4A3DK

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 33
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3dK00
4XLPA 4LK1A 2E2HK 3HOUK 3RZDK 3GTGC 3GTOK 3I4NC 3DXJA 4BY7C 3S1NK 3CQZC 3HOVK 4JK1A 3GTPK 1Y1VC 5IP9K 3HOXK 2NVTK 4A3JK 3S17C 2BE5A 1I6VA 5C3EK 1K83C 3WODA 3S15K 3S2DC 3PO3K 4OINA 3M4OK 3S14C 2JA8C 5IYCK 3HKZD 1HQMA 1SFOC 4Y7NK 2O5JA 2VUMC 4A3KK 4Y52K 5C4JC 4A3IC 4X6AK 5C4XC 2NVQK 4C3HK 3HOZC 1Y1WK 4OIRA 4A3BC 3EQLA 3HKZL 4YFKA 5FLMC 3S2HC 2R92C 1R9TC 3GTJC 2NVYC 2R93C 1TWCC 2B63C 4Q5SA 4A3DC 3M3YK 1XPPA 4A3LK 2Y0SD 4QJVA 3HOYK 5FJ8K 5TMFA 2WAQD 4YFXA 4A3MK 2YU9K 4NOIA 4YG2A 3GTGK 3I4NK 3GTMC 2Y0SL 4BY7K 4A3FK 3PO2C 3CQZK 2WB1D 4LLGA 2WAQL 5TMCA 3H3VD 3RZOC 3S17K 1K83K 2JA7C 4A93C 3HOWC 3S14K 1I50K 5IYDC 3S1RC 1BDFA 4BY1C 2WB1L 3FKIK 2R7ZC 2E2IC 3GTKC 4C3JK 2VUMK 4GZYA 4LK0A 3H0GC 2JA6C 4BBRC 5C4XK 4A3IK 3H3VL 3S16C 3S1QK 3HOZK 1TWGC 3I4MC 1I6HK 1I3QC 1WCMK 2NVXC 2CW0A 4LJZA 5FLMK 4XLNA 2R92K 1R9TK 3GTOC 4QJVB 2NVYK 3GTJK 2R93K 1TWCK 4A3GK 4A3DK 3K7AC 3HOXC 2A6EA 4XSXA 1ZYRA 5D4DA 4Q4ZA 4A3JC 4BXXC 1TWAK 2JA5C 3M4OC 1TWHC 1TWFC 2PA8D 4QIWD 4KN7A 4A3EC 5IYCC 3GTMK 4Y7NC 1Y1VK 3PO2K 4A3KC 4BBSC 4X6AC 2O5IA 3S2DK 3GTQC 5IP7C 2PA8L 1YNJA 4QIWL 4C2MK 5M3FK 2JA7K 2JA8K 4OIPA 4A3CC 3HOWK 5M3MK 1SFOK 3GTKK 4BY1K 2PMZD 2R7ZK 4C3IK 3GTLC 2A68A 5C44C 5C4JK 3S1MC 3H0GK 4BBRK 4Y52C 4G7HA 2E2JC 3S16K 4A3BK 4YFNA 5IYBC 3HOYC 1TWGK 4OIQA 5M5XK 3I4MK 2E2HC 1I3QK 3RZDC 2PMZL 2NVXK 2YU9C 3HOUC 3S2HK 3S1NC 3HOVC 2B63K 3GTPC 5IP9C 4A3FC 2NVTC 3K7AK 5C3EC 3S15C 4ZH4A 4BXXK 3PO3C 4MQ9A 4XSZA 4MEXA 2JA5K 1TWHK 1I50C 1TWFK 2A69A 4KN4A 4G7OA 4AYBD 5M5YK 3FKIC 4A3EK 1IW7A 1YNNA 2NVQC 4BBSK 5M5WK 4MEYA 1Y1WC 3S1QC 4KMUA 3RZOK 2PPBA 3GTQK 5IP7K 4A93K 1I6HC 4AYBL 1WCMC 4A3CK 5IYDK 3S1RK 2E2IK 3M3YC 4A3LC 4A3GC 3GTLK 4OIOA 2A6HA 2JA6K 5C44K 4G7ZA 3S1MK 1SMYA 2E2JK 1TWAC 5IYBK 4A3MC
chains in the Genus database with same CATH superfamily
