 4DR7Q 1VQOA 3NTHA 1LTID 5C3XA 5KGUA 3DXJC 4CHTB 3GTJB 1UE6A 4DV0Q 3VR3A 2L12A 1QE6A 1A2UA 2KEDA 2QEJC 1EUJA 2RDGA 1F9QA 1HJPA 3PIP3 5FOBB 1IKMA 1PRTF 2EDGA 2RVLA 2B2WA 4R4QA 1WTPA 1X3FA 1HNZQ 1GXDC 3ITPA 1RL2A 1V9PA 2P5ZX 4HJ7A 3X3NA 1TWAB 2V1CC 2B3GA 2SNSA 5EKLA 1A63A 3J7YW 1TWHB 1HCZA 4K5WA 2K1BA 2JA6G 2NVYB 2EYHA 4P2CB 1GOZA 2A74C 1VQBA 1Y69U 3MC0B 5AFWA 2VQEQ 4A3LG 2IL8A 2JQOA 2NBFA 4IPCA 4LF9Q 2R93H 3FPUB 1NAPA 1AN8A 1WTXA 3CPFA 3DHQA 4KHPL 1E22A 4M8AA 4G7ZC 1CSPA 4FXKC 4UP9A 3HS0C 1Q82C 2K5WA 3A8IE 5C44H 4DV4Q 2F0FA 1EY4A 4A3MH 3HOXH 1JMCA 3OTOQ 1AZPA 4QMGA 3I90A 4JI6L 2R92H 2F1MA 5IP9G 1VQEA 4LFBQ 2A6EC 2HT1A 2OTJA 5ELEA 2KCCA 3S2DB 1IL2A 2JA8G 5JPMC 1I94L 2YYZA 4C3HH 2ZXRA 3EJIA 4R1JA 5J22A 1SMYD 3SE0A 2ICEC 2EY6A 2SEBD 3T56B 1YNJC 1EYAA 2FHTA 4WRDA 2B39A 4BBSB 4BXXH 3K59A 1LT5D 1XXGA 2EYMA 4LW1A 5D3IB 2YU9B 4EGVA 4PG3A 2KQ3A 5GAGC 3MEHA 4B3ML 4GKJL 4DV3L 3OYYA 1QOHA 2HIXA 4LUZA 1DGSA 1DZ1A 2WAQG 4V0BA 3BYYB 1AH9A 1F2YA 1K0RA 4XYOA 4JK1C 4PQXA 1QVFA 2KHJA 3DEOA 4CBVA 2JA7G 1S4ZA 3RLNA 2HQEA 4QUFA 3P7JA 5KNBA 1KNEA 2NUCA 1CSQA 4NPSA 4F8MA 3HOUH 3I4MH 5CGKA 1WCMH 1XPOA 1ET6A 2PZUA 2PNRC 3J80c 5C5LA 2KUMA 1IBML 1EY9A 1XNQL 4IPGA 1LT3D 2JE6I 3KOJA 3CU7A 4X6AH 4JI4Q 4YHHQ 3K5LA 1U9RA 3AU7A 4KI0A 4PV1C 5CV7A 4DK0A 1I5FA 1AE2A 1GD7A 1TY0A 5EBDA 2NB0A 1S40A 5M3FG 2WB1B 1DOMA 4QJFA 1VQ4A 3LWUA 1C48A 3HKZB 2UUCL 2G9HD 4BA2I 1EL0A 3K7AB 2LMCB 3A8KE 3K80C 3AMUA 1ENAA 1HH2P 1I3QB 3NP8A 1I4XA 2CH4A 2KA7A 4GKKQ 1CTMA 4A75A 5GADC 1HZAA 2LKVA 2MFIA 4YCWA 1RTOA 3NELA 2SOBA 4FF1A 2ZTDA 3AYHB 2HIVA 2E76C 3HOYH 4A3FH 1LO5D 4OEMB 4JI0Q 3BZDB 1EIYB 4FF4A 2R3ZA 1N33L 1L2FA 3L7ZC 4OO1H 3CQZB 1KHIA 2E2JB 2IHFA 3CCVA 3MEFA 2K5QA 3Q24A 3NENA 1X54A 1PFNA 4GN5A 3I4LA 3PF4A 4LF7Q 4DF7A 5I6WA 1N9WA 2EXZA 4LF4L 4C2MB 3KLSX 1J5EQ 4KJOA 2QDLA 3GTLH 4GOPC 3HOZG 1CI3M 3MAQA 3D0FA 1XPRA 1BUVT 3EFXD 3PUWA 4A3IH 4UP8A 1SDFA 3NBIA 1PH6A 4R4TA 3GO5A 2E2IB 5C0XG 2F4VL 1QJOA 5IGFA 4DR6L 5ELDA 1F2MA 1O7IA 1LT4D 1G291 4ZQ3A 3RZDH 1XMOL 3I4OA 4ZKBB 3KFUA 4A3DB 3OHXC 5FO7B 4XDXA 5EGTA 3T1YQ 1D2BA 2K03A 3BDLA 2JJQA 3PUZA 4IURA 3NUCA 2VW9A 2X6LA 1RTNA 2SNMA 4WJ3M 4IPDA 4TVAB 4JI3Q 1EWIA 2BDNA 2X6GA 1Y1VG 2UUAQ 1Q7YC 5M5YB 1D5MC 1NMGA 5CV5A 3IRBA 4A3GG 2K32A 5DLQE 5IYBG 1IYUA 2F3IA 4N8FA 2E5LQ 4LF5L 4IFDI 4YWKA 1STEA 3H3VI 2D2CC 5LMNQ 3GTKB 3UE0A 4UPAA 1D1KA 4IUNA 5J39A 4QL5A 1F9SA 5ISRA 2EIFA 5HURA 4C3JH 3EQLC 3H0GG 4B9XA 2F0OA 5IP7H 3K8AA 3DLLA 1E1OA 1EYCA 2K14A 5KNCA 2B29A 3J81E 3K5MA 1EQTA 2R7ZH 1Y1WH 1PFBA 4GNXB 1EFID 2K04A 1I6HH 4JG2A 1VMCA 4A4IA 4LK1C 4CJ2C 2RKSA 1TS4A 4IQZA 4N9PA 2ID0A 1AE3A 2VB3X 5EPLA 1KAAA 4DR5Q 1SAPA 5IYCH 1E7ZA 2F0VA 5IGCA 3G71A 1Q8KA 4DAPA 3V96A 1JICA 5FLMH 4RGNA 4N8X1 3I4NB 3Q6SA 3HEJA 2N88A 3CC7A 2JA5H 4LFAL 1Z9FA 4FDBA 4JI1Q 3STBD 4LAAA 5DM73 1G6PA 1WTHA 2L9HA 2MO1A 3ERQA 3K81C 1TWFH 1P8LA 1TXYA 1PFMA 1Q86C 2I07B 3C46A 4KD4A 4A3BG 4IFDG 1PXUA 3S14H 4JI7Q 4A3EH 1HQRD 1K8GA 2MGSA 1CA6A 4XQQA 3MXNB 4Y52H 3CW2C 3NHHA 2LY7A 4Q0FA 4NKLA 2VUMH 3AFQA 4ABNA 2F4IA 3ND9A 1CQVA 4CJ0B 1MSGA 4JBWA 1HTLD 2I0QA 3NBHA 1STHA 3RZOB 5C4XH 2C5CA 4JI2L 4RCNA 3UDGA 2D0OA 3VYRA 3A8JE 4LF6L 4UAIA 1SMYC 1O78A 1AW7A 3MWYW 4K5XA 1YNND 3H15A 2BDOA 1MGSA 2B2VA 1LM0A 5IWAQ 2RHSB 1HR0W 3K6OA 3DWQA 1B44D 4DV7L 3E3XA 3QOJA 2CW0C 1GUGA 1PRTC 4H0LC 4KV6A 5JAVA 5C3EG 1BCPF 2FMCA 4ID6A 2KECA 3HG9A 3S9WA 1GHJA 1EQVA 2F0EA 2EVBA 4OX9L 2JK8A 1LTLA 2XN9C 3S16B 1EYGA 1YZ6A 4B3SQ 3G48A 3HKZG 4HMJA 3B6YA 5IE8A 2K5DA 3GTOH 2CVRA 2JA6B 3AB9A 3PIOA 2Y0SE 2ZJQA 3PO2G 4JV5Q 4YY3L 1TS2A 2E2HH 2XWJB 4DR7L 4HMIA 5JJLA 1PH5A 1ONLA 4A3LH 2L11A 4CKCA 1VQ8A 3U50C 2ES2A 1HQMC 1RD9D 2MNAA 2Z6BA 1UE1A 1TR5A 1XTCD 2B2UA 1MD2D 5JJZA 3SK5A 5C4HA 4R4IA 3F8TA 2NVTH 1F9PA 2WIIB 4CDFC 1ENFA 1X32A 5E1FA 3S1QB 3F2BA 2ZM6Q 4IJLA 1V1OA 1HNZL 3VR2A 3HZXA 4HEDA 4B3RL 2MP1A 4X3SA 2GVBA 3KLSA 1SSOA 3FMCA 1CZGA 3EA6A 1BBWA 3A0JA 1DYQA 3GTPH 1JORA 4MTNA 2JA8B 3HP3A 5E4WC 1BCPB 1VQPA 1OTCA 4BY7H 2TMPA 1J9OA 2H1EA 1VQ9A 1PH4A 2N78A 1L0WA 2VQEL 3OIQA 1BCPD 5C3WA 1YHBA 3FPPA 4RGMA 2O2LD 2K5HA 3NWSA 2CH4W 5AJ3Q 2F0GA 4QCLA 1QWYA 1HFNA 1TWAH 1C0AA 2WAQB 3OTOL 3RMHA 2BE5D 1TWCB 1KIXA 2K01A 3J81j 4DR2L 2L15A 5C44G 5GAEC 4POGA 2O5IC 1I4GA 4A3MG 3E0JA 2JA7B 2FMMA 1EWHA 3Q22A 3IKJA 2R92G 5I4DA 1C8CA 3D4DA 4RGTA 4KJNA 4UHVA 1CKOA 3PIO3 5JVH3 4P72A 4EQOA 4X62Q 3U9SA 1LUZA 2NVQH 2HD3A 1KLGD 1T9HA 3SXHA 4JYAL 2KCMA 1XX8A 2DUDA 2N8NA 2IX3A 1SJED 4BXXG 4BA1I 1GVPA 4K6DA 2EOTA 4QUCA 2DNEA 1NR4A 1VQAA 4ZLTF 5M3FB 2ZXPA 1SLJA 1D1IA 4LMQD 3NTIA 1KRTA 1GHKA 1YNXA 3T1HQ 2D5DA 1SJHD 4DR3Q 1NNXA 1TIID 3TEHB 3W1BA 1WJJA 1XPUA 5T1GA 3SK6A 4BBSH 2N55A 3GTMB 2D62A 2DNCA 2XGTA 2XIWA 5GAHC 4DR1L 2PZWA 1MKHA 3U9OA 3W2DA 4OO1I 1F2LA 1S5DD 1K8MA 3W5OA 4FXGC 1O7YA 1G2SA 1N36Q 1EEID 2PYKA 1AP0A 4KK7A 3HOUG 3I4MG 1X9NA 3IAYA 1WCMG 1I6VC 1ASYA 2PO4A 4FYDA 3M4YA 1IW7D 2SDFA 3CXCA 2KJXA 4B9WA 1RIPA 4IALA 4RWSC 1EY5A 1B50A 3UE1A 1YITA 3BVZA 4S3SA 4LJZC 3M3YB 1JOKA 3S1NB 4Z9CB 1UEAB 5JVG3 2WB1E 3QO2A 1LYLA 1HHVA 3WOEA 1FVIA 1SR3A 3HKZE 2KOLA 1SFOH 4PZ6A 4GN3B 5HGTA 3PUVA 5FLXE 3HOZB 4A3JG 1V1QA 1EZ8A 5H1SE 2RDHA 1MSHA 1J8IA 1K28A 1XMQQ 4C1NI 2PI2E 2HDMA 1VQ5A 1PH9A 5JJIA 1CKNA 4RA8A 5FLXL 2YTXA 4GNXC 1X3EA 5KYLA 1JJ2A 3E9HA 2JXMB 1B3QA 2B2UC 3VR4A 1CM9A 3MFGA 3F2CA 4OXPA 1LACA 5E3FA 1S5ED 3J7AV 4XQNA 2I46A 4K6LA 3CD6A 3TSSA 4KKSA 2EYOA 3E5SA 2EJMA 1J5EL 1Y1VB 1B53A 1DXMA 4X66L 1HA6A 1DOLA 1K8AC 1PFSA 1PV4A 4A3GB 1H9MA 3M4OB 3FVQA 1V1PB 2PW7A 1SRUA 4GOPA 2E8GA 2WINB 1FJGQ 2L1BA 3CMEA 3UDFA 4B3TQ 1WD0A 4ZAIA 3CQZH 1KAWA 4OWXB 2V4DA 1PLFA 3KBGA 1T5EA 2EQSA 3H0GB 4DV6Q 4L8JA 2ZT9C 2KCNA 1II3A 3SDZA 3T16A 5IT9E 2EJFC 5FJ8G 4C2MH 3CCQA 1QNKA 3E9IA 4A3KH 4RKLA 4X3TA 5K36G 1VDZA 1HNWQ 3OSOA 3CAMA 2R7FA 4K5VA 4JI3L 5ELFA 4HCSA 2ENBA 2UUAL 1LTAD 2RSNA 5IT9L 3V2TA 1P16A 2E2IH 3ER0A 5IY0A 3ULPA 4NXMQ 1E2ZA 5BN5A 3W1GA 2B8FA 1IKLA 1UEBA 4PMWA 2F0UA 2D0PA 2RHQB 4A3DH 1STNA 2VL6A 3CC4A 3TN2A 2QA4A 3G6JB 1NY4A 2A73B 4BWGB 2KVMA 1SXTA 1IBLQ 1KL9A 2F0DA 2Q2HA 4XT1B 1WD1A 4KKUA 4Y7NB 2WP8J 1PH7A 1KQSA 4C3JG 4JBJA 5DNFA 3QB3A 1IHZA 1KTKA 4A3CH 4A3BB 1K3RA 3OOCA 4OIKA 2HCCA 1L1OA 2FINB 2VQFQ 2D9UA 3E0EA 1YJNA 1IBKQ 1WVLA 3H09A 4A93G 1Y1WG 4TKOB 3C1FA 2B63H 2RCFA 2KENA 1X55A 5M5WB 5LMUQ 3OW2A 2Z0SA 4DR5L 5KEEA 1SEBD 2K5VA 3O13A 3J7ZC 3MFYA 3I73A 2GN5A 2BA1A 3CKIB 2BA0A 2IHEA 5FKAC 3RNUA 1VMPA 1A0IA 3S15H 4MN3A 4MZ9A 3D4WA 3PGZA 2NVXB 1CHQD 4HJAA 2XRQD 1K8OA 4FP5D 1YIJA 4JI1L 1KDCA 1PH8A 1IL8A 5C3EB 3RN2A 2JA5G 1BCPC 3QR8A 5EAYA 1N34L 3BZKA 2CHBD 4LF8L 3MTSA 1IYVA 2AHOB 3KLRA 4QY7A 5FK9C 4TQUS 4BBRH 1MIUA 2XRSD 4A3EG 3TP7A 1DM0B 4O1NA 2NYZD 2G5DA 1ZYRC 2RSOA 2BE5C 3D3RA 3S1RH 3PO2B 1Q81C 2K28A 3GV3A 3Q8DA 1BVSA 3I91A 1Z7TA 1B8AA 1WYDA 4DU9A 1W3SA 4ZKCB 1HNXL 3J81c 3S17H 4HIDA 3WOFA 2NTTA 5KYIA 4JPBW 4BY1H 3KDFB 4ME3A 2Z4HA 4QF4A 3RD4A 3SVMA 1MHWC 1UAPA 1LV9A 4DUZL 3TS2A 1G6ZA 3FKIH 1WTRA 3P75A 1YHQA 4JI8Q 4CDEC 1VQ7A 1R9TH 3MZ5A 2JSOA 1T5XD 3CCJA 5CV4A 4X64Q 2UXDQ 2NTSA 3PCOB 3P1HA 1EYDA 1STAA 2PZTA 2MQHA 4G7HC 2VXWA 4JV5L 2F0TA 1A6XA 1JC7A 5D3DA 2I5MX 1HUNA 3GTQH 2FJ2A 1QVGA 3CP0A 3J7AF 2EZVA 4E6IA 1VF5C 3NK9A 3HOVH 4EVOA 1U5KA 1K3BC 5C4ZA 3S16H 2Z8LA 1A3UA 1Q3LA 1C4QA 1JQYD 4JW0A 1FL0A 2Q2UA 4QIWB 3NEMA 4GLXA 1IW7C 2ZM6L 4PMBA 4JOIC 5C44B 1I50B 1OXVA 2LSSA 4A3MB 3PQIA 3TP5A 3TZDA 5KNDA 5CC4A 4G7OC 2R92B 3S2HH 2M2LA 4XTCS 1XWEA 2YTVA 4DUYL 2WKDA 4K0KQ 4ALPA 3H94A 1SNDA 4BY7G 5BR8L 1V8QA 1I4PA 4ZYSA 3N52A 2HDLA 3MXGA 1TS5A 1N32L 1DCZA 3T4AC 4KHPQ 3R2IA 4F87A 1Y8OB 2KCTA 3DMUA 4HSVA 2E74C 2CQOA 1EWCA 3QIAA 5AJ3L 4O42A 1JE4A 3Q23A 3BZCA 4DXGA 1RHPA 1JWMD 3UDXA 3I8ZA 2PPBC 4CKEA 1L1OC 4ULLA 3FHWA 2WAQE 4RMFA 2AKWB 2RCNA 2C35B 4Q5VA 4TRDA 1B1ZA 4KHZA 4F7XA 5M3MH 2Q8IB 1RODA 2E75C 4C3IG 4DKAC 4V190 3L9AX 4NXNL 3C3LA 3I2ZA 1QG7A 1QZHA 4HJ9A 3TZUA 3S1MH 1E3PA 4IUTA 3J81L 1M4VA 2F03A 1Q1EA 3I4MB 3RLOA 3HOUB 1WCMB 2OWOA 5IGGA 1WFQA 2A69D 4X65Q 2HHHL 5EBCA 4B3MQ 3K7UC 3TRZA 3PO3H 2NZHA 1SYEA 4J1MA 3VYTA 1LTRD 2EYJA 3MHBA 1FYCA 1L0YB 2L4NA 2UXCQ 4DFAA 1MBYA 4I65A 1PTOF 5CV9A 2WV6D 3D4RA 3I70A 5JPNC 3KF8A 3T1HL 5JOBA 2LXKA 1LABA 2OTLA 5F2DA 5CV6A 1U4MA 1H9SB 2B2TA 4A3JB 4CJ1B 5IGEA 2RF4A 1J6QA 2Z9HA 2HCIA 