4A3FG

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid and soaked with ampcpp
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 28
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3fG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3fG01
4X62Q 1J6QA 1Z47A 4L5TA 5IWAL 2Z6KC 4PZ7A 4BA1I 1W2BA 5LMNQ 2ZJRA 2UXBQ 1HZAA 3G4SA 4POGA 1BKBA 4JI3Q 1SFOH 2KCTA 4NXML 4IOAA 2PQAB 1VQ5A 1GVPA 4DR6L 1NTGA 2VQFL 4BBRH 2OQKA 1QZGA 2CCZA 4IJHA 1KIXA 2K75A 3TRZA 1E7ZA 3I4MG 1HJPA 3CCVA 4LF6L 4LF9L 4L5SA 2LSSA 2NVXH 2YTXA 4YWKA 1BBUA 4HIMA 5FJ8G 1SROA 4OWTB 4JI1Q 4GKJQ 4A3MH 2R93G 4B3TL 4DV6Q 5JJIA 1XPUA 1N9WA 3W5OA 1AE3A 3CMAA 5E7NA 4JBWA 3UE0A 4GLVB 4DV4L 4DV7Q 4X66Q 4X65Q 1EYGA 4DNIA 2JA9A 1PH5A 1TWCH 4YWLA 1K73C 3M7NA 4GKKQ 1G6PA 1NBWA 4A3GH 1IBLL 3S1NH 4APVA 4A75A 4LFAQ 3PO3H 5M3MH 1Q46A 2Y0SE 3CCMA 2IHFA 4B3MQ 1VQGA 3RR5A 1JJCB 2AKWB 2Z6KA 3NELA 4BBRG 2F3IA 2Q2TA 4GNXB 1HZCA 3E9IA 2HT1A 2UUAL 3K8AA 2LXJA 2YV5A 2DUDA 3I55A 4HIDA 1A63A 4DV2L 3OTOL 2QA4A 3CC4A 4A3LH 2K52A 4GN4B 4JOIC 2ZM6L 2MFIA 2JE6I 3PCOB 4ALPA 4DV0L 2Q2IA 4A3MG 5M3FG 1NMGA 4ME3A 1PYBA 2XGTA 4DR5Q 4OXPA 1VQLA 2D62A 1XPOA 2HIVA 1XNRL 4BA2I 2K50A 3K0XA 1VQIA 4A3JH 5FLXc 2VQEL 4HJ8A 2R92H 4K0KQ 1JJ2A 1EWIA 4QQBX 4C3HH 3T1YL 2N3SA 3TREA 5FLMH 1TWGH 4L5RC 3CCSA 4B3RL 4JI6Q 3PO3G 3AEVA 5M3MG 1VQBA 4A3FH 4OX9Q 4DR7L 4A4IA 3BJUA 1NY4A 3U4VA 2E5LQ 1Y14B 5JJKA 4JI5L 4UP8A 4OWXB 3S14H 4JI4Q 3PO2H 3KYHC 4FDBA 4PZ6A 2E2HH 1JJGA 1UE7A 5JEAG 4JYAL 1BBWA 5AJ3L 1I50H 1X6OA 2WB1G 3GD7A 3CD6A 1Q7YC 4A3LG 4EQ5A 4X62L 5C3EG 4GLXA 4HJ7A 5ELNA 3RLNA 1K8GA 1EIYB 2UXBL 5LMNL 3HOVH 1WI5A 1PH1A 3GTLH 4JOIA 4JI3L 2ZJQA 1NE3A 2JA7G 4LUZA 3J80c 4L5QA 1I3QH 4HIKA 3CC2A 4DV5Q 2ZTEA 4JI8Q 4QGUA 4LF4Q 2L15A 3CW2C 3KLWA 4NPSA 5IP7H 2VW9A 2OTLA 4BY1H 4NXNL 4A76A 4UY8C 4TVAB 1HNXQ 3I4NH 1YEZA 5FLMG 2GVAA 1PYSB 1HZ9A 1UEBA 1HR0Q 4A93H 1UWVA 3TEHB 3IRBA 1NMFA 4IOCA 3CCRA 4A3FG 4C3JH 2UXDQ 2AHOB 3PV0A 5M5WH 1C9OA 1VQ4A 1VS0A 3M3YH 2OTJA 1QVGA 3M4OH 2DGYA 2FXQA 1EQRA 3FKIH 3F8TA 3HKZG 3K80C 5ELOA 4DV6L 2JA5H 3CF5A 2IHEA 4JI0Q 4YHHQ 3CCUA 1IZ6A 3M4PA 3M9BA 1OXXK 1HNZQ 4X64Q 1FGUA 2ZTDA 3RZDH 4GKKL 2V1CC 1YHAA 1M1KC 1GKHA 1WJJA 2BA1A 4O0AA 1U0LA 3S17H 1EQQA 4HJ5A 3A5ZB 1WCMH 1EOVA 4LFAL 4HJ9A 1CKMA 2ZJPA 2JA6G 3J7A5 4TQUS 4UP9A 4BBSG 1B70B 2VL6A 3ER0A 4JI7Q 5C44H 1N33Q 3GDEA 2ES2A 1QVCA 1L1OC 1X3FA 3J80i 1LM0A 2AWNA 3F2BA 4GOPC 4A93G 4MZ9A 4WJ3M 3JC66 4IFDG 2AWOA 2I5LX 4DPGA 5IP9H 1I6HH 4PG3A 3HOUH 1C7YA 4P74A 3CC7A 3FKIG 4AIMA 5C0XG 4P72A 1IBKQ 3MEFA 1X55A 1XTDA 2JA5G 1VQNA 1JB7A 4DR5L 3CP0A 2UUCQ 5LMNW 4DR1Q 1VQDA 4A3BG 4IJLA 1S40A 1ASYA 1CKOA 1I94Q 3J7ZC 4K0KL 1TXYA 1YHBA 2VY3A 4GLAC 1PFSA 1X3EA 4KI0A 2HIXA 5DLQE 4R4OA 4DUZQ 1XNQQ 2MNAA 1X65A 4AYBE 3GTGH 4OONA 1ASZA 3UDGA 2KHIA 2WB1E 3NEMA 2NVTH 3NBHB 2B63G 1N8RC 5C4XG 1AE2A 4OX9L 3SGIA 3KF6A 2E2IH 3EN2A 2BA0A 3UDXA 4O2DA 1OXUA 4YY3Q 4A3KH 3S15H 2N8NA 2E5LL 4LUOA 1QUQA 1OTCA 2JA8H 4A3CH 3BZKA 4JBJA 4JI4L 1YVCA 4LUVA 3RN5A 4HJAA 3ICEA 1TWFH 5IYDH 4R4CA 5JEAJ 4DR4Q 1MJCA 3VDYA 3PUYA 2K5NA 5IP9G 1X56A 2F4VQ 3HOUG 3L2PA 3H3VH 1L1OA 2RHSB 2F4VL 1P8LA 5IY0A 1Z9FA 4GOPA 1A8VA 5HY6A 1EFWA 4WJ4A 5M5XH 4J15A 4PZ8A 1JE5A 4DK3C 1VQ7A 2CFMA 4LF4L 5LMUQ 3G6EA 1VQFA 5BR8Q 3HOXH 1R9TH 1VQAA 1UE6A 1CSPA 3KOJA 1O7IA 4P71A 4QL5A 4LW1A 3U4ZA 3LGJA 1NJIC 1KHIA 1HR0L 1P16A 1Q12A 2WAQG 3CAMA 2HHHQ 1FJGQ 3HOWH 2KENA 5IT9c 2N78A 4IFDI 2I5MX 2MO0A 1UE5A 3F2CA 3CCJA 1XPRA 4A3KG 3ULLA 4DV1Q 2VNUD 3D0FA 4A3CG 3ZJYC 5IE8A 5C0XI 2JA8G 5K36G 2D0PA 2K5VA 3AYHB 4MNOA 2KCMA 1VQ9A 4KHPQ 1TWHH 2UU9L 4LF5Q 5GAEC 3FHWA 3W1GA 4X64L 3PUXA 1QUQB 4YCWA 1HNZL 1J5EQ 1D7QA 4IPGA 1PHJA 1S3OA 1Q8KA 1HZBA 4R4QA 4A3GG 2IY5B 3E9HA 2UUBL 4Y7NH 3ULJA 1PH4A 3DM3A 2OCEA 3PIOA 3I56A 1VQKA 1Y1WH 1OXTA 1VQ8A 3RLOA 4GOPB 4JI7L 1N33L 1KQSA 5IWAQ 1YJ9A 3RLFA 2GVBA 3HOWG 2CKZB 1PH9A 4IFDJ 4A3IH 4XTCS 2VZAA 1KRSA 4DR6Q 2VQFQ 1K8AC 1YJWA 2Q2UA 1CSQA 2IT1A 3AFPA 3KDFA 5C0XJ 3A5UA 1KC8C 3GTOH 2JJQA 3NENA 2UUCL 1B7YB 3L0OA 2AMCB 2XTIA 4DR1L 1S72A 1N36Q 4LF6Q 3UE1A 4Y52H 4A3JG 1I94L 1M90C 3CCQA 1YI2A 1YJNA 2R6GA 2R92G 3D31A 2PNHA 4JV5Q 1XNQL 4QJFA 3J81j 4DV3Q 4POFA 4LNQA 2QEXA 3Q8DA 4DAYB 1B8AA 