2V6TA 2E2HK 1PJ7A 3GTGC 3CQZC 3BP3A 4A3JK 1GE9A 5C3EK 1K83C 3WODA 2CFAA 3S15K 3S2DC 1WIHA 3T00A 5IYCK 4GTEA 4AH6A 4A3KK 3T01A 4X6AK 1Y1WK 3GSIA 4P5BA 2XCQA 4WJ3M 3TFJA 2NVYC 4A3DC 1X31C 4A3LK 1HI9A 1IBAA 1PJ5A 1VGXA 5EGEA 3HOYK 4BY7K 3PO2C 2WB1D 2CFAB 5TMCA 4ILDA 2JA7C 1J98A 4PABA 4O2DA 3SZZA 3HOWC 1I50K 5IYDC 3S14K 2ZUFA 1BDFA 4BY1C 3FKIK 4C3JK 3H0GC 4A3IK 3S1QK 4KATA 3HOZK 1I6HK 2CW0A 2XCRB 2R92K 1R9TK 3GTJK 4GTFA 1TWCK 4A3GK 2R93K 1WORA 5TJ3A 4XSXA 4A3JC 2PHCB 1TWAK 1PJ6A 3OREA 3FOFA 4QIWD 5IYCC 5L46A 4A3KC 4X6AC 1O29A 2PA8L 3GTMA 1EK8A 3MMLB 1SFOK 3GTKK 2R7ZK 4C3IK 4KASA 1WSVA 4Y52C 2E2JC 3S16K 4A3BK 4YFNA 3HOYC 1TWGK 3I4MK 5M5XK 3S2HK 3RZDC 3LAPA 2NVXK 3S1NC 3HOVC 1O28A 5IP9C 1F7VA 2NVTC 1I3QA 3IPJA 4ZH4A 4BXXK 4XSZA 1TWHK 1I50C 4A3EK 3FKIC 4BLBA 3T02A 1WOOA 4BBSK 1TWFA 3S1QC 1JOEA 3AQPA 5IP7K 1I6HC 1BGWA 4RMFA 4GTBA 3M3YC 4A3GC 2JA6K 3AD8C 1DCHA 1O2AA 1TWAC 4LK1A 3GTLA 3HOUK 3H0GA 3GTOK 3Q3QA 2W7VA 4JK1A 1VJEA 2XCOA 4GT9A 2E2HA 1I6VA 1XZPB 1WQGA 2Y3PA 3N3YA 3PO3K 3M4OK 1YCLA 2GSOA 1HQMA 1USOA 1SFOC 1IQ0A 4Y7NK 4C3IC 3LAJA 2NVQK 1BJTA 4A3BC 1USMA 1J6XA 4KAWX 3S2HC 4Q5SA 3GEHA 1XPPA 1L0WA 1WOSA 1WQHA 5FJ8K 4A3MK 4YFXA 5IOTA 2YU9K 4YG2A 3I4NK 3GTMC 2Y0SL 4A3FK 1DCOA 4GTCA 2WAQL 3S17K 3QX3A 1XXBA 2GAGC 1IS1A 2JH3A 2VUMK 4GZYA 4LK0A 2JA6C 5C4XK 1I50A 3FKIA 1I3QC 1WCMK 4LJZA 5FLMK 3GTOC 4LOWA 2GSUA 1EI6A 1ZYRA 2R92A 1R9TA 3GTJA 4KMAA 2R93A 1TWCA 3M4OC 1TWFC 2PA8D 4Y7NC 1Y1VK 1TWAA 2FQTA 4M1XA 3BP8C 1DD5A 4C2MK 5M3FK 4A3CC 4OIPA 3GTLC 3AQOA 5C4JK 3VA7A 3S1MC 2V6UA 4BBRK 4G7HA 5IYBC 1SFOA 3GTKA 2R7ZA 2E2HC 2YU9C 2B63K 4G0VA 3GEIA 4A3FC 4BKWA 1EQRA 1TWGA 3K7AK 3G4AA 2NVXA 5C3EC 3S15C 2GAHC 2JA5K 1F7UA 1UV7A 1TWHA 1Y1WC 4KMUA 3RZOK 5EGHA 1B4AA 3GTQK 2V6SA 3A8KA 1WCMC 4G0WA 3S1RK 2E2IK 4A3LC 4OIOA 1XXAA 5C44K 4G7ZA 1SMYA 4XLPA 2JA6A 2ZUEA 4BY7C 3DXJA 4KB2A 1ZQ1C 3GTPK 1Y1VC 4FM9A 4KM9A 3FOEA 1VRQC 3GTOA 3GDZA 4OINA 3S14C 1XZPA 3ADAC 4C3JC 2O5JA 3GEEA 5C4JC 4A3IC 1KQ4A 1O27A 3HOZC 2KWAA 3HKZL 1J6VA 2R92C 1R9TC 3GTJC 2R93C 1TWCC 3LPXA 2B63C 2Y0SD 4KC6A 5TMFA 2WAQD 3GTGK 3JSTA 3ERED 3CQZK 2YU9A 1V5VA 1B4BA 4KMHA 3OEPA 3RZOC 1K83K 4LQYA 3S1RC 3GTKC 2R7ZC 2E2IC 5JVOA 3H3VL 3S16C 1WQFA 1TWGC 1VH2A 3I4MC 5IOQA 1WOPA 1ZVUA 2NVXC 2VUMA 1Y1WA 2NVYK 4A3DK 1WCMA 5CHPA 4Q4ZA 4BXXC 3SZYA 3HXAA 1TWHC 4KN7A 3OPFA 4A3EC 1JVIA 1O25A 3PO2K 1YX2A 4BBSC 2O5IA 5IP7C 1YNJA 1Y1VA 2JA7K 3BUEA 2JA8K 3HOWK 5M3MK 4BY1K 2A68A 3H0GK 3NUHA 5IOSA 2GSNA 3HOUC 2PMZL 4GFQA 4KMDA 5E68A 3PO3C 4MQ9A 4MEXA 2B63A 4KDDA 4KN4A 3GIRA 