4A3DK

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 33
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3dK00
3S14K 2PPBA 5C3EC 4LJZA 1HQMA 4AYBD 5C44C 2R92K 3I4MK 3S2HC 2R93K 4QIWL 1YNNA 4BY7K 2E2JC 5FJ8K 4A3CK 3HKZL 2R7ZC 2NVTC 1IW7A 1YNJA 2E2HC 3S17K 1Y1VK 1I6HK 4C3JK 1TWCC 2Y0SD 2NVXK 3HOVC 5D4DA 1SMYA 2VUMC 3HOZC 3HOYC 3RZOC 2JA5K 1WCMC 1ZYRA 3S1RK 4A3IK 1I50C 4KMUA 1SFOK 2JA7K 3RZDK 3GTMC 3GTGC 3CQZK 3H3VD 4A3BC 4GZYA 4BY1C 3DXJA 4OIOA 4A3EC 3HOUK 4BXXC 3EQLA 5C4JC 2O5IA 4BBRK 5M3MK 4Q5SA 2E2IC 4A3MC 1K83K 4BBSC 4NOIA 3M4OC 3GTJK 5M3FK 2JA6C 1Y1WK 3GTKC 5IYCK 3S15K 3S16K 4G7ZA 1TWHC 3K7AC 3S1NC 5IP9C 5FLMC 3FKIK 4A3JK 4A3LC 3GTOC 3HOXC 2PMZL 4A3FC 3GTPC 3S1MC 3S1QK 2NVQK 3GTLK 3S2DK 3GTQC 2CW0A 1R9TC 2WAQL 3H0GK 4A93K 1I6VA 4A3DC 3HOZK 2A69A 4QIWD 2PMZD 2WB1L 3HOWC 3M3YC 3GTMK 3HKZD 2R92C 4OIPA 5IP7C 3I4NK 1TWFC 4C3HK 4G7OA 3WODA 1TWAC 4LK0A 4A3KC 2E2IK 4XSZA 2B63C 5TMCA 2JA8K 3S1QC 1TWGC 2YU9C 2NVYC 1I3QC 4Y52C 5IYBK 3PO3C 5C4XC 3GTKK 3S14C 4X6AK 5IYDC 2R93C 3I4MC 5C3EK 3S2HK 5C44K 4BY7C 2A6EA 1BDFA 2E2JK 4A3CC 4Y7NC 3S17C 2R7ZK 2NVTK 2E2HK 1Y1VC 5M5WK 1I6HC 1TWCK 2NVXC 2O5JA 3HOVK 2VUMK 3HOYK 2JA5C 3HOWK 2A6HA 3S1RC 3RZOK 4A3IC 1WCMK 1SFOC 2JA7C 3RZDC 1I50K 3CQZC 3GTGK 4KN7A 5M5XK 4A3BK 1XPPA 2A68A 4OIRA 3HOUC 2WAQD 4A3EK 4BY1K 3PO2C 4QJVB 4BXXK 4YFXA 5C4JK 4AYBL 4A3GK 2WB1D 4MQ9A 2YU9K 1K83C 5C4XK 4LK1A 3GTJC 4A3MK 1Y1WC 4BBSK 3M4OK 2JA6K 4A3GC 5IYCC 5IYDK 3S15C 3S16C 5M5YK 2Y0SL 4XLPA 5TMFA 4C2MK 4G7HA 4A3JC 3FKIC 1TWHK 3K7AK 4YG2A 4QJVA 5IP9K 4ZH4A 5FLMK 3S1NK 3GTOK 4A3LK 4Y7NK 3HOXK 4A3FK 2NVQC 3GTLC 4KN4A 3GTPK 4YFNA 3S1MK 3S2DC 3H3VL 3GTQK 3H0GC 1R9TK 4LLGA 4A93C 4A3DK 4C3IK 4MEXA 2PA8L 4OIQA 3M3YK 4XLNA 4MEYA 4YFKA 4Q4ZA 3I4NC 3PO2K 5IP7K 4OINA 1TWFK 4Y52K 4JK1A 2BE5A 2PA8D 1TWAK 4A3KK 2JA8C 4XSXA 4BBRC 2B63K 5IYBC 1TWGK 2NVYK 1I3QK 3PO3K 4X6AC
chains in the Genus database with same CATH superfamily