3RZOH 2CWPA 3HOYH 2ATWA 1HR0W 4MTNA 4DV4Q 4JBMA 1RL2A 2K5HA 4YY3L 3CCEA 4JI1L 3J81i 1Q82C 3S1MH 2JK8A 1VQEA 1AH9A 4P73A 3PO2G 1DGSA 3TS0A 2D0OA 4DV7L 2A8VA 4C2MH 4DR4L 4X66L 3HOZH 2VUMH 4RMFA 4QIWE 4X65L 4OO1G 1QZHA 2EQSA 2YYZA 5HGQA 4OWWB 3I7FA 1IL2A 3STBC 3STBD 4DAMA 1Q86C 2E2JH 3H3VI 4GKJL 4KLKA 1RIPA 2CQOA 4DR2Q 3HOVG 2H5XA 4JCVE 1C0AA 2KBNA 5JJLA 4BY7H 3M85A 3GTQH 1XMQQ 4DV2Q 1FVIA 4GNXC 4A3EH 4B3ML 1SE8A 3E0EA 4GS3A 1SN8A 3UDIA 1Y1VH 4DK6C 5IP7G 3CXCA 4BY1G 5LMUL 1IXRA 2PQAA 2Y0SG 5BR8L 4DUYQ 1K9MC 3I4NG 2B3GA 3BZCA 1XNRQ 4LFCL 1OXSC 3JAMc 2RHQB 1T9HA 3HOYG 3F1ZA 2VQEQ 2MQHA 3BU2A 3CQZH 4DV1L 3S1RH 4YCUA 3F2DA 1PH8A 3T1HQ 2GN5A 2K4KA 1K0RA 2YU9H 2NZOA 3PIPA 3I4MH 1LYLA 2I5HA 3K7UC 2LXKA 4DKAC 1SLJA 1E1OA 2C35B 1MIUA 1VCIA 2PI2E 3KF8B 4LF8Q 2A1AA 2VUMG 3S16H 1J5EL 1MKHA 3K81C 2EXDA 3EBEA 4R1JA 3PF4A 2R93H 3U50C 1L2FA 2EIFA 3DLLA 1PH7A 2KHJA 1SR3A 1WCMG 4JI6L 1X9NA 1KAWA 5H1SE 4A3EG 4JYAQ 5AJ3Q 3H15A 4LF7Q 2JEAI 4X6AH 4YCVA 1Y1VG 1CKNA 3S2DH 3U58A 5C44G 1CUKA 5GQOA 4PMWA 3H0GH 3RNUA 1N34Q 3S2HH 1L0WA 1X3GA 2RCNA 4GNXA 3AQQA 1V43A 4DR3Q 5GAGC 4BXXH 2YTVA 4OO1I 3AFQA 4JI2Q 3JAMi 1E22A 1IBMQ 1V1QA 4NXNQ 1SMXA 1MJEA 3KJPA 2R7FA 1N36L 1KD1C 3B6YA 1SRUA 3HKZE 2VS1A 1VQJA 1GO3E 3G48A 1HH2P 1OXVA 3PGZA 4JI8L 4DV5L 1WYDA 2NVYH 2WFWA 5GROA 3OW2A 3GTPH 4LFBQ 4JV5L 5M3FH 5IYBH 2OQ0A 1W3SA 2MO1A 4DV3L 4HIOA 3RN2A 1VQOA 1PA6A 1QVFA 4A3DH 1JMCA 2IX0A 4B3SQ 2IX1A 1K3RA 2UXDL 1XMOQ 2OWOA 2F52A 3S1QH 1JT8A 1LUZA 3A74A 4XIGS 3GTJH 3CMEA 2ZTCA 4JI0L 1N32Q 4JBKA 1YITA 3H0GG 4YHHL 4UP7A 4AQYQ 1E1TA 3KF6B 2NVQH 1LTLA 2B29A 5IYDG 2UXCQ 4RG1A 4LFCQ 1CKNB 4BXXG 2NN6G 5IYCH 4IO9A 3UDFA 3KJOA 4DR2L 5GAHC 4NB3A 3J81c 1E3PA 1V9PA 1PH2A 3FP9A 1XMQL 4QY7A 1HNWQ 1L1OB 2PMZE 1YHQA 1X54A 4GN3B 5C3EH 1PV4A 1YZ6A 1IYJB 3HOXG 4DUYL 2YTYA 5IYBG 1G51A 2RF4A 3S24A 4A3DG 3KFUA 4NXMQ 3M4QA 2JA7H 2E8GA 1PH3A 3GO5A 3PF5A 4LF5L 3HFZB 1IBKL 3T1HL 2ALYB 1GD7A 4JC0A 1A0IA 3CPWA 4GN5A 3WWVA 4LF9Q 1I5FA 2BH8A 3HKSA 4LF8L 2JQOA 2BH2A 2R7ZH 4DUZL 1KL9A 1VQCA 5IYCG 3EIVA 2NZHA 4B3TQ 1UE1A 2PI2A 2A19A 1YBYA 2I0QA 3PUVA 1XJVA 1EUJA 1A62A 4R4TA 5M5YH 4AYBG 1WFQA 1Y1WG 2JEBI 4LF7L 4IPDA 3MXNB 3GTMH 5EAYA 1FL0A 3CPFA 2K14A 4H02A 1N34L 1IBLQ 1VQ6A 3ERSX 5GADC 4DR3L 3PSIA 4A3IG 3PUWA 2JA6H 4AH6A 4JI2L 1K83H 1VQHA 2NN6I 2WAQE 1IBML 4JG2A 2Q2HA 3I2ZA 2UUAQ 3L7ZC 3CCLA 1BVSA 1PVOA 2ID0A 5J3BA 2WP8J 2HQLA 2N49A 3OTOQ 3KDFB 1D8LA 3GTKH 2QGQA 3I4OA 4KHZA 3TQYA 4EX5A 1TWAH 2ZM6Q 2R7ZG 4DV0Q 4LFBL 1PH6A 4R4IA 1GM5A 1FJGL 2HHHL 4B3SL 4A3BH 4BBSH 1XMOL 2Z0SA 2UU9Q 4LWCA 1VQMA 1N32L 3T1YQ 3G71A 1Q81C 4AQYL 3PUZA 4P75A 1Q1BA 4KHPL 5C4JH 4B3RQ 1H95A 1EIFA 2UUBQ 2B63H 2UXCL 5C4XH 1KXLA 3HOZG 4YWMA 1YIJA 4DR7Q 1HNXL 4C3IH 3W1BA 5FJ8H 3A0JA 1YNXA 3K7AH 3OYYA 1Q1EA 1KRTA 4IPHA 4JI5Q 1WOCA 1U5KA 4IPCA 3TS2A 2ASBA 1G291 3ULPA 4BY7G 1VQPA 4UPAA 2CWAA 2R7DA 1HNWL 1E24A
chains in the Genus database with same CATH superfamily
5JVLA 1VKZA 4X62Q 1J6QA 2XCLA 3D4RA 3R93A 5IWAL 2EJFC 2Z6KC 4IUUA 4PZ7A 2NYZD 5KFQA 3FKIA 4ECRA 1MI2A 4POGA 3C2PA 2KCTA 1GVPA 4RUCA 2OQKA 3TRZA 1PRTD 1E7ZA 1K8MA 3I4MG 4EFEA 3X3NA 1HJPA 2A73B 3CCVA 3MR5A 4Q8FA 4LF9L 2J7ZA 5L1IA 5M5YB 2LSSA 5FO9B 2F0KA 2EYFA 4LMYA 4DV0H 1SROA 4JI1Q 2F0NA 4X64H 2RA4A 5JJIA 2YZMA 3W5OA 3H3VC 3C0FB 5KFRA 4EYIB 4HMIA 4JBWA 4DV4L 4GLVB 5CA1F 4X65Q 1EYGA 5LL6X 2JA9A 1TWCH 3RGXA 1NBWA 1G6ZA 1IBLL 1JWSD 1LABA 4A75A 1Z2PX 4JI7H 2JN4A 1N33H 4K6DA 3RMHA 4G7OC 1AUVA 2AKWB 2Z6KA 3KLSA 2L0CA 4GNXB 3MFGA 3OIQA 4RGOS 2HT1A 4KN7C 3K5HA 2VPSA 2LXJA 3GTGA 4LF5H 4DV2L 3OTOL 5KFSA 5TSSA 4GN4B 4A3LH 4DR1H 2MFIA 2E2IA 4ALPA 2W9BA 1RK6A 4WORA 1T5XD 1F2YA 2HIVA 2B63B 4BA2I 1GUTA 2K50A 3K0XA 3L4KA 4IR1A 1XNQH 4KKSA 4RGMA 3VR2A 2R3ZA 4E6IA 4UCSA 2SNSA 1O7LA 4IQZA 2NU8B 3RB6A 3M9NB 1PFBA 4J9MA 1SEBD 3HP3A 1MD2D 2FLPA 4CJ0B 2B2UC 1F2MA 1SXTA 5M3MG 3AEVA 3PO3G 2DJGC 4A3FH 3HG9A 3HOUB 3BQ2A 2E5LQ 1KLUD 5JJKA 4JI5L 2DNEA 3K5IA 3PO2H 3URYA 3A8JE 2D2CC 3KAKA 1JJGA 1I7LA 4HEDA 1BBWA 5AJ3L 3GD7A 3CD6A 2I46A 5C3EG 5ELEA 2M00A 3G6VA 1WI5A 2WAQB 4ZK9B 5LMUH 3RJ0A 3T16A 1STEA 1EUCB 3GTLH 3K5OA 4JI3L 2ZJQA 1NE3A 2K01A 4LUZA 4HIKA 1I3QH 2BE5C 2BE5D 5HBRB 2L15A 4BY1H 1Q8IA 