4G7OA 1IW7A 3TFIA 1YNNA 2JA5A 2NVQC 3N0BA 4MEYA 4WILA 1AB4A 4A93K 1C0AA 5JFEA 4AYBL 4GTLA 3S0XA 3GTQA 2A6HA 3AH5A 2P5MA 4Y52K 1O2FB 1INNA 2E2JK 2E2IA 4A3MC 3RZDK 3I4NC 3TFHA 3S1NK 3HOVK 2ZFZA 5IP9K 3HOXK 2NVTK 3S17C 2BE5A 4P5AA 3GTPA 2JA8C 3TTGA 3HKZD 1ZBSA 2RGRA 2VUMC 5C4XC 4C3HK 4OIRA 3EQLA 3G4CA 4YFKA 5FLMC 5IORA 3M3YK 1BS2A 4QJVA 1XZQA 1RU0A 4G0UA 4DDQA 1XXCA 4NOIA 2FQOA 2RH6A 4LLGA 1G51A 3H3VD 3GTGA 4C2MC 4A93C 3CQZA 2WB1L 1K83A 4KM8A 4BBRC 3L4KA 1EH1A 1WSRA 4XLNA 4QJVB 1O24A 1F93A 1VLOA 3K7AC 1O26A 1XZQB 4KB4A 3HOXC 2A6EA 5D4DA 2NVYA 2JA5C 4GTDA 4WJ4A 3V4GA 5HL8A 4PAAA 3GTMK 4P9SA 4XCHA 3AD7C 2P8TA 4C3HC 3S2DK 3GTQC 4QIWL 4LR2A 3L4JA 2PMZD 1O2BA 3AD9C 4GTAA 1IE0A 5C44C 3FHZA 2JA7A 3A8IA 4KARA 4OIQA 2D6FC 1I3QK 1DCPA 3GTPC 1J6WA 1TWFK 2A69A 1ZXOA 4AYBD 5M5YK 4C45A 1IL2A 4J3NA 1F9NA 5M5WK 1EFWA 2PPBA 4A3CK 4FZBA 5IYDK 1JQWA 3A8JA 3N0CA 4BLAA 3GTLK 5CJ9A 3CAGA 2EBBA 3S1MK 1ISEA 5IYBK
chains in the Genus database with same CATH topology
4XLPA 4LK1A 2E2HK 3HOUK 3RZDK 3GTGC 3GTOK 3I4NC 3DXJA 4BY7C 3S1NK 3CQZC 3HOVK 4JK1A 3GTPK 1Y1VC 5IP9K 3HOXK 2NVTK 4A3JK 3S17C 2BE5A 1I6VA 5C3EK 1K83C 3WODA 3S15K 3S2DC 3PO3K 4OINA 3M4OK 3S14C 2JA8C 5IYCK 3HKZD 1HQMA 1SFOC 4Y7NK 2O5JA 2VUMC 4A3KK 4Y52K 5C4JC 4A3IC 4X6AK 5C4XC 2NVQK 4C3HK 3HOZC 1Y1WK 4OIRA 4A3BC 3EQLA 3HKZL 4YFKA 5FLMC 3S2HC 2R92C 1R9TC 3GTJC 2NVYC 2R93C 1TWCC 2B63C 4Q5SA 4A3DC 3M3YK 1XPPA 4A3LK 2Y0SD 4QJVA 3HOYK 5FJ8K 5TMFA 2WAQD 4YFXA 4A3MK 2YU9K 4NOIA 4YG2A 3GTGK 3I4NK 3GTMC 2Y0SL 4BY7K 4A3FK 3PO2C 3CQZK 2WB1D 4LLGA 2WAQL 5TMCA 3H3VD 3RZOC 3S17K 1K83K 2JA7C 4A93C 3HOWC 3S14K 1I50K 5IYDC 3S1RC 1BDFA 4BY1C 2WB1L 3FKIK 2R7ZC 2E2IC 3GTKC 4C3JK 2VUMK 4GZYA 4LK0A 3H0GC 2JA6C 4BBRC 5C4XK 4A3IK 3H3VL 3S16C 3S1QK 3HOZK 1TWGC 3I4MC 1I6HK 1I3QC 1WCMK 2NVXC 2CW0A 4LJZA 5FLMK 4XLNA 2R92K 1R9TK 3GTOC 4QJVB 2NVYK 3GTJK 2R93K 1TWCK 4A3GK 4A3DK 3K7AC 3HOXC 2A6EA 4XSXA 1ZYRA 5D4DA 4Q4ZA 4A3JC 4BXXC 1TWAK 2JA5C 3M4OC 1TWHC 1TWFC 2PA8D 4QIWD 4KN7A 4A3EC 5IYCC 3GTMK 4Y7NC 1Y1VK 3PO2K 4A3KC 4BBSC 4X6AC 2O5IA 3S2DK 3GTQC 5IP7C 2PA8L 1YNJA 4QIWL 4C2MK 5M3FK 2JA7K 2JA8K 4OIPA 4A3CC 3HOWK 5M3MK 1SFOK 3GTKK 4BY1K 2PMZD 2R7ZK 4C3IK 3GTLC 2A68A 5C44C 5C4JK 3S1MC 3H0GK 4BBRK 4Y52C 4G7HA 