4KDDA 5C3EC 3S2HC 4AYBD 5C44C 3I4MK 2CFAA 4BY7K 1DCPA 4GTFA 1EI6A 1PJ5A 3GEHA 4A3CK 3HKZL 1WIHA 5IOQA 3TFJA 2R7ZC 1I6HK 3GTKA 2NVXK 5D4DA 3A8KA 2JA7K 4A3BC 3RZDK 3GTMC 3GTOA 3CQZK 3DXJA 2ZFZA 5C4JC 4BBRK 2E2IC 3OEPA 4NOIA 1Y1WK 5IYCK 1TWFA 1TWHC 4KB4A 3FKIK 4A3LC 3HOXC 2GSUA 4RMFA 3S1MC 1JVIA 1WOSA 2KWAA 1R9TC 4A93K 4AH6A 2R93A 2WB1L 2RH6A 3M3YC 1IS1A 1O2BA 1ZQ1C 3FOEA 1VH2A 3LPXA 1DCOA 1AB4A 1R9TA 2GAGC 1JOEA 2B63C 1ZBSA 2JA8K 2JA5A 2YU9C 3VA7A 1I3QC 3GTKK 3S14C 2PHCB 3T00A 1PJ6A 2XCOA 5C3EK 5EGHA 3S2HK 1O29A 5C44K 3AD9C 1BDFA 4Y7NC 1K83A 2R7ZK 5L46A 1Y1VC 4C3JC 2A6HA 1SFOC 4A3BK 1J98A 4G0WA 2WAQD 5C4JK 4AYBL 3FOFA 3N0CA 2GSOA 4LQYA 4LK1A 4A3GC 5IYDK 1XZQB 1SFOA 5TMFA 1O28A 4KMDA 1INNA 1TWHK 2JH3A 4A3LK 3HOXK 3S1MK 1O25A 5JFEA 1R9TK 1ISEA 1O27A 4KC6A 1XZQA 4PABA 3M3YK 3AQOA 3I4NC 3PO2K 4GTAA 4JK1A 3T01A 4PAAA 4BBRC 2B63K 1PJ7A 1I3QK 5E68A 4X6AC 3S14K 1G51A 4LJZA 1HQMA 5JVOA 1IW7A 3AD7C 2E2HC 2JA6A 1Y1VK 4C3JK 1SMYA 1UV7A 3RZOC 1WCMC 3GTGC 1SFOK 3H3VD 4OIOA 4A3EC 1IL2A 3GTQA 1EQRA 1IBAA 2P8TA 1O2FB 1ZXOA 4A3MC 1EK8A 3GTKC 3K7AC 3S1NC 4WILA 3GTOC 1J6XA 2PMZL 3ADAC 3HXAA 3TTGA 2CW0A 2WAQL 2V6UA 4C3IC 3HOZK 4QIWD 3TFHA 1WQHA 4KARA 5IP7C 3I4NK 1TWFC 4G7OA 4LK0A 1F7VA 2NVYC 4KAWX 4X6AK 5IYDC 2R93C 1USOA 3GSIA 1F9NA 2A6EA 2GSNA 3L4JA 2XCRB 3OREA 2E2HK 1GE9A 2Y3PA 5M5WK 2NVYA 5CJ9A 2O5JA 3RZOK 2JA5C 3S1RC 4A3IC 1WCMK 3GTGK 3JSTA 4KN7A 3HOUC 4OIRA 3PO2C 4A3EK 3N0BA 4MQ9A 4KMHA 1K83C 2RGRA 4A3MK 3GTJC 3QX3A 3GEIA 3S16C 4A3JC 3K7AK 3S1NK 4P5BA 3GTOK 3GTLC 3S2DC 4KN4A 4YFNA 3H3VL 3GTJA 3H0GC 2EBBA 1KQ4A 4C3IK 4O2DA 2FQTA 4GTEA 5IP7K 1TWFK 3T02A 3GTLA 2PA8D 1TWCA 3L4KA 3H0GA 1RU0A 5IYBC 2NVYK 3Q3QA 2R93K 2V6SA 4QIWL 1X31C 1YNNA 5FJ8K 5HL8A 1IE0A 2NVTC 1YNJA 3G4AA 2VUMC 3HOZC 2JA5K 1ZYRA 3S1RK 3A8IA 4A3IK 3GTPA 1O26A 4GZYA 1XXAA 4BY1C 3HOUK 4Q5SA 1K83K 2VUMA 3M4OC 1WOOA 3GTJK 5M3FK 2JA6C 4C2MC 3S16K 3IPJA 5IP9C 4M1XA 4A3JK 1XZPB 4A3FC 3GTLK 3S2DK 3GTQC 3H0GK 1J6VA 1I6VA 4KMAA 2A69A 1IQ0A 2W7VA 4OIPA 1XZPA 1L0WA 3WODA 5IOSA 4A3KC 2NVXA 1YX2A 5TMCA 1ZVUA 3PO3C 5IYBK 3ERED 3N3YA 1BJTA 4GFQA 3S17C 2NVTK 1Y1WA 4J3NA 3AH5A 4FZBA 4BLBA 1VRQC 2VUMK 3HOWK 2R92A 3FKIA 5M5XK 2A68A 3AD8C 4BY1K 4YFXA 5CHPA 1VLOA 3S0XA 1EFWA 5C4XK 4WJ3M 3M4OK 1JQWA 2JA6K 3S15C 5M5YK 4C2MK 4G7HA 3AQPA 5IP9K 4ZH4A 3S1QC 4A3FK 2NVQC 1BS2A 1WQGA 3GTQK 2ZUEA 3OPFA 4LLGA 4DDQA 4XLNA 2GAHC 4MEYA 4YFKA 4LR2A 4Q4ZA 2ZUFA 2R7ZA 3FHZA 5TJ3A 4C3HC 2BE5A 3A8JA 4A3KK 3GIRA 3PO3K 3V4GA 3SZYA 3GTMA 2PPBA 1VGXA 2R92K 1EH1A 4KATA 2E2JC 2E2IA 1F7UA 4BKWA 