4A3DK

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 33
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3dK00
3K7AK 4A3CK 3GTGC 2Y0SL 3H0GK 3WODA 2YU9C 4MEXA 3GTGK 4Q5SA 2CW0A 3CQZK 1I6HC 4X6AC 5D4DA 1K83K 5C44K 5IYDC 2R93K 1I50C 2NVYC 2JA6C 3HOYK 5C4JC 2JA7K 2NVYK 3GTKC 3I4NC 2JA7C 4A3GK 3GTKK 4OINA 1Y1WK 1YNNA 4A3GC 4OIOA 3S2DK 1TWHK 5IP9C 2R7ZK 4Q4ZA 4A3KC 4A3LK 3S1NC 4BXXK 5M5XK 5C4XC 4ZH4A 4LLGA 4C3JK 4Y52C 2E2HK 4A3IK 2NVTC 5M5WK 4A3BK 4A93K 2E2HC 4Y52K 4C2MK 3FKIK 4C3HK 3S15C 5IYBK 4A3CC 4LK0A 5IYCC 3S16C 5TMFA 1HQMA 3GTJC 3S16K 5M3FK 3RZOC 4NOIA 3GTJK 1IW7A 1I50K 2B63K 2PMZD 2E2IK 4BY1C 3S1MK 4BBRC 1Y1VK 4Y7NC 4BBRK 1SFOK 4Y7NK 1SFOC 4JK1A 2R7ZC 4A3KK 3S1NK 5FJ8K 4XLNA 3HOUC 4A3DC 2NVTK 2WB1L 3S14C 2JA8K 3S2HK 2JA5K 1TWGC 3GTQK 5FLMC 4A3FK 3FKIC 3S15K 4AYBD 2NVXK 5FLMK 4A3FC 3M3YC 4MEYA 1TWAK 3GTPK 2R92C 3H3VL 3H3VD 3I4MC 3M4OC 2A6EA 3S1QK 4BY7K 4BY7C 3HOVK 3CQZC 3HOXK 3HOVC 2WAQD 2VUMC 3GTMC 3HOXC 4BY1K 3PO2C 3M4OK 5IP7C 3GTOC 5C4JK 1TWCC 1R9TK 2E2JC 5IP7K 1SMYA 2BE5A 4KN4A 4X6AK 4QJVB 3HOZC 1K83C 2JA8C 1YNJA 3S2HC 2PMZL 4GZYA 4A3IC 1I3QC 4A3JK 2A69A 4LJZA 3GTPC 2R92K 3I4MK 1TWHC 1ZYRA 2A68A 4QJVA 5IP9K 1WCMC 1XPPA 2PPBA 3HKZL 5C4XK 3S17K 3GTLK 4BBSC 2Y0SD 4G7ZA 2NVQC 3RZOK 4YG2A 4XLPA 2NVQK 5TMCA 5C44C 2R93C 5IYDK 4QIWD 2E2JK 3S1RK 2JA6K 5IYCK 1Y1VC 3H0GC 2YU9K 3HKZD 1TWFC 1TWFK 4G7HA 3HOZK 1I6VA 2E2IC 4OIRA 4BXXC 3HOYC 2PA8L 4A3MC 3PO3K 4YFXA 2JA5C 1TWGK 3GTQC 3I4NK 3RZDC 3PO3C 4KN7A 1Y1WC 3RZDK 3S17C 4OIPA 1WCMK 5IYBC 4A3DK 2O5JA 4KMUA 3GTLC 4BBSK 3S1QC 4XSZA 5C3EK 4A3BC 4YFKA 4A93C 5C3EC 4AYBL 4A3EK 2O5IA 3PO2K 3DXJA 2NVXC 4A3EC 3M3YK 2WAQL 5M3MK 3S1RC 1TWAC 2B63C 3S1MC 3HOWC 2WB1D 1TWCK 1R9TC 3K7AC 3EQLA 5M5YK 2VUMK 1I6HK 3HOUK 4A3MK 4G7OA 3S14K 3GTOK 2PA8D 4YFNA 1I3QK 4A3JC 4LK1A 2A6HA 3S2DC 4MQ9A 4A3LC 4QIWL 4C3IK 1BDFA 4XSXA 3GTMK 3HOWK 4OIQA
chains in the Genus database with same CATH superfamily