2E2JC 3S16K 4A3BK 4YFNA 5IYBC 3HOYC 1TWGK 4OIQA 5M5XK 3I4MK 2E2HC 1I3QK 3RZDC 2PMZL 2NVXK 2YU9C 3HOUC 3S2HK 3S1NC 3HOVC 2B63K 3GTPC 5IP9C 4A3FC 2NVTC 3K7AK 5C3EC 3S15C 4ZH4A 4BXXK 3PO3C 4MQ9A 4XSZA 4MEXA 2JA5K 1TWHK 1I50C 1TWFK 2A69A 4KN4A 4G7OA 4AYBD 5M5YK 3FKIC 4A3EK 1IW7A 1YNNA 2NVQC 4BBSK 5M5WK 4MEYA 1Y1WC 3S1QC 4KMUA 3RZOK 2PPBA 3GTQK 5IP7K 4A93K 1I6HC 4AYBL 1WCMC 4A3CK 5IYDK 3S1RK 2E2IK 3M3YC 4A3LC 4A3GC 3GTLK 4OIOA 2A6HA 2JA6K 5C44K 4G7ZA 3S1MK 1SMYA 2E2JK 1TWAC 5IYBK 4A3MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLP A;  4LK1 A;  2E2H K;  3HOU K;  3RZD K;  3GTG C;  3GTO K;  3I4N C;  3DXJ A;  4BY7 C;  3S1N K;  3CQZ C;  3HOV K;  4JK1 A;  3GTP K;  1Y1V C;  5IP9 K;  3HOX K;  2NVT K;  4A3J K;  3S17 C;  2BE5 A;  1I6V A;  5C3E K;  1K83 C;  3WOD A;  3S15 K;  3S2D C;  3PO3 K;  4OIN A;  3M4O K;  3S14 C;  2JA8 C;  5IYC K;  3HKZ D;  1HQM A;  1SFO C;  4Y7N K;  2O5J A;  2VUM C;  4A3K K;  4Y52 K;  5C4J C;  4A3I C;  4X6A K;  5C4X C;  2NVQ K;  4C3H K;  3HOZ C;  1Y1W K;  4OIR A;  4A3B C;  3EQL A;  3HKZ L;  4YFK A;  5FLM C;  3S2H C;  2R92 C;  1R9T C;  3GTJ C;  2NVY C;  2R93 C;  1TWC C;  2B63 C;  4Q5S A;  4A3D C;  3M3Y K;  1XPP A;  4A3L K;  2Y0S D;  4QJV A;  3HOY K;  5FJ8 K;  5TMF A;  2WAQ D;  4YFX A;  4A3M K;  2YU9 K;  4NOI A;  4YG2 A;  3GTG K;  3I4N K;  3GTM C;  2Y0S L;  4BY7 K;  4A3F K;  3PO2 C;  3CQZ K;  2WB1 D;  4LLG A;  2WAQ L;  5TMC A;  3H3V D;  3RZO C;  3S17 K;  1K83 K;  2JA7 C;  4A93 C;  3HOW C;  3S14 K;  1I50 K;  5IYD C;  3S1R C;  1BDF A;  4BY1 C;  2WB1 L;  3FKI K;  2R7Z C;  2E2I C;  3GTK C;  4C3J K;  2VUM K;  4GZY A;  4LK0 A;  3H0G C;  2JA6 C;  4BBR C;  5C4X K;  4A3I K;  3H3V L;  3S16 C;  3S1Q K;  3HOZ K;  1TWG C;  3I4M C;  1I6H K;  1I3Q C;  1WCM K;  2NVX C;  2CW0 A;  4LJZ A;  5FLM K;  4XLN A;  2R92 K;  1R9T K;  3GTO C;  4QJV B;  2NVY K;  3GTJ K;  2R93 K;  1TWC K;  4A3G K;  4A3D K;  3K7A C;  3HOX C;  2A6E A;  4XSX A;  1ZYR A;  5D4D A;  4Q4Z A;  4A3J C;  4BXX C;  1TWA K;  2JA5 C;  3M4O C;  1TWH C;  1TWF C;  2PA8 D;  4QIW D;  4KN7 A;  4A3E C;  5IYC C;  3GTM K;  4Y7N C;  1Y1V K;  3PO2 K;  4A3K C;  4BBS C;  4X6A C;  2O5I A;  3S2D K;  3GTQ C;  5IP7 C;  2PA8 L;  1YNJ A;  4QIW L;  4C2M K;  5M3F K;  2JA7 K;  