1IBMQ 3DM3A 1XNQQ 1EY7A 4KHVA 5JEAJ 1D8LA 1N36L 3HOWH 3NPPA 2Q8TA 4CGYB 5M3FH 4DN4M 1SYGA 3BG3A 3ERSX 1YI2A 4R4OA 1FNWA 1B3AA 2K05A 3HKSA 4K2LA 3AQQA 2QW7A 5EPJA 1LTSD 4IOCA 1VQFA 3PV0A 4AYBG 4RH6A 4X3UA 1SE8A 3GTMH 1Q46A 2PMZB 5CBAE 1K83H 1TKWB 1I4HA 1RJTA 3L0OA 3N6RA 2UU9Q 1D7QA 4N9TA 4DAYA 4DAVA 2AMCB 1M90C 2WKCA 1ZXTA 4JCVE 3CRLC 1Q8IA 5GQOA 4XQJA 1PTOB 5J1ZA 3GTLB 1XMQL 4OIJA 4I7AA 1R4PB 4LFCL 2UUBL 2XTIA 2PQAB 1ESRA 1STYA 3QWNA 1MJEA 4L5TA 1BNZA 3S1NH 1BR9A 4HIOA 1HA5A 1CUKA 2WFWA 3TBIB 1PTOD 1XNRQ 4EQ5A 1QILA 2AUKA 4DV0L 4GNXA 1FNUA 5I2XA 1E1TA 2MUYA 1PYSB 3NQTA 2Q2TA 1B9NA 4LF4Q 1S5CD 1SNCA 4MNOA 1R4QB 1F2ZA 3HGBA 1FD7D 2JA9A 4DV1Q 2EJGC 1K73C 2RA4A 3GP7A 3MXUA 2EYFA 2X69A 3TP8A 5A2QE 1ZEQX 2PQEA 3IFTA 1VQIA 3J81i 5ELNA 1PYBA 3GTJH 1FJGL 1C7YA 4B3TL 5KIXA 2F4VQ 4NDXA 5EKIA 5JJKA 1FGUA 3CCLA 1HXYD 2WACA 4LNQA 4L5QA 1JWUD 5A2QL 3T51B 2BOSA 5COYA 1ET9A 2QKIC 5BN3A 4LF9L 2K50A 4C3JB 2ZXOA 4DK3C 5TSSA 1AFPA 3MXNA 2UXBQ 5FLXc 4A3GH 1EU4A 4MHEA 2R93G 1IXRA 2EY1A 1HNWL 3SK4A 1KNAA 4DV4L 5IYDH 5CV8A 4KN4C 4P75A 5D14A 5L37A 4A93B 1Y1WB 1TWHH 3G6EA 2NVYH 1KDBA 3G4SA 2IT1A 1JE5A 4NXML 4LFBL 3HOXG 1EFWA 2DY7A 5C4JB 1EY0A 4WFN3 1EY8A 4UP7A 1VQJA 3KF6B 4YWMA 1DONA 1W6JA 3D6WA 4NB3A 1IBLL 3OIPA 2A5HA 4ZCKA 4J15A 4C3HG 4J6HA 1M8AA 1RDPD 1U0LA 2R7DA 2VB2X 1B9MA 2CQAA 4YIJA 3F2DA 1JJCB 2J4XA 2JA5B 3GDEA 4DNTB 1TWFB 2VQFL 3S2DH 4K8JA 4JI5Q 1IBKL 3LX0A 4A3CG 2Z6KA 3NE5B 4A3EB 1EOTA 2F0IA 2B2TC 2MO0A 4RHRA 4IUPA 2OQ0A 3NQIA 1BDOA 5DM63 2VUMB 3TP6A 1PH2A 3P20A 3A5ZB 4KTAA 1O80A 2B63G 4Y7NH 3VR5A 1ASZA 1VQ6A 2A8VA 5IT9c 3K58A 2YU9H 1PHJA 2FXQA 2OEOA 3A54A 3T53B 1XJVA 5I9PA 4LFAQ 3CPWA 1WOCA 4P74A 3CCMA 5J3BA 4DGZA 1S72A 4B08A 1UE7A 1PA6A 1A8VA 4JI4L 4YHHL 4GN4B 2E2DC 2O5JC 2XVSA 4APVA 2ZJPA 2RBMA 3FDTA 4IUQA 3KLWA 1GM5A 1E2VA 1LLRD 3K5NA 4HJ5A 1JR0D 2QDBA 4CKBA 2B2YC 3ZYYX 1RCVD 4IJHA 1SN8A 4ZK9B 1QNUA 5JEAH 2Z1CA 1LTBD 1NJIC 3GD7A 4JI2Q 4BBRG 3HFZB 3DM1A 4GKKL 5IGDA 1BF4A 3GTOB 4DK6C 3U4VA 4PZ8A 2E2HB 4DNRB 1VF7A 4LUVA 4DV7Q 2K52A 4U673 1SBBB 4IUVA 3QG1A 1A15A 4JI0L 5CYUA 4OX9Q 1HR0Q 2A69C 2EXDA 3K7AH 1SYBA 2YTYA 4BY1G 1BOSA 2K33A 3M7GA 1C9OA 3TMEA 2FFKB 1JCKB 1JOOA 4A3FG 3HOYG 1I3QH 1IYJB 2Q2IA 2H5XA 4JI8L 1EIFA 2KHIA 2M9VA 3PO2H 2ZJRA 3BDCA 1G8ZD 1ML0D 3GTGB 2NN6H 2K4KA 2OCEA 4DV2Q 4OO1G 4LF7L 2UXDL 3STBC 3AEVA 3FKIG 2A68D 5E7NA 2TSSA 4YY3Q 3M4PA 2AQ1B 4BY7B 3JAME 2LS01 3NTKA 4KY7A 1MJCA 2QILA 4KN7C 3URYA 4HJ8A 4BS9A 1H95A 1EEFD 4GZYC 2EY2A 4PZ7A 4A3IG 2E2JH 5CBEE 1VQCA 1VQMA 4JC0A 3EN2A 3RLFA 3JAML 5M5XB 3ULJA 4QIWE 3HOVG 4B3RQ 1B70B 4XT3B 1JJGA 3OPOA 4LWCA 3T1YL 1ICWA 4IPHA 3UDIA 4DXFA 1YNNC 1D5ZC 3T13A 1YJ9A 1UWVA 4C3IB 1SE3A 4JOIA 1KRSA 2CKZB 1VQLA 2L0CA 4K0KL 3OMGA 3A5UA 4X3KA 5LMNW 3ICEA 2A6HD 3M85A 1XYIA 1NUCA 4EQPA 1SNQA 2E5LL 4GLAC 2F0PA 5I9OA 4QGUA 1Q90A 1U4RA 1QUQA 1Y8NB 3CCUA 2RQXA 1PYWD 5ELBA 4H02A 5IIFA 2JYOA 1GUOA 5LMNL 1H9JA 4HAEA 2NVQB 4UY8C 3DEPA 1GUTA 1WTVA 1I50H 1DOKA 1SNPA 5C6AA 3MA2B 1TU2B 3MVVA 5K5PA 1VQHA 2LFNA 4DR2Q 2YV5A 2IJ0A 1JWSD 2R6GA 1PTOC 5G3LF 3G7LA 4R4CA 1PRTB 5M5YH 5IP7G 1QVCA 2EE1A 2Z6KC 1CKMA 1A62A 4XXEA 1ILPA 4KLKA 2IWHA 2F0NA 3BDOA 1IZ6A 3KUPA 3KJOA 2RDFA 1NE3A 1Q1BA 4KKTA 4YCVA 2VS1A 2R7ZG 2K75A 5M3MG 1LT6D 4JBKA 3GTKH 4XIGS 2CW0D 1PRTD 1DD2A 3TQYA 4JYAQ 4HCEA 4RKBA 4J8QA 4XYQA 4X65L 1D6EC 4AH6A 3VR6A 3TS0A 5IYCG 2A19A 2IW3A 1QCBD 1FGBD 4AQYQ 3GQBA 2MJ8A 3HRZC 1EIHA 3TDQA 4AYBB 1UNSA 3PO3G 2UXCL 1YHAA 5FLMG 4DV5Q 2KEEA 1GO3E 4HTHA 4KY5A 5KRUA 3VA5A 5EJWA 2PW5A 3D31A 1X65A 1X6OA 2B8GA 4JBMA 4JI7L 1V1PA 3SR1A 4A76A 2O4XA 4DR1Q 3EVQA 1SFOB 1BBXC 1NTGA 3FRPB 3R8BA 4FO2A 4DPGA 3UI2A 4OHJA 4DR4Q 3I4NH 2VUMG 1TWGB 2BCOA 1JT8A 1DJRD 1BXTA 4R8NA 3K5OA 3WDNA 1EOVA 2AWOA 2N49A 4HSPA 3HOWG 5G3LD 1VQDA 3JAMi 3ZJYC 2F0KA 5C4XG 1YJWA 5CMDA 5C0XI 2IY5B 4YCUA 5IWAL 3KBXA 1PH1A 1WTOA 3H91A 1OXXK 3R3OA 1CK1A 4A3JH 4IO9A 1A3TA 5CORA 4L5SA 5LHY1 2UU9L 2PMZE 1Y14B 1WTQA 3VYSA 3DUZA 4RAUC 1EIGA 2IX1A 4IUUA 3QJYA 4B3SL 3RZOH 4MIUA 2Q8RE 1I4RA 1WTWA 1L0XB 1X3PA 3X3MA 1PZID 2K5NA 5NUCA 2CWAA 3M7NA 2IX0A 5C0XJ 2DGYA 3IFDA 1GUWA 1HRJA 5EPKA 1PVOA 2CFMA 1XNRL 1U4PA 1EQQA 2DJGC 2B2WC 5I6YA 2QEXA 3SGIA 1SYDA 2AUJD 2IPKD 3A55A 3KK7A 3FP9A 1XTDA 2R93B 2G9DA 3OWFA 2ATWA 1PTOH 4WJWA 4X66Q 3KF8B 4A3KB 2F0JA 4ZRZA 1NCVA 4NP5A 1KDAA 4ODGA 1JB3A 4DV1L 3ND8A 2JA6H 1CT1D 3I3CA 1VS0A 4KD3A 3TREA 3HOXB 2Y0SG 1H9RA 1GKHA 3F2UA 4K8IA 5DEHA 5FJ8H 5GROA 3A7LA 2F0QA 1OXTA 3NBHB 2PCFB 4C3HB 2EPBA 3PUXA 5K36H 2K7VA 2KHSA 1YEZA 3V05A 1D5XC 3J80E 3S1QH 3K57A 1S5FD 2UXBL 3DWAA 4JVZA 5IP9H 1NBWA 4OELB 5ELOA 4JI6Q 2JA8H 1KXLA 4ZUJA 1LTGD 1X3QA 4DAYB 4RHSA 1ILQA 1PZKD 1AZQA 2F0SA 2DN8A 3BVGA 3J80L 2JEAI 5IYDG 1RKNA 1I4QA 5LL6X 4TSSA 1I94Q 3E6ZX 2PI2A 3OWEB 2B63B 4OWTB 4NW2A 1S3OA 3C1EA 5ELCA 4AIMA 3IL8A 2A68C 1HZ9A 1UUPA 2ZTEA 3KDFA 3BJUA 4X62L 1STBA 4FVMA 4NMZA 3S15B 2LXJA 4HN7A 2DY8A 4I7ZC 1E2WA 4RGOS 4A93H 4GKJQ 4DV3Q 4RFBA 1QZGA 5D65A 3RN5A 1TWCH 1M1KC 1PDQA 1TT2A 4RCOA 5BN4A 3CF5A 4IFDJ 2JA7H 3J7A5 5C4JH 4JI5L 3ULLA 3PF5A 3SEBA 2AQ2B 2CWPA 1BKBA 2JEBI 4P73A 4DR3L 4C56C 2GA4B 5T1IA 3S24A 4FNFA 4ILWA 4C1NK 4BBRB 2OXPA 3VA7A 1WI5A 1CZWA 3D8GA 3NSWA 3BU2A 3WWVA 3CMAA 4HR7B 1Y8PB 3MXPA 4DNIA 2I5HA 3S1RB 2OQKA 2PNHA 4BBSG 2A6HC 3LWEA 3M4QA 2VZAA 3FEWX 1QB5D 2NN6I 1B7YB 1VQNA 1H9KA 2NZOA 1BO0A 2BH8A 1N34Q 4EX5A 1A3VA 3S17B 1U4LA 4LF8Q 1X56A 1SE2A 4BY1B 5M9OA 3HOYB 4A3FB 3K0XA 1EZ6A 3CCRA 2UUCQ 1KLUD 3R2TA 2F0MA 1G91A 2H4OA 4K2KA 5A35A 2L55A 3FKIB 1MI2A 1JOQA 4DAMA 3EROA 1R9TB 2B2YA 2EY5A 4POFA 2F3VA 4MTKA 2F52A 1ESFA 5JEAG 1HNXQ 1SYCA 4OWWB 3EIVA 4WJ4A 3KJPA 3EBEA 1TS3A 2XNAC 3M9BA 4LUOA 2K6AA 4G57A 4A3IB 3M3YH 3GTQB 5DAUA 1N33Q 4K14A 4DUZQ 3H3VC 2A6ED 5C5MA 1HR0L 2L5TA 3NWTA 3RR5A 3HOVB 2WB1G 1EU3A 3LNNA 1E24A 4KY6A 3RZDB 3HOZH 3J80i 2ALYB 2F0HA 4DV2L 4U68A 1O7ZA 1CHPD 1YNJD 2BH2A 1B4OA 4FF3A 3SK8A 1KD1C 2AWNA 2I5LX 3I7FA 4L5RC 1V43A 4P71A 2NN6G 4QQBX 4CDCC 5HY6A 3S2HB 4ME5A 4RG1A 5C0XH 3DWPA 3CCEA 5EQ0A 3PSIA 1HZBA 4PNYA 2MPMA 4DR6Q 3KYHC 1FR3A 1OXSC 1XMOQ 4DV6L 1STGA 3GTGH 3GV6A 3W3AA 4YWLA 4ZUIA 1FNVA 2KBNA 5HGQA 5FO8B 4L63B 4HIKA 4EQNA 1Y1VH 4L6TB 3CRKC 3BVMA 1H9SA 2DJFC 4OGQC 1NSNS 5IYBH 3M4OH 1BBUA 4KMUC 4DUYQ 5FO9B 2OF1A 4A3KG 1HFGA
chains in the Genus database with same CATH topology
5BR8Q 4YY3Q 4GLVB 3M4PA 3S1RH 4LF5Q 4DR5Q 5IYCH 3I55A 1E7ZA 1Q81C 3CC2A 1N32Q 1SROA 3Q8DA 1BVSA 3G71A 1Q8KA 4GS3A 1MJCA 3H0GH 1B8AA 5M5XH 5FLMH 1WYDA 4HJ8A 1W3SA 1HNXL 3J81c 3CC7A 1H95A 3S17H 1NMFA 4HIDA 2JA5H 1N8RC 2GVAA 4LFAL 1Z9FA 1HZCA 4PZ7A 4A3IG 1CKNB 2E2JH 4FDBA 1VQCA 3KDFB 4JI1Q 3STBD 4ME3A 1VQMA 4BY1H 4A3DG 1G6PA 4JC0A 3EN2A 2MO1A 3RLFA 3K81C 1TWFH 1P8LA 1TXYA 4C3IH 2ASBA 3ULJA 4QIWE 3HOVG 4B3RQ 1B70B 3F1ZA 4DUZL 1Z47A 1Q86C 4A3BG 3TS2A 4IFDG 3S14H 4JI7Q 4A3EH 3HOUH 1K8GA 4LWCA 3T1YL 1JJGA 4IPHA 3UDIA 3MXNB 3FKIH 4Y52H 1YHQA 3CW2C 4JI8Q 1SMXA 4HIMA 1YJ9A 3JAMc 1R9TH 1VQ7A 4NXNQ 2VUMH 3PUYA 1UWVA 3CCJA 3AFQA 4X64Q 2UXDQ 1OXUA 4JOIA 1KRSA 3PCOB 2CKZB 3I56A 1VQLA 4JBWA 2PQAA 3A74A 4K0KL 2MQHA 3A5UA 2I0QA 5LMNW 3ICEA 4JV5L 3M85A 5C4XH 5LMUL 2E5LL 1X3GA 4GLAC 2HHHQ 4QGUA 4JI2L 3UDGA 3CCUA 1QUQA 2N3SA 2I5MX 2D0OA 4GOPB 1YVCA 4LF6L 4H02A 3GTQH 1YBYA 5LMNL 1QVGA 2VNUD 3CP0A 3H15A 4UY8C 2HQLA 1UE5A 1LM0A 5IWAQ 3PIPA 1W2BA 2RHSB 1HR0W 3HOVH 3S16H 1U5KA 1I50H 1Q12A 4A3LG 4DV7L 4AQYL 4A3BH 1FL0A 2Q2UA 2ZTCA 5C3EG 3H3VH 1VQHA 4DV5L 4DR2Q 3NEMA 4OONA 3U4ZA 2YV5A 4GLXA 4AYBE 1EQRA 2R6GA 2ZM6L 4OX9L 4O2DA 2JK8A 1LTLA 4R4CA 4JOIC 5M5YH 5IP7G 3CCSA 1QVCA 2CCZA 2LSSA 1OXVA 2Z6KC 1EYGA 1YZ6A 1CKMA 1A62A 5M5WH 4B3SQ 4KLKA 3AFPA 3G48A 3HKZG 1IZ6A 3B6YA 3KJOA 3S2HH 5IE8A 1NE3A 1Q1BA 4XTCS 4YCVA 2VS1A 3GTOH 2R7ZG 2K75A 2YTVA 4DUYL 4K0KQ 4ALPA 5M3MG 4JBKA 3PIOA 3GTKH 2Y0SE 4XIGS 2ZJQA 3PO2G 4BY7G 4JV5Q 5BR8L 4YY3L 4DR4L 2E2HH 3TQYA 2NVXH 4DR7L 4JYAQ 5JJLA 1QUQB 1VCIA 2VY3A 1N32L 1PH5A 4A3LH 4X65L 4LF6Q 4AH6A 4KHPQ 1VQ8A 3I4NG 3U50C 2KCTA 2ES2A 1VQGA 5C3EH 3TS0A 5IYCG 2MNAA 2A19A 1UE1A 2CQOA 2QGQA 5AJ3L 4AQYQ 3BZCA 4R4IA 3PO3G 2UXCL 1YHAA 3F8TA 5FLMG 2NVTH 1VQKA 3UDXA 4DV5Q 1GO3E 3F2BA 2ZM6Q 1L1OC 3U58A 3FHWA 4IJLA 1K9MC 2WAQE 4RMFA 2AKWB 1HNZL 1PH3A 2A1AA 1G51A 2RCNA 2C35B 4B3RL 3D31A 1JB7A 1X65A 1X6OA 