1AB4A 1EQRA 2Y0SL 4MEXA 3BP3A 4Q5SA 2CW0A 3CQZK 3N0BA 5CHPA 4X6AC 5C44K 4LOWA 5C4JC 3GTQA 3GTKC 1KQ4A 3GTKK 1Y1WK 3S2DK 3V4GA 2R7ZK 5EGHA 3TTGA 2NVTC 5M5WK 1I3QA 1XZQB 4A3CC 1VJEA 1O28A 5M3FK 4KB4A 3RZOC 2JA7A 4G0UA 2PMZD 1SFOK 1IBAA 5CJ9A 1SFOC 2VUMA 1USOA 1O2BA 2R92A 4KARA 4XLNA 4A3DC 2WB1L 4DDQA 3S2HK 3GTMA 1IE0A 4GTBA 3FKIC 4C3HC 3S15K 4AYBD 5HL8A 2FQOA 2P8TA 2R92C 2RH6A 3GTMC 2NVYA 3A8IA 5IP7C 5IP7K 4WJ4A 1WCMA 1L0WA 4AH6A 1K83C 2JA8C 3BP8C 1I3QC 4A3JK 4KM8A 4QJVA 1WCMC 5TJ3A 4KMDA 2E2JK 2JA6K 5IYCK 1TWFC 3SZYA 1TWFK 3GEIA 1VRQC 2PA8L 4A3MC 2R93A 2NVXA 2JA5C 3GIRA 4ILDA 1Y1WC 1VLOA 3S17C 4J3NA 3S1QC 5C3EK 2W7VA 4YFKA 5C3EC 3AD7C 1WQGA 4KAWX 3PO2K 2NVXC 3M3YK 2JA5A 1TWAC 3HOWC 3BUEA 3GEEA 1I6HK 3HOUK 1B4BA 4G7OA 4YFNA 3FHZA 2A6HA 3LAJA 2D6FC 1INNA 2XCRB 1BDFA 1I50A 4G0WA 4OIQA 3GTGC 1TWFA 2YU9C 1WOSA 4GTDA 3GTGK 4P5AA 4GT9A 3H0GA 5D4DA 2R93K 1I50C 2GSUA 1TWHK 4A3LK 4BXXK 1XZQA 3GTPA 4LLGA 4Y52C 2E2HK 1JQWA 2E2HC 4Y52K 4C2MK 4FZBA 5IYBK 1TWHA 3ERED 1HQMA 1O2FB 3MMLB 4NOIA 2E2IK 1TWGA 4KMHA 4BBRC 3IPJA 4BBRK 4GFQA 2GAHC 4JK1A 4A3KK 3S1NK 3S14C 2JA5K 5FLMC 2RGRA 5FLMK 4MEYA 1J6XA 3GTPK 3I4MC 2XCOA 3H3VD 1GE9A 3S1QK 3A8KA 1DCOA 2WAQD 3PO2C 1G51A 3A8JA 4BY1K 4XCHA 1USMA 1SMYA 3CQZA 1ZVUA 1Y1VA 3GDZA 1YNJA 4KATA 2PMZL 2V6SA 4A3IC 2A69A 3GTOA 4LJZA 3VA7A 3M4OK 1ZYRA 5IP9K 3HKZL 4KC6A 5C4XK 3GTLK 4BBSC 1PJ5A 2E2IA 1X31C 3AD8C 4YG2A 5C44C 2ZUEA 4QIWD 3S1RK 1K83A 2YU9K 3HKZD 3HOZK 1WSRA 1R9TA 3GTQC 2P5MA 5E68A 1UV7A 4KN7A 2O5JA 1XXAA 4AYBL 3FOEA 4C2MC 2WAQL 5M3MK 1DCHA 2WB1D 1EK8A 3GTLA 3EQLA 2VUMK 1IL2A 3Q3QA 1YCLA 3AH5A 4C45A 3GTOK 4LK1A 1EH1A 3T02A 3S2DC 1WIHA 3GTMK 3K7AK 4A3CK 1F93A 3H0GK 5IOSA 2FQTA 3L4JA 1K83K 5IYDC 3TFJA 2NVYC 2NVYK 3I4NC 4KMAA 4LR2A 4PAAA 4Q4ZA 2ZUFA 4C3JK 4FM9A 4A93K 4A3IK 4C3JC 1XZPA 3HXAA 3FKIK 4C3HK 4G0VA 3S15C 4LK0A 5IYCC 3T01A 3S16C 2JA6A 5TMFA 3FOFA 3GTJC 3S16K 4WJ3M 3GTJK 1IW7A 2XCQA 2Y3PA 2B63K 3S1MK 1XZPB 4GTCA 3SZZA 1O27A 3LAPA 2R7ZC 5FJ8K 2NVTK 2JA8K 3GTQK 2NVXK 3M3YC 2V6UA 1TWAK 1VH2A 3H3VL 4BY7K 2JH3A 2R7ZA 4BY7C 1EI6A 2ZFZA 4GTAA 2CFAB 3CAGA 2E2JC 3T00A 2BE5A 4KN4A 4X6AK 4KB2A 3S2HC 3OEPA 2R92K 5L46A 2A68A 3S17K 1XPPA 2PPBA 2Y0SD 4KASA 2NVQC 1BJTA 3NUHA 4XLPA 4LQYA 2NVQK 5TMCA 2R93C 1Y1VC 3H0GC 1ZBSA 4M1XA 4G7HA 1WOOA 1IQ0A 4BXXC 1O2AA 3PO3K 4YFXA 1TWGK 3I4NK 4BLBA 3PO3C 4OIPA 1WCMK 5IYBC 4GTLA 4A3DK 4KMUA 1JVIA 4XSZA 1J6WA 4A93C 1XXCA 2O5IA 1PJ7A 3DXJA 1C0AA 3TFIA 1WQHA 1TWCK 1R9TC 1BS2A 1F7VA 4A3MK 3S14K 5IOQA 1DD5A 1J98A 1BGWA 3GTKA 4MQ9A 4A3LC 1XXBA 