3S17K 1WOPA 3MMLB 1TWCC 2Y0SD 3TFIA 4P9SA 2XCQA 3HOVC 3HOYC 1TWHA 1I50C 4KMUA 3LAPA 3GEEA 2V6TA 4BXXC 1F93A 3EQLA 4KASA 2O5IA 5M3MK 3GDZA 4KM8A 4BBSC 5EGEA 4XCHA 1I50A 3S15K 4G7ZA 1C0AA 5FLMC 4GTCA 3GTPC 3S1QK 2NVQK 2B63A 2YU9A 1I3QA 4GTDA 3NUHA 3CAGA 4A3DC 2PMZD 3HOWC 4KM9A 3GTMK 4WJ4A 3HKZD 3BP3A 1Y1VA 4C3HK 1TWAC 2E2IK 4XSZA 2D6FC 1TWGC 1WSRA 4Y52C 5C4XC 3BUEA 4GTLA 1B4AA 5IORA 3I4MC 3BP8C 1B4BA 4GTBA 4BY7C 4FM9A 4BLAA 2E2JK 4GT9A 4A3CC 1TWAA 1I6HC 1TWGA 4C45A 1TWCK 2NVXC 3SZZA 3HOVK 3HOYK 2P5MA 1XXCA 3G4CA 2JA7C 3RZDC 1I50K 3CQZC 1XPPA 5IOTA 1O2AA 4QJVB 4BXXK 1O24A 2WB1D 4KB2A 2YU9K 2FQOA 1WQFA 1WSVA 1Y1WC 4BBSK 5IYCC 1YCLA 4G0UA 2JA7A 3CQZA 1USMA 2Y0SL 4XLPA 2R92C 3FKIC 4YG2A 4QJVA 5FLMK 4Y7NK 3GTPK 1BGWA 4ILDA 4P5AA 4A93C 1XXBA 4A3DK 1HI9A 1DD5A 4MEXA 2PA8L 4OIQA 1J6WA 4G0VA 1VJEA 4OINA 2CFAB 1DCHA 2E2HA 4Y52K 1WORA 1TWAK 1V5VA 3LAJA 2JA8C 4XSXA 4LOWA 1TWGK 1WCMA 4A3GK 3GTGA
chains in the Genus database with same CATH topology
3S14K 2PPBA 5C3EC 4LJZA 1HQMA 4AYBD 5C44C 2R92K 3I4MK 3S2HC 2R93K 4QIWL 1YNNA 4BY7K 2E2JC 5FJ8K 4A3CK 3HKZL 2R7ZC 2NVTC 1IW7A 1YNJA 2E2HC 3S17K 1Y1VK 1I6HK 4C3JK 1TWCC 2Y0SD 2NVXK 3HOVC 5D4DA 1SMYA 2VUMC 3HOZC 3HOYC 3RZOC 2JA5K 1WCMC 1ZYRA 3S1RK 4A3IK 1I50C 4KMUA 1SFOK 2JA7K 3RZDK 3GTMC 3GTGC 3CQZK 3H3VD 4A3BC 4GZYA 4BY1C 3DXJA 4OIOA 4A3EC 3HOUK 4BXXC 3EQLA 5C4JC 2O5IA 4BBRK 5M3MK 4Q5SA 2E2IC 4A3MC 1K83K 4BBSC 4NOIA 3M4OC 3GTJK 5M3FK 2JA6C 1Y1WK 3GTKC 5IYCK 3S15K 3S16K 4G7ZA 1TWHC 3K7AC 3S1NC 5IP9C 5FLMC 3FKIK 4A3JK 4A3LC 3GTOC 3HOXC 2PMZL 4A3FC 3GTPC 3S1MC 3S1QK 2NVQK 3GTLK 3S2DK 3GTQC 2CW0A 1R9TC 2WAQL 3H0GK 4A93K 1I6VA 4A3DC 3HOZK 2A69A 4QIWD 2PMZD 2WB1L 3HOWC 3M3YC 3GTMK 3HKZD 2R92C 4OIPA 5IP7C 3I4NK 1TWFC 4C3HK 4G7OA 3WODA 1TWAC 4LK0A 4A3KC 2E2IK 4XSZA 2B63C 5TMCA 2JA8K 3S1QC 1TWGC 2YU9C 2NVYC 1I3QC 4Y52C 5IYBK 3PO3C 5C4XC 3GTKK 3S14C 4X6AK 5IYDC 2R93C 3I4MC 5C3EK 3S2HK 5C44K 4BY7C 2A6EA 1BDFA 2E2JK 4A3CC 4Y7NC 3S17C 2R7ZK 2NVTK 2E2HK 1Y1VC 5M5WK 1I6HC 1TWCK 2NVXC 2O5JA 3HOVK 2VUMK 3HOYK 2JA5C 3HOWK 2A6HA 3S1RC 3RZOK 4A3IC 1WCMK 1SFOC 2JA7C 3RZDC 1I50K 3CQZC 3GTGK 4KN7A 5M5XK 4A3BK 1XPPA 2A68A 4OIRA 3HOUC 2WAQD 4A3EK 4BY1K 3PO2C 4QJVB 4BXXK 4YFXA 5C4JK 4AYBL 4A3GK 2WB1D 4MQ9A 