2GVBA 3L2PA 4JBMA 4JI7L 4KHZA 4IOAA 1BBWA 1L1OB 3A0JA 1TWGH 5M3MH 4A76A 4MTNA 4DR1Q 3GTPH 4BY7H 4O0AA 4DKAC 1VQPA 1OTCA 3JC66 4NXNL 4LFCQ 2UUBQ 1NTGA 3KF6A 3I2ZA 4X64L 1QZHA 4HJ9A 1KC8C 3VDYA 4DPGA 3S1MH 4DR4Q 1E3PA 1VQ9A 3I4NH 2VUMG 3LGJA 4DR7Q 1VQOA 1PH4A 3I4MH 1Q1EA 1JT8A 3RLOA 2N78A 1UE6A 1L0WA 2VQEL 2OWOA 4X65Q 1WFQA 2HHHL 1EOVA 1YHBA 2AWOA 2N49A 3K7UC 4DV0Q 4B3MQ 3HOWG 3TRZA 3PO3H 1VQDA 3JAMi 3ZJYC 2NZHA 1EUJA 5C4XG 1HJPA 1YJWA 2K5HA 5C0XI 5AJ3Q 2IY5B 4YCUA 5IWAL 1PH1A 2UXCQ 1OXXK 1TWAH 4A3JH 1C0AA 4IO9A 3OTOL 4R4QA 1KIXA 4L5SA 2UU9L 3J81j 4DR2L 2L15A 2PMZE 1Y14B 5C44G 3T1HL 1X3FA 1HNZQ 5GAEC 2LXKA 4POGA 4A3MG 1RL2A 2OTLA 2IX1A 1V9PA 4HJ7A 2V1CC 2R92G 2B3GA 4B3SL 3RZOH 1A63A 2RF4A 1J6QA 2JA6G 1IBMQ 3DM3A 1XNQQ 1CKOA 5JEAJ 1D8LA 4P72A 1N36L 3HOWH 4X62Q 1LUZA 2NVQH 1VQBA 2K5NA 3M7NA 2CWAA 5M3FH 2IX0A 5C0XJ 2VQEQ 1T9HA 4JYAL 2KCMA 2DGYA 2JQOA 4IPCA 4LF9Q 2R93H 1PVOA 2DUDA 2N8NA 3ERSX 2CFMA 1YI2A 4R4OA 4BXXG 1XNRL 4BA1I 3CPFA 1GVPA 3HKSA 1EQQA 1E22A 4KHPL 3AQQA 1CSPA 4UP9A 2QEXA 1VQAA 4IOCA 1VQFA 3PV0A 4AYBG 3SGIA 1Q82C 5C44H 4DV4Q 1SE8A 3FP9A 4A3MH 3GTMH 1Q46A 1XTDA 3HOXH 1JMCA 1K83H 1SLJA 3OTOQ 2ATWA 4X66Q 3L0OA 1KRTA 4JI6L 2UU9Q 3KF8B 1D7QA 1YNXA 3T1HQ 2R92H 5IP9G 1VQEA 4DR3Q 4LFBQ 2AMCB 3TEHB 3W1BA 1WJJA 2HT1A 4DV1L 2OTJA 1XPUA 1M90C 2JA6H 4BBSH 1VS0A 1IL2A 2JA8G 4JCVE 1I94L 3TREA 2YYZA 2D62A 5GQOA 4C3HH 2XGTA 4R1JA 2Y0SG 5GAHC 4DR1L 1XMQL 1MKHA 4OO1I 1GKHA 4LFCL 2UUBL 3W5OA 2XTIA 5FJ8H 5GROA 1N36Q 2PQAB 4BXXH 1OXTA 1MJEA 3HOUG 3I4MG 1X9NA 3NBHB 4L5TA 1WCMG 4LW1A 3S1NH 1ASYA 4HIOA 3PUXA 1CUKA 2WFWA 3CXCA 1YEZA 4PG3A 1RIPA 5GAGC 4EQ5A 1XNRQ 4DV0L 4B3ML 4GKJL 4DV3L 3S1QH 3OYYA 3UE1A 1YITA 2HIXA 4GNXA 4LUZA 2UXBL 1E1TA 1PYSB 5IP9H 1DGSA 1NBWA 2WAQG 2WB1E 2Q2TA 4LF4Q 5ELOA 1LYLA 1AH9A 1K0RA 4JI6Q 2JA8H 1FVIA 4MNOA 1KXLA 1SR3A 3HKZE 1QVFA 2KHJA 4PZ6A 4DAYB 1SFOH 4GN3B 2JA7G 3PUVA 2JA9A 4DV1Q 3RLNA 1K73C 2JEAI 5IYDG 4A3JG 1V1QA 1I94Q 5H1SE 1CSQA 2PI2A 4NPSA 1VQIA 3J81i 5ELNA 1XMQQ 1PYBA 3GTJH 4OWTB 1C7YA 2PI2E 1WCMH 4B3TL 1XPOA 1FJGL 1S3OA 2F4VQ 4AIMA 1VQ5A 3J80c 1PH9A 1IBML 1HZ9A 5JJIA 1XNQL 5JJKA 4IPGA 1CKNA 1FGUA 2JE6I 2ZTEA 3KOJA 3KDFA 3CCLA 4X6AH 4JI4Q 3BJUA 4X62L 4YHHQ 4LNQA 2YTXA 4GNXC 4L5QA 1X3EA 2LXJA 1JJ2A 3E9HA 4KI0A 4LF9L 2K50A 3F2CA 4A93H 4OXPA 1I5FA 4DK3C 4DV3Q 1QZGA 3RN5A 1AE2A 1GD7A 4GKJQ 1TWCH 1S40A 2UXBQ 5M3FG 4OO1G 1M1KC 5FLXc 4A3GH 3CF5A 4QJFA 4IFDJ 2R93G 2JA7H 1IXRA 1VQ4A 3CD6A 1HNWL 2UUCL 4BA2I 3J7A5 5C4JH 4DV4L 4JI5L 5IYDH 3ULLA 4P75A 3PF5A 3K80C 1J5EL 1HH2P 4X66L 1TWHH 2CWPA 1BKBA 3G6EA 2JEBI 2NVYH 4P73A 1K8AC 1PFSA 1PV4A 3G4SA 2IT1A 4DR3L 1JE5A 4NXML 4LFBL 3S24A 3HOXG 4GKKQ 4A75A 5GADC 1EFWA 3OW2A 1SRUA 1HZAA 1WI5A 2MFIA 4GOPA 2E8GA 3BU2A 1FJGQ 3CMEA 4B3TQ 3UDFA 4YCWA 3WWVA 4UP7A 3NELA 3CMAA 1VQJA 3KF6B 4YWMA 4DNIA 2I5HA 2OQKA 3CQZH 2PNHA 4NB3A 1IBLL 4BBSG 1KAWA 2ZTDA 3AYHB 4J15A 4OWXB 2EQSA 2HIVA 3HOYH 4DV6Q 4A3FH 4JI0Q 3M4QA 1U0LA 2VZAA 2NN6I 1EIYB 2R7DA 1B7YB 1VQNA 1N33L 2NZOA 5FJ8G 1L2FA 2BH8A 1N34Q 4EX5A 3L7ZC 4C2MH 3F2DA 1JJCB 3CCQA 1KHIA 4LF8Q 1X56A 2IHFA 3E9IA 3CCVA 4A3KH 3MEFA 3GDEA 3NENA 5K36G 1X54A 4GN5A 3K0XA 2VQFL 3S2DH 1HNWQ 3PF4A 3CCRA 2UUCQ 4LF7Q 4QQBX 3CAMA 1N9WA 2R7FA 4JI5Q 4JI3L 1IBKL 4A3CG 4LF4L 2Z6KA 1J5EQ 2UUAL 3GTLH 2MO0A 4GOPC 1P16A 3HOZG 4DAMA 2E2IH 3ER0A 5IY0A 2OQ0A 3ULPA 4NXMQ 3D0FA 3W1GA 1XPRA 1PH2A 1UEBA 4PMWA 3A5ZB 3PUWA 4POFA 4A3IH 2D0PA 2RHQB 4UP8A 2F52A 2B63G 4A3DH 5JEAG 4Y7NH 1VQ6A 1ASZA 2VL6A 2A8VA 3CC4A 2QA4A 5IT9c 1PH6A 1HNXQ 1PHJA 2YU9H 4OWWB 2FXQA 3EIVA 1NY4A 4R4TA 1XJVA 4WJ4A 3GO5A 3KJPA 4LFAQ 1IBLQ 3EBEA 5C0XG 1KL9A 3CPWA 2F4VL 1WOCA 4P74A 3CCMA 5J3BA 2Q2HA 3M9BA 4LUOA 4DR6L 1O7IA 1S72A 1G291 1XMOL 3RZDH 3M3YH 3I4OA 1UE7A 1PA6A 3KFUA 1A8VA 4JI4L 4YHHL 1N33Q 2WP8J 1PH7A 1KQSA 4DUZQ 4GN4B 4JBJA 1HR0L 4APVA 2ZJPA 3RR5A 3T1YQ 2WB1G 2JJQA 3PUZA 4A3CH 1K3RA 2VW9A 3KLWA 1E24A 1GM5A 1L1OA 2VQFQ 4WJ3M 3HOZH 3J80i 3E0EA 2ALYB 4HJ5A 4IPDA 4TVAB 1YJNA 1IBKQ 4JI3Q 1EWIA 4IJHA 4DV2L 1Y1VG 4A93G 1SN8A 1Y1WG 2UUAQ 1Q7YC 2BH2A 1NMGA 2B63H 1KD1C 2AWNA 2I5LX 2KENA 3IRBA 4A3GG 1X55A 3I7FA 5DLQE 1V43A 4L5RC 5IYBG 4P71A 1NJIC 2F3IA 2NN6G 2Z0SA 5LMUQ 3GD7A 5HY6A 4JI2Q 4BBRG 4DR5L 2K5VA 2E5LQ 4LF5L 3J7ZC 4IFDI 2GN5A 2BA1A 3HFZB 4RG1A 4YWKA 4GKKL 3H3VI 3CCEA 2BA0A 2IHEA 3RNUA 4DK6C 1A0IA 5LMNQ 3S15H 3UE0A 4UPAA 3U4VA 4MZ9A 4PZ8A 3PGZA 3PSIA 1HZBA 4QL5A 2EIFA 4HJAA 4LUVA 4C3JH 4DV7Q 3H0GG 4DR6Q 2K52A 3KYHC 5IP7H 1OXSC 1XMOQ 1YIJA 3K8AA 4JI1L 1E1OA 3DLLA 1PH8A 4DV6L 2K14A 3GTGH 4JI0L 4YWLA 3RN2A 2JA5G 4OX9Q 2KBNA 5HGQA 1HR0Q 2B29A 2EXDA 3K7AH 5EAYA 4HIKA 2YTYA 4BY1G 1N34L 3BZKA 2R7ZH 1C9OA 1Y1VH 3HOYG 4A3FG 1Y1WH 1I3QH 1IYJB 2Q2IA 4GNXB 4LF8L 2H5XA 4JI8L 1EIFA 2KHIA 3PO2H 4JG2A 1I6HH 2AHOB 2ZJRA 5IYBH 4A4IA 3M4OH 4QY7A 1BBUA 2K4KA 2OCEA 4TQUS 4BBRH 1MIUA 4DUYQ 4DV2Q 2ID0A 4A3EG 3STBC 4LF7L 3AEVA 2UXDL 3FKIG 4A3KG 1AE3A 5E7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 Q;  4YY3 Q;  4GLV B;  3M4P A;  3S1R H;  4LF5 Q;  4DR5 Q;  5IYC H;  3I55 A;  1E7Z A;  1Q81 C;  3CC2 A;  1N32 Q;  1SRO A;  3Q8D A;  1BVS A;  3G71 A;  1Q8K A;  4GS3 A;  1MJC A;  3H0G H;  1B8A A;  5M5X H;  5FLM H;  1WYD A;  4HJ8 A;  1W3S A;  1HNX L;  3J81 c;  3CC7 A;  1H95 A;  3S17 H;  1NMF A;  4HID A;  2JA5 H;  1N8R C;  2GVA A;  4LFA L;  1Z9F A;  1HZC A;  4PZ7 A;  4A3I G;  1CKN B;  2E2J H;  4FDB A;  1VQC A;  3KDF B;  4JI1 Q;  3STB D;  4ME3 A;  1VQM A;  4BY1 H;  4A3D G;  1G6P A;  4JC0 A;  3EN2 A;  2MO1 A;  3RLF A;  3K81 C;  1TWF H;  1P8L A;  1TXY A;  4C3I H;  2ASB A;  3ULJ A;  4QIW E;  3HOV G;  4B3R Q;  1B70 B;  3F1Z A;  4DUZ L;  1Z47 A;  1Q86 C;  4A3B G;  3TS2 A;  4IFD G;  3S14 H;  4JI7 Q;  4A3E H;  3HOU H;  1K8G A;  4LWC A;  3T1Y L;  1JJG A;  4IPH A;  3UDI A;  3MXN B;  3FKI H;  4Y52 H;  1YHQ A;  3CW2 C;  4JI8 Q;  1SMX A;  4HIM A;  1YJ9 A;  3JAM c;  1R9T H;  1VQ7 A;  4NXN Q;  2VUM H;  3PUY A;  1UWV A;  3CCJ A;  3AFQ A;  4X64 Q;  2UXD Q;  1OXU A;  4JOI A;  1KRS A;  3PCO B;  2CKZ B;  3I56 A;  1VQL A;  4JBW A;  2PQA A;  3A74 A;  4K0K L;  2MQH A;  3A5U A;  2I0Q A;  5LMN W;  3ICE A;  4JV5 L;  3M85 A;  5C4X H;  5LMU L;  2E5L L;  1X3G A;  4GLA C;  2HHH Q;  4QGU A;  4JI2 L;  3UDG A;  3CCU A;  1QUQ A;  2N3S A;  2I5M X;  2D0O A;  4GOP B;  1YVC A;  4LF6 L;  4H02 A;  3GTQ H;  1YBY A;  5LMN L;  1QVG A;  2VNU D;  3CP0 A;  3H15 A;  4UY8 C;  2HQL A;  1UE5 A;  1LM0 A;  5IWA Q;  3PIP A;  1W2B A;  2RHS B;  1HR0 W;  3HOV H;  3S16 H;  1U5K A;  1I50 H;  1Q12 A;  4A3L G;  4DV7 L;  4AQY L;  4A3B H;  1FL0 A;  2Q2U A;  2ZTC A;  5C3E G;  3H3V H;  1VQH A;  4DV5 L;  4DR2 Q;  3NEM A;  4OON A;  3U4Z A;  2YV5 A;  4GLX A;  4AYB E;  1EQR A;  2R6G A;  2ZM6 L;  4OX9 L;  4O2D A;  2JK8 A;  1LTL A;  4R4C A;  4JOI C;  5M5Y H;  5IP7 G;  3CCS A;  1QVC A;  2CCZ A;  2LSS A;  1OXV A;  2Z6K C;  1EYG A;  1YZ6 A;  1CKM A;  1A62 A;  5M5W H;  4B3S Q;  4KLK A;  3AFP A;  3G48 A;  3HKZ G;  1IZ6 A;  3B6Y A;  3KJO A;  3S2H H;  5IE8 A;  1NE3 A;  1Q1B A;  4XTC S;  4YCV A;  2VS1 A;  3GTO H;  2R7Z G;  2K75 A;  2YTV A;  4DUY L;  4K0K Q;  4ALP A;  5M3M G;  4JBK A;  3PIO A;  3GTK H;  2Y0S E;  4XIG S;  2ZJQ A;  3PO2 G;  4BY7 G;  4JV5 Q;  5BR8 L;  4YY3 L;  4DR4 L;  2E2H H;  3TQY A;  2NVX H;  4DR7 L;  4JYA Q;  5JJL A;  1QUQ B;  1VCI A;  2VY3 A;  1N32 L;  1PH5 A;  4A3L H;  4X65 L;  4LF6 Q;  4AH6 A;  4KHP Q;  1VQ8 A;  3I4N G;  3U50 C;  2KCT A;  2ES2 A;  1VQG A;  5C3E H;  3TS0 A;  5IYC G;  2MNA A;  2A19 A;  1UE1 A;  2CQO A;  2QGQ A;  5AJ3 L;  4AQY Q;  3BZC A;  4R4I A;  3PO3 G;  2UXC L;  1YHA A;  3F8T A;  5FLM G;  2NVT H;  1VQK A;  3UDX A;  4DV5 Q;  1GO3 E;  3F2B A;  2ZM6 Q;  1L1O C;  3U58 A;  3FHW A;  4IJL A;  1K9M C;  2WAQ E;  4RMF A;  2AKW B;  1HNZ L;  1PH3 A;  2A1A A;  1G51 A;  2RCN A;  2C35 B;  4B3R L;  3D31 A;  1JB7 A;  1X65 A;  1X6O A;  2GVB A;  3L2P A;  4JBM A;  4JI7 L;  4KHZ A;  4IOA A;  1BBW A;  1L1O B;  3A0J A;  1TWG H;  5M3M H;  4A76 A;  4MTN A;  4DR1 Q;  3GTP H;  4BY7 H;  4O0A A;  4DKA C;  1VQP A;  1OTC A;  3JC6 6;  4NXN L;  4LFC Q;  2UUB Q;  1NTG A;  3KF6 A;  3I2Z A;  4X64 L;  1QZH A;  4HJ9 A;  1KC8 C;  3VDY A;  4DPG A;  3S1M H;  4DR4 Q;  1E3P A;  1VQ9 A;  3I4N H;  2VUM G;  3LGJ A;  4DR7 Q;  1VQO