2JA8 K;  4OIP A;  4A3C C;  3HOW K;  5M3M K;  1SFO K;  3GTK K;  4BY1 K;  2PMZ D;  2R7Z K;  4C3I K;  3GTL C;  2A68 A;  5C44 C;  5C4J K;  3S1M C;  3H0G K;  4BBR K;  4Y52 C;  4G7H A;  2E2J C;  3S16 K;  4A3B K;  4YFN A;  5IYB C;  3HOY C;  1TWG K;  4OIQ A;  5M5X K;  3I4M K;  2E2H C;  1I3Q K;  3RZD C;  2PMZ L;  2NVX K;  2YU9 C;  3HOU C;  3S2H K;  3S1N C;  3HOV C;  2B63 K;  3GTP C;  5IP9 C;  4A3F C;  2NVT C;  3K7A K;  5C3E C;  3S15 C;  4ZH4 A;  4BXX K;  3PO3 C;  4MQ9 A;  4XSZ A;  4MEX A;  2JA5 K;  1TWH K;  1I50 C;  1TWF K;  2A69 A;  4KN4 A;  4G7O A;  4AYB D;  5M5Y K;  3FKI C;  4A3E K;  1IW7 A;  1YNN A;  2NVQ C;  4BBS K;  5M5W K;  4MEY A;  1Y1W C;  3S1Q C;  4KMU A;  3RZO K;  2PPB A;  3GTQ K;  5IP7 K;  4A93 K;  1I6H C;  4AYB L;  1WCM C;  4A3C K;  5IYD K;  3S1R K;  2E2I K;  3M3Y C;  4A3L C;  4A3G C;  3GTL K;  4OIO A;  2A6H A;  2JA6 K;  5C44 K;  4G7Z A;  3S1M K;  1SMY A;  2E2J K;  1TWA C;  5IYB K;  4A3M C; 
#chains in the Genus database with same CATH topology
 2V6T A;  2E2H K;  1PJ7 A;  3GTG C;  3CQZ C;  3BP3 A;  4A3J K;  1GE9 A;  5C3E K;  1K83 C;  3WOD A;  2CFA A;  3S15 K;  3S2D C;  1WIH A;  3T00 A;  5IYC K;  4GTE A;  4AH6 A;  4A3K K;  3T01 A;  4X6A K;  1Y1W K;  3GSI A;  4P5B A;  2XCQ A;  4WJ3 M;  3TFJ A;  2NVY C;  4A3D C;  1X31 C;  4A3L K;  1HI9 A;  1IBA A;  1PJ5 A;  1VGX A;  5EGE A;  3HOY K;  4BY7 K;  3PO2 C;  2WB1 D;  2CFA B;  5TMC A;  4ILD A;  2JA7 C;  1J98 A;  4PAB A;  4O2D A;  3SZZ A;  3HOW C;  1I50 K;  5IYD C;  3S14 K;  2ZUF A;  1BDF A;  4BY1 C;  3FKI K;  4C3J K;  3H0G C;  4A3I K;  3S1Q K;  4KAT A;  3HOZ K;  1I6H K;  2CW0 A;  2XCR B;  2R92 K;  1R9T K;  3GTJ K;  4GTF A;  1TWC K;  4A3G K;  2R93 K;  1WOR A;  5TJ3 A;  4XSX A;  4A3J C;  2PHC B;  1TWA K;  1PJ6 A;  3ORE A;  3FOF A;  4QIW D;  5IYC C;  5L46 A;  4A3K C;  4X6A C;  1O29 A;  2PA8 L;  3GTM A;  1EK8 A;  3MML B;  1SFO K;  3GTK K;  2R7Z K;  4C3I K;  4KAS A;  1WSV A;  4Y52 C;  2E2J C;  3S16 K;  4A3B K;  4YFN A;  3HOY C;  1TWG K;  3I4M K;  5M5X K;  3S2H K;  3RZD C;  3LAP A;  2NVX K;  3S1N C;  3HOV C;  1O28 A;  5IP9 C;  1F7V A;  2NVT C;  1I3Q A;  3IPJ A;  4ZH4 A;  4BXX K;  4XSZ A;  1TWH K;  1I50 C;  4A3E K;  3FKI C;  4BLB A;  3T02 A;  1WOO A;  4BBS K;  1TWF A;  3S1Q