2YU9K 1K83C 5C4XK 4LK1A 3GTJC 4A3MK 1Y1WC 4BBSK 3M4OK 2JA6K 4A3GC 5IYCC 5IYDK 3S15C 3S16C 5M5YK 2Y0SL 4XLPA 5TMFA 4C2MK 4G7HA 4A3JC 3FKIC 1TWHK 3K7AK 4YG2A 4QJVA 5IP9K 4ZH4A 5FLMK 3S1NK 3GTOK 4A3LK 4Y7NK 3HOXK 4A3FK 2NVQC 3GTLC 4KN4A 3GTPK 4YFNA 3S1MK 3S2DC 3H3VL 3GTQK 3H0GC 1R9TK 4LLGA 4A93C 4A3DK 4C3IK 4MEXA 2PA8L 4OIQA 3M3YK 4XLNA 4MEYA 4YFKA 4Q4ZA 3I4NC 3PO2K 5IP7K 4OINA 1TWFK 4Y52K 4JK1A 2BE5A 2PA8D 1TWAK 4A3KK 2JA8C 4XSXA 4BBRC 2B63K 5IYBC 1TWGK 2NVYK 1I3QK 3PO3K 4X6AC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S14 K;  2PPB A;  5C3E C;  4LJZ A;  1HQM A;  4AYB D;  5C44 C;  2R92 K;  3I4M K;  3S2H C;  2R93 K;  4QIW L;  1YNN A;  4BY7 K;  2E2J C;  5FJ8 K;  4A3C K;  3HKZ L;  2R7Z C;  2NVT C;  1IW7 A;  1YNJ A;  2E2H C;  3S17 K;  1Y1V K;  1I6H K;  4C3J K;  1TWC C;  2Y0S D;  2NVX K;  3HOV C;  5D4D A;  1SMY A;  2VUM C;  3HOZ C;  3HOY C;  3RZO C;  2JA5 K;  1WCM C;  1ZYR A;  3S1R K;  4A3I K;  1I50 C;  4KMU A;  1SFO K;  2JA7 K;  3RZD K;  3GTM C;  3GTG C;  3CQZ K;  3H3V D;  4A3B C;  4GZY A;  4BY1 C;  3DXJ A;  4OIO A;  4A3E C;  3HOU K;  4BXX C;  3EQL A;  5C4J C;  2O5I A;  4BBR K;  5M3M K;  4Q5S A;  2E2I C;  4A3M C;  1K83 K;  4BBS C;  4NOI A;  3M4O C;  3GTJ K;  5M3F K;  2JA6 C;  1Y1W K;  3GTK C;  5IYC K;  3S15 K;  3S16 K;  4G7Z A;  1TWH C;  3K7A C;  3S1N C;  5IP9 C;  5FLM C;  3FKI K;  4A3J K;  4A3L C;  3GTO C;  3HOX C;  2PMZ L;  4A3F C;  3GTP C;  3S1M C;  3S1Q K;  2NVQ K;  3GTL K;  3S2D K;  3GTQ C;  2CW0 A;  1R9T C;  2WAQ L;  3H0G K;  4A93 K;  1I6V A;  4A3D C;  3HOZ K;  2A69 A;  4QIW D;  2PMZ D;  2WB1 L;  3HOW C;  3M3Y C;  3GTM K;  3HKZ D;  2R92 C;  4OIP A;  5IP7 C;  3I4N K;  1TWF C;  4C3H K;  4G7O A;  3WOD A;  1TWA C;  4LK0 A;  4A3K C;  2E2I K;  4XSZ A;  2B63 C;  5TMC A;  2JA8 K;  3S1Q C;  1TWG C;  2YU9 C;  2NVY C;  1I3Q C;  4Y52 C;  5IYB K;  3PO3 C;  5C4X C;  3GTK K;  3S14 C;  4X6A K;  5IYD C;  2R93 C;  3I4M C;  5C3E K;  3S2H K;  5C44 K;  4BY7 C;  2A6E A;  1BDF A;  2E2J K;  4A3C C;  4Y7N C;  3S17 C;  2R7Z K;  2NVT K;  2E2H K;  1Y1V C;  5M5W K;  1I6H C;  1TWC K;  2NVX C;  2O5J A;  3HOV K;  2VUM K;  3HOY K;  2JA5 C;  3HOW K;  2A6H A;  3S1R C;  3RZO K;  4A3I C;  1WCM K;  1SFO C;  2JA7 C;  3RZD C;  1I50 K;  