5EPJA 3T53B 2OTLA 4C56C 3MWYW 3I4NH 1N48A 5FLMG 1PYSB 5KFZA 2PN1A 3MFHA 1A6XA 1NMFA 3Q24A 1B6SA 4C3JH 1Z2OX 3M4OH 1TWCB 4KHPH 1EQRA 2F0OA 3FKIH 5C0XH 2DIKA 1Y1WA 4DV6L 2XC9A 1H9JA 4KV6A 1HNZQ 1FGUA 2ZTDA 4H7BA 3OMGA 2NTTA 4GKKL 2V1CC 2B2YC 1GKHA 3VYSA 4XYLB 1LTBD 2BA1A 1SNQA 2C9OA 1LACA 3Q8PB 2YW2A 4HJ5A 4YBZB 3GTOA 2CQYA 2RDJA 1TS2A 3ETHA 4UP9A 2VL6A 3ER0A 2FMAA 2ASLA 4O4LF 1QVCA 1JQYD 1LM0A 4WJ3M 2SDFA 4MZ9A 2PO4A 1PK8A 2I5LX 4DPGA 2BQRA 3KLSX 1AFPA 4XQJA 5CYUA 3H6MA 1KDCA 1XYIA 5IODA 3D8GA 2UUCQ 2K05A 4F4WA 4JV5H 3TBIB 1I94Q 1B9NA 4Q43A 4J9PA 2XSCA 3GV6A 3GV8B 2HCCA 4GLAC 2W9CA 5KNBA 4DUZQ 4CKBA 2UXDH 1X65A 1KAAA 3P20A 3GTGH 3PO2B 3DF7A 3QZ7A 1CTMA 5KFOA 4QWEA 4IRKA 3H40A 2B63G 3RGZA 1N8RC 4JI0H 1PLFA 1AE2A 4OX9L 2E2IH 5F9NA 1OXUA 1WSCA 4JUZA 3BDCA 4A3CH 1QUQA 3BZKA 4JI4L 1TS3A 3ORRA 5J2UF 2HGSA 1I3QB 1MJCA 3SVMA 4DR2H 1GSHA 4KY6A 4BY1B 2F4VQ 3HOUG 3L2PA 3H3VH 4K5XA 3MWDA 1P8LA 3EFXD 3I4NB 4O3OA 3P7JA 1Z6HA 2NU9B 4DGZA 2RBMA 5LL6b 4DUYH 4PZ8A 1JE5A 4DK3C 3M4OB 1MHWC 3RBEA 3PW2A 2AU0A 5D3IB 3U4ZA 3KOJA 1R4QB 2R93A 4EGQA 2NB0A 3VA7A 3LGJA 2F0DA 2FFKB 4LFCQ 2IBKA 2WAQG 1BOSA 2K5DA 2KENA 1BXTA 1T3NA 4G57A 4IFDI 2I5MX 1ENAA 1TAEA 1BNZA 1XPRA 1TIID 3ULLA 4DV1Q 1GUOA 2VNUD 1SCUB 2FPIB 3NUCA 1ILPA 1WD0A 5C0XI 5JQWA 3H4DA 4MTEA 5K36G 3NXWA 1VQ9A 3AYHB 2CZGA 3VR4A 2UU9L 4K8JA 2P0AA 4DA2A 4YCWA 1PHJA 1CQVA 5L9XA 2NUCA 3EYYA 1PZKD 1Q8KA 1S3OA 2UUBL 4QCLA 3ULJA 1HQRD 4JV2A 2OCEA 5JUMA 1WR2A 1K1SA 1Y1WH 3S1RB 5IGBA 5KT3A 1TY0A 5IWAQ 3EPGA 3RLFA 1TY2A 1ZXTA 1IBMH 1KABA 4IFDJ 3KBGA 2L9HA 5DEHA 1Y69U 2FB9A 5C0XJ 1KC8C 3I8ZA 3GTOH 4LK1C 3L0OA 2AMCB 3RTXA 4Y52H 4LJZC 1IHZA 2K32A 2QILA 3CCQA 1YI2A 2SEBD 1YJNA 3OW7A 5IOCA 4ECWA 1H9MA 1NUCA 1S5FD 3FPUB 5LL6S 3T51B 3UI2A 5FPRA 3R5XA 4B9WA 4DV4Q 1RL2A 2K5HA 4YY3L 4AQYH 1EYAA 2WB1A 1KC7A 1HA6A 1DXMA 1Q82C 4YB8B 4EYHB 4FO2A 3PO2G 2D0OA 4ZYSA 1DYQA 5KFTA 4DR4L 2DY7A 4MIUA 3E5NA 2LKVA 5HGQA 1QZHA 3H3VI 3RAXA 3KTMA 1PXUA 4A3DB 4ZUIA 1SAPA 3GV3A 2YRWA 4DV2Q 1FVIA 4A3EH 1STBA 2C00A 5KFMA 1KJ8A 3CXCA 4BY1G 4UFZA 4RU9A 2R7ZA 2PQAA 1FR3A 2EY6A 4OIKA 4K2KA 3I4NG 2B3GA 2D9UA 3P1HA 4CDCC 4R8UA 2E2DC 1M7JA 2RSNA 2X6LA 4LF6H 4YCUA 5E1FA 2XN9C 2GPWA 1E1OA 4LF8Q 1Y1WB 4U6PA 2F0VA 2A1AA 2VUMG 2EXDA 3EBEA 4R1JA 2R93H 4O3RA 3TN2A 3N52A 3I90A 5ISRA 4RNMA 1PH7A 4K5WA 1IL8A 4PMBA 3K58A 3OOCA 5AJ3Q 2R6FA 4LF7Q 3S2DH 4UCTA 3GTOB 1AW7A 1TVXA 3RNUA 5KG0A 1N34Q 1JOOA 4EEYA 4DR3Q 5JJZA 2KJXA 2F0HA 4BXXH 4ETSA 2PQEA 3D6CA 3AFQA 3Q8QB 5FKAC 2R7KA 5KFEA 4ECXA 1EZ6A 2M2LA 2ZM6H 4IHJF 1SRUA 3HKZE 1TQOA 3V96A 1XNRH 4DV5L 2GA4B 4ZQIA 3GIDA 1L0YB 1F9SA 3BYYB 1RHPA 2EYLA 1JMCA 2IX0A 2IX1A 2W9CB 1KTKA 1TS4A 2PZWA 1XMOQ 3BDOA 2F52A 2W71A 1HUNA 3FRPB 1AN8A 5T1GA 1N32Q 4MV6A 4JBKA 1ILQA 4CJ2C 3PW5A 4IALA 1F2ZA 1JWMD 1FNVA 4F88A 1CQJB 3TZUA 5IYZF 4X62H 3QO2A 1XMQL 3HS0C 2PYKA 1MGSA 3N6XA 2AUJD 1YHQA 3JSLA 2NVXA 4GN3B 4KD3A 4S3SA 5KYLA 2F0PA 4A3DG 4DL2A 4NXMQ 1ESFA 5KFXA 2R93B 3PF5A 5KT2A 3KUPA 3HFZB 2R84A 3CPWA 1RJPA 2IW3A 3U9SA 2W8LA 3WWVA 2XGQA 2BH8A 2FK3A 2R7ZH 3S2DB 1EY9A 3E3XA 2NZHA 4B3TQ 2I0QA 3PUVA 3J7YW 1A3TA 1AEXA 2WKCA 3NPPA 4ILWA 1Y1WG 1B44D 2HVRA 4BBRB 3MXNB 3VR3A 3CPFA 2K14A 3IFTA 4H02A 3BVMA 2W6OA 2M9VA 3PSIA 3PUWA 3QFFA 3SE0A 1EU3A 5KX5F 4JI2L 2WDTA 2FMCA 1VQHA 5EKIA 2NN6I 3GLKA 2W8KA 3QOJA 3M9OB 1CFMA 4V190 3ITPA 3CCLA 1UC8A 5JAVA 5FLXL 2WP8J 1M8AA 1BNCA 4XXEA 2AGQA 4DV0Q 5FPOA 3C1EA 1XDNA 3KHLA 1AN7A 1FJGL 2HHHL 5G3LF 4A3BH 5D14A 2UU9Q 2Z0SA 4O2BF 4MV3A 4ZRZA 3T1YQ 5KFNA 4RB0A 2YZNA 2AQ1B 4ECQA 4MV1A 5C4JH 1E2WA 2E5LH 2UUBQ 2UXCL 2WB1B 5C4XH 1KXLA 1SBBB 1O75A 4YWMA 4B08A 5KNCA 4MA0A 3W1BA 1NCVA 3A0JA 1YNXA 2QDLA 3L3OC 5E3FA 1KRTA 2IL8A 3TS2A 2EE1A 3ULPA 1EL0A 1G91A 3J80L 2KVMA 4UPAA 2R7DA 1HNWL 2ZJTA 1M4VA 1E24A 1PMRA 2W70A 1Z47A 1ZQ7A 5CR3A 5KT4A 1W2BA 1TWGB 2ZJRA 5LMNQ 2L11A 1HZAA 2SNMA 2B2VC 4F87A 2B2TC 2CQAA 2PQAB 1CA6A 2LMCB 4DR6L 4RNNA 1NTGA 2VQFL 1QZGA 4MTKA 4IJHA 2K75A 4YQWA 2HUGA 4EGVA 4L5SA 2E2HB 2FKLA 1E4GT 1W96A 1B3QA 2NVXH 3Q0AA 2O4XA 4OWTB 4GKJQ 2R93G 3H94A 3M9MB 5KFLA 1HNZH 3GP7A 3E5SA 4KD4A 3DMUA 4O4HF 5J2TF 2W7PA 5E7NA 5DG9A 3PVXA 2EXZA 2R8KA 3UE0A 4N9PA 3Q1KA 1TR5A 2K5WA 1PH5A 1RK5A 1K73C 