3S0XA 4QIWL 4XSXA 1ZQ1C 3HOWK 3WODA 3QX3A 1I6HC 3JSTA 2E2HA 2JA6C 3HOYK 2JA7K 2JA7C 2CFAA 4A3GK 4OINA 1YNNA 4A3GC 4OIOA 4WILA 5IP9C 2GSOA 2V6TA 3AD9C 4GTEA 4A3KC 3S1NC 5C4XC 3OPFA 3LPXA 4ZH4A 5M5XK 4A3BK 1YX2A 1WQFA 1V5VA 3FKIA 2PHCB 3N3YA 3N0CA 1I50K 4BY1C 1Y1VK 4Y7NC 4Y7NK 1VGXA 2GSNA 3HOUC 1O29A 3GEHA 1ISEA 1TWGC 4A3FK 1EFWA 4A3FC 3GTGA 3M4OC 5IOTA 2A6EA 1JOEA 3CQZC 1O25A 5EGEA 3HOVK 3HOXK 3HOVC 1SFOA 2VUMC 5JVOA 3HOXC 1O26A 1O24A 1DCPA 3GTOC 5C4JK 1TWCC 1R9TK 1B4AA 3AQPA 4BKWA 4QJVB 3HOZC 5IORA 1WORA 4GZYA 1HI9A 1F7UA 3GTPC 3I4MK 1TWHC 3GSIA 4G7ZA 3ADAC 3RZOK 4RMFA 5IYDK 1F9NA 1PJ6A 4O2DA 1I6VA 2E2IC 4OIRA 3TFHA 4P5BA 4BLAA 3HOYC 3RZDC 2KWAA 3RZDK 3L4KA 3GTLC 4BBSK 4GTFA 4PABA 4A3BC 2EBBA 4A3EK 1WSVA 4A3EC 3S1RC 2B63C 3S1MC 3GTJA 3K7AC 3G4CA 1WOPA 5JFEA 1ZXOA 5M5YK 1TWCA 1Y1WA 2YU9A 2PA8D 4KM9A 2B63A 1I3QK 4A3JC 3AQOA 4KDDA 1RU0A 1TWAA 3OREA 1J6VA 4C3IC 2GAGC 4C3IK 1IS1A 4P9SA 3G4AA
chains in the Genus database with same CATH topology
3K7AK 4A3CK 3GTGC 2Y0SL 3H0GK 3WODA 2YU9C 4MEXA 3GTGK 4Q5SA 2CW0A 3CQZK 1I6HC 4X6AC 5D4DA 1K83K 5C44K 5IYDC 2R93K 1I50C 2NVYC 2JA6C 3HOYK 5C4JC 2JA7K 2NVYK 3GTKC 3I4NC 2JA7C 4A3GK 3GTKK 4OINA 1Y1WK 1YNNA 4A3GC 4OIOA 3S2DK 1TWHK 5IP9C 2R7ZK 4Q4ZA 4A3KC 4A3LK 3S1NC 4BXXK 5M5XK 5C4XC 4ZH4A 4LLGA 4C3JK 4Y52C 2E2HK 4A3IK 2NVTC 5M5WK 4A3BK 4A93K 2E2HC 4Y52K 4C2MK 3FKIK 4C3HK 3S15C 5IYBK 4A3CC 4LK0A 5IYCC 3S16C 5TMFA 1HQMA 3GTJC 3S16K 5M3FK 3RZOC 4NOIA 3GTJK 1IW7A 1I50K 2B63K 2PMZD 2E2IK 4BY1C 3S1MK 4BBRC 1Y1VK 4Y7NC 4BBRK 1SFOK 4Y7NK 1SFOC 4JK1A 2R7ZC 4A3KK 3S1NK 5FJ8K 4XLNA 3HOUC 4A3DC 2NVTK 2WB1L 3S14C 2JA8K 3S2HK 2JA5K 1TWGC 3GTQK 5FLMC 4A3FK 3FKIC 3S15K 4AYBD 2NVXK 5FLMK 4A3FC 3M3YC 4MEYA 1TWAK 3GTPK 2R92C 3H3VL 3H3VD 3I4MC 3M4OC 2A6EA 3S1QK 4BY7K 4BY7C 3HOVK 3CQZC 3HOXK 3HOVC 2WAQD 2VUMC 3GTMC 3HOXC 4BY1K 3PO2C 3M4OK 5IP7C 3GTOC 5C4JK 1TWCC 1R9TK 2E2JC 5IP7K 1SMYA 2BE5A 4KN4A 4X6AK 4QJVB 3HOZC 1K83C 2JA8C 1YNJA 3S2HC 2PMZL 4GZYA 4A3IC 1I3QC 4A3JK 2A69A 4LJZA 3GTPC 2R92K 3I4MK 1TWHC 1ZYRA 2A68A 4QJVA 5IP9K 1WCMC 1XPPA 2PPBA 3HKZL 5C4XK 3S17K 3GTLK 4BBSC 2Y0SD 4G7ZA 2NVQC 3RZOK 4YG2A 4XLPA 2NVQK 5TMCA 5C44C 2R93C 5IYDK 4QIWD 2E2JK 3S1RK 2JA6K 5IYCK 1Y1VC 3H0GC 2YU9K 3HKZD 1TWFC 