3CQZ C;  3GTG K;  4KN7 A;  5M5X K;  4A3B K;  1XPP A;  2A68 A;  4OIR A;  3HOU C;  2WAQ D;  4A3E K;  4BY1 K;  3PO2 C;  4QJV B;  4BXX K;  4YFX A;  5C4J K;  4AYB L;  4A3G K;  2WB1 D;  4MQ9 A;  2YU9 K;  1K83 C;  5C4X K;  4LK1 A;  3GTJ C;  4A3M K;  1Y1W C;  4BBS K;  3M4O K;  2JA6 K;  4A3G C;  5IYC C;  5IYD K;  3S15 C;  3S16 C;  5M5Y K;  2Y0S L;  4XLP A;  5TMF A;  4C2M K;  4G7H A;  4A3J C;  3FKI C;  1TWH K;  3K7A K;  4YG2 A;  4QJV A;  5IP9 K;  4ZH4 A;  5FLM K;  3S1N K;  3GTO K;  4A3L K;  4Y7N K;  3HOX K;  4A3F K;  2NVQ C;  3GTL C;  4KN4 A;  3GTP K;  4YFN A;  3S1M K;  3S2D C;  3H3V L;  3GTQ K;  3H0G C;  1R9T K;  4LLG A;  4A93 C;  4A3D K;  4C3I K;  4MEX A;  2PA8 L;  4OIQ A;  3M3Y K;  4XLN A;  4MEY A;  4YFK A;  4Q4Z A;  3I4N C;  3PO2 K;  5IP7 K;  4OIN A;  1TWF K;  4Y52 K;  4JK1 A;  2BE5 A;  2PA8 D;  1TWA K;  4A3K K;  2JA8 C;  4XSX A;  4BBR C;  2B63 K;  5IYB C;  1TWG K;  2NVY K;  1I3Q K;  3PO3 K;  4X6A C; 
#chains in the Genus database with same CATH topology
 4KDD A;  5C3E C;  3S2H C;  4AYB D;  5C44 C;  3I4M K;  2CFA A;  4BY7 K;  1DCP A;  4GTF A;  1EI6 A;  1PJ5 A;  3GEH A;  4A3C K;  3HKZ L;  1WIH A;  5IOQ A;  3TFJ A;  2R7Z C;  1I6H K;  3GTK A;  2NVX K;  5D4D A;  3A8K A;  2JA7 K;  4A3B C;  3RZD K;  3GTM C;  3GTO A;  3CQZ K;  3DXJ A;  2ZFZ A;  5C4J C;  4BBR K;  2E2I C;  3OEP A;  4NOI A;  1Y1W K;  5IYC K;  1TWF A;  1TWH C;  4KB4 A;  3FKI K;  4A3L C;  3HOX C;  2GSU A;  4RMF A;  3S1M C;  1JVI A;  1WOS A;  2KWA A;  1R9T C;  4A93 K;  4AH6 A;  2R93 A;  2WB1 L;  2RH6 A;  3M3Y C;  1IS1 A;  1O2B A;  1ZQ1 C;  3FOE A;  1VH2 A;  3LPX A;  1DCO A;  1AB4 A;  1R9T A;  2GAG C;  1JOE A;  2B63 C;  1ZBS A;  2JA8 K;  2JA5 A;  2YU9 C;  3VA7 A;  1I3Q C;  3GTK K;  3S14 C;  2PHC B;  3T00 A;  1PJ6 A;  2XCO A;  5C3E K;  5EGH A;  3S2H K;  1O29 A;  5C44 K;  3AD9 C;  1BDF A;  4Y7N C;  1K83 A;  2R7Z K;  5L46 A;  1Y1V C;  4C3J C;  2A6H A;  1SFO C;  4A3B K;  1J98 A;  4G0W A;  2WAQ D;  5C4J K;  4AYB L;  3FOF A;  3N0C A;  2GSO A;  4LQY A;  4LK1 A;  4A3G C;  5IYD K;  1XZQ B;  1SFO A;  5TMF A;  1O28 A;  4KMD A;  1INN A;  1TWH K;  2JH3 A;  4A3L K;  3HOX K;  3S1M K;  1O25 A;  5JFE A;  1R9T K;  1ISE A;  1O27 A;  4KC6 A;  1XZQ A;  4PAB A;  3M3Y K;  3AQO A;  3I4N