1MZBA 4RAUC 3SK4A 4G7ZC 1H9SA 4A93B 3S1NH 3HXLA 3PO3H 5M3MH 1EZ1A 4LMQD 2Y0SE 5I47A 2IHFA 4RHSA 3MJFA 1MSHA 2Z6BA 1QILA 4BBRG 2XIWA 2PMZB 3E9IA 2B2VA 2UUAL 2C5CA 4DL3A 3K8AA 3OMCA 3DM1A 4HIDA 4A3BB 2B2TA 1A63A 3FDTA 5KFVA 2WAQA 1C8CA 1D5ZC 1WVLA 3VPBA 4JOIC 2UUCH 1L0XB 1I94H 4ME3A 1PYBA 2XGTA 4DR5Q 5C4JB 1VQLA 1SNCA 1XPOA 3V4ZA 3JZIA 5C4XB 1VQIA 3J80E 5FLXc 2VQEL 2CH4W 2ICEC 2K04A 4K0KQ 2ALZA 3KBXA 1CS0A 3E0JA 1QNKA 2KHSA 1GUWA 2IWHA 3RF2A 4EBEA 3P75A 5FLMH 3BS1A 1GLVA 4DL6A 3CCSA 4B3RL 5CORA 2Q8TA 4DR7L 5CBEE 1NY4A 1DV2A 5DQHA 3TDQA 4U7CA 2JEFA 4DV7H 4HTHA 1Y14B 4UP8A 1HA5A 4OWXB 2I80A 4X66H 2F4VH 4JYAL 4YR2A 3OSNA 2WB1G 1IKMA 3A7LA 4OO1H 1GJXA 4XQNA 3MXUA 5K5PA 4WFN3 3D4DA 1AZPA 2P5ZX 2UXBL 1EEID 4B3MH 1PH1A 3WO0A 2MGSA 3CKIB 2NVXB 3SI8A 4JOIA 3J80c 4L5QA 2KEDA 4O42A 1S10A 4DV5Q 4LF4Q 4FP5D 5IGDA 4LFCH 2OXPA 3CW2C 4NPSA 2JA8B 3QWNA 3S17H 3OHXC 4NXNL 1IYUA 4UY8C 3KAJA 1HNXQ 3OUUA 1YEZA 1TWFB 1HR0Q 4DV1H 1UWVA 3TEHB 3N44B 3OHAA 1TKWB 2VB2X 4DFAA 1VQ4A 1VS0A 3M3YH 2OTJA 1QVGA 4M9UA 3F8TA 2YRXA 3CF5A 4RHRA 3S1NB 3R23A 1YNJD 1U4RA 4DXGA 3PO3B 2W9AA 3M9BA 3BJYA 1OXXK 3ONAB 5ELCA 2K6AA 4XT3B 4L63B 4TV8F 4JI6H 1I4HA 4FYDA 1FNWA 1XWEA 1EQQA 3HOWB 3A5ZB 4LFAL 2IMWP 3N41B 3FVQA 5C3WA 3J7A5 2R8IA 3HZXA 2WYOA 1IOVA 1X32A 5C44H 1SEIA 3GDEA 1V1PA 1X3FA 5T1IA 3J80i 1UNSA 2O2LD 3F2BA 3MFIA 4A93G 4Z9CB 2W6PA 3QG1A 3BABA 1VMPA 3HOUH 4I4TF 4P74A 2GLTA 1D5XC 1STNA 3MEFA 1X55A 1XTDA 1VBGA 4JI8H 5LMNW 4Y7NB 4A3BG 5I6YA 1ASYA 3X3MA 1DZ1A 4NDXA 1ZYRC 1ZYRD 3O13A 2R7LA 3BA9A 1PFSA 2IJ0A 4FF4A 1HFNA 2VUMA 4NLGA 2K1BA 2QF7A 4AYBE 4OONA 1ASZA 3UDGA 1LTRD 2NWGA 5C4XG 3UQ8A 3GTQA 3TIGA 3VYTA 3M7GA 4YHHH 1CI3M 4O2DA 4WD3A 2KSWA 2OLSA 4LUOA 1EY0A 1STHA 5K36H 4I7HA 2CH4A 4LUVA 4HJAA 5IYDH 1UEAB 4Q5VA 2IPKD 5DLFA 1EY5A 3S17B 2K5NA 3HEJA 3TINA 3OIPA 4G3IA 2RHSB 2FE3A 3JAML 4YJ3F 2OEOA 3HOYB 4J15A 5JPMC 3M3YB 2KEEA 5GONF 1SMYC 1SMYD 1MBYA 1GYFA 1L2ZA 5BR8Q 2RDIA 2EJGC 4P71A 4JK1C 4QL5A 4LW1A 1NJIC 4ME6A 5BN4A 1FJGQ 2RDFA 2HHHQ 5IT9c 3CU7A 5L1JA 1NAPA 3CCJA 5C8YF 3F2CA 1SYEA 4ECZA 4R8IA 4A3KG 1XX8A 3IKJA 1Z2NX 2JA8G 4LF8H 4U673 4EVOA 5KFGA 1F9RA 5GAEC 3FHWA 1HTLD 4X64L 3RB0A 1J5EQ 2DZDA 5C44B 2R8GA 3DEPA 5A2QL 2XWBB 4R4QA 4LF7H 5G3LD 2MPMA 2A69C 2A69D 3PW4A 3DM3A 1N34H 1OXTA 4GOPB 2DPIA 1H9SB 4JI7L 1N33L 2YU9B 3W3AA 2CW8A 4DR3H 3I3CA 2B8GA 2FLLA 1YJ9A 1E2VA 2PZUA 3HOWG 2Z1CA 2IX3A 3Q8RB 2CKZB 4F4ZA 4UDUC 4XTCS 3CVZA 3BDLA 3KHGA 1DJRD 4DR6Q 2VQFQ 1YJWA 4FS1A 2F3VA 3MWEA 1JXLA 3NTHA 2NBFA 2XGPA 2JJQA 4YP3A 2MP1A 4BS9A 4K5VA 4DR1L 1S72A 1N36Q 3UE1A 5J39A 1GUSA 1KNAA 1LTTD 1SYGA 2LFNA 3QR8A 4FXGC 5ELFA 2MUYA 1XNQL 4MV4A 4LSAA 4DV3Q 4POFA 3V6JA 1XMOH 1S5ED 2XWJB 2CWPA 3WOFA 1HR0W 1N32H 1HQMC 2EYPA 1RTOA 3K5NA 4UHVA 2JSOA 2O5JC 3J81i 1K0SA 1SE3A 4M7EA 5KT7A 1EFID 1Y8PB 1JIHA 1TA8A 5KFPA 2A8VA 2VUMH 4RMFA 4UCUA 4OO1G 2EQSA 3I7FA 3AMUA 4KLKA 2A6EC 2A6ED 4I50F 4JCVE 2KBNA 3GTQH 2HJWA 1S97A 3WNZA 4GS3A 1SN8A 4DK6C 1ENFA 5LMUL 1BCPF 1RYRA 2K03A 1WTQA 2JEJA 4NXMH 2NVQB 5KG5A 1OXSC 3JAMc 1T9HA 3HOYG 1K28A 4ZUJA 2VQEQ 1G2TA 3S1RH 3BVZA 3F2DA 5IIFA 3T1HQ 2XRSD 1GHJA 2GN5A 4OEMB 1PH8A 3ERQA 5FK9C 4TV9F 1LYLA 2DWCA 4PDBA 1STAA 3K7UC 2LXKA 4P2CB 4DKAC 1SLJA 2PI2E 4B3TH 5EBCA 1V8QA 3S16H 3N40P 4EBDA 2JA6A 3DUZA 4IRDA 3U50C 1L2FA 1KBLA 2FPGB 4HCSA 2KHJA 1B6RA 5DGAA 2XCAA 2XVSA 1KAWA 3L9AX 3MWMA 4JYAQ 2RSOA 3BYTB 2V9WA 5COYA 4X6AH 3LWUA 4N8FA 4O4IF 2MJ8A 3GTKA 5C44G 4O2AF 2WE6A 1HHVA 4OIJA 4GC7A 3BQ0A 2UVWA 2RCNA 1U4MA 3M4IA 2VPQA 1DOKA 5GAGC 3QIAA 4WJWA 5DAUA 1V1PB 3HB9A 4IUNA 5F2DA 4KK7A 3JAMi 1E22A 1B33N 3GV5B 1PFMA 4NXNQ 1S68A 2IP4A 5D1PA 5H80A 3KLRA 1MJEA 1TT2A 1DV1A 2W6NA 2R7FA 1YNNC 1YNND 2CW0C 2CW0D 3SXHA 3EA6A 2VS1A 1KD1C 1VQJA 3BG5A 1GO3E 3G48A 2BQUA 2OF1A 2ASDA 4K6LA 3GTMB 1VF7A 2HQEA 2WFWA 3NHHA 4JV5L 3SEBA 4LFBQ 2JEGA 4HIOA 1B1ZA 5ELDA 2H1EA 4A3DH 4B3SQ 1RJTA 3T1YH 2UXDL 2VUMB 2OWOA 2F0WA 2XRQD 4CKCA 1LUZA 3A74A 4XIGS 4I7ZC 4JI0L 3G6YA 1BQQT 2PZTA 3NTKA 4HCEA 3GTQB 3TP6A 1IKLA 2B29A 5IYDG 1NR4A 4G4KA 5KFUA 3UFXB 3Q23A 4WBNF 4G7HC 1SFOA 4IO9A 2F3WA 3KJOA 4FNFA 3MXNA 5GAHC 4DR2L 4NB3A 1D5MC 2O03A 1JE4A 1ZHQA 4QY7A 5JEAH 5EQ0A 1CM9A 5LMNH 4NW2A 3G6XA 