1TWFK 4G7HA 3HOZK 1I6VA 2E2IC 4OIRA 4BXXC 3HOYC 2PA8L 4A3MC 3PO3K 4YFXA 2JA5C 1TWGK 3GTQC 3I4NK 3RZDC 3PO3C 4KN7A 1Y1WC 3RZDK 3S17C 4OIPA 1WCMK 5IYBC 4A3DK 2O5JA 4KMUA 3GTLC 4BBSK 3S1QC 4XSZA 5C3EK 4A3BC 4YFKA 4A93C 5C3EC 4AYBL 4A3EK 2O5IA 3PO2K 3DXJA 2NVXC 4A3EC 3M3YK 2WAQL 5M3MK 3S1RC 1TWAC 2B63C 3S1MC 3HOWC 2WB1D 1TWCK 1R9TC 3K7AC 3EQLA 5M5YK 2VUMK 1I6HK 3HOUK 4A3MK 4G7OA 3S14K 3GTOK 2PA8D 4YFNA 1I3QK 4A3JC 4LK1A 2A6HA 3S2DC 4MQ9A 4A3LC 4QIWL 4C3IK 1BDFA 4XSXA 3GTMK 3HOWK 4OIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K7A K;  4A3C K;  3GTG C;  2Y0S L;  3H0G K;  3WOD A;  2YU9 C;  4MEX A;  3GTG K;  4Q5S A;  2CW0 A;  3CQZ K;  1I6H C;  4X6A C;  5D4D A;  1K83 K;  5C44 K;  5IYD C;  2R93 K;  1I50 C;  2NVY C;  2JA6 C;  3HOY K;  5C4J C;  2JA7 K;  2NVY K;  3GTK C;  3I4N C;  2JA7 C;  4A3G K;  3GTK K;  4OIN A;  1Y1W K;  1YNN A;  4A3G C;  4OIO A;  3S2D K;  1TWH K;  5IP9 C;  2R7Z K;  4Q4Z A;  4A3K C;  4A3L K;  3S1N C;  4BXX K;  5M5X K;  5C4X C;  4ZH4 A;  4LLG A;  4C3J K;  4Y52 C;  2E2H K;  4A3I K;  2NVT C;  5M5W K;  4A3B K;  4A93 K;  2E2H C;  4Y52 K;  4C2M K;  3FKI K;  4C3H K;  3S15 C;  5IYB K;  4A3C C;  4LK0 A;  5IYC C;  3S16 C;  5TMF A;  1HQM A;  3GTJ C;  3S16 K;  5M3F K;  3RZO C;  4NOI A;  3GTJ K;  1IW7 A;  1I50 K;  2B63 K;  2PMZ D;  2E2I K;  4BY1 C;  3S1M K;  4BBR C;  1Y1V K;  4Y7N C;  4BBR K;  1SFO K;  4Y7N K;  1SFO C;  4JK1 A;  2R7Z C;  4A3K K;  3S1N K;  5FJ8 K;  4XLN A;  3HOU C;  4A3D C;  2NVT K;  2WB1 L;  3S14 C;  2JA8 K;  3S2H K;  2JA5 K;  1TWG C;  3GTQ K;  5FLM C;  4A3F K;  3FKI C;  3S15 K;  4AYB D;  2NVX K;  5FLM K;  4A3F C;  3M3Y C;  4MEY A;  1TWA K;  3GTP K;  2R92 C;  3H3V L;  3H3V D;  3I4M C;  3M4O C;  2A6E A;  3S1Q K;  4BY7 K;  4BY7 C;  3HOV K;  3CQZ C;  3HOX K;  3HOV C;  2WAQ D;  2VUM C;  3GTM C;  3HOX C;  4BY1 K;  3PO2 C;  3M4O K;  5IP7 C;  3GTO C;  5C4J K;  1TWC C;  1R9T K;  2E2J C;  5IP7 K;  1SMY A;  2BE5 A;  4KN4 A;  4X6A K;  4QJV B;  3HOZ C;  1K83 C;  2JA8 C;  1YNJ A;  3S2H C;  2PMZ L;  4GZY A;  4A3I C;  1I3Q C;  4A3J K;  2A69 A;  4LJZ A;  3GTP C;  2R92 K;  3I4M K;  1TWH C;  1ZYR A;  2A68 A;  4QJV A;  5IP9 K;  1WCM C;  1XPP A;  2PPB A;  3HKZ L;  5C4X K;  3S17 K;  3GTL K;  4BBS C;  2Y0S D;  