A;  1PH4 A;  3I4M H;  1Q1E A;  1JT8 A;  3RLO A;  2N78 A;  1UE6 A;  1L0W A;  2VQE L;  2OWO A;  4X65 Q;  1WFQ A;  2HHH L;  1EOV A;  1YHB A;  2AWO A;  2N49 A;  3K7U C;  4DV0 Q;  4B3M Q;  3HOW G;  3TRZ A;  3PO3 H;  1VQD A;  3JAM i;  3ZJY C;  2NZH A;  1EUJ A;  5C4X G;  1HJP A;  1YJW A;  2K5H A;  5C0X I;  5AJ3 Q;  2IY5 B;  4YCU A;  5IWA L;  1PH1 A;  2UXC Q;  1OXX K;  1TWA H;  4A3J H;  1C0A A;  4IO9 A;  3OTO L;  4R4Q A;  1KIX A;  4L5S A;  2UU9 L;  3J81 j;  4DR2 L;  2L15 A;  2PMZ E;  1Y14 B;  5C44 G;  3T1H L;  1X3F A;  1HNZ Q;  5GAE C;  2LXK A;  4POG A;  4A3M G;  1RL2 A;  2OTL A;  2IX1 A;  1V9P A;  4HJ7 A;  2V1C C;  2R92 G;  2B3G A;  4B3S L;  3RZO H;  1A63 A;  2RF4 A;  1J6Q A;  2JA6 G;  1IBM Q;  3DM3 A;  1XNQ Q;  1CKO A;  5JEA J;  1D8L A;  4P72 A;  1N36 L;  3HOW H;  4X62 Q;  1LUZ A;  2NVQ H;  1VQB A;  2K5N A;  3M7N A;  2CWA A;  5M3F H;  2IX0 A;  5C0X J;  2VQE Q;  1T9H A;  4JYA L;  2KCM A;  2DGY A;  2JQO A;  4IPC A;  4LF9 Q;  2R93 H;  1PVO A;  2DUD A;  2N8N A;  3ERS X;  2CFM A;  1YI2 A;  4R4O A;  4BXX G;  1XNR L;  4BA1 I;  3CPF A;  1GVP A;  3HKS A;  1EQQ A;  1E22 A;  4KHP L;  3AQQ A;  1CSP A;  4UP9 A;  2QEX A;  1VQA A;  4IOC A;  1VQF A;  3PV0 A;  4AYB G;  3SGI A;  1Q82 C;  5C44 H;  4DV4 Q;  1SE8 A;  3FP9 A;  4A3M H;  3GTM H;  1Q46 A;  1XTD A;  3HOX H;  1JMC A;  1K83 H;  1SLJ A;  3OTO Q;  2ATW A;  4X66 Q;  3L0O A;  1KRT A;  4JI6 L;  2UU9 Q;  3KF8 B;  1D7Q A;  1YNX A;  3T1H Q;  2R92 H;  5IP9 G;  1VQE A;  4DR3 Q;  4LFB Q;  2AMC B;  3TEH B;  3W1B A;  1WJJ A;  2HT1 A;  4DV1 L;  2OTJ A;  1XPU A;  1M90 C;  2JA6 H;  4BBS H;  1VS0 A;  1IL2 A;  2JA8 G;  4JCV E;  1I94 L;  3TRE A;  2YYZ A;  2D62 A;  5GQO A;  4C3H H;  2XGT A;  4R1J A;  2Y0S G;  5GAH C;  4DR1 L;  1XMQ L;  1MKH A;  4OO1 I;  1GKH A;  4LFC L;  2UUB L;  3W5O A;  2XTI A;  5FJ8 H;  5GRO A;  1N36 Q;  2PQA B;  4BXX H;  1OXT A;  1MJE A;  3HOU G;  3I4M G;  1X9N A;  3NBH B;  4L5T A;  1WCM G;  4LW1 A;  3S1N H;  1ASY A;  4HIO A;  3PUX A;  1CUK A;  2WFW A;  3CXC A;  1YEZ A;  4PG3 A;  1RIP A;  5GAG C;  4EQ5 A;  1XNR Q;  4DV0 L;  4B3M L;  4GKJ L;  4DV3 L;  3S1Q H;  3OYY A;  3UE1 A;  1YIT A;  2HIX A;  4GNX A;  4LUZ A;  2UXB L;  1E1T A;  1PYS B;  5IP9 H;  1DGS A;  1NBW A;  2WAQ G;  2WB1 E;  2Q2T A;  4LF4 Q;  5ELO A;  1LYL A;  1AH9 A;  1K0R A;  4JI6 Q;  2JA8 H;  1FVI A;  4MNO A;  1KXL A;  1SR3 A;  3HKZ E;  1QVF A;  2KHJ A;  4PZ6 A;  4DAY B;  1SFO H;  4GN3 B;  2JA7 G;  3PUV A;  2JA9 A;  4DV1 Q;  3RLN A;  1K73 C;  2JEA I;  5IYD G;  4A3J G;  1V1Q A;  1I94 Q;  5H1S E;  1CSQ A;  2PI2 A;  4NPS A;  1VQI A;  3J81 i;  5ELN A;  1XMQ Q;  1PYB A;  3GTJ H;  4OWT B;  1C7Y A;  2PI2 E;  1WCM H;  4B3T L;  1XPO A;  1FJG L;  1S3O A;  2F4V Q;  4AIM A;  1VQ5 A;  3J80 c;  1PH9 A;  1IBM L;  1HZ9 A;  5JJI A;  1XNQ L;  5JJK A;  4IPG A;  1CKN A;  1FGU A;  2JE6 I;  2ZTE A;  3KOJ A;  3KDF A;  3CCL A;  4X6A H;  4JI4 Q;  3BJU A;  4X62 L;  4YHH Q;  4LNQ A;  2YTX A;  4GNX C;  4L5Q A;  1X3E A;  2LXJ A;  1JJ2 A;  3E9H A;  4KI0 A;  4LF9 L;  2K50 A;  3F2C A;  4A93 H;  4OXP A;  1I5F A;  4DK3 C;  4DV3 Q;  1QZG A;  3RN5 A;  1AE2 A;  1GD7 A;  4GKJ Q;  1TWC H;  1S40 A;  2UXB Q;  5M3F G;  4OO1 G;  1M1K C;  5FLX c;  4A3G H;  3CF5 A;  4QJF A;  4IFD J;  2R93 G;  2JA7 H;  1IXR A;  1VQ4 A;  3CD6 A;  1HNW L;  2UUC L;  4BA2 I;  3J7A 5;  5C4J H;  4DV4 L;  4JI5 L;  5IYD H;  3ULL A;  4P75 A;  3PF5 A;  3K80 C;  1J5E L;  1HH2 P;  4X66 L;  1TWH H;  2CWP A;  1BKB A;  3G6E A;  2JEB I;  2NVY H;  4P73 A;  1K8A C;  1PFS A;  1PV4 A;  3G4S A;  2IT1 A;  4DR3 L;  1JE5 A;  4NXM L;  4LFB L;  3S24 A;  3HOX G;  4GKK Q;  4A75 A;  5GAD C;  1EFW A;  3OW2 A;  1SRU A;  1HZA A;  1WI5 A;  2MFI A;  4GOP A;  2E8G A;  3BU2 A;  1FJG Q;  3CME A;  4B3T Q;  3UDF A;  4YCW A;  3WWV A;  4UP7 A;  3NEL A;  3CMA A;  1VQJ A;  3KF6 B;  4YWM A;  4DNI A;  2I5H A;  2OQK A;  3CQZ H;  2PNH A;  4NB3 A;  1IBL L;  4BBS G;  1KAW A;  2ZTD A;  3AYH B;  4J15 A;  4OWX B;  2EQS A;  2HIV A;  3HOY H;  4DV6 Q;  4A3F H;  4JI0 Q;  3M4Q A;  1U0L A;  2VZA A;  2NN6 I;  1EIY B;  2R7D A;  1B7Y B;  1VQN A;  1N33 L;  2NZO A;  5FJ8 G;  1L2F A;  2BH8 A;  1N34 Q;  4EX5 A;  3L7Z C;  4C2M H;  3F2D A;  1JJC B;  3CCQ A;  1KHI A;  4LF8 Q;  1X56 A;  2IHF A;  3E9I A;  3CCV A;  4A3K H;  3MEF A;  3GDE A;  3NEN A;  5K36 G;  1X54 A;  4GN5 A;  3K0X A;  2VQF L;  3S2D H;  1HNW Q;  3PF4 A;  3CCR A;  2UUC Q;  4LF7 Q;  4QQB X;  3CAM A;  1N9W A;  2R7F A;  4JI5 Q;  4JI3 L;  1IBK L;  4A3C G;  4LF4 L;  2Z6K A;  1J5E Q;  2UUA L;  3GTL H;  2MO0 A;  4GOP C;  1P16 A;  3HOZ G;  4DAM A;  2E2I H;  3ER0 A;  5IY0 A;  2OQ0 A;  3ULP A;  4NXM Q;  3D0F A;  3W1G A;  1XPR A;  1PH2 A;  1UEB A;  4PMW A;  3A5Z B;  3PUW A;  4POF A;  4A3I H;  2D0P A;  2RHQ B;  4UP8 A;  2F52 A;  2B63 G;  4A3D H;  5JEA G;  4Y7N H;  1VQ6 A;  1ASZ A;  2VL6 A;  2A8V A;  3CC4 A;  2QA4 A;  5IT9 c;  1PH6 A;  1HNX Q;  1PHJ A;  2YU9 H;  4OWW B;  2FXQ A;  3EIV A;  1NY4 A;  4R4T A;  1XJV A;  4WJ4 A;  3GO5 A;  3KJP A;  4LFA Q;  1IBL Q;  3EBE A;  5C0X G;  1KL9 A;  3CPW A;  2F4V L;  1WOC A;  4P74 A;  3CCM A;  5J3B A;  2Q2H A;  3M9B A;  4LUO A;  4DR6 L;  1O7I A;  1S72 A;  1G29 1;  1XMO L;  3RZD H;  3M3Y H;  3I4O A;  1UE7 A;  1PA6 A;  3KFU A;  1A8V A;  4JI4 L;  4YHH L;  1N33 Q;  2WP8 J;  1PH7 A;  1KQS A;  4DUZ Q;  4GN4 B;  4JBJ A;  1HR0 L;  4APV A;  2ZJP A;  3RR5 A;  3T1Y Q;  2WB1 G;  2JJQ A;  3PUZ A;  4A3C H;  1K3R A;  2VW9 A;  3KLW A;  1E24 A;  1GM5 A;  1L1O A;  2VQF Q;  4WJ3 M;  3HOZ H;  3J80 i;  3E0E A;  2ALY B;  4HJ5 A;  4IPD A;  4TVA B;  1YJN A;  1IBK Q;  4JI3 Q;  1EWI A;  4IJH A;  4DV2 L;  1Y1V G;  4A93 G;  1SN8 A;  1Y1W G;  2UUA Q;  1Q7Y C;  2BH2 A;  1NMG A;  2B63 H;  1KD1 C;  2AWN A;  2I5L X;  2KEN A;  3IRB A;  4A3G G;  1X55 A;  3I7F A;  5DLQ E;  1V43 A;  4L5R C;  5IYB G;  4P71 A;  1NJI C;  2F3I A;  2NN6 G;  2Z0S A;  5LMU Q;  3GD7 A;  5HY6 A;  4JI2 Q;  4BBR G;  4DR5 L;  2K5V A;  2E5L Q;  4LF5 L;  3J7Z C;  4IFD I;  2GN5 A;  2BA1 A;  3HFZ B;  4RG1 A;  4YWK A;  4GKK L;  3H3V I;  3CCE A;  2BA0 A;  2IHE A;  3RNU A;  4DK6 C;  1A0I A;  5LMN Q;  3S15 H;  3UE0 A;  4UPA A;  3U4V A;  4MZ9 A;  4PZ8 A;  3PGZ A;  3PSI A;  1HZB A;  4QL5 A;  2EIF A;  4HJA A;  4LUV A;  4C3J H;  4DV7 Q;  3H0G G;  4DR6 Q;  2K52 A;  3KYH C;  5IP7 H;  1OXS C;  1XMO Q;  1YIJ A;  3K8A A;  4JI1 L;  1E1O A;  3DLL A;  1PH8 A;  4DV6 L;  2K14 A;  3GTG H;  4JI0 L;  4YWL A;  3RN2 A;  2JA5 G;  4OX9 Q;  2KBN A;  5HGQ A;  1HR0 Q;  2B29 A;  2EXD A;  3K7A H;  5EAY A;  4HIK A;  2YTY A;  4BY1 G;  1N34 L;  3BZK A;  2R7Z H;  1C9O A;  1Y1V H;  3HOY G;  4A3F G;  1Y1W H;  1I3Q H;  1IYJ B;  2Q2I A;  4GNX B;  4LF8 L;  2H5X A;  4JI8 L;  1EIF A;  2KHI A;  3PO2 H;  4JG2 A;  1I6H H;  2AHO B;  2ZJR A;  5IYB H;  4A4I A;  3M4O H;  4QY7 A;  1BBU A;  2K4K A;  2OCE A;  4TQU S;  4BBR H;  1MIU A;  4DUY Q;  4DV2 Q;  2ID0 A;  4A3E G;  3STB C;  4LF7 L;  3AEV A;  2UXD L;  3FKI G;  4A3K G;  1AE3 A;  5E7N A; 
#chains in the Genus database with same CATH topology
 1Z6H A;  5BR8 Q;  2R7Z B;  4DK1 A;  1KAB A;  4GLV B;  4IN3 A;  5M3M B;  4R9W A;  4LF5 Q;  3I72 A;  3CC2 A;  3I55 A;  1I6H B;  1N32 Q;  2OT2 A;  1SRO A;  5LL6 S;  4M1U B;  4GS3 A;  4UDU C;  3H0G H;  5I2Y A;  5M5X H;  3S1M B;  4IZ8 A;  2NWG A;  1NMF A;  1N8R C;  2GVA A;  1HZC A;  1A2T A;  1CKN B;  1LTT D;  4A3D G;  5EKK A;  1G2T A;  1ZYR D;  2EYL A;  3PO3 B;  2F0L A;  3BYT B;  1PZJ D;  4C3I H;  5IGB A;  2ASB A;  1TVX A;  3F1Z A;  1Z47 A;  1HUM A;  3OW7 A;  2J0T D;  3R93 A;  1SMX A;  4HIM A;  4NXN Q;  3JAM c;  2QCP X;  2ICI A;  3PUY A;  4G4K A;  4H44 C;  1PMR A;  3VYU A;  1HPC A;  1OXU A;  1ZKO A;  5E4X A;  3I56 A;  4H13 C;  2PQA A;  3A74 A;  3S14 B;  1EY6 A;  1CFM A;  1E0B A;  4H7B A;  4F88 A;  1TY2 A;  1CA5 A;  2C9O A;  5LMU L;  1X3G A;  2NZ1 D;  2HHH Q;  2N3S A;  4GOP B;  2F0W A;  1YVC A;  3CHB D;  3D6C A;  1YBY A;  2HUG A;  3HOW B;  2VNU D;  2MHV A;  4QB4 A;  2HQL A;  1UE5 A;  4CDD C;  1ICF B;  3PIP A;  1W2B A;  1O7L A;  5C4X B;  1Q12 A;  2EYP A;  3OMC A;  4AQY L;  5IOD A;  4A3B H;  4IFD H;  4FXD A;  2F3W A;  2ZTC A;  3K0Y A;  3H3V H;  4DV5 L;  4OON A;  3U4Z A;  4AYB E;  1EQR A;  1W6K A;  4O2D A;  3A56 A;  3CCS A;  4WOR A;  2JP1 A;  3PMF A;  2CCZ A;  1ENC A;  1K83 B;  5M5W H;  1GUS A;  3AFP A;  3ONA B;  1SNM A;  4PMC A;  1K0S A;  2JN4 A;  2Z4I A;  3C2P A;  1B2T A;  1F77 A;  4DR4 L;  1SE4 A;  1F9R A;  3QOL A;  1RF2 D;  2NVX H;  1TQO A;  3H6M A;  5CR3 A;  3BS1 A;  2B2V C;  2XWB B;  1QUQ B;  1VCI A;  2VY3 A;  4R8I A;  4LF6 Q;  5IOC A;  3Q0A A;  3I4N G;  1BQQ T;  1VQG A;  5C3E H;  1SYF A;  3L3O C;  3NXW A;  2QGQ A;  1GJX A;  4DA2 A;  1VQK A;  2XSC A;  2J7Z A;  2QF7 A;  2AQ3 B;  1GUN A;  3U58 A;  1K9M C;  4FF2 A;  1PH3 A;  2M00 A;  2A1A A;  1G51 A;  3SHL A;  1JB7 A;  3L2P A;  4IOA A;  4OL7 A;  1L1O B;  1TWG H;  2NVT B;  4O0A A;  1S5B D;  2R61 A;  3JC6 6;  4LFC Q;  2UUB Q;  3A7A B;  2Y0S B;  3KF6 A;  4X64 L;  1KC8 C;  1NR2 A;  3VDY A;  1SNO A;  1CQF A;  3RUZ A;  1HTP A;  1OO9 B;  1AEX A;  3LGJ A;  3GTP B;  4DR7 Q;  1VQO A;  3NTH A;  1LTI D;  5C3X A;  5KGU A;  3DXJ C;  4CHT B;  3GTJ B;  1UE6 A;  4DV0 Q;  3VR3 A;  2L12 A;  1QE6 A;  1A2U A;  2KED A;  2QEJ C;  1EUJ A;  2RDG A;  1F9Q A;  1HJP A;  3PIP 3;  5FOB B;  1IKM A;  1PRT F;  2EDG A;  2RVL A;  2B2W A;  4R4Q A;  1WTP A;  1X3F A;  1HNZ Q;  1GXD C;  3ITP A;  1RL2 A;  1V9P A;  2P5Z X;  4HJ7 A;  3X3N A;  1TWA B;  2V1C C;  2B3G A;  2SNS A;  5EKL A;  1A63 A;  3J7Y W;  1TWH B;  1HCZ A;  4K5W A;  2K1B A;  2JA6 G;  2NVY B;  2EYH A;  4P2C B;  1GOZ A;  2A74 C;  1VQB A;  1Y69 U;  3MC0 B;  5AFW A;  2VQE Q;  4A3L G;  2IL8 A;  2JQO A;  2NBF A;  4IPC A;  4LF9 Q;  2R93 H;  3FPU B;  1NAP A;  1AN8 A;  1WTX A;  3CPF A;  3DHQ A;  4KHP L;  1E22 A;  4M8A A;  4G7Z C;  1CSP A;  4FXK C;  4UP9 A;  3HS0 C;  1Q82 C;  2K5W A;  3A8I E;  5C44 H;  4DV4 Q;  2F0F A;  1EY4 A;  4A3M H;  3HOX H;  1JMC A;  3OTO Q;  1AZP A;  4QMG A;  3I90 A;  4JI6 L;  2R92 H;  2F1M A;  5IP9 G;  1VQE A;  4LFB Q;  2A6E C;  2HT1 A;  2OTJ A;  5ELE A;  2KCC A;  3S2D B;  1IL2 A;  2JA8 G;  5JPM C;  1I94 L;  2YYZ A;  4C3H H;  2ZXR A;  3EJI A;  4R1J A;  5J22 A;  1SMY D;  3SE0 A;  2ICE C;  2EY6 A;  2SEB D;  3T56 B;  1YNJ C;  1EYA A;  2FHT A;  4WRD A;  2B39 A;  4BBS B;  4BXX H;  3K59 A;  1LT5 D;  1XXG A;  2EYM A;  4LW1 A;  5D3I B;  2YU9 B;  4EGV A;  4PG3 A;  2KQ3 A;  5GAG C;  3MEH A;  4B3M L;  4GKJ L;  4DV3 L;  3OYY A;  1QOH A;  2HIX A;  4LUZ A;  1DGS A;  1DZ1 A;  2WAQ G;  4V0B A;  3BYY B;  1AH9 A;  1F2Y A;  1K0R A;  4XYO A;  4JK1 C;  4PQX A;  1QVF A;  2KHJ A;  3DEO A;  4CBV A;  2JA7 G;  1S4Z A;  3RLN A;  2HQE A;  4QUF A;  3P7J A;  5KNB A;  1KNE A;  2NUC A;  1CSQ A;  4NPS A;  4F8M A;  3HOU H;  3I4M H;  5CGK A;  1WCM H;  1XPO A;  1ET6 A;  2PZU A;  2PNR C;  3J80 c;  5C5L A;  2KUM A;  1IBM L;  1EY9 A;  1XNQ L;  4IPG A;  1LT3 D;  2JE6 I;  3KOJ A;  3CU7 A;  4X6A H;  4JI4 Q;  4YHH Q;  3K5L A;  1U9R A;  3AU7 A;  4KI0 A;  4PV1 C;  5CV7 A;  4DK0 A;  1I5F A;  1AE2 A;  1GD7 A;  1TY0 A;  5EBD A;  2NB0 A;  1S40 A;  5M3F G;  2WB1 B;  1DOM A;  4QJF A;  1VQ4 A;  3LWU A;  1C48 A;  3HKZ B;  2UUC L;  2G9H D;  4BA2 I;  1EL0 A;  3K7A B;  2LMC B;  3A8K E;  3K80 C;  3AMU A;  1ENA A;  1HH2 P;  1I3Q B;  3NP8 A;  1I4X A;  2CH4 A;  2KA7 A;  4GKK Q;  1CTM A;  4A75 A;  5GAD C;  1HZA A;  2LKV A;  2MFI A;  4YCW A;  1RTO A;  3NEL A;  2SOB A;  4FF1 A;  2ZTD A;  3AYH B;  2HIV A;  2E76 C;  3HOY H;  4A3F H;  1LO5 D;  4OEM B;  4JI0 Q;  3BZD B;  1EIY B;  4FF4 A;  2R3Z A;  1N33 L;  1L2F A;  3L7Z C;  4OO1 H;  3CQZ B;  1KHI A;  2E2J B;  2IHF A;  3CCV A;  3MEF A;  2K5Q A;  3Q24 A;  3NEN A;  1X54 A;  1PFN A;  4GN5 A;  3I4L A;  3PF4 A;  4LF7 Q;  4DF7 A;  5I6W A;  1N9W A;  2EXZ A;  4LF4 L;  4C2M B;  3KLS X;  1J5E Q;  4KJO A;  2QDL A;  3GTL H;  4GOP C;  3HOZ G;  1CI3 M;  3MAQ A;  3D0F A;  1XPR A;  1BUV T;  3EFX D;  3PUW A;  4A3I H;  4UP8 A;  1SDF A;  3NBI A;  1PH6 A;  4R4T A;  3GO5 A;  2E2I B;  5C0X G;  2F4V L;  1QJO A;  5IGF A;  4DR6 L;  5ELD A;  1F2M A;  1O7I A;  1LT4 D;  1G29 1;  4ZQ3 A;  3RZD H;  1XMO L;  3I4O A;  4ZKB B;  3KFU A;  4A3D B;  3OHX C;  5FO7 B;  4XDX A;  5EGT A;  3T1Y Q;  1D2B A;  2K03 A;  3BDL A;  2JJQ A;  3PUZ A;  4IUR A;  3NUC A;  2VW9 A;  2X6L A;  1RTN A;  2SNM A;  4WJ3 M;  4IPD A;  4TVA B;  4JI3 Q;  1EWI A;  2BDN A;  2X6G A;  1Y1V G;  2UUA Q;  1Q7Y C;  5M5Y B;  1D5M C;  1NMG A;  5CV5 A;  3IRB A;  4A3G G;  2K32 A;  5DLQ E;  5IYB G;  1IYU A;  2F3I A;  4N8F A;  2E5L Q;  4LF5 L;  4IFD I;  4YWK A;  1STE A;  3H3V I;  2D2C C;  5LMN Q;  3GTK B;  3UE0 A;  4UPA A;  1D1K A;  4IUN A;  5J39 A;  4QL5 A;  1F9S A;  5ISR A;  2EIF A;  5HUR A;  4C3J H;  3EQL C;  3H0G G;  4B9X A;  2F0O A;  5IP7 H;  3K8A A;  3DLL A;  1E1O A;  1EYC A;  2K14 A;  5KNC A;  2B29 A;  3J81 E;  3K5M A;  1EQT A;  2R7Z H;  1Y1W H;  1PFB A;  4GNX B;  1EFI D;  2K04 A;  1I6H H;  4JG2 A;  1VMC A;  4A4I A;  4LK1 C;  4CJ2 C;  2RKS A;  1TS4 A;  4IQZ A;  4N9P A;  2ID0 A;  1AE3 A;  2VB3 X;  5EPL A;  1KAA A;  4DR5 Q;  1SAP A;  5IYC H;  1E7Z A;  2F0V A;  5IGC A;  3G71 A;  1Q8K A;  4DAP A;  3V96 A;  1JIC A;  5FLM H;  4RGN A;  4N8X 1;  3I4N B;  3Q6S A;  3HEJ A;  2N88 A;  3CC7 A;  2JA5 H;  4LFA L;  1Z9F A;  4FDB A;  4JI1 Q;  3STB D;  4LAA A;  5DM7 3;  1G6P A;  1WTH A;  2L9H A;  2MO1 A;  3ERQ A;  3K81 C;  1TWF H;  1P8L A;  1TXY A;  1PFM A;  1Q86 C;  2I07 B;  3C46 A;  4KD4 A;  4A3B G;  4IFD G;  1PXU A;  3S14 H;  4JI7 Q;  4A3E H;  1HQR D;  1K8G A;  2MGS A;  1CA6 A;  4XQQ A;  3MXN B;  4Y52 H;  3CW2 C;  3NHH A;  2LY7 A;  4Q0F A;  4NKL A;  2VUM H;  3AFQ A;  4ABN A;  2F4I A;  3ND9 A;  1CQV A;  4CJ0 B;  1MSG A;  4JBW A;  1HTL D;  2I0Q A;  3NBH A;  1STH A;  3RZO B;  5C4X H;  2C5C A;  4JI2 L;  4RCN A;  3UDG A;  2D0O A;  3VYR A;  3A8J E;  4LF6 L;  4UAI A;  1SMY C;  1O78 A;  1AW7 A;  3MWY W;  4K5X A;  1YNN D;  3H15 A;  2BDO A;  1MGS A;  2B2V A;  1LM0 A;  5IWA Q;  2RHS B;  1HR0 W;  3K6O A;  3DWQ A;  1B44 D;  4DV7 L;  3E3X A;  3QOJ A;  2CW0 C;  1GUG A;  1PRT C;  4H0L C;  4KV6 A;  5JAV A;  5C3E G;  1BCP F;  2FMC A;  4ID6 A;  2KEC A;  3HG9 A;  3S9W A;  1GHJ A;  1EQV A;  2F0E A;  2EVB A;  4OX9 L;  2JK8 A;  1LTL A;  2XN9 C;  3S16 B;  1EYG A;  1YZ6 A;  4B3S Q;  3G48 A;  3HKZ G;  4HMJ A;  3B6Y A;  5IE8 A;  2K5D A;  3GTO H;  2CVR A;  2JA6 B;  3AB9 A;  3PIO A;  2Y0S E;  2ZJQ A;  3PO2 G;  4JV5 Q;  4YY3 L;  1TS2 A;  2E2H H;  2XWJ B;  4DR7 L;  4HMI A;  5JJL A;  1PH5 A;  1ONL A;  4A3L H;  2L11 A;  4CKC A;  1VQ8 A;  3U50 C;  2ES2 A;  1HQM C;  1RD9 D;  2MNA A;  2Z6B A;  1UE1 A;  1TR5 A;  1XTC D;  2B2U A;  1MD2 D;  5JJZ A;  3SK5 A;  5C4H A;  4R4I A;  3F8T A;  2NVT H;  1F9P A;  2WII B;  4CDF C;  1ENF A;  1X32 A;  5E1F A;  3S1Q B;  3F2B A;  2ZM6 Q;  4IJL A;  1V1O A;  1HNZ L;  3VR2 A;  3HZX A;  4HED A;  4B3R L;  2MP1 A;  4X3S A;  2GVB A;  3KLS A;  1SSO A;  3FMC A;  1CZG A;  3EA6 A;  1BBW A;  3A0J A;  1DYQ A;  3GTP H;  1JOR A;  4MTN A;  2JA8 B;  3HP3 A;  5E4W C;  1BCP B;  1VQP A;  1OTC A;  4BY7 H;  2TMP A;  1J9O A;  2H1E A;  1VQ9 A;  1PH4 A;  2N78 A;  1L0W A;  2VQE L;  3OIQ A;  1BCP D;  5C3W A;  1YHB A;  3FPP A;  4RGM A;  2O2L D;  2K5H A;  3NWS A;  2CH4 W;  5AJ3 Q;  2F0G A;  4QCL A;  1QWY A;  1HFN A;  1TWA H;  1C0A A;  2WAQ B;  3OTO L;  3RMH A;  2BE5 D;  1TWC B;  1KIX A;  2K01 A;  3J81 j;  4DR2 L;  2L15 A;  5C44 G;  5GAE C;  4POG A;  2O5I C;  1I4G A;  4A3M G;  3E0J A;  2JA7 B;  2FMM A;  1EWH A;  3Q22 A;  3IKJ A;  2R92 G;  5I4D A;  1C8C A;  3D4D A;  4RGT A;  4KJN A;  4UHV A;  1CKO A;  3PIO 3;  5JVH 3;  4P72 A;  4EQO A;  4X62 Q;  3U9S A;  1LUZ A;  2NVQ H;  2HD3 A;  1KLG D;  1T9H A;  3SXH A;  4JYA L;  2KCM A;  1XX8 A;  2DUD A;  2N8N A;  2IX3 A;  1SJE D;  4BXX G;  4BA1 I;  1GVP A;  4K6D A;  2EOT A;  4QUC A;  2DNE A;  1NR4 A;  1VQA A;  4ZLT F;  5M3F B;  2ZXP A;  1SLJ A;  1D1I A;  4LMQ D;  3NTI A;  1KRT A;  1GHK A;  1YNX A;  3T1H Q;  2D5D A;  1SJH D;  4DR3 Q;  1NNX A;  1TII D;  3TEH B;  3W1B A;  1WJJ A;  1XPU A;  5T1G A;  3SK6 A;  4BBS H;  2N55 A;  3GTM B;  2D62 A;  2DNC A;  2XGT A;  2XIW A;  5GAH C;  4DR1 L;  2PZW A;  1MKH A;  3U9O A;  3W2D A;  4OO1 I;  1F2L A;  1S5D D;  1K8M A;  3W5O A;  4FXG C;  1O7Y A;  1G2S A;  1N36 Q;  1EEI D;  2PYK A;  1AP0 A;  4KK7 A;  3HOU G;  3I4M G;  1X9N A;  3IAY A;  1WCM G;  1I6V C;  1ASY A;  2PO4 A;  4FYD A;  3M4Y A;  1IW7 D;  2SDF A;  3CXC A;  2KJX A;  4B9W A;  1RIP A;  4IAL