2QK4A 1PV4A 3NE5B 4L1KA 2EOTA 4DUYL 1ICWA 1PTOF 5EOYA 5IYBG 1G51A 3GIPA 2YL2A 3S16B 2JA7H 1PH3A 2FK1A 3MXGA 2KCNA 2YS7A 3VPCA 1IBKL 1LTAD 3LNNA 1KJ9A 4JC0A 1GD7A 1EOTA 2AUKA 1T36A 4GN5A 3TP7A 4LF9Q 4GKJH 1M6VA 3HKSA 2L4NA 3L4JA 3H09A 2F0EA 4F4YA 4HYKA 3VR6A 2R7NA 2CVRA 2VXWA 5EWGA 1VQCA 1JORA 2DPJA 4DK0A 4XYQA 2R8JA 3V4SA 5CV7A 1UE1A 1C48A 1QCBD 5AFWA 1F77A 2E75C 1EU4A 1EUJA 1A62A 1FGBD 4R4TA 2FK2A 2JEBI 4EQPA 2WV6D 4K14A 4RWSC 1FL0A 5KFKA 3G7LA 1IBLQ 1KDAA 4IZ8A 3K57A 4RB3C 2JA6H 3H91A 2L12A 2FHTA 3NBIA 4A3MB 4J6HA 2W6QA 1IBML 4JG2A 2Q2HA 3I2ZA 3L7ZC 3BZDB 4C5AA 1LO5D 2R8HA 5J3BA 3T13A 1DOMA 1TWGA 3OTOQ 1D8LA 3GTKH 4DR5H 3I4OA 4KHZA 4NP5A 4EX5A 4Q0FA 3I72A 3GIIA 4ED2A 4R4IA 4K0KH 3DWAA 4ABNA 4YR3A 4ZI7F 2E2HA 2W6MA 5C4ZA 3RUZA 1I50A 3MTSA 1VQMA 2KA7A 1ET9A 4AQYL 2FP4B 1Q1BA 3JRXA 1S0OA 3KXYT 1OWTA 1Y8OB 4CDEC 2KECA 4IUVA 4DAPA 5J1ZA 5BMVF 2RDGA 4EFBA 1Q1EA 4HMJA 4IPHA 4JI5Q 2J9GA 3VPDA 1U5KA 4H44C 4EEQA 2Y0SA 2J6TA 1VQPA 2JA7B 4HNUA 1I4XA 5KG6A 2E76C 1DOLA 4L5TA 3VA5A 5CAEB 1BBXC 4EQOA 4BA1I 4LF4H 2PMZA 4PNYA 2N55A 4JI3Q 1SFOH 1HNXH 1CT1D 1WD1A 1VQ5A 2SCUB 3HKZB 4BBRH 1HR0H 3NSWA 4DL4A 1KIXA 2FJ2A 2PCFB 5L1KA 1ULZA 3MC0B 3Q6SA 2BDOA 4LF6L 1RD9D 2PPBC 4KY7A 1WCMA 2YTXA 4YWKA 1BBUA 1GSOA 5FJ8G 3N42B 2LS01 4QW9A 4DV6Q 1SJHD 1X3QA 1N9WA 2BR0A 1AE3A 3CMAA 4A2AA 4ZLTF 2JA6B 4UCOA 5HURA 2W6ZA 4GKKQ 4DF7A 1SYCA 4RKBA 3M7NA 2A6HC 2A6HD 2YYAA 5KFAA 2Q8RE 1I7NA 2JYOA 4XQQA 1FKAH 1STYA 1Q46A 3GTKB 3CCMA 3GIQA 4X3SA 4PV1C 4EGJA 2DY8A 3RR5A 1JJCB 2F3IA 4KY5A 3F2UA 1HZCA 3A8IE 4TRDA 3QJYA 2R85A 3I55A 1JKJB 4HSPA 4JW0A 2QA4A 1EHIA 1W6JA 2K52A 2ZM6L 1STGA 2JE6I 4UCRA 4A3MG 5D1OB 2V58A 1NMGA 4J9SA 1XNRL 4OXPA 2D62A 5LYJF 5KT6A 3FMCA 3H20A 2C2EA 1LT3D 4HJ8A 1TWFA 1RJQA 1BCPC 1BCPD 1JJ2A 1EWIA 3ORQA 5FD6A 4C3HH 1WTXA 3TREA 1TWGH 4L5RC 4LSXA 2ZDQA 4JI1H 4ED6A 3RUPA 4OX9Q 3WOEA 5KT5A 4A4IA 1SNPA 3BJUA 2FJZA 4CC5A 5KFDA 3U4VA 3A8KE 3IN5A 3WO1A 3GV7B 4J9NA 2KCCA 3S14H 4JI4Q 4X65H 4FDBA 3PIO3 4RNOA 1R9TA 3PZPA 2E2HH 1SFOB 5JEAG 5JPNC 1I50H 3MHBA 1Q7YC 1KNEA 5C1PA 4X62L 1LTSD 3PW0A 4GLXA 4HJ7A 5ELNA 3FPPA 1K8GA 5HGTA 3T56B 2QYZA 3HOVH 2XNAC 1QE6A 1CQFA 3EVQA 5BR8H 2JA7G 3KK7A 3R5HA 4XYMB 4O3SA 3CC2A 1TWHA 2EYMA 4QGUA 3KLWA 2VW9A 4A76A 1JX4A 4TVAB 3TP8A 1WH2A 3J7AF 1CQIB 1HXYD 2GVAA 5KEEA 3MAQA 5HV6A 4A93H 1BF4A 3I12A 2F0TA 4IOCA 3A56A 3CCRA 1SJED 5A35A 2UXDQ 2AHOB 3PV0A 5M5WH 1NSNS 1C3OA 2WIIB 3HKZG 3S9WA 5ELOA 1BDOA 5JVH3 4JI0Q 3C3LA 2IHEA 5KKNB 4J1MA 1J5EH 4ED8A 4IRCA 1E2ZA 2BCOA 4ZKCB 1JLLB 4RA8A 1YHAA 1M1KC 1WJJA 1PDQA 4RZQA 3PMFA 3MA2B 1HUMA 1EOVA 1U9RA 1WCMH 5J22A 2FPPB 5IGEA 1CKMA 2Z4IA 4V0BA 2JA6G 4BBSG 3DWPA 2EY1A 1I6VC 3JRWA 5KRUA 5EWFA 1L1OC 3J7AV 2AWNA 4GOPC 1I4RA 5I4DA 2AWOA 1ICFB 4FXKC 4YR0A 1I6HH 4C3HB 1N36H 1C7YA 4FF2A 4AIMA 2JA5G 4P72A 1IBKQ 4ZOLF 4TQRA 3K5MA 2K7VA 4QUCA 1JB7A 4OGQC 4Q8EA 5CGKA 4FBTA 1VQDA 1CKOA 1T5EA 1JICA 2HCIA 4DV3H 1TXYA 3E6ZX 1YHBA 2VY3A 4KI0A 4C2MA 2PBZA 2BQ3A 5DLQE 1PTOC 1PTOD 4R4OA 3S14B 3EROA 4Q0YA 2KHIA 2WB1E 1QJOA 2NVTH 2HVSA 2IA6A 1I50B 1EZ8A 4C1NI 3KF6A 3EN2A 1CZWA 2BA0A 4A3KH 4YY3Q 3S15H 2E5LL 4ECSA 5CV6A 1OTCA 2JA8H 3DWQA 3HOVB 1O7YA 1RF2D 1EYZA 2RQXA 4ED0A 1YVCA 2R86A 4RGTA 1TWFH 1R4PB 1RTNA 5FLXE 5D65A 5KG1A 2EYOA 4DR4Q 4C1NK 2J4XA 3PUYA 3VDYA 1B04A 1LTGD 5IP9G 1X56A 5EDWA 2Y0SB 1L1OA 5BPHA 5IY0A 4MA5A 1Z9FA 4GOPA 3RZOB 5C1OA 2YU9A 5HY6A 5CV5A 5C4HA 1EFWA 5CV9A 4WJ4A 3IG0A 3U9OA 5M5WB 1RDPD 5KYIA 1NR2A 3W2DA 2CFMA 5CV8A 3EJIA 3HOXH 1R9TH 4Q45A 1LT6D 4EQ5A 1G6PA 2ICIA 2K33A 2VQDA 3ETJA 3HOWH 2K5QA 3CAMA 3T1HH 2AQ4A 1SE2A 2MO0A 1UE5A 4EG0A 5KFBA 5I2XA 4B9XA 1S5CD 4RB1A 3D0FA 2EYHA 3ZJYC 4DAVA 2RCFA 4FBUA 4ECUA 3K0YA 1WCMB 2K5VA 2R82A 5CB4F 4DUZH 3BA8A 1WTOA 1TWHH 4HNVA 1HNZL 1A15A 1Y1VB 4ECTA 4IPGA 5KGUA 1K3BC 3R2TA 4DU9A 1XTCD 1HZBA 1WTPA 3PR4A 4JPBW 4Y7NH 3PIOA 2AGOA 1I6HB 1WTRA 1VQ8A 5CV4A 1EUDB 1KQSA 2WKDA 1HPCA 4CJ1B 1JOKA 1J9OA 3ND8A 3RBDA 4HN7A 2HDLA 2EJMA 3VMMA 3OSPA 3WDNA 2Z4HA 3N6RA 3LMLA 2VZAA 1E4EA 3T4AC 1KRSA 2IT1A 3AFPA 3KDFA 3TQTA 3A5UA 2NVTB 3NENA 5DM73 2UUCL 5IT9L 4LF6Q 2XTIA 3R5FA 3TQ1A 4LFBH 1I94L 3NTIA 4A3KB 1M90C 3S15B 3D31A 4XYOA 4B3SH 4C3HG 3AU7A 1Q3LA 4QJFA 1PZJD 