C;  1JOE A;  3AQP A;  5IP7 K;  1I6H C;  1BGW A;  4RMF A;  4GTB A;  3M3Y C;  4A3G C;  2JA6 K;  3AD8 C;  1DCH A;  1O2A A;  1TWA C;  4LK1 A;  3GTL A;  3HOU K;  3H0G A;  3GTO K;  3Q3Q A;  2W7V A;  4JK1 A;  1VJE A;  2XCO A;  4GT9 A;  2E2H A;  1I6V A;  1XZP B;  1WQG A;  2Y3P A;  3N3Y A;  3PO3 K;  3M4O K;  1YCL A;  2GSO A;  1HQM A;  1USO A;  1SFO C;  1IQ0 A;  4Y7N K;  4C3I C;  3LAJ A;  2NVQ K;  1BJT A;  4A3B C;  1USM A;  1J6X A;  4KAW X;  3S2H C;  4Q5S A;  3GEH A;  1XPP A;  1L0W A;  1WOS A;  1WQH A;  5FJ8 K;  4A3M K;  4YFX A;  5IOT A;  2YU9 K;  4YG2 A;  3I4N K;  3GTM C;  2Y0S L;  4A3F K;  1DCO A;  4GTC A;  2WAQ L;  3S17 K;  3QX3 A;  1XXB A;  2GAG C;  1IS1 A;  2JH3 A;  2VUM K;  4GZY A;  4LK0 A;  2JA6 C;  5C4X K;  1I50 A;  3FKI A;  1I3Q C;  1WCM K;  4LJZ A;  5FLM K;  3GTO C;  4LOW A;  2GSU A;  1EI6 A;  1ZYR A;  2R92 A;  1R9T A;  3GTJ A;  4KMA A;  2R93 A;  1TWC A;  3M4O C;  1TWF C;  2PA8 D;  4Y7N C;  1Y1V K;  1TWA A;  2FQT A;  4M1X A;  3BP8 C;  1DD5 A;  4C2M K;  5M3F K;  4A3C C;  4OIP A;  3GTL C;  3AQO A;  5C4J K;  3VA7 A;  3S1M C;  2V6U A;  4BBR K;  4G7H A;  5IYB C;  1SFO A;  3GTK A;  2R7Z A;  2E2H C;  2YU9 C;  2B63 K;  4G0V A;  3GEI A;  4A3F C;  4BKW A;  1EQR A;  1TWG A;  3K7A K;  3G4A A;  2NVX A;  5C3E C;  3S15 C;  2GAH C;  2JA5 K;  1F7U A;  1UV7 A;  1TWH A;  1Y1W C;  4KMU A;  3RZO K;  5EGH A;  1B4A A;  3GTQ K;  2V6S A;  3A8K A;  1WCM C;  4G0W A;  3S1R K;  2E2I K;  4A3L C;  4OIO A;  1XXA A;  5C44 K;  4G7Z A;  1SMY A;  4XLP A;  2JA6 A;  2ZUE A;  4BY7 C;  3DXJ A;  4KB2 A;  1ZQ1 C;  3GTP K;  1Y1V C;  4FM9 A;  4KM9 A;  3FOE A;  1VRQ C;  3GTO A;  3GDZ A;  4OIN A;  3S14 C;  1XZP A;  3ADA C;  4C3J C;  2O5J A;  3GEE A;  5C4J C;  4A3I C;  1KQ4 A;  1O27 A;  3HOZ C;  2KWA A;  3HKZ L;  1J6V A;  2R92 C;  1R9T C;  3GTJ C;  2R93 C;  1TWC C;  3LPX A;  2B63 C;  2Y0S D;  4KC6 A;  5TMF A;  2WAQ D;  3GTG K;  3JST A;  3ERE D;  3CQZ K;  2YU9 A;  1V5V A;  1B4B A;  4KMH A;  3OEP A;  3RZO C;  1K83 K;  4LQY A;  3S1R C;  3GTK C;  2R7Z C;  2E2I C;  5JVO A;  3H3V L;  3S16 C;  1WQF A;  1TWG C;  1VH2 A;  3I4M C;  5IOQ A;  1WOP A;  1ZVU A;  2NVX C;  2VUM A;  1Y1W A;  2NVY K;  4A3D K;  1WCM A;  5CHP A;  4Q4Z A;  4BXX C;  3SZY A;  3HXA A;  1TWH C;  