4G7Z A;  2NVQ C;  3RZO K;  4YG2 A;  4XLP A;  2NVQ K;  5TMC A;  5C44 C;  2R93 C;  5IYD K;  4QIW D;  2E2J K;  3S1R K;  2JA6 K;  5IYC K;  1Y1V C;  3H0G C;  2YU9 K;  3HKZ D;  1TWF C;  1TWF K;  4G7H A;  3HOZ K;  1I6V A;  2E2I C;  4OIR A;  4BXX C;  3HOY C;  2PA8 L;  4A3M C;  3PO3 K;  4YFX A;  2JA5 C;  1TWG K;  3GTQ C;  3I4N K;  3RZD C;  3PO3 C;  4KN7 A;  1Y1W C;  3RZD K;  3S17 C;  4OIP A;  1WCM K;  5IYB C;  4A3D K;  2O5J A;  4KMU A;  3GTL C;  4BBS K;  3S1Q C;  4XSZ A;  5C3E K;  4A3B C;  4YFK A;  4A93 C;  5C3E C;  4AYB L;  4A3E K;  2O5I A;  3PO2 K;  3DXJ A;  2NVX C;  4A3E C;  3M3Y K;  2WAQ L;  5M3M K;  3S1R C;  1TWA C;  2B63 C;  3S1M C;  3HOW C;  2WB1 D;  1TWC K;  1R9T C;  3K7A C;  3EQL A;  5M5Y K;  2VUM K;  1I6H K;  3HOU K;  4A3M K;  4G7O A;  3S14 K;  3GTO K;  2PA8 D;  4YFN A;  1I3Q K;  4A3J C;  4LK1 A;  2A6H A;  3S2D C;  4MQ9 A;  4A3L C;  4QIW L;  4C3I K;  1BDF A;  4XSX A;  3GTM K;  3HOW K;  4OIQ A; 
#chains in the Genus database with same CATH topology
 1AB4 A;  1EQR A;  2Y0S L;  4MEX A;  3BP3 A;  4Q5S A;  2CW0 A;  3CQZ K;  3N0B A;  5CHP A;  4X6A C;  5C44 K;  4LOW A;  5C4J C;  3GTQ A;  3GTK C;  1KQ4 A;  3GTK K;  1Y1W K;  3S2D K;  3V4G A;  2R7Z K;  5EGH A;  3TTG A;  2NVT C;  5M5W K;  1I3Q A;  1XZQ B;  4A3C C;  1VJE A;  1O28 A;  5M3F K;  4KB4 A;  3RZO C;  2JA7 A;  4G0U A;  2PMZ D;  1SFO K;  1IBA A;  5CJ9 A;  1SFO C;  2VUM A;  1USO A;  1O2B A;  2R92 A;  4KAR A;  4XLN A;  4A3D C;  2WB1 L;  4DDQ A;  3S2H K;  3GTM A;  1IE0 A;  4GTB A;  3FKI C;  4C3H C;  3S15 K;  4AYB D;  5HL8 A;  2FQO A;  2P8T A;  2R92 C;  2RH6 A;  3GTM C;  2NVY A;  3A8I A;  5IP7 C;  5IP7 K;  4WJ4 A;  1WCM A;  1L0W A;  4AH6 A;  1K83 C;  2JA8 C;  3BP8 C;  1I3Q C;  4A3J K;  4KM8 A;  4QJV A;  1WCM C;  5TJ3 A;  4KMD A;  2E2J K;  2JA6 K;  5IYC K;  1TWF C;  3SZY A;  1TWF K;  3GEI A;  1VRQ C;  2PA8 L;  4A3M C;  2R93 A;  2NVX A;  2JA5 C;  3GIR A;  4ILD A;  1Y1W C;  1VLO A;  3S17 C;  4J3N A;  3S1Q C;  5C3E K;  2W7V A;  4YFK A;  5C3E C;  3AD7 C;  1WQG A;  4KAW X;  3PO2 K;  2NVX C;  3M3Y K;  2JA5 A;  1TWA C;  3HOW C;  3BUE A;  3GEE A;  1I6H K;  3HOU K;  1B4B A;  4G7O A;  4YFN A;  3FHZ A;  2A6H A;  3LAJ A;  2D6F C;  1INN A;  2XCR B;  1BDF A;  1I50 A;  4G0W A;  4OIQ A;  3GTG C;  1TWF A;  2YU9 C;  1WOS A;  4GTD A;  3GTG K;  4P5A A;  4GT9 A;  3H0G A;  5D4D A;  2R93 K;  1I50 C;  2GSU A;  1TWH K;  4A3L K;  4BXX K;  1XZQ A;  3GTP A;  4LLG A;  4Y52 C;  2E2H K;  1JQW A;  2E2H C;  4Y52 K;  4C2M K;  4FZB A;  5IYB K;  1TWH A;  3ERE D;  1HQM A;  1O2F B;  3MML B;  4NOI A;  2E2I K;  1TWG A;  4KMH A;  4BBR C;  3IPJ A;  4BBR K;  4GFQ A;  2GAH C;  4JK1 A;  4A3K K;  3S1N K;  3S14 C;  2JA5 K;  5FLM C;  2RGR A;  5FLM K;  4MEY A;  1J6X A;  3GTP K;  3I4M C;  2XCO A;  3H3V D;  1GE9 A;  3S1Q K;  3A8K A;  1DCO A;  2WAQ D;  3PO2 C;  1G51 A;  3A8J A;  4BY1 K;  4XCH A;  1USM A;  1SMY A;  3CQZ A;  1ZVU A;  1Y1V A;  3GDZ A;  1YNJ A;  4KAT A;  2PMZ L;  2V6S A;  4A3I C;  2A69 A;  3GTO A;  4LJZ A;  3VA7 A;  3M4O K;  1ZYR A;  5IP9 K;  3HKZ L;  4KC6 A;  5C4X K;  3GTL K;  4BBS C;  1PJ5 A;  2E2I A;  1X31 C;  3AD8 C;  4YG2 A;  5C44 C;  2ZUE A;  4QIW D;  3S1R K;  1K83 A;  2YU9 K;  3HKZ D;  3HOZ K;  1WSR A;  1R9T A;  3GTQ C;  2P5M A;  5E68 A;  1UV7 A;  4KN7 A;  2O5J A;  1XXA A;  4AYB L;  3FOE A;  4C2M C;  2WAQ L;  5M3M K;  1DCH A;  2WB1 D;  1EK8 A;  3GTL A;  3EQL A;  2VUM K;  1IL2 A;  3Q3Q A;  1YCL A;  3AH5 A;  4C45 A;  3GTO K;  4LK1 A;  1EH1 A;  3T02 A;  3S2D C;  1WIH A;  3GTM K;  3K7A K;  4A3C K;  1F93 A;  3H0G K;  5IOS A;  2FQT A;  3L4J A;  1K83 K;  5IYD C;  3TFJ A;  2NVY C;  2NVY K;  3I4N C;  4KMA A;  4LR2 A;  4PAA A;  4Q4Z A;  2ZUF A;  4C3J K;  4FM9 A;  4A93 K;  4A3I K;  4C3J C;  1XZP A;  3HXA A;  3FKI K;  4C3H K;  4G0V A;  3S15 C;  4LK0 A;  5IYC C;  3T01 A;  3S16 C;  2JA6 A;  5TMF A;  3FOF A;  3GTJ C;  3S16 K;  4WJ3 M;  3GTJ K;  1IW7 A;  2XCQ A;  2Y3P A;  2B63 K;  3S1M K;  1XZP B;  4GTC A;  3SZZ A;  1O27 A;  3LAP A;  2R7Z C;  5FJ8 K;  2NVT K;  2JA8 K;  3GTQ K;  2NVX K;  3M3Y C;  2V6U A;  1TWA K;  1VH2 A;  3H3V L;  4BY7 K;  2JH3 A;  2R7Z A;  4BY7 C;  1EI6 A;  2ZFZ A;  4GTA A;  2CFA B;  3CAG A;  2E2J C;  3T00 A;  2BE5 A;  4KN4 A;  4X6A K;  4KB2 A;  3S2H C;  3OEP A;  2R92 K;  5L46 A;  2A68 A;  3S17 K;  1XPP A;  2PPB A;  2Y0S D;  4KAS A;  2NVQ C;  1BJT A;  3NUH A;  4XLP A;  4LQY A;  2NVQ K;  5TMC A;  2R93 C;  1Y1V C;  3H0G C;  1ZBS A;  4M1X A;  4G7H A;  1WOO A;  1IQ0 A;  4BXX C;  1O2A A;  3PO3 K;  4YFX A;  