C;  3PO2 K;  4GTA A;  4JK1 A;  3T01 A;  4PAA A;  4BBR C;  2B63 K;  1PJ7 A;  1I3Q K;  5E68 A;  4X6A C;  3S14 K;  1G51 A;  4LJZ A;  1HQM A;  5JVO A;  1IW7 A;  3AD7 C;  2E2H C;  2JA6 A;  1Y1V K;  4C3J K;  1SMY A;  1UV7 A;  3RZO C;  1WCM C;  3GTG C;  1SFO K;  3H3V D;  4OIO A;  4A3E C;  1IL2 A;  3GTQ A;  1EQR A;  1IBA A;  2P8T A;  1O2F B;  1ZXO A;  4A3M C;  1EK8 A;  3GTK C;  3K7A C;  3S1N C;  4WIL A;  3GTO C;  1J6X A;  2PMZ L;  3ADA C;  3HXA A;  3TTG A;  2CW0 A;  2WAQ L;  2V6U A;  4C3I C;  3HOZ K;  4QIW D;  3TFH A;  1WQH A;  4KAR A;  5IP7 C;  3I4N K;  1TWF C;  4G7O A;  4LK0 A;  1F7V A;  2NVY C;  4KAW X;  4X6A K;  5IYD C;  2R93 C;  1USO A;  3GSI A;  1F9N A;  2A6E A;  2GSN A;  3L4J A;  2XCR B;  3ORE A;  2E2H K;  1GE9 A;  2Y3P A;  5M5W K;  2NVY A;  5CJ9 A;  2O5J A;  3RZO K;  2JA5 C;  3S1R C;  4A3I C;  1WCM K;  3GTG K;  3JST A;  4KN7 A;  3HOU C;  4OIR A;  3PO2 C;  4A3E K;  3N0B A;  4MQ9 A;  4KMH A;  1K83 C;  2RGR A;  4A3M K;  3GTJ C;  3QX3 A;  3GEI A;  3S16 C;  4A3J C;  3K7A K;  3S1N K;  4P5B A;  3GTO K;  3GTL C;  3S2D C;  4KN4 A;  4YFN A;  3H3V L;  3GTJ A;  3H0G C;  2EBB A;  1KQ4 A;  4C3I K;  4O2D A;  2FQT A;  4GTE A;  5IP7 K;  1TWF K;  3T02 A;  3GTL A;  2PA8 D;  1TWC A;  3L4K A;  3H0G A;  1RU0 A;  5IYB C;  2NVY K;  3Q3Q A;  2R93 K;  2V6S A;  4QIW L;  1X31 C;  1YNN A;  5FJ8 K;  5HL8 A;  1IE0 A;  2NVT C;  1YNJ A;  3G4A A;  2VUM C;  3HOZ C;  2JA5 K;  1ZYR A;  3S1R K;  3A8I A;  4A3I K;  3GTP A;  1O26 A;  4GZY A;  1XXA A;  4BY1 C;  3HOU K;  4Q5S A;  1K83 K;  2VUM A;  3M4O C;  1WOO A;  3GTJ K;  5M3F K;  2JA6 C;  4C2M C;  3S16 K;  3IPJ A;  5IP9 C;  4M1X A;  4A3J K;  1XZP B;  4A3F C;  3GTL K;  3S2D K;  3GTQ C;  3H0G K;  1J6V A;  1I6V A;  4KMA A;  2A69 A;  1IQ0 A;  2W7V A;  4OIP A;  1XZP A;  1L0W A;  3WOD A;  5IOS A;  4A3K C;  2NVX A;  1YX2 A;  5TMC A;  1ZVU A;  3PO3 C;  5IYB K;  3ERE D;  3N3Y A;  1BJT A;  4GFQ A;  3S17 C;  2NVT K;  1Y1W A;  4J3N A;  3AH5 A;  4FZB A;  4BLB A;  1VRQ C;  2VUM K;  3HOW K;  2R92 A;  3FKI A;  5M5X K;  2A68 A;  3AD8 C;  4BY1 K;  4YFX A;  5CHP A;  1VLO A;  3S0X A;  1EFW A;  5C4X K;  4WJ3 M;  3M4O K;  1JQW A;  2JA6 K;  3S15 C;  5M5Y K;  4C2M K;  4G7H A;  3AQP A;  5IP9 K;  4ZH4 A;  3S1Q C;  4A3F K;  