A;  4RWS C;  1EY5 A;  1B50 A;  3UE1 A;  1YIT A;  3BVZ A;  4S3S A;  4LJZ C;  3M3Y B;  1JOK A;  3S1N B;  4Z9C B;  1UEA B;  5JVG 3;  2WB1 E;  3QO2 A;  1LYL A;  1HHV A;  3WOE A;  1FVI A;  1SR3 A;  3HKZ E;  2KOL A;  1SFO H;  4PZ6 A;  4GN3 B;  5HGT A;  3PUV A;  5FLX E;  3HOZ B;  4A3J G;  1V1Q A;  1EZ8 A;  5H1S E;  2RDH A;  1MSH A;  1J8I A;  1K28 A;  1XMQ Q;  4C1N I;  2PI2 E;  2HDM A;  1VQ5 A;  1PH9 A;  5JJI A;  1CKN A;  4RA8 A;  5FLX L;  2YTX A;  4GNX C;  1X3E A;  5KYL A;  1JJ2 A;  3E9H A;  2JXM B;  1B3Q A;  2B2U C;  3VR4 A;  1CM9 A;  3MFG A;  3F2C A;  4OXP A;  1LAC A;  5E3F A;  1S5E D;  3J7A V;  4XQN A;  2I46 A;  4K6L A;  3CD6 A;  3TSS A;  4KKS A;  2EYO A;  3E5S A;  2EJM A;  1J5E L;  1Y1V B;  1B53 A;  1DXM A;  4X66 L;  1HA6 A;  1DOL A;  1K8A C;  1PFS A;  1PV4 A;  4A3G B;  1H9M A;  3M4O B;  3FVQ A;  1V1P B;  2PW7 A;  1SRU A;  4GOP A;  2E8G A;  2WIN B;  1FJG Q;  2L1B A;  3CME A;  3UDF A;  4B3T Q;  1WD0 A;  4ZAI A;  3CQZ H;  1KAW A;  4OWX B;  2V4D A;  1PLF A;  3KBG A;  1T5E A;  2EQS A;  3H0G B;  4DV6 Q;  4L8J A;  2ZT9 C;  2KCN A;  1II3 A;  3SDZ A;  3T16 A;  5IT9 E;  2EJF C;  5FJ8 G;  4C2M H;  3CCQ A;  1QNK A;  3E9I A;  4A3K H;  4RKL A;  4X3T A;  5K36 G;  1VDZ A;  1HNW Q;  3OSO A;  3CAM A;  2R7F A;  4K5V A;  4JI3 L;  5ELF A;  4HCS A;  2ENB A;  2UUA L;  1LTA D;  2RSN A;  5IT9 L;  3V2T A;  1P16 A;  2E2I H;  3ER0 A;  5IY0 A;  3ULP A;  4NXM Q;  1E2Z A;  5BN5 A;  3W1G A;  2B8F A;  1IKL A;  1UEB A;  4PMW A;  2F0U A;  2D0P A;  2RHQ B;  4A3D H;  1STN A;  2VL6 A;  3CC4 A;  3TN2 A;  2QA4 A;  3G6J B;  1NY4 A;  2A73 B;  4BWG B;  2KVM A;  1SXT A;  1IBL Q;  1KL9 A;  2F0D A;  2Q2H A;  4XT1 B;  1WD1 A;  4KKU A;  4Y7N B;  2WP8 J;  1PH7 A;  1KQS A;  4C3J G;  4JBJ A;  5DNF A;  3QB3 A;  1IHZ A;  1KTK A;  4A3C H;  4A3B B;  1K3R A;  3OOC A;  4OIK A;  2HCC A;  1L1O A;  2FIN B;  2VQF Q;  2D9U A;  3E0E A;  1YJN A;  1IBK Q;  1WVL A;  3H09 A;  4A93 G;  1Y1W G;  4TKO B;  3C1F A;  2B63 H;  2RCF A;  2KEN A;  1X55 A;  5M5W B;  5LMU Q;  3OW2 A;  2Z0S A;  4DR5 L;  5KEE A;  1SEB D;  2K5V A;  3O13 A;  3J7Z C;  3MFY A;  3I73 A;  2GN5 A;  2BA1 A;  3CKI B;  2BA0 A;  2IHE A;  5FKA C;  3RNU A;  1VMP A;  1A0I A;  3S15 H;  4MN3 A;  4MZ9 A;  3D4W A;  3PGZ A;  2NVX B;  1CHQ D;  4HJA A;  2XRQ D;  1K8O A;  4FP5 D;  1YIJ A;  4JI1 L;  1KDC A;  1PH8 A;  1IL8 A;  5C3E B;  3RN2 A;  2JA5 G;  1BCP C;  3QR8 A;  5EAY A;  1N34 L;  3BZK A;  2CHB D;  4LF8 L;  3MTS A;  1IYV A;  2AHO B;  3KLR A;  4QY7 A;  5FK9 C;  4TQU S;  4BBR H;  1MIU A;  2XRS D;  4A3E G;  3TP7 A;  1DM0 B;  4O1N A;  2NYZ D;  2G5D A;  1ZYR C;  2RSO A;  2BE5 C;  3D3R A;  3S1R H;  3PO2 B;  1Q81 C;  2K28 A;  3GV3 A;  3Q8D A;  1BVS A;  3I91 A;  1Z7T A;  1B8A A;  1WYD A;  4DU9 A;  1W3S A;  4ZKC B;  1HNX L;  3J81 c;  3S17 H;  4HID A;  3WOF A;  2NTT A;  5KYI A;  4JPB W;  4BY1 H;  3KDF B;  4ME3 A;  2Z4H A;  4QF4 A;  3RD4 A;  3SVM A;  1MHW C;  1UAP A;  1LV9 A;  4DUZ L;  3TS2 A;  1G6Z A;  3FKI H;  1WTR A;  3P75 A;  1YHQ A;  4JI8 Q;  4CDE C;  1VQ7 A;  1R9T H;  3MZ5 A;  2JSO A;  1T5X D;  3CCJ A;  5CV4 A;  4X64 Q;  2UXD Q;  2NTS A;  3PCO B;  3P1H A;  1EYD A;  1STA A;  2PZT A;  2MQH A;  4G7H C;  2VXW A;  4JV5 L;  2F0T A;  1A6X A;  1JC7 A;  5D3D A;  2I5M X;  1HUN A;  3GTQ H;  2FJ2 A;  1QVG A;  3CP0 A;  3J7A F;  2EZV A;  4E6I A;  1VF5 C;  3NK9 A;  3HOV H;  4EVO A;  1U5K A;  1K3B C;  5C4Z A;  3S16 H;  2Z8L A;  1A3U A;  1Q3L A;  1C4Q A;  1JQY D;  4JW0 A;  1FL0 A;  2Q2U A;  4QIW B;  3NEM A;  4GLX A;  1IW7 C;  2ZM6 L;  4PMB A;  4JOI C;  5C44 B;  1I50 B;  1OXV A;  2LSS A;  4A3M B;  3PQI A;  3TP5 A;  3TZD A;  5KND A;  5CC4 A;  4G7O C;  2R92 B;  3S2H H;  2M2L A;  4XTC S;  1XWE A;  2YTV A;  4DUY L;  2WKD A;  4K0K Q;  4ALP A;  3H94 A;  1SND A;  4BY7 G;  5BR8 L;  1V8Q A;  1I4P A;  4ZYS A;  3N52 A;  2HDL A;  3MXG A;  1TS5 A;  1N32 L;  1DCZ A;  3T4A C;  4KHP Q;  3R2I A;  4F87 A;  1Y8O B;  2KCT A;  3DMU A;  4HSV A;  2E74 C;  2CQO A;  1EWC A;  3QIA A;  5AJ3 L;  4O42 A;  1JE4 A;  3Q23 A;  3BZC A;  4DXG A;  1RHP A;  1JWM D;  3UDX A;  3I8Z A;  2PPB C;  4CKE A;  1L1O C;  4ULL A;  3FHW A;  2WAQ E;  4RMF A;  2AKW B;  2RCN A;  2C35 B;  4Q5V A;  4TRD A;  1B1Z A;  4KHZ A;  4F7X A;  5M3M H;  2Q8I B;  1ROD A;  2E75 C;  4C3I G;  4DKA C;  4V19 0;  3L9A X;  4NXN L;  3C3L A;  3I2Z A;  1QG7 A;  1QZH A;  4HJ9 A;  3TZU A;  3S1M H;  1E3P A;  4IUT A;  3J81 L;  1M4V A;  2F03 A;  1Q1E A;  3I4M B;  3RLO A;  3HOU B;  1WCM B;  2OWO A;  5IGG A;  1WFQ A;  2A69 D;  4X65 Q;  2HHH L;  5EBC A;  4B3M Q;  3K7U C;  3TRZ A;  3PO3 H;  2NZH A;  1SYE A;  4J1M A;  3VYT A;  1LTR D;  2EYJ A;  3MHB A;  1FYC A;  1L0Y B;  2L4N A;  2UXC Q;  4DFA A;  1MBY A;  4I65 A;  1PTO F;  5CV9 A;  2WV6 D;  3D4R A;  3I70 A;  5JPN C;  3KF8 A;  3T1H L;  5JOB A;  2LXK A;  1LAB A;  2OTL A;  5F2D A;  5CV6 A;  1U4M A;  1H9S B;  2B2T A;  4A3J B;  4CJ1 B;  5IGE A;  2RF4 A;  1J6Q A;  2Z9H A;  2HCI A;  1IBM Q;  3DM3 A;  1XNQ Q;  1EY7 A;  4KHV A;  5JEA J;  1D8L A;  1N36 L;  3HOW H;  3NPP A;  2Q8T A;  4CGY B;  5M3F H;  4DN4 M;  1SYG A;  3BG3 A;  3ERS X;  1YI2 A;  4R4O A;  1FNW A;  1B3A A;  2K05 A;  3HKS A;  4K2L A;  3AQQ A;  2QW7 A;  5EPJ A;  1LTS D;  4IOC A;  1VQF A;  3PV0 A;  4AYB G;  4RH6 A;  4X3U A;  1SE8 A;  3GTM H;  1Q46 A;  2PMZ B;  5CBA E;  1K83 H;  1TKW B;  1I4H A;  1RJT A;  3L0O A;  3N6R A;  2UU9 Q;  1D7Q A;  4N9T A;  4DAY A;  4DAV A;  2AMC B;  1M90 C;  2WKC A;  1ZXT A;  4JCV E;  3CRL C;  1Q8I A;  5GQO A;  4XQJ A;  1PTO B;  5J1Z A;  3GTL B;  1XMQ L;  4OIJ A;  4I7A A;  1R4P B;  4LFC L;  2UUB L;  2XTI A;  2PQA B;  1ESR A;  1STY A;  3QWN A;  1MJE A;  4L5T A;  1BNZ A;  3S1N H;  1BR9 A;  4HIO A;  1HA5 A;  1CUK A;  2WFW A;  3TBI B;  1PTO D;  1XNR Q;  4EQ5 A;  1QIL A;  2AUK A;  4DV0 L;  4GNX A;  1FNU A;  5I2X A;  1E1T A;  2MUY A;  1PYS B;  3NQT A;  2Q2T A;  1B9N A;  4LF4 Q;  1S5C D;  1SNC A;  4MNO A;  1R4Q B;  1F2Z A;  3HGB A;  1FD7 D;  2JA9 A;  4DV1 Q;  2EJG C;  1K73 C;  2RA4 A;  3GP7 A;  3MXU A;  2EYF A;  2X69 A;  3TP8 A;  5A2Q E;  1ZEQ X;  2PQE A;  3IFT A;  1VQI A;  3J81 i;  5ELN A;  1PYB A;  3GTJ H;  1FJG L;  1C7Y A;  4B3T L;  5KIX A;  2F4V Q;  4NDX A;  5EKI A;  5JJK A;  1FGU A;  3CCL A;  1HXY D;  2WAC A;  4LNQ A;  4L5Q A;  1JWU D;  5A2Q L;  3T51 B;  2BOS A;  5COY A;  1ET9 A;  2QKI C;  5BN3 A;  4LF9 L;  2K50 A;  4C3J B;  2ZXO A;  4DK3 C;  5TSS A;  1AFP A;  3MXN A;  2UXB Q;  5FLX c;  4A3G H;  1EU4 A;  4MHE A;  2R93 G;  1IXR A;  2EY1 A;  1HNW L;  3SK4 A;  1KNA A;  4DV4 L;  5IYD H;  5CV8 A;  4KN4 C;  4P75 A;  5D14 A;  5L37 A;  4A93 B;  1Y1W B;  1TWH H;  3G6E A;  2NVY H;  1KDB A;  3G4S A;  2IT1 A;  1JE5 A;  4NXM L;  4LFB L;  3HOX G;  1EFW A;  2DY7 A;  5C4J B;  1EY0 A;  4WFN 3;  1EY8 A;  4UP7 A;  1VQJ A;  3KF6 B;  4YWM A;  1DON A;  1W6J A;  3D6W A;  4NB3 A;  1IBL L;  3OIP A;  2A5H A;  4ZCK A;  4J15 A;  4C3H G;  4J6H A;  1M8A A;  1RDP D;  1U0L A;  2R7D A;  2VB2 X;  1B9M A;  2CQA A;  4YIJ A;  3F2D A;  1JJC B;  2J4X A;  2JA5 B;  3GDE A;  4DNT B;  1TWF B;  2VQF L;  3S2D H;  4K8J A;  4JI5 Q;  1IBK L;  3LX0 A;  4A3C G;  2Z6K A;  3NE5 B;  4A3E B;  1EOT A;  2F0I A;  2B2T C;  2MO0 A;  4RHR A;  4IUP A;  2OQ0 A;  3NQI A;  1BDO A;  5DM6 3;  2VUM B;  3TP6 A;  1PH2 A;  3P20 A;  3A5Z B;  4KTA A;  1O80 A;  2B63 G;  4Y7N H;  3VR5 A;  1ASZ A;  1VQ6 A;  2A8V A;  5IT9 c;  3K58 A;  2YU9 H;  1PHJ A;  2FXQ A;  2OEO A;  3A54 A;  3T53 B;  1XJV A;  5I9P A;  4LFA Q;  3CPW A;  1WOC A;  4P74 A;  3CCM A;  5J3B A;  4DGZ A;  1S72 A;  4B08 A;  1UE7 A;  1PA6 A;  1A8V A;  4JI4 L;  4YHH L;  4GN4 B;  2E2D C;  2O5J C;  2XVS A;  4APV A;  2ZJP A;  2RBM A;  3FDT A;  4IUQ A;  3KLW A;  1GM5 A;  1E2V A;  1LLR D;  3K5N A;  4HJ5 A;  1JR0 D;  2QDB A;  4CKB A;  2B2Y C;  3ZYY X;  1RCV D;  4IJH A;  1SN8 A;  4ZK9 B;  1QNU A;  5JEA H;  2Z1C A;  1LTB D;  1NJI C;  3GD7 A;  4JI2 Q;  4BBR G;  3HFZ B;  3DM1 A;  4GKK L;  5IGD A;  1BF4 A;  3GTO B;  4DK6 C;  3U4V A;  4PZ8 A;  2E2H B;  4DNR B;  1VF7 A;  4LUV A;  4DV7 Q;  2K52 A;  4U67 3;  1SBB B;  4IUV A;  3QG1 A;  1A15 A;  4JI0 L;  5CYU A;  4OX9 Q;  1HR0 Q;  2A69 C;  2EXD A;  3K7A H;  1SYB A;  2YTY A;  4BY1 G;  1BOS A;  2K33 A;  3M7G A;  1C9O A;  3TME