3J81j 2QEXA 3Q8DA 1VDZA 1B8AA 3IFDA 1A3UA 2EDGA 3HOYH 4RFBA 2ATWA 4H13C 3CCEA 1S4ZA 3AB9A 1C30A 2EZVA 3S1MH 4IURA 1VQEA 3D3RA 4KTAA 4ODGA 4P73A 3J81L 1AH9A 3N8DA 1SDFA 1CHQD 2X0SA 2R87A 2EY2A 4OHJA 4DV7L 4E4TA 4C2MH 2V59A 4X66L 4QIWE 2YYZA 2F4VL 1R9TB 3HOXB 1EY7A 2F4IA 4DAMA 5BN3A 3HOVG 5KFYA 2H5XA 4BY7H 3M85A 1JB3A 1I4PA 1XMQQ 5IWAH 5I6WA 4B3ML 1SE8A 3E0EA 4ED3A 2NTSA 3MR2A 1IXRA 2Y0SG 2MHVA 2ZXRA 1K9MC 1CK1A 1EWCA 3BZCA 3DEOA 4LFCL 1XNRQ 2G9HD 2C2RA 1TWHB 4LH7A 1O78A 3LX0A 1IW7C 1IW7D 4LF9H 2FMMA 4DV1L 3N43B 1ML0D 1KJJA 4X3KA 2K4KA 1K0RA 2YU9H 3PIPA 1BCPB 5E4WC 3GTMA 2I5HA 5JVDF 1SYFA 4X3TA 4AYBB 4OL7A 2C35B 1MIUA 1VCIA 3KF8B 4I55F 4TKOB 2ZXPA 1E4FT 1CZGA 4PMCA 2EPBA 4DV4H 1UAPA 2EIFA 1K83A 3R3OA 1WCMG 5IT9E 4JI6L 1PTOH 3FDSA 3H15A 1IBLH 5E4XA 2JEAI 4YCVA 1Y1VG 2L5TA 1CUKA 1TWAA 4PMWA 1I6UA 4PQXA 3SDZA 5LXTF 4ECYA 4OO1I 4JI2Q 3A7AB 4DV2H 2NUAB 1PRTC 1VMCA 1V1QA 3OTOH 1SMXA 3J81E 3KJPA 1IOWA 1KJIA 1DIKA 4BWSC 3B6YA 4CDDC 1SSOA 1HH2P 1OXVA 2V4DA 4JI8L 4J8QA 4NKLA 5GROA 3S1MB 1UNNC 5DM63 5M3FH 5IYBH 3RN2A 1VQOA 1M0TA 1K8OA 3OHBA 1RODA 1QVFA 5C5JA 4MN3A 4C2MB 4APMA 1K3RA 4IN3A 2A5HA 2UVRA 3CMEA 5C3XA 3K3PA 2QEJC 1H9KA 3H0GG 4YHHL 1T94A 4UP7A 4J9OA 2NVQH 1U4PA 3HRZC 1LTLA 3KF6B 4BY7B 2UXCQ 4RG1A 1CKNB 4QWAA 4JI5H 4BWGB 5EWEA 1EQVA 4QW8A 4QWBA 3PN1A 3J81c 1V9PA 1PH2A 3FP9A 3RV3A 1HNWQ 2WTFA 1L1OB 2A68C 2A68D 1X54A 1C4QA 4TQSA 4FM9A 4O1NA 5IGFA 4JI3H 3HOXG 3K6OA 3U9TA 2YTYA 2SOBA 2RF4A 5CA0F 3S24A 1TU2B 1JDBB 4DNRB 3GO5A 3TSSA 2F0MA 3K7AB 4RGNA 4LF5L 5DLGA 3F8NA 2V4RA 1A0IA 5CMDA 1EY6A 4WRDA 1PTOB 4LF8L 4DV6H 2BH2A 4MV9A 2RGRA 3C46A 1K1QA 4N9TA 4FVMA 5IYCG 2V4QA 4L6TB 5FOBB 2HVQA 1B2TA 1UC9A 3JAME 2A19A 1YBYA 1XJVA 2L55A 4GKKH 4AYBG 4F8MA 4LF7L 4IPDA 4Q44A 3MZ5A 3GTMH 4F50A 5FO7B 4J9KA 1N34L 3BAAA 1VQ6A 5KFIA 1GSAA 2EY5A 3ERSX 5GADC 1EY4A 4DR3L 4NMZA 4K2LA 4AH6A 4QMGA 2JA7A 2R92A 1K83H 2WAQE 3NK9A 5M3FB 3Q2OA 2B2WC 4DK1A 2UUAQ 1SYXB 3OWFA 1GHKA 1E4EB 1PFNA 1JCKB 5C6AA 2HQLA 2N49A 4IFDH 2NZ1D 3KDFB 3TQYA 1TWAH 5A2QE 1PH6A 3MXPA 2YZGA 3HKZA 2B2UA 2ASJA 1F9QA 3VYUA 1XMOL 5I2YA 1O7ZA 4UAIA 2X69A 1JDEA 3NBHA 3IAYA 3RB3A 2O5IC 3TIIA 4FF1A 1N32L 2CW7A 2GPSA 4C5CA 2NU7B 3G71A 4OX9H 2KOLA 4C5BA 1Q81C 4P75A 4KHPL 3RFCA 4B3RQ 1H95A 5IGGA 4KKTA 5JH7F 5EKLA 4DR7Q 4JI4H 2Z8LA 4C3IH 1EEFD 5FJ8H 4CGYB 3OYYA 3C1FA 1V51A 1D6EC 3TP5A 1WOCA 4LAAA 4YJ2F 1G291 4BY7G 3I70A 4YAJB 2CWAA 2L1BA 4XZ3B 1EIGA 2B2WA 4DXFA 3SE7A 4IUQA 1WTVA 1EY8A 1ZHSA 2UXBQ 4IWYA 1ONLA 2JA5A 5D3DA 3G4SA 2ZDHA 1BKBA 4A3FB 1VBHA 4NXML 4IOAA 2CCZA 4J9QA 2F0GA 2I87A 5D1OA 4YIJA 4K8IA 5FLXW 5EJWA 3V6HA 2B2YA 5M9OA 1SE4A 3CRLC 4HIMA 1UUPA 4A3MH 2UU9H 4B3TL 3K3VA 2A74C 2ENBA 1XPUA 3HBLA 4KJOA 1HCZA 3GTLB 1DONA 4DV7Q 1LTID 1ESRA 3T5LA 4X66Q 2RGVA 1K83B 1S0NA 2E74C 4RKLA 4DNIA 2UUBH 4YWLA 4RAYA 4A3GH 4APVA 4LFAQ 1B4OA 4C3JB 4H0LC 4ZAIA 4B3MQ 1TWAB 1VQGA 1BO0A 1DCZA 2Q2TA 3FKIB 1NNXA 3NELA 1S0MA 5K2MA 2OH2A 1JOQA 1FD7D 2YV5A 2DUDA 1IBKH 4ULLA 3CC4A 4R9WA 3J80W 4GC6A 5EPLA 2F0QA 1QG7A 3PCOB 1LT5D 4DV0L 2Q2IA 1A2UA 5M3FG 3G6JB 2Z9HA 3FEWX 4HNTA 4N8X1 3ND9A 3T5KA 1G8ZD 4DAYA 4A3JH 2WACA 1MSGA 4C3IB 2R92H 2QDBA 2RDHA 4XDXA 1FNUA 4QQBX 3TZDA 2K28A 3T1YL 2N3SA 1RJRA 1ZETA 2C22A 4YY3H 3BQ1A 1N56A 4JI6Q 3K59A 1VQBA 4IUTA 4ED1A 1ZKOA 3JSNA 1AP0A 2F0IA 2QCPX 1HFGA 4TUYF 4DR4H 1LLRD 4O3PA 3KYHC 4PZ6A 1UE7A 1X6OA 3PR5B 4DN4M 4A3LG 2N88A 2JXMB 5LP6F 2YCHA 3RLNA 1EIYB 3GTGB 1A3VA 5LMNL 5C5LA 5NUCA 2DNCA 1PRTB 4J9LA 2E2IB 4ME5A 4XX0B 4BBSH 2W9BB 5DQIA 2ZTEA 4JI8Q 2J6UA 2CHBD 3BG3A 3HGBA 4KHVA 5IP7H 1HZ9A 1UEBA 1EWHA 1DD2A 3V2TA 1O80A 3IRBA 5L37A 1AZQA 4A3FG 3GQBA 1C9OA 1TS5A 2DGYA 2FXQA 4GKJL 2JA5H 4CC6A 3K80C 4MHEA 5LHY1 4RZRA 1JR0D 4A3GB 3GIJA 3T5JA 4YHHQ 3CCUA 1IZ6A 3M4PA 3SK6A 4J0MA 4L8JA 3MFYA 2G9DA 4X64Q 4A2BA 3RZDH 1VAJA 4FF3A 5EKKA 4QWDA 1BR9A 4O0AA 4UCVA 1W93A 1U0LA 2V5AA 4MV8A 4J9RA 1D2BA 4HJ9A 1GOZA 1B3AA 3V05A 2ZJPA 3H4BA 4TQUS 1B70B 2NU6B 4IZOA 4ZKBB 4JI7Q 2F03A 1N33Q 2ES2A 3MR6A 1JC7A 3JC66 4A3JB 3NWTA 4IFDG 2R92B 2KQ3A 4C3JG 3J7AK 5D8DA 5IP9H 5BPFA 2JEIA 3DXJC 4PG3A 4LF5Q 3CC7A 3FKIG 3MEHA 5C0XG 1VQNA 1SNMA 2RVLA 4DR5L 3CP0A 1GGOA 1PYWD 2R7MA 4DR1Q 4DV5H 4IJLA 1S40A 1BUVT 