2NVQ C;  1BS2 A;  1WQG A;  3GTQ K;  2ZUE A;  3OPF A;  4LLG A;  4DDQ A;  4XLN A;  2GAH C;  4MEY A;  4YFK A;  4LR2 A;  4Q4Z A;  2ZUF A;  2R7Z A;  3FHZ A;  5TJ3 A;  4C3H C;  2BE5 A;  3A8J A;  4A3K K;  3GIR A;  3PO3 K;  3V4G A;  3SZY A;  3GTM A;  2PPB A;  1VGX A;  2R92 K;  1EH1 A;  4KAT A;  2E2J C;  2E2I A;  1F7U A;  4BKW A;  3S17 K;  1WOP A;  3MML B;  1TWC C;  2Y0S D;  3TFI A;  4P9S A;  2XCQ A;  3HOV C;  3HOY C;  1TWH A;  1I50 C;  4KMU A;  3LAP A;  3GEE A;  2V6T A;  4BXX C;  1F93 A;  3EQL A;  4KAS A;  2O5I A;  5M3M K;  3GDZ A;  4KM8 A;  4BBS C;  5EGE A;  4XCH A;  1I50 A;  3S15 K;  4G7Z A;  1C0A A;  5FLM C;  4GTC A;  3GTP C;  3S1Q K;  2NVQ K;  2B63 A;  2YU9 A;  1I3Q A;  4GTD A;  3NUH A;  3CAG A;  4A3D C;  2PMZ D;  3HOW C;  4KM9 A;  3GTM K;  4WJ4 A;  3HKZ D;  3BP3 A;  1Y1V A;  4C3H K;  1TWA C;  2E2I K;  4XSZ A;  2D6F C;  1TWG C;  1WSR A;  4Y52 C;  5C4X C;  3BUE A;  4GTL A;  1B4A A;  5IOR A;  3I4M C;  3BP8 C;  1B4B A;  4GTB A;  4BY7 C;  4FM9 A;  4BLA A;  2E2J K;  4GT9 A;  4A3C C;  1TWA A;  1I6H C;  1TWG A;  4C45 A;  1TWC K;  2NVX C;  3SZZ A;  3HOV K;  3HOY K;  2P5M A;  1XXC A;  3G4C A;  2JA7 C;  3RZD C;  1I50 K;  3CQZ C;  1XPP A;  5IOT A;  1O2A A;  4QJV B;  4BXX K;  1O24 A;  2WB1 D;  4KB2 A;  2YU9 K;  2FQO A;  1WQF A;  1WSV A;  1Y1W C;  4BBS K;  5IYC C;  1YCL A;  4G0U A;  2JA7 A;  3CQZ A;  1USM A;  2Y0S L;  4XLP A;  2R92 C;  3FKI C;  4YG2 A;  4QJV A;  5FLM K;  4Y7N K;  3GTP K;  1BGW A;  4ILD A;  4P5A A;  4A93 C;  1XXB A;  4A3D K;  1HI9 A;  1DD5 A;  4MEX A;  2PA8 L;  4OIQ A;  1J6W A;  4G0V A;  1VJE A;  4OIN A;  2CFA B;  1DCH A;  2E2H A;  4Y52 K;  1WOR A;  1TWA K;  1V5V A;  3LAJ A;  2JA8 C;  4XSX A;  4LOW A;  1TWG K;  1WCM A;  4A3G K;  3GTG A; 
#chains in the Genus database with same CATH homology
 3S14 K;  2PPB A;  5C3E C;  4LJZ A;  1HQM A;  4AYB D;  5C44 C;  2R92 K;  3I4M K;  3S2H C;  2R93 K;  4QIW L;  1YNN A;  4BY7 K;  2E2J C;  5FJ8 K;  4A3C K;  3HKZ L;  2R7Z C;  2NVT C;  1IW7 A;  1YNJ A;  2E2H C;  3S17 K;  1Y1V K;  1I6H K;  4C3J K;  1TWC C;  2Y0S D;  2NVX K;  3HOV C;  5D4D A;  1SMY A;  2VUM C;  3HOZ C;  3HOY C;  3RZO C;  2JA5 K;  1WCM C;  1ZYR A;  3S1R K;  4A3I K;  1I50 C;  4KMU A;  1SFO K;  2JA7 K;  3RZD K;  3GTM