A;  2FFK B;  1JCK B;  1JOO A;  4A3F G;  3HOY G;  1I3Q H;  1IYJ B;  2Q2I A;  2H5X A;  4JI8 L;  1EIF A;  2KHI A;  2M9V A;  3PO2 H;  2ZJR A;  3BDC A;  1G8Z D;  1ML0 D;  3GTG B;  2NN6 H;  2K4K A;  2OCE A;  4DV2 Q;  4OO1 G;  4LF7 L;  2UXD L;  3STB C;  3AEV A;  3FKI G;  2A68 D;  5E7N A;  2TSS A;  4YY3 Q;  3M4P A;  2AQ1 B;  4BY7 B;  3JAM E;  2LS0 1;  3NTK A;  4KY7 A;  1MJC A;  2QIL A;  4KN7 C;  3URY A;  4HJ8 A;  4BS9 A;  1H95 A;  1EEF D;  4GZY C;  2EY2 A;  4PZ7 A;  4A3I G;  2E2J H;  5CBE E;  1VQC A;  1VQM A;  4JC0 A;  3EN2 A;  3RLF A;  3JAM L;  5M5X B;  3ULJ A;  4QIW E;  3HOV G;  4B3R Q;  1B70 B;  4XT3 B;  1JJG A;  3OPO A;  4LWC A;  3T1Y L;  1ICW A;  4IPH A;  3UDI A;  4DXF A;  1YNN C;  1D5Z C;  3T13 A;  1YJ9 A;  1UWV A;  4C3I B;  1SE3 A;  4JOI A;  1KRS A;  2CKZ B;  1VQL A;  2L0C A;  4K0K L;  3OMG A;  3A5U A;  4X3K A;  5LMN W;  3ICE A;  2A6H D;  3M85 A;  1XYI A;  1NUC A;  4EQP A;  1SNQ A;  2E5L L;  4GLA C;  2F0P A;  5I9O A;  4QGU A;  1Q90 A;  1U4R A;  1QUQ A;  1Y8N B;  3CCU A;  2RQX A;  1PYW D;  5ELB A;  4H02 A;  5IIF A;  2JYO A;  1GUO A;  5LMN L;  1H9J A;  4HAE A;  2NVQ B;  4UY8 C;  3DEP A;  1GUT A;  1WTV A;  1I50 H;  1DOK A;  1SNP A;  5C6A A;  3MA2 B;  1TU2 B;  3MVV A;  5K5P A;  1VQH A;  2LFN A;  4DR2 Q;  2YV5 A;  2IJ0 A;  1JWS D;  2R6G A;  1PTO C;  5G3L F;  3G7L A;  4R4C A;  1PRT B;  5M5Y H;  5IP7 G;  1QVC A;  2EE1 A;  2Z6K C;  1CKM A;  1A62 A;  4XXE A;  1ILP A;  4KLK A;  2IWH A;  2F0N A;  3BDO A;  1IZ6 A;  3KUP A;  3KJO A;  2RDF A;  1NE3 A;  1Q1B A;  4KKT A;  4YCV A;  2VS1 A;  2R7Z G;  2K75 A;  5M3M G;  1LT6 D;  4JBK A;  3GTK H;  4XIG S;  2CW0 D;  1PRT D;  1DD2 A;  3TQY A;  4JYA Q;  4HCE A;  4RKB A;  4J8Q A;  4XYQ A;  4X65 L;  1D6E C;  4AH6 A;  3VR6 A;  3TS0 A;  5IYC G;  2A19 A;  2IW3 A;  1QCB D;  1FGB D;  4AQY Q;  3GQB A;  2MJ8 A;  3HRZ C;  1EIH A;  3TDQ A;  4AYB B;  1UNS A;  3PO3 G;  2UXC L;  1YHA A;  5FLM G;  4DV5 Q;  2KEE A;  1GO3 E;  4HTH A;  4KY5 A;  5KRU A;  3VA5 A;  5EJW A;  2PW5 A;  3D31 A;  1X65 A;  1X6O A;  2B8G A;  4JBM A;  4JI7 L;  1V1P A;  3SR1 A;  4A76 A;  2O4X A;  4DR1 Q;  3EVQ A;  1SFO B;  1BBX C;  1NTG A;  3FRP B;  3R8B A;  4FO2 A;  4DPG A;  3UI2 A;  4OHJ A;  4DR4 Q;  3I4N H;  2VUM G;  1TWG B;  2BCO A;  1JT8 A;  1DJR D;  1BXT A;  4R8N A;  3K5O A;  3WDN A;  1EOV A;  2AWO A;  2N49 A;  4HSP A;  3HOW G;  5G3L D;  1VQD A;  3JAM i;  3ZJY C;  2F0K A;  5C4X G;  1YJW A;  5CMD A;  5C0X I;  2IY5 B;  4YCU A;  5IWA L;  3KBX A;  1PH1 A;  1WTO A;  3H91 A;  1OXX K;  3R3O A;  1CK1 A;  4A3J H;  4IO9 A;  1A3T A;  5COR A;  4L5S A;  5LHY 1;  2UU9 L;  2PMZ E;  1Y14 B;  1WTQ A;  3VYS A;  3DUZ A;  4RAU C;  1EIG A;  2IX1 A;  4IUU A;  3QJY A;  4B3S L;  3RZO H;  4MIU A;  2Q8R E;  1I4R A;  1WTW A;  1L0X B;  1X3P A;  3X3M A;  1PZI D;  2K5N A;  5NUC A;  2CWA A;  3M7N A;  2IX0 A;  5C0X J;  2DGY A;  3IFD A;  1GUW A;  1HRJ A;  5EPK A;  1PVO A;  2CFM A;  1XNR L;  1U4P A;  1EQQ A;  2DJG C;  2B2W C;  5I6Y A;  2QEX A;  3SGI A;  1SYD A;  2AUJ D;  2IPK D;  3A55 A;  3KK7 A;  3FP9 A;  1XTD A;  2R93 B;  2G9D A;  3OWF A;  2ATW A;  1PTO H;  4WJW A;  4X66 Q;  3KF8 B;  4A3K B;  2F0J A;  4ZRZ A;  1NCV A;  4NP5 A;  1KDA A;  4ODG A;  1JB3 A;  4DV1 L;  3ND8 A;  2JA6 H;  1CT1 D;  3I3C A;  1VS0 A;  4KD3 A;  3TRE A;  3HOX B;  2Y0S G;  1H9R A;  1GKH A;  3F2U A;  4K8I A;  5DEH A;  5FJ8 H;  5GRO A;  3A7L A;  2F0Q A;  1OXT A;  3NBH B;  2PCF B;  4C3H B;  2EPB A;  3PUX A;  5K36 H;  2K7V A;  2KHS A;  1YEZ A;  3V05 A;  1D5X C;  3J80 E;  3S1Q H;  3K57 A;  1S5F D;  2UXB L;  3DWA A;  4JVZ A;  5IP9 H;  1NBW A;  4OEL B;  5ELO A;  4JI6 Q;  2JA8 H;  1KXL A;  4ZUJ A;  1LTG D;  1X3Q A;  4DAY B;  4RHS A;  1ILQ A;  1PZK D;  1AZQ A;  2F0S A;  2DN8 A;  3BVG A;  3J80 L;  2JEA I;  5IYD G;  1RKN A;  1I4Q A;  5LL6 X;  4TSS A;  1I94 Q;  3E6Z X;  2PI2 A;  3OWE B;  2B63 B;  4OWT B;  4NW2 A;  1S3O A;  3C1E A;  5ELC A;  4AIM A;  3IL8 A;  2A68 C;  1HZ9 A;  1UUP A;  2ZTE A;  3KDF A;  3BJU A;  4X62 L;  1STB A;  4FVM A;  4NMZ A;  3S15 B;  2LXJ A;  4HN7 A;  2DY8 A;  4I7Z C;  1E2W A;  4RGO S;  4A93 H;  4GKJ Q;  4DV3 Q;  4RFB A;  1QZG A;  5D65 A;  3RN5 A;  1TWC H;  1M1K C;  1PDQ A;  1TT2 A;  4RCO A;  5BN4 A;  3CF5 A;  4IFD J;  2JA7 H;  3J7A 5;  5C4J H;  4JI5 L;  3ULL A;  3PF5 A;  3SEB A;  2AQ2 B;  2CWP A;  1BKB A;  2JEB I;  4P73 A;  4DR3 L;  4C56 C;  2GA4 B;  5T1I A;  3S24 A;  4FNF A;  4ILW A;  4C1N K;  4BBR B;  2OXP A;  3VA7 A;  1WI5 A;  1CZW A;  3D8G A;  3NSW A;  3BU2 A;  3WWV A;  3CMA A;  4HR7 B;  1Y8P B;  3MXP A;  4DNI A;  2I5H A;  3S1R B;  2OQK A;  2PNH A;  4BBS G;  2A6H C;  3LWE A;  3M4Q A;  2VZA A;  3FEW X;  1QB5 D;  2NN6 I;  1B7Y B;  1VQN A;  1H9K A;  2NZO A;  1BO0 A;  2BH8 A;  1N34 Q;  4EX5 A;  1A3V A;  3S17 B;  1U4L A;  4LF8 Q;  1X56 A;  1SE2 A;  4BY1 B;  5M9O A;  3HOY B;  4A3F B;  3K0X A;  1EZ6 A;  3CCR A;  2UUC Q;  1KLU D;  3R2T A;  2F0M A;  1G91 A;  2H4O A;  4K2K A;  5A35 A;  2L55 A;  3FKI B;  1MI2 A;  1JOQ A;  4DAM A;  3ERO A;  1R9T B;  2B2Y A;  2EY5 A;  4POF A;  2F3V A;  4MTK A;  2F52 A;  1ESF A;  5JEA G;  1HNX Q;  1SYC A;  4OWW B;  3EIV A;  4WJ4 A;  3KJP A;  3EBE A;  1TS3 A;  2XNA C;  3M9B A;  4LUO A;  2K6A A;  4G57 A;  4A3I B;  3M3Y H;  3GTQ B;  5DAU A;  1N33 Q;  4K14 A;  4DUZ Q;  3H3V C;  2A6E D;  5C5M A;  1HR0 L;  2L5T A;  3NWT A;  3RR5 A;  3HOV B;  2WB1 G;  1EU3 A;  3LNN A;  1E24 A;  4KY6 A;  3RZD B;  3HOZ H;  3J80 i;  2ALY B;  2F0H A;  4DV2 L;  4U68 A;  1O7Z A;  1CHP D;  1YNJ D;  2BH2 A;  1B4O A;  4FF3 A;  3SK8 A;  1KD1 C;  2AWN A;  2I5L X;  3I7F A;  4L5R C;  1V43 A;  4P71 A;  2NN6 G;  4QQB X;  4CDC C;  5HY6 A;  3S2H B;  4ME5 A;  4RG1 A;  5C0X H;  3DWP A;  3CCE A;  5EQ0 A;  3PSI A;  1HZB A;  4PNY A;  2MPM A;  4DR6 Q;  3KYH C;  1FR3 A;  1OXS C;  1XMO Q;  4DV6 L;  1STG A;  3GTG H;  3GV6 A;  3W3A A;  4YWL A;  4ZUI A;  1FNV A;  2KBN A;  5HGQ A;  5FO8 B;  4L63 B;  4HIK A;  4EQN A;  1Y1V H;  4L6T B;  3CRK C;  3BVM A;  1H9S A;  2DJF C;  4OGQ C;  1NSN S;  5IYB H;  3M4O H;  1BBU A;  4KMU C;  4DUY Q;  5FO9 B;  2OF1 A;  4A3K G;  1HFG A; 
#chains in the Genus database with same CATH homology
 5BR8 Q;  4YY3 Q;  4GLV B;  3M4P A;  3S1R H;  4LF5 Q;  4DR5 Q;  5IYC H;  3I55 A;  1E7Z A;  1Q81 C;  3CC2 A;  1N32 Q;  1SRO A;  3Q8D A;  1BVS A;  3G71 A;  1Q8K A;  4GS3 A;  1MJC A;  3H0G H;  1B8A A;  5M5X H;  5FLM H;  1WYD A;  4HJ8 A;  1W3S A;  1HNX L;  3J81 c;  3CC7 A;  1H95 A;  3S17 H;  1NMF A;  4HID A;  2JA5 H;  1N8R C;  2GVA A;  4LFA L;  1Z9F A;  1HZC A;  4PZ7 A;  4A3I G;  1CKN B;  2E2J H;  4FDB A;  1VQC A;  3KDF B;  4JI1 Q;  3STB D;  4ME3 A;  1VQM A;  4BY1 H;  4A3D G;  1G6P A;  4JC0 A;  3EN2 A;  2MO1 A;  3RLF A;  3K81 C;  1TWF H;  1P8L A;  1TXY A;  4C3I H;  2ASB A;  3ULJ A;  4QIW E;  3HOV G;  4B3R Q;  1B70 B;  3F1Z A;  4DUZ L;  1Z47 A;  1Q86 C;  4A3B G;  3TS2 A;  4IFD G;  3S14 H;  4JI7 Q;  4A3E H;  3HOU H;  1K8G A;  4LWC A;  3T1Y L;  1JJG A;  4IPH A;  3UDI A;  3MXN B;  3FKI H;  4Y52 H;  1YHQ A;  3CW2 C;  4JI8 Q;  1SMX A;  4HIM A;  1YJ9 A;  3JAM c;  1R9T H;  1VQ7 A;  4NXN Q;  2VUM H;  3PUY A;  1UWV A;  3CCJ A;  3AFQ A;  4X64 Q;  2UXD Q;  1OXU A;  4JOI A;  1KRS A;  3PCO B;  2CKZ B;  3I56 A;  1VQL A;  4JBW A;  2PQA A;  3A74 A;  4K0K L;  2MQH A;  3A5U A;  2I0Q A;  5LMN W;  3ICE A;  4JV5 L;  3M85 A;  5C4X H;  5LMU L;  2E5L L;  1X3G A;  4GLA C;  2HHH Q;  4QGU A;  4JI2 L;  3UDG A;  3CCU A;  1QUQ A;  2N3S A;  2I5M X;  2D0O A;  4GOP B;  1YVC A;  4LF6 L;  4H02 A;  3GTQ H;  1YBY A;  5LMN L;  1QVG A;  2VNU D;  3CP0 A;  3H15 A;  4UY8 C;  2HQL A;  1UE5 A;  1LM0 A;  5IWA Q;  3PIP A;  1W2B A;  2RHS B;  1HR0 W;  3HOV H;  3S16 H;  1U5K A;  1I50 H;  1Q12 A;  4A3L G;  4DV7 L;  4AQY L;  4A3B H;  1FL0 A;  2Q2U A;  2ZTC A;  5C3E G;  3H3V H;  1VQH A;  4DV5 L;  4DR2 Q;  3NEM A;  4OON A;  3U4Z A;  2YV5 A;  4GLX A;  4AYB E;  1EQR A;  2R6G A;  2ZM6 L;  4OX9 L;  4O2D A;  2JK8 A;  1LTL A;  4R4C A;  4JOI C;  5M5Y H;  5IP7 G;  3CCS A;  1QVC A;  2CCZ A;  2LSS A;  1OXV A;  2Z6K C;  1EYG A;  1YZ6 A;  1CKM A;  1A62 A;  5M5W H;  4B3S Q;  4KLK A;  3AFP A;  3G48 A;  3HKZ G;  1IZ6 A;  3B6Y A;  3KJO A;  3S2H H;  5IE8 A;  1NE3 A;  1Q1B A;  4XTC S;  4YCV A;  2VS1 