3VR5A 3TMEA 3EPIA 1S9FA 3A54A 3J7ZC 5IT9W 4K0KL 4HR7A 3PQIA 1X3EA 4RCNA 4QUFA 2HIXA 3T5HA 4U68A 1XNQQ 2MNAA 1RKNA 5DG7A 3NEMA 4M1UB 3NBHB 4XT1B 2BDNA 3SGIA 2X6GA 4C3IG 3UDXA 4CKEA 2N8NA 1XXGA 5KG7A 1Y1VA 1EYDA 4JBJA 4O3QA 4ZCKA 4X3UA 3RN5A 3ICEA 3J81W 4M8AA 4R4CA 3RD4A 5JEAJ 4YAKB 4BBSB 1CE8A 3GQCA 2ZXOA 3EQLC 3LWBA 3RIZA 5T14A 2AGPA 2NN6H 1XMQH 3CQZA 3K5LA 1A8VA 1HTPA 4IR9A 3R8BA 4MTDA 5M5XH 2H4OA 2EVBA 1I4QA 2C28A 1VQ7A 4LF4L 5LMUQ 1WTWA 2JA5B 2YS6A 4IUPA 3G6EA 1GUGA 1VQFA 4F7XA 1PX2A 1HNXL 1VQAA 1UE6A 1CSPA 1O7IA 1W6KA 1HR0L 1KHIA 1P16A 1Q12A 4FS2A 1EYCA 5IGCA 2N78A 3RZDB 1GXDC 5ELBA 1B50A 2AQ2B 4A3CG 5IE8A 2D0PA 4DL5A 2UVVA 4MNOA 2KCMA 3H0GA 4KHPQ 3SR1A 4A3EB 2ZDGA 3W1GA 1D7QA 3PUXA 1QUQB 5L1LA 1I4GA 1J8IA 4TSSA 1SYBA 3SHLA 1E0BA 2J6SA 1QB5D 4A3GG 2IY5B 3E9HA 2PW5A 1KLGD 4QIWA 1PH4A 2F0FA 2PNRC 3BVGA 1Q90A 3I56A 1VQKA 4EBCA 4ZQ3A 3RLOA 1A2TA 2VA2A 1PRTF 2NVYA 3GTPA 1S5BD 3D4WA 4Y8VB 2GVBA 4JI2H 1QWYA 2KUMA 2J0TD 1PH9A 1F2LA 4A3IH 5DNFA 3KHRA 3QOLA 4MAMA 4CHTB 2I07B 3SK8A 2W57A 1DM0B 1II3A 1K8AC 2Q2UA 1CSQA 2HD3A 3GTJA 4ID6A 1VF5C 2TMPA 2XD4A 1B7YB 3JAMW 5F9LA 2ATLA 3NGDA 4A3JG 5C5MA 1M0WA 2R92G 2R6GA 3OPOA 1FJGH 1QNUA 2HHHH 2BOSA 2PNHA 4JV5Q 4LNQA 4DAYB 3RZOH 3R2IA 3A55A 1Y8NB 2TSSA 5JOBA 2F0JA 4MTNA 2WINB 4JBMA 4AYBA 3KF8A 4JI1L 5KFCA 3PW7A 2UXCH 2JK8A 1AUXA 4KN4C 1DGSA 3TS0A 1RCVD 5M5XB 1A9XA 1B9MA 2B8FA 3HOZH 1BXRA 4KMUC 4X65L 5KG2A 1RYSA 2EYJA 1IL2A 3MR3A 4OWWB 2VB3X 3STBC 1LV9A 3STBD 1Q86C 2E2JH 1HNWH 1RIPA 2CQOA 4DR2Q 5A2QW 4F4XA 1C0AA 5JJLA 4GZYC 4GNXC 1V4YA 3UDIA 1Y1VH 5JVG3 5IP7G 5EZYF 4JVZA 5EGTA 4R8NA 5BR8L 4DUYQ 4DR6H 2VQFH 2RHQB 2VUGA 3F1ZA 4EQNA 5DG8A 2MQHA 3BU2A 3CQZH 3GILA 3I4MH 2NZOA 3CRKC 5KFHA 2HDMA 1ENCA 2B39A 1J5EL 1MKHA 3K81C 3PIP3 3PF4A 5CC4A 3G8CA 1KDBA 3DLLA 2M05A 3IL8A 3LWEA 5DGBA 1SR3A 1X9NA 2RKSA 4A3IB 5H1SE 4A3EG 2XCPA 3KHHA 1CKNA 5I9OA 3U58A 1SNOA 3GIKA 5GQOA 3H0GH 3CHBD 4HAEA 2DJFC 2VOBA 3S2HH 1L0WA 1X3GA 2D5DA 4GNXA 3FMAA 4ECVA 3AQQA 2UVUA 3NQTA 1V43A 2UUAH 5KFWA 2R7ZB 1B53A 2YTVA 2FINB 4R8UB 2G5DA 4DLKA 1IBMQ 2QKIC 5EPKA 1N36L 2PW7A 3OUZA 5BN5A 3I91A 2B63A 4MV7A 3PGZA 3RAQA 1WYDA 1D1KA 2NVYH 3OW2A 3GTPH 4DV3L 3M4YA 2OQ0A 1W3SA 2MO1A 1PA6A 4IAJA 2VQEH 1G2SA 2AQ3B 3D6WA 4HR7B 1ZEQX 4DNTB 3HOZB 4RCOA 3QZ8A 3S1QH 1JT8A 3OWEB 4I65A 3GTJH 2F1MA 3I4LA 2E2JB 4CDFC 4QF4A 4B3RH 2ZTCA 5KIXA 3VYRA 1YITA 3ZYYX 4DR7H 4AQYQ 1E1TA 3NP8A 4KKUA 3OSOA 1WTHA 5EBDA 4BXXG 4KJNA 1IYVA 3RB4A 2DLNA 2NN6G 5IYCH 5FD5A 3UDFA 4JYAH 2XIGA 4CBVA 1SNDA 1E3PA 1BJTA 1EQTA 2F0LA 2UXBH 2PMZE 3CQZB 5KNDA 3DHQA 1S03G 1SYDA 5C3EH 3Q22A 3I4MB 1YZ6A 1Z7TA 1IYJB 5I9PA 4ED7A 5CBAE 4QB4A 1D1IA 3KALA 3KFUA 1HRJA 4NXNH 3M4QA 4RUAA 2E8GA 4O3NA 1F9PA 4ZHQF 2VA3A 1PZID 3T1HL 2OT2A 2ALYB 1TWCA 1I5FA 3RV4A 4QWCA 1FYCA 2JQOA 1CA5A 2PVPA 1OO9B 1BGWA 4DUZL 2JP1A 1S5DD 1KL9A 4FXDA 1X3PA 3EIVA 3H0GB 3GIMA 2ZT9C 2W7OA 3S2HB 2PI2A 5KFJA 2R61A 5M5YH 1WFQA 5FO8B 1V1OA 4IWXA 4LFAH 5EAYA 4QIWB 3NQIA 2I8CA 2Q8IB 4PWQA 1LT4D 4A3IG 2F0SA 2NVYB 3NWSA 3GTPB 3LP8A 1CHPD 4HQ6A 5KG3A 4FU0A 1BVSA 1PVOA 4JV0A 2ID0A 2FLNA 3S1QB 1EIHA 3QB3A 2QGQA 3GTJB 2R7ZG 2ZM6Q 5LA6F 4HSVA 3Q8SB 4LFBL 5KG4A 4I7AA 4LH6A 4R7RA 4RAZA 3SK5A 1GM5A 1YNJC 5M3MB 4B3SL 1GUNA 2VR1A 1QOHA 2LY7A 4JV1A 4LWCA 2MCTA 2F0UA 1U4LA 5LOVF 3PUZA 3V6KA 1EIFA 2B63H 2C2DA 2DN8A 3I73A 3HOZG 1YIJA 1JWUD 3GTLA 5C3EB 2QW7A 1H9RA 4RB2C 1ET6A 5DQGA 3K7AH 1I3QA 4OELB 3MVVA 1KEEA 4IPCA 2ASBA 4DL7A 4RH6A 1KJQA 5KFFA
chains in the Genus database with same CATH topology
4X62Q 1J6QA 1Z47A 4L5TA 5IWAL 2Z6KC 4PZ7A 4BA1I 1W2BA 5LMNQ 2ZJRA 2UXBQ 1HZAA 3G4SA 4POGA 1BKBA 4JI3Q 1SFOH 2KCTA 4NXML 4IOAA 2PQAB 1VQ5A 1GVPA 4DR6L 1NTGA 2VQFL 4BBRH 2OQKA 1QZGA 2CCZA 4IJHA 1KIXA 2K75A 3TRZA 1E7ZA 3I4MG 1HJPA 3CCVA 4LF6L 4LF9L 4L5SA 2LSSA 2NVXH 2YTXA 4YWKA 1BBUA 4HIMA 5FJ8G 1SROA 4OWTB 4JI1Q 4GKJQ 4A3MH 2R93G 4B3TL 4DV6Q 5JJIA 1XPUA 1N9WA 3W5OA 1AE3A 3CMAA 5E7NA 4JBWA 3UE0A 4GLVB 4DV4L 4DV7Q 4X66Q 4X65Q 1EYGA 4DNIA 2JA9A 1PH5A 1TWCH 4YWLA 1K73C 3M7NA 4GKKQ 1G6PA 1NBWA 4A3GH 1IBLL 3S1NH 4APVA 4A75A 4LFAQ 3PO3H 5M3MH 1Q46A 2Y0SE 3CCMA 2IHFA 4B3MQ 1VQGA 3RR5A 1JJCB 2AKWB 2Z6KA 3NELA 4BBRG 2F3IA 2Q2TA 4GNXB 1HZCA 