C;  3GTG C;  3CQZ K;  3H3V D;  4A3B C;  4GZY A;  4BY1 C;  3DXJ A;  4OIO A;  4A3E C;  3HOU K;  4BXX C;  3EQL A;  5C4J C;  2O5I A;  4BBR K;  5M3M K;  4Q5S A;  2E2I C;  4A3M C;  1K83 K;  4BBS C;  4NOI A;  3M4O C;  3GTJ K;  5M3F K;  2JA6 C;  1Y1W K;  3GTK C;  5IYC K;  3S15 K;  3S16 K;  4G7Z A;  1TWH C;  3K7A C;  3S1N C;  5IP9 C;  5FLM C;  3FKI K;  4A3J K;  4A3L C;  3GTO C;  3HOX C;  2PMZ L;  4A3F C;  3GTP C;  3S1M C;  3S1Q K;  2NVQ K;  3GTL K;  3S2D K;  3GTQ C;  2CW0 A;  1R9T C;  2WAQ L;  3H0G K;  4A93 K;  1I6V A;  4A3D C;  3HOZ K;  2A69 A;  4QIW D;  2PMZ D;  2WB1 L;  3HOW C;  3M3Y C;  3GTM K;  3HKZ D;  2R92 C;  4OIP A;  5IP7 C;  3I4N K;  1TWF C;  4C3H K;  4G7O A;  3WOD A;  1TWA C;  4LK0 A;  4A3K C;  2E2I K;  4XSZ A;  2B63 C;  5TMC A;  2JA8 K;  3S1Q C;  1TWG C;  2YU9 C;  2NVY C;  1I3Q C;  4Y52 C;  5IYB K;  3PO3 C;  5C4X C;  3GTK K;  3S14 C;  4X6A K;  5IYD C;  2R93 C;  3I4M C;  5C3E K;  3S2H K;  5C44 K;  4BY7 C;  2A6E A;  1BDF A;  2E2J K;  4A3C C;  4Y7N C;  3S17 C;  2R7Z K;  2NVT K;  2E2H K;  1Y1V C;  5M5W K;  1I6H C;  1TWC K;  2NVX C;  2O5J A;  3HOV K;  2VUM K;  3HOY K;  2JA5 C;  3HOW K;  2A6H A;  3S1R C;  3RZO K;  4A3I C;  1WCM K;  1SFO C;  2JA7 C;  3RZD C;  1I50 K;  3CQZ C;  3GTG K;  4KN7 A;  5M5X K;  4A3B K;  1XPP A;  2A68 A;  4OIR A;  3HOU C;  2WAQ D;  4A3E K;  4BY1 K;  3PO2 C;  4QJV B;  4BXX K;  4YFX A;  5C4J K;  4AYB L;  4A3G K;  2WB1 D;  4MQ9 A;  2YU9 K;  1K83 C;  5C4X K;  4LK1 A;  3GTJ C;  4A3M K;  1Y1W C;  4BBS K;  3M4O K;  2JA6 K;  4A3G C;  5IYC C;  5IYD K;  3S15 C;  3S16 C;  5M5Y K;  2Y0S L;  4XLP A;  5TMF A;  4C2M K;  4G7H A;  4A3J C;  3FKI C;  1TWH K;  3K7A K;  4YG2 A;  4QJV A;  5IP9 K;  4ZH4 A;  5FLM K;  3S1N K;  3GTO K;  4A3L K;  4Y7N K;  3HOX K;  4A3F K;  2NVQ C;  3GTL C;  4KN4 A;  3GTP K;  4YFN A;  3S1M K;  3S2D C;  3H3V L;  3GTQ K;  3H0G C;  1R9T K;  4LLG A;  4A93 C;  4A3D K;  4C3I K;  4MEX A;  2PA8 L;  4OIQ A;  3M3Y K;  4XLN A;  4MEY A;  4YFK A;  4Q4Z A;  3I4N C;  3PO2 K;  5IP7 K;  4OIN A;  1TWF K;  4Y52 K;  4JK1 A;  2BE5 A;  2PA8 D;  1TWA K;  4A3K K;  2JA8 C;  4XSX A;  4BBR C;  2B63 K;  5IYB C;  1TWG K;  2NVY K;  1I3Q K;  3PO3 K;  4X6A C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...