1TWG K;  3I4N K;  4BLB A;  3PO3 C;  4OIP A;  1WCM K;  5IYB C;  4GTL A;  4A3D K;  4KMU A;  1JVI A;  4XSZ A;  1J6W A;  4A93 C;  1XXC A;  2O5I A;  1PJ7 A;  3DXJ A;  1C0A A;  3TFI A;  1WQH A;  1TWC K;  1R9T C;  1BS2 A;  1F7V A;  4A3M K;  3S14 K;  5IOQ A;  1DD5 A;  1J98 A;  1BGW A;  3GTK A;  4MQ9 A;  4A3L C;  1XXB A;  3S0X A;  4QIW L;  4XSX A;  1ZQ1 C;  3HOW K;  3WOD A;  3QX3 A;  1I6H C;  3JST A;  2E2H A;  2JA6 C;  3HOY K;  2JA7 K;  2JA7 C;  2CFA A;  4A3G K;  4OIN A;  1YNN A;  4A3G C;  4OIO A;  4WIL A;  5IP9 C;  2GSO A;  2V6T A;  3AD9 C;  4GTE A;  4A3K C;  3S1N C;  5C4X C;  3OPF A;  3LPX A;  4ZH4 A;  5M5X K;  4A3B K;  1YX2 A;  1WQF A;  1V5V A;  3FKI A;  2PHC B;  3N3Y A;  3N0C A;  1I50 K;  4BY1 C;  1Y1V K;  4Y7N C;  4Y7N K;  1VGX A;  2GSN A;  3HOU C;  1O29 A;  3GEH A;  1ISE A;  1TWG C;  4A3F K;  1EFW A;  4A3F C;  3GTG A;  3M4O C;  5IOT A;  2A6E A;  1JOE A;  3CQZ C;  1O25 A;  5EGE A;  3HOV K;  3HOX K;  3HOV C;  1SFO A;  2VUM C;  5JVO A;  3HOX C;  1O26 A;  1O24 A;  1DCP A;  3GTO C;  5C4J K;  1TWC C;  1R9T K;  1B4A A;  3AQP A;  4BKW A;  4QJV B;  3HOZ C;  5IOR A;  1WOR A;  4GZY A;  1HI9 A;  1F7U A;  3GTP C;  3I4M K;  1TWH C;  3GSI A;  4G7Z A;  3ADA C;  3RZO K;  4RMF A;  5IYD K;  1F9N A;  1PJ6 A;  4O2D A;  1I6V A;  2E2I C;  4OIR A;  3TFH A;  4P5B A;  4BLA A;  3HOY C;  3RZD C;  2KWA A;  3RZD K;  3L4K A;  3GTL C;  4BBS K;  4GTF A;  4PAB A;  4A3B C;  2EBB A;  4A3E K;  1WSV A;  4A3E C;  3S1R C;  2B63 C;  3S1M C;  3GTJ A;  3K7A C;  3G4C A;  1WOP A;  5JFE A;  1ZXO A;  5M5Y K;  1TWC A;  1Y1W A;  2YU9 A;  2PA8 D;  4KM9 A;  2B63 A;  1I3Q K;  4A3J C;  3AQO A;  4KDD A;  1RU0 A;  1TWA A;  3ORE A;  1J6V A;  4C3I C;  2GAG C;  4C3I K;  1IS1 A;  4P9S A;  3G4A A; 
#chains in the Genus database with same CATH homology
 3K7A K;  4A3C K;  3GTG C;  2Y0S L;  3H0G K;  3WOD A;  2YU9 C;  4MEX A;  3GTG K;  4Q5S A;  2CW0 A;  3CQZ K;  1I6H C;  4X6A C;  5D4D A;  1K83 K;  5C44 K;  5IYD C;  2R93 K;  1I50 C;  2NVY C;  2JA6 C;  3HOY K;  5C4J C;  2JA7 K;  2NVY K;  3GTK C;  3I4N C;  2JA7 C;  4A3G K;  3GTK K;  4OIN A;  1Y1W K;  1YNN A;  4A3G C;  4OIO A;  3S2D K;  1TWH K;  5IP9 C;  2R7Z K;  4Q4Z A;  4A3K C;  4A3L K;  3S1N C;  4BXX K;  5M5X K;  5C4X C;  