4KN7 A;  3OPF A;  4A3E C;  1JVI A;  1O25 A;  3PO2 K;  1YX2 A;  4BBS C;  2O5I A;  5IP7 C;  1YNJ A;  1Y1V A;  2JA7 K;  3BUE A;  2JA8 K;  3HOW K;  5M3M K;  4BY1 K;  2A68 A;  3H0G K;  3NUH A;  5IOS A;  2GSN A;  3HOU C;  2PMZ L;  4GFQ A;  4KMD A;  5E68 A;  3PO3 C;  4MQ9 A;  4MEX A;  2B63 A;  4KDD A;  4KN4 A;  3GIR A;  4G7O A;  1IW7 A;  3TFI A;  1YNN A;  2JA5 A;  2NVQ C;  3N0B A;  4MEY A;  4WIL A;  1AB4 A;  4A93 K;  1C0A A;  5JFE A;  4AYB L;  4GTL A;  3S0X A;  3GTQ A;  2A6H A;  3AH5 A;  2P5M A;  4Y52 K;  1O2F B;  1INN A;  2E2J K;  2E2I A;  4A3M C;  3RZD K;  3I4N C;  3TFH A;  3S1N K;  3HOV K;  2ZFZ A;  5IP9 K;  3HOX K;  2NVT K;  3S17 C;  2BE5 A;  4P5A A;  3GTP A;  2JA8 C;  3TTG A;  3HKZ D;  1ZBS A;  2RGR A;  2VUM C;  5C4X C;  4C3H K;  4OIR A;  3EQL A;  3G4C A;  4YFK A;  5FLM C;  5IOR A;  3M3Y K;  1BS2 A;  4QJV A;  1XZQ A;  1RU0 A;  4G0U A;  4DDQ A;  1XXC A;  4NOI A;  2FQO A;  2RH6 A;  4LLG A;  1G51 A;  3H3V D;  3GTG A;  4C2M C;  4A93 C;  3CQZ A;  2WB1 L;  1K83 A;  4KM8 A;  4BBR C;  3L4K A;  1EH1 A;  1WSR A;  4XLN A;  4QJV B;  1O24 A;  1F93 A;  1VLO A;  3K7A C;  1O26 A;  1XZQ B;  4KB4 A;  3HOX C;  2A6E A;  5D4D A;  2NVY A;  2JA5 C;  4GTD A;  4WJ4 A;  3V4G A;  5HL8 A;  4PAA A;  3GTM K;  4P9S A;  4XCH A;  3AD7 C;  2P8T A;  4C3H C;  3S2D K;  3GTQ C;  4QIW L;  4LR2 A;  3L4J A;  2PMZ D;  1O2B A;  3AD9 C;  4GTA A;  1IE0 A;  5C44 C;  3FHZ A;  2JA7 A;  3A8I A;  4KAR A;  4OIQ A;  2D6F C;  1I3Q K;  1DCP A;  3GTP C;  1J6W A;  1TWF K;  2A69 A;  1ZXO A;  4AYB D;  5M5Y K;  4C45 A;  1IL2 A;  4J3N A;  1F9N A;  5M5W K;  1EFW A;  2PPB A;  4A3C K;  4FZB A;  5IYD K;  1JQW A;  3A8J A;  3N0C A;  4BLA A;  3GTL K;  5CJ9 A;  3CAG A;  2EBB A;  3S1M K;  1ISE A;  5IYB K; 
#chains in the Genus database with same CATH homology
 4XLP A;  4LK1 A;  2E2H K;  3HOU K;  3RZD K;  3GTG C;  3GTO K;  3I4N C;  3DXJ A;  4BY7 C;  3S1N K;  3CQZ C;  3HOV K;  4JK1 A;  3GTP K;  1Y1V C;  5IP9 K;  3HOX K;  2NVT K;  4A3J K;  3S17 C;  2BE5 A;  1I6V A;  5C3E K;  1K83 C;  3WOD A;  3S15 K;  3S2D C;  3PO3 K;  4OIN A;  3M4O K;  3S14 C;  2JA8 C;  5IYC K;  3HKZ D;  1HQM A;  1SFO C;  4Y7N K;  2O5J A;  2VUM C;  4A3K K;  4Y52 K;  5C4J C;  4A3I C;  4X6A K;  5C4X C;  2NVQ K;  