A;  3GTO H;  2R7Z G;  2K75 A;  2YTV A;  4DUY L;  4K0K Q;  4ALP A;  5M3M G;  4JBK A;  3PIO A;  3GTK H;  2Y0S E;  4XIG S;  2ZJQ A;  3PO2 G;  4BY7 G;  4JV5 Q;  5BR8 L;  4YY3 L;  4DR4 L;  2E2H H;  3TQY A;  2NVX H;  4DR7 L;  4JYA Q;  5JJL A;  1QUQ B;  1VCI A;  2VY3 A;  1N32 L;  1PH5 A;  4A3L H;  4X65 L;  4LF6 Q;  4AH6 A;  4KHP Q;  1VQ8 A;  3I4N G;  3U50 C;  2KCT A;  2ES2 A;  1VQG A;  5C3E H;  3TS0 A;  5IYC G;  2MNA A;  2A19 A;  1UE1 A;  2CQO A;  2QGQ A;  5AJ3 L;  4AQY Q;  3BZC A;  4R4I A;  3PO3 G;  2UXC L;  1YHA A;  3F8T A;  5FLM G;  2NVT H;  1VQK A;  3UDX A;  4DV5 Q;  1GO3 E;  3F2B A;  2ZM6 Q;  1L1O C;  3U58 A;  3FHW A;  4IJL A;  1K9M C;  2WAQ E;  4RMF A;  2AKW B;  1HNZ L;  1PH3 A;  2A1A A;  1G51 A;  2RCN A;  2C35 B;  4B3R L;  3D31 A;  1JB7 A;  1X65 A;  1X6O A;  2GVB A;  3L2P A;  4JBM A;  4JI7 L;  4KHZ A;  4IOA A;  1BBW A;  1L1O B;  3A0J A;  1TWG H;  5M3M H;  4A76 A;  4MTN A;  4DR1 Q;  3GTP H;  4BY7 H;  4O0A A;  4DKA C;  1VQP A;  1OTC A;  3JC6 6;  4NXN L;  4LFC Q;  2UUB Q;  1NTG A;  3KF6 A;  3I2Z A;  4X64 L;  1QZH A;  4HJ9 A;  1KC8 C;  3VDY A;  4DPG A;  3S1M H;  4DR4 Q;  1E3P A;  1VQ9 A;  3I4N H;  2VUM G;  3LGJ A;  4DR7 Q;  1VQO A;  1PH4 A;  3I4M H;  1Q1E A;  1JT8 A;  3RLO A;  2N78 A;  1UE6 A;  1L0W A;  2VQE L;  2OWO A;  4X65 Q;  1WFQ A;  2HHH L;  1EOV A;  1YHB A;  2AWO A;  2N49 A;  3K7U C;  4DV0 Q;  4B3M Q;  3HOW G;  3TRZ A;  3PO3 H;  1VQD A;  3JAM i;  3ZJY C;  2NZH A;  1EUJ A;  5C4X G;  1HJP A;  1YJW A;  2K5H A;  5C0X I;  5AJ3 Q;  2IY5 B;  4YCU A;  5IWA L;  1PH1 A;  2UXC Q;  1OXX K;  1TWA H;  4A3J H;  1C0A A;  4IO9 A;  3OTO L;  4R4Q A;  1KIX A;  4L5S A;  2UU9 L;  3J81 j;  4DR2 L;  2L15 A;  2PMZ E;  1Y14 B;  5C44 G;  3T1H L;  1X3F A;  1HNZ Q;  5GAE C;  2LXK A;  4POG A;  4A3M G;  1RL2 A;  2OTL A;  2IX1 A;  1V9P A;  4HJ7 A;  2V1C C;  2R92 G;  2B3G A;  4B3S L;  3RZO H;  1A63 A;  2RF4 A;  1J6Q A;  2JA6 G;  1IBM Q;  3DM3 A;  1XNQ Q;  1CKO A;  5JEA J;  1D8L A;  4P72 A;  1N36 L;  3HOW H;  4X62 Q;  1LUZ A;  2NVQ H;  1VQB A;  2K5N A;  3M7N A;  2CWA A;  5M3F H;  2IX0 A;  5C0X J;  2VQE Q;  1T9H A;  4JYA L;  2KCM A;  2DGY A;  2JQO A;  4IPC A;  4LF9 Q;  2R93 H;  1PVO A;  2DUD A;  2N8N A;  3ERS X;  2CFM A;  1YI2 A;  4R4O A;  4BXX G;  1XNR L;  4BA1 I;  3CPF A;  1GVP A;  3HKS A;  1EQQ A;  1E22 A;  4KHP L;  3AQQ A;  1CSP A;  4UP9 A;  2QEX A;  1VQA A;  4IOC A;  1VQF A;  3PV0 A;  4AYB G;  3SGI A;  1Q82 C;  5C44 H;  4DV4 Q;  1SE8 A;  3FP9 A;  4A3M H;  3GTM H;  1Q46 A;  1XTD A;  3HOX H;  1JMC A;  1K83 H;  1SLJ A;  3OTO Q;  2ATW A;  4X66 Q;  3L0O A;  1KRT A;  4JI6 L;  2UU9 Q;  3KF8 B;  1D7Q A;  1YNX A;  3T1H Q;  2R92 H;  5IP9 G;  1VQE A;  4DR3 Q;  4LFB Q;  2AMC B;  3TEH B;  3W1B A;  1WJJ A;  2HT1 A;  4DV1 L;  2OTJ A;  1XPU A;  1M90 C;  2JA6 H;  4BBS H;  1VS0 A;  1IL2 A;  2JA8 G;  4JCV E;  1I94 L;  3TRE A;  2YYZ A;  2D62 A;  5GQO A;  4C3H H;  2XGT A;  4R1J A;  2Y0S G;  5GAH C;  4DR1 L;  1XMQ L;  1MKH A;  4OO1 I;  1GKH A;  4LFC L;  2UUB L;  3W5O A;  2XTI A;  5FJ8 H;  5GRO A;  1N36 Q;  2PQA B;  4BXX H;  1OXT A;  1MJE A;  3HOU G;  3I4M G;  1X9N A;  3NBH B;  4L5T A;  1WCM G;  4LW1 A;  3S1N H;  1ASY A;  4HIO A;  3PUX A;  1CUK A;  2WFW A;  3CXC A;  1YEZ A;  4PG3 A;  1RIP A;  5GAG C;  4EQ5 A;  1XNR Q;  4DV0 L;  4B3M L;  4GKJ L;  4DV3 L;  3S1Q H;  3OYY A;  3UE1 A;  1YIT A;  2HIX A;  4GNX A;  4LUZ A;  2UXB L;  1E1T A;  1PYS B;  5IP9 H;  1DGS A;  1NBW A;  2WAQ G;  2WB1 E;  2Q2T A;  4LF4 Q;  5ELO A;  1LYL A;  1AH9 A;  1K0R A;  4JI6 Q;  2JA8 H;  1FVI A;  4MNO A;  1KXL A;  1SR3 A;  3HKZ E;  1QVF A;  2KHJ A;  4PZ6 A;  4DAY B;  1SFO H;  4GN3 B;  2JA7 G;  3PUV A;  2JA9 A;  4DV1 Q;  3RLN A;  1K73 C;  2JEA I;  5IYD G;  4A3J G;  1V1Q A;  1I94 Q;  5H1S E;  1CSQ A;  2PI2 A;  4NPS A;  1VQI A;  3J81 i;  5ELN A;  1XMQ Q;  1PYB A;  3GTJ H;  4OWT B;  1C7Y A;  2PI2 E;  1WCM H;  4B3T L;  1XPO A;  1FJG L;  1S3O A;  2F4V Q;  4AIM A;  1VQ5 A;  3J80 c;  1PH9 A;  1IBM L;  1HZ9 A;  5JJI A;  1XNQ L;  5JJK A;  4IPG A;  1CKN A;  1FGU A;  2JE6 I;  2ZTE A;  3KOJ A;  3KDF A;  3CCL A;  4X6A H;  4JI4 Q;  3BJU A;  4X62 L;  4YHH Q;  4LNQ A;  2YTX A;  4GNX C;  4L5Q A;  1X3E A;  2LXJ A;  1JJ2 A;  3E9H A;  4KI0 A;  4LF9 L;  2K50 A;  3F2C A;  4A93 H;  4OXP A;  1I5F A;  4DK3 C;  4DV3 Q;  1QZG A;  3RN5 A;  1AE2 A;  1GD7 A;  4GKJ Q;  1TWC H;  1S40 A;  2UXB Q;  5M3F G;  4OO1 G;  1M1K C;  5FLX c;  4A3G H;  3CF5 A;  4QJF A;  4IFD J;  2R93 G;  2JA7 H;  1IXR A;  1VQ4 A;  3CD6 A;  1HNW L;  2UUC L;  4BA2 I;  3J7A 5;  5C4J H;  4DV4 L;  4JI5 L;  5IYD H;  3ULL A;  4P75 A;  3PF5 A;  3K80 C;  1J5E L;  1HH2 P;  4X66 L;  1TWH H;  2CWP A;  1BKB A;  3G6E A;  2JEB I;  2NVY H;  4P73 A;  1K8A C;  1PFS A;  1PV4 A;  3G4S A;  2IT1 A;  4DR3 L;  1JE5 A;  4NXM L;  4LFB L;  3S24 A;  3HOX G;  4GKK Q;  4A75 A;  5GAD C;  1EFW A;  3OW2 A;  1SRU A;  1HZA A;  1WI5 A;  2MFI A;  4GOP A;  2E8G A;  3BU2 A;  1FJG Q;  3CME A;  4B3T Q;  3UDF A;  4YCW A;  3WWV A;  4UP7 A;  3NEL A;  3CMA A;  1VQJ A;  3KF6 B;  4YWM A;  4DNI A;  2I5H A;  2OQK A;  3CQZ H;  2PNH A;  4NB3 A;  1IBL L;  4BBS G;  1KAW A;  2ZTD A;  3AYH B;  4J15 A;  4OWX B;  2EQS A;  2HIV A;  3HOY H;  4DV6 Q;  4A3F H;  4JI0 Q;  3M4Q A;  1U0L A;  2VZA A;  2NN6 I;  1EIY B;  2R7D A;  1B7Y B;  1VQN A;  1N33 L;  2NZO A;  5FJ8 G;  1L2F A;  2BH8 A;  1N34 Q;  4EX5 A;  3L7Z C;  4C2M H;  3F2D A;  1JJC B;  3CCQ A;  1KHI A;  4LF8 Q;  1X56 A;  2IHF A;  3E9I A;  3CCV A;  4A3K H;  3MEF A;  3GDE A;  3NEN A;  5K36 G;  1X54 A;  4GN5 A;  3K0X A;  2VQF L;  3S2D H;  1HNW Q;  3PF4 A;  3CCR A;  2UUC Q;  4LF7 Q;  4QQB X;  3CAM A;  1N9W A;  2R7F A;  4JI5 Q;  4JI3 L;  1IBK L;  4A3C G;  4LF4 L;  2Z6K A;  1J5E Q;  2UUA L;  3GTL H;  2MO0 A;  4GOP C;  1P16 A;  3HOZ G;  4DAM A;  2E2I H;  3ER0 A;  5IY0 A;  2OQ0 A;  3ULP A;  4NXM Q;  3D0F A;  3W1G A;  1XPR A;  1PH2 A;  1UEB A;  4PMW A;  3A5Z B;  3PUW A;  4POF A;  4A3I H;  2D0P A;  2RHQ B;  4UP8 A;  2F52 A;  2B63 G;  4A3D H;  5JEA G;  4Y7N H;  1VQ6 A;  1ASZ A;  2VL6 A;  2A8V A;  3CC4 A;  2QA4 A;  5IT9 c;  1PH6 A;  1HNX Q;  1PHJ A;  2YU9 H;  4OWW B;  2FXQ A;  3EIV A;  1NY4 A;  4R4T A;  1XJV A;  4WJ4 A;  3GO5 A;  3KJP A;  4LFA Q;  1IBL Q;  3EBE A;  5C0X G;  1KL9 A;  3CPW A;  2F4V L;  1WOC A;  4P74 A;  3CCM A;  5J3B A;  2Q2H A;  3M9B A;  4LUO A;  4DR6 L;  1O7I A;  1S72 A;  1G29 1;  1XMO L;  3RZD H;  3M3Y H;  3I4O A;  1UE7 A;  1PA6 A;  3KFU A;  1A8V A;  4JI4 L;  4YHH L;  1N33 Q;  2WP8 J;  1PH7 A;  1KQS A;  4DUZ Q;  4GN4 B;  4JBJ A;  1HR0 L;  4APV A;  2ZJP A;  3RR5 A;  3T1Y Q;  2WB1 G;  2JJQ A;  3PUZ A;  4A3C H;  1K3R A;  2VW9 A;  3KLW A;  1E24 A;  1GM5 A;  1L1O A;  2VQF Q;  4WJ3 M;  3HOZ H;  3J80 i;  3E0E A;  2ALY B;  4HJ5 A;  4IPD A;  4TVA B;  1YJN A;  1IBK Q;  4JI3 Q;  1EWI A;  4IJH A;  4DV2 L;  1Y1V G;  4A93 G;  1SN8 A;  1Y1W G;  2UUA Q;  1Q7Y C;  2BH2 A;  1NMG A;  2B63 H;  1KD1 C;  2AWN A;  2I5L X;  2KEN A;  3IRB A;  4A3G G;  1X55 A;  3I7F A;  5DLQ E;  1V43 A;  4L5R C;  5IYB G;  4P71 A;  1NJI C;  2F3I A;  2NN6 G;  2Z0S A;  5LMU Q;  3GD7 A;  5HY6 A;  4JI2 Q;  4BBR G;  4DR5 L;  2K5V A;  2E5L Q;  4LF5 L;  3J7Z C;  4IFD I;  2GN5 A;  2BA1 A;  3HFZ B;  4RG1 A;  4YWK A;  4GKK L;  3H3V I;  3CCE A;  2BA0 A;  2IHE A;  3RNU A;  4DK6 C;  1A0I A;  5LMN Q;  3S15 H;  3UE0 A;  4UPA A;  3U4V A;  4MZ9 A;  4PZ8 A;  3PGZ A;  3PSI A;  1HZB A;  4QL5 A;  2EIF A;  4HJA A;  4LUV A;  4C3J H;  4DV7 Q;  3H0G G;  4DR6 Q;  2K52 A;  3KYH C;  5IP7 H;  1OXS C;  1XMO Q;  1YIJ A;  3K8A A;  4JI1 L;  1E1O A;  3DLL A;  1PH8 A;  4DV6 L;  2K14 A;  3GTG H;  4JI0 L;  4YWL A;  3RN2 A;  2JA5 G;  4OX9 Q;  2KBN A;  5HGQ A;  1HR0 Q;  2B29 A;  2EXD A;  3K7A H;  5EAY A;  4HIK A;  2YTY A;  4BY1 G;  1N34 L;  3BZK A;  2R7Z H;  1C9O A;  1Y1V H;  3HOY G;  4A3F G;  1Y1W H;  1I3Q H;  1IYJ B;  2Q2I A;  4GNX B;  4LF8 L;  2H5X A;  4JI8 L;  1EIF A;  2KHI A;  3PO2 H;  4JG2 A;  1I6H H;  2AHO B;  2ZJR A;  5IYB H;  4A4I A;  3M4O H;  4QY7 A;  1BBU A;  2K4K A;  2OCE A;  4TQU S;  4BBR H;  1MIU A;  4DUY Q;  4DV2 Q;  2ID0 A;  4A3E G;  3STB C;  4LF7 L;  3AEV A;  2UXD L;  3FKI G;  4A3K G;  1AE3 A;  5E7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...