4ZH4 A;  4LLG A;  4C3J K;  4Y52 C;  2E2H K;  4A3I K;  2NVT C;  5M5W K;  4A3B K;  4A93 K;  2E2H C;  4Y52 K;  4C2M K;  3FKI K;  4C3H K;  3S15 C;  5IYB K;  4A3C C;  4LK0 A;  5IYC C;  3S16 C;  5TMF A;  1HQM A;  3GTJ C;  3S16 K;  5M3F K;  3RZO C;  4NOI A;  3GTJ K;  1IW7 A;  1I50 K;  2B63 K;  2PMZ D;  2E2I K;  4BY1 C;  3S1M K;  4BBR C;  1Y1V K;  4Y7N C;  4BBR K;  1SFO K;  4Y7N K;  1SFO C;  4JK1 A;  2R7Z C;  4A3K K;  3S1N K;  5FJ8 K;  4XLN A;  3HOU C;  4A3D C;  2NVT K;  2WB1 L;  3S14 C;  2JA8 K;  3S2H K;  2JA5 K;  1TWG C;  3GTQ K;  5FLM C;  4A3F K;  3FKI C;  3S15 K;  4AYB D;  2NVX K;  5FLM K;  4A3F C;  3M3Y C;  4MEY A;  1TWA K;  3GTP K;  2R92 C;  3H3V L;  3H3V D;  3I4M C;  3M4O C;  2A6E A;  3S1Q K;  4BY7 K;  4BY7 C;  3HOV K;  3CQZ C;  3HOX K;  3HOV C;  2WAQ D;  2VUM C;  3GTM C;  3HOX C;  4BY1 K;  3PO2 C;  3M4O K;  5IP7 C;  3GTO C;  5C4J K;  1TWC C;  1R9T K;  2E2J C;  5IP7 K;  1SMY A;  2BE5 A;  4KN4 A;  4X6A K;  4QJV B;  3HOZ C;  1K83 C;  2JA8 C;  1YNJ A;  3S2H C;  2PMZ L;  4GZY A;  4A3I C;  1I3Q C;  4A3J K;  2A69 A;  4LJZ A;  3GTP C;  2R92 K;  3I4M K;  1TWH C;  1ZYR A;  2A68 A;  4QJV A;  5IP9 K;  1WCM C;  1XPP A;  2PPB A;  3HKZ L;  5C4X K;  3S17 K;  3GTL K;  4BBS C;  2Y0S D;  4G7Z A;  2NVQ C;  3RZO K;  4YG2 A;  4XLP A;  2NVQ K;  5TMC A;  5C44 C;  2R93 C;  5IYD K;  4QIW D;  2E2J K;  3S1R K;  2JA6 K;  5IYC K;  1Y1V C;  3H0G C;  2YU9 K;  3HKZ D;  1TWF C;  1TWF K;  4G7H A;  3HOZ K;  1I6V A;  2E2I C;  4OIR A;  4BXX C;  3HOY C;  2PA8 L;  4A3M C;  3PO3 K;  4YFX A;  2JA5 C;  1TWG K;  3GTQ C;  3I4N K;  3RZD C;  3PO3 C;  4KN7 A;  1Y1W C;  3RZD K;  3S17 C;  4OIP A;  1WCM K;  5IYB C;  4A3D K;  2O5J A;  4KMU A;  3GTL C;  4BBS K;  3S1Q C;  4XSZ A;  5C3E K;  4A3B C;  4YFK A;  4A93 C;  5C3E C;  4AYB L;  4A3E K;  2O5I A;  3PO2 K;  3DXJ A;  2NVX C;  4A3E C;  3M3Y K;  2WAQ L;  5M3M K;  3S1R C;  1TWA C;  2B63 C;  3S1M C;  3HOW C;  2WB1 D;  1TWC K;  1R9T C;  3K7A C;  3EQL A;  5M5Y K;  2VUM K;  1I6H K;  3HOU K;  4A3M K;  4G7O A;  3S14 K;  3GTO K;  2PA8 D;  4YFN A;  1I3Q K;  4A3J C;  4LK1 A;  2A6H A;  3S2D C;  4MQ9 A;  4A3L C;  4QIW L;  4C3I K;  1BDF A;  4XSX A;  3GTM K;  3HOW K;  4OIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...