4C3H K;  3HOZ C;  1Y1W K;  4OIR A;  4A3B C;  3EQL A;  3HKZ L;  4YFK A;  5FLM C;  3S2H C;  2R92 C;  1R9T C;  3GTJ C;  2NVY C;  2R93 C;  1TWC C;  2B63 C;  4Q5S A;  4A3D C;  3M3Y K;  1XPP A;  4A3L K;  2Y0S D;  4QJV A;  3HOY K;  5FJ8 K;  5TMF A;  2WAQ D;  4YFX A;  4A3M K;  2YU9 K;  4NOI A;  4YG2 A;  3GTG K;  3I4N K;  3GTM C;  2Y0S L;  4BY7 K;  4A3F K;  3PO2 C;  3CQZ K;  2WB1 D;  4LLG A;  2WAQ L;  5TMC A;  3H3V D;  3RZO C;  3S17 K;  1K83 K;  2JA7 C;  4A93 C;  3HOW C;  3S14 K;  1I50 K;  5IYD C;  3S1R C;  1BDF A;  4BY1 C;  2WB1 L;  3FKI K;  2R7Z C;  2E2I C;  3GTK C;  4C3J K;  2VUM K;  4GZY A;  4LK0 A;  3H0G C;  2JA6 C;  4BBR C;  5C4X K;  4A3I K;  3H3V L;  3S16 C;  3S1Q K;  3HOZ K;  1TWG C;  3I4M C;  1I6H K;  1I3Q C;  1WCM K;  2NVX C;  2CW0 A;  4LJZ A;  5FLM K;  4XLN A;  2R92 K;  1R9T K;  3GTO C;  4QJV B;  2NVY K;  3GTJ K;  2R93 K;  1TWC K;  4A3G K;  4A3D K;  3K7A C;  3HOX C;  2A6E A;  4XSX A;  1ZYR A;  5D4D A;  4Q4Z A;  4A3J C;  4BXX C;  1TWA K;  2JA5 C;  3M4O C;  1TWH C;  1TWF C;  2PA8 D;  4QIW D;  4KN7 A;  4A3E C;  5IYC C;  3GTM K;  4Y7N C;  1Y1V K;  3PO2 K;  4A3K C;  4BBS C;  4X6A C;  2O5I A;  3S2D K;  3GTQ C;  5IP7 C;  2PA8 L;  1YNJ A;  4QIW L;  4C2M K;  5M3F K;  2JA7 K;  2JA8 K;  4OIP A;  4A3C C;  3HOW K;  5M3M K;  1SFO K;  3GTK K;  4BY1 K;  2PMZ D;  2R7Z K;  4C3I K;  3GTL C;  2A68 A;  5C44 C;  5C4J K;  3S1M C;  3H0G K;  4BBR K;  4Y52 C;  4G7H A;  2E2J C;  3S16 K;  4A3B K;  4YFN A;  5IYB C;  3HOY C;  1TWG K;  4OIQ A;  5M5X K;  3I4M K;  2E2H C;  1I3Q K;  3RZD C;  2PMZ L;  2NVX K;  2YU9 C;  3HOU C;  3S2H K;  3S1N C;  3HOV C;  2B63 K;  3GTP C;  5IP9 C;  4A3F C;  2NVT C;  3K7A K;  5C3E C;  3S15 C;  4ZH4 A;  4BXX K;  3PO3 C;  4MQ9 A;  4XSZ A;  4MEX A;  2JA5 K;  1TWH K;  1I50 C;  1TWF K;  2A69 A;  4KN4 A;  4G7O A;  4AYB D;  5M5Y K;  3FKI C;  4A3E K;  1IW7 A;  1YNN A;  2NVQ C;  4BBS K;  5M5W K;  4MEY A;  1Y1W C;  3S1Q C;  4KMU A;  3RZO K;  2PPB A;  3GTQ K;  5IP7 K;  4A93 K;  1I6H C;  4AYB L;  1WCM C;  4A3C K;  5IYD K;  3S1R K;  2E2I K;  3M3Y C;  4A3L C;  4A3G C;  3GTL K;  4OIO A;  2A6H A;  2JA6 K;  5C44 K;  4G7Z A;  3S1M K;  1SMY A;  2E2J K;  1TWA C;  5IYB K;  4A3M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...