3E9IA 2HT1A 2UUAL 3K8AA 2LXJA 2YV5A 2DUDA 3I55A 4HIDA 1A63A 4DV2L 3OTOL 2QA4A 3CC4A 4A3LH 2K52A 4GN4B 4JOIC 2ZM6L 2MFIA 2JE6I 3PCOB 4ALPA 4DV0L 2Q2IA 4A3MG 5M3FG 1NMGA 4ME3A 1PYBA 2XGTA 4DR5Q 4OXPA 1VQLA 2D62A 1XPOA 2HIVA 1XNRL 4BA2I 2K50A 3K0XA 1VQIA 4A3JH 5FLXc 2VQEL 4HJ8A 2R92H 4K0KQ 1JJ2A 1EWIA 4QQBX 4C3HH 3T1YL 2N3SA 3TREA 5FLMH 1TWGH 4L5RC 3CCSA 4B3RL 4JI6Q 3PO3G 3AEVA 5M3MG 1VQBA 4A3FH 4OX9Q 4DR7L 4A4IA 3BJUA 1NY4A 3U4VA 2E5LQ 1Y14B 5JJKA 4JI5L 4UP8A 4OWXB 3S14H 4JI4Q 3PO2H 3KYHC 4FDBA 4PZ6A 2E2HH 1JJGA 1UE7A 5JEAG 4JYAL 1BBWA 5AJ3L 1I50H 1X6OA 2WB1G 3GD7A 3CD6A 1Q7YC 4A3LG 4EQ5A 4X62L 5C3EG 4GLXA 4HJ7A 5ELNA 3RLNA 1K8GA 1EIYB 2UXBL 5LMNL 3HOVH 1WI5A 1PH1A 3GTLH 4JOIA 4JI3L 2ZJQA 1NE3A 2JA7G 4LUZA 3J80c 4L5QA 1I3QH 4HIKA 3CC2A 4DV5Q 2ZTEA 4JI8Q 4QGUA 4LF4Q 2L15A 3CW2C 3KLWA 4NPSA 5IP7H 2VW9A 2OTLA 4BY1H 4NXNL 4A76A 4UY8C 4TVAB 1HNXQ 3I4NH 1YEZA 5FLMG 2GVAA 1PYSB 1HZ9A 1UEBA 1HR0Q 4A93H 1UWVA 3TEHB 3IRBA 1NMFA 4IOCA 3CCRA 4A3FG 4C3JH 2UXDQ 2AHOB 3PV0A 5M5WH 1C9OA 1VQ4A 1VS0A 3M3YH 2OTJA 1QVGA 3M4OH 2DGYA 2FXQA 1EQRA 3FKIH 3F8TA 3HKZG 3K80C 5ELOA 4DV6L 2JA5H 3CF5A 2IHEA 4JI0Q 4YHHQ 3CCUA 1IZ6A 3M4PA 3M9BA 1OXXK 1HNZQ 4X64Q 1FGUA 2ZTDA 3RZDH 4GKKL 2V1CC 1YHAA 1M1KC 1GKHA 1WJJA 2BA1A 4O0AA 1U0LA 3S17H 1EQQA 4HJ5A 3A5ZB 1WCMH 1EOVA 4LFAL 4HJ9A 1CKMA 2ZJPA 2JA6G 3J7A5 4TQUS 4UP9A 4BBSG 1B70B 2VL6A 3ER0A 4JI7Q 5C44H 1N33Q 3GDEA 2ES2A 1QVCA 1L1OC 1X3FA 3J80i 1LM0A 2AWNA 3F2BA 4GOPC 4A93G 4MZ9A 4WJ3M 3JC66 4IFDG 2AWOA 2I5LX 4DPGA 5IP9H 1I6HH 4PG3A 3HOUH 1C7YA 4P74A 3CC7A 3FKIG 4AIMA 5C0XG 4P72A 1IBKQ 3MEFA 1X55A 1XTDA 2JA5G 1VQNA 1JB7A 4DR5L 3CP0A 2UUCQ 5LMNW 4DR1Q 1VQDA 4A3BG 4IJLA 1S40A 1ASYA 1CKOA 1I94Q 3J7ZC 4K0KL 1TXYA 1YHBA 2VY3A 4GLAC 1PFSA 1X3EA 4KI0A 2HIXA 5DLQE 4R4OA 4DUZQ 1XNQQ 2MNAA 1X65A 4AYBE 3GTGH 4OONA 1ASZA 3UDGA 2KHIA 2WB1E 3NEMA 2NVTH 3NBHB 2B63G 1N8RC 5C4XG 1AE2A 4OX9L 3SGIA 3KF6A 2E2IH 3EN2A 2BA0A 3UDXA 4O2DA 1OXUA 4YY3Q 4A3KH 3S15H 2N8NA 2E5LL 4LUOA 1QUQA 1OTCA 2JA8H 4A3CH 3BZKA 4JBJA 4JI4L 1YVCA 4LUVA 3RN5A 4HJAA 3ICEA 1TWFH 5IYDH 4R4CA 5JEAJ 4DR4Q 1MJCA 3VDYA 3PUYA 2K5NA 5IP9G 1X56A 2F4VQ 3HOUG 3L2PA 3H3VH 1L1OA 2RHSB 2F4VL 1P8LA 5IY0A 1Z9FA 4GOPA 1A8VA 5HY6A 1EFWA 4WJ4A 5M5XH 4J15A 4PZ8A 1JE5A 4DK3C 1VQ7A 2CFMA 4LF4L 5LMUQ 3G6EA 1VQFA 5BR8Q 3HOXH 1R9TH 1VQAA 1UE6A 1CSPA 3KOJA 1O7IA 4P71A 4QL5A 4LW1A 3U4ZA 3LGJA 1NJIC 1KHIA 1HR0L 1P16A 1Q12A 2WAQG 3CAMA 2HHHQ 1FJGQ 3HOWH 2KENA 5IT9c 2N78A 4IFDI 2I5MX 2MO0A 1UE5A 3F2CA 3CCJA 1XPRA 4A3KG 3ULLA 4DV1Q 2VNUD 3D0FA 4A3CG 3ZJYC 5IE8A 5C0XI 2JA8G 5K36G 2D0PA 2K5VA 3AYHB 4MNOA 2KCMA 1VQ9A 4KHPQ 1TWHH 2UU9L 4LF5Q 5GAEC 3FHWA 3W1GA 4X64L 3PUXA 1QUQB 4YCWA 1HNZL 1J5EQ 1D7QA 4IPGA 1PHJA 1S3OA 1Q8KA 1HZBA 4R4QA 4A3GG 2IY5B 3E9HA 2UUBL 4Y7NH 3ULJA 1PH4A 3DM3A 2OCEA 3PIOA 3I56A 1VQKA 1Y1WH 1OXTA 1VQ8A 3RLOA 4GOPB 4JI7L 1N33L 1KQSA 5IWAQ 1YJ9A 3RLFA 2GVBA 3HOWG 2CKZB 1PH9A 4IFDJ 4A3IH 4XTCS 2VZAA 1KRSA 4DR6Q 2VQFQ 1K8AC 1YJWA 2Q2UA 1CSQA 2IT1A 3AFPA 3KDFA 5C0XJ 3A5UA 1KC8C 3GTOH 2JJQA 3NENA 2UUCL 1B7YB 3L0OA 2AMCB 2XTIA 4DR1L 1S72A 1N36Q 4LF6Q 3UE1A 4Y52H 4A3JG 1I94L 1M90C 3CCQA 1YI2A 1YJNA 2R6GA 2R92G 3D31A 2PNHA 4JV5Q 1XNQL 4QJFA 3J81j 4DV3Q 4POFA 4LNQA 2QEXA 3Q8DA 4DAYB 1B8AA 3RZOH 2CWPA 3HOYH 2ATWA 1HR0W 4MTNA 4DV4Q 4JBMA 1RL2A 2K5HA 4YY3L 3CCEA 4JI1L 3J81i 1Q82C 3S1MH 2JK8A 1VQEA 1AH9A 4P73A 3PO2G 1DGSA 3TS0A 2D0OA 4DV7L 2A8VA 4C2MH 4DR4L 4X66L 3HOZH 2VUMH 4RMFA 4QIWE 4X65L 4OO1G 1QZHA 2EQSA 2YYZA 5HGQA 4OWWB 3I7FA 1IL2A 3STBC 3STBD 4DAMA 1Q86C 2E2JH 3H3VI 4GKJL 4KLKA 1RIPA 2CQOA 4DR2Q 3HOVG 2H5XA 4JCVE 1C0AA 2KBNA 5JJLA 4BY7H 3M85A 3GTQH 1XMQQ 4DV2Q 1FVIA 4GNXC 4A3EH 4B3ML 1SE8A 3E0EA 4GS3A 1SN8A 3UDIA 1Y1VH 4DK6C 5IP7G 3CXCA 4BY1G 5LMUL 1IXRA 2PQAA 2Y0SG 5BR8L 4DUYQ 1K9MC 3I4NG 2B3GA 3BZCA 1XNRQ 4LFCL 1OXSC 3JAMc 2RHQB 1T9HA 3HOYG 3F1ZA 2VQEQ 2MQHA 3BU2A 3CQZH 4DV1L 3S1RH 4YCUA 3F2DA 1PH8A 3T1HQ 2GN5A 2K4KA 1K0RA 2YU9H 2NZOA 3PIPA 3I4MH 1LYLA 2I5HA 3K7UC 2LXKA 4DKAC 1SLJA 1E1OA 2C35B 1MIUA 1VCIA 2PI2E 3KF8B 4LF8Q 2A1AA 2VUMG 3S16H 1J5EL 1MKHA 3K81C 2EXDA 3EBEA 4R1JA 3PF4A 2R93H 3U50C 1L2FA 2EIFA 3DLLA 1PH7A 2KHJA 1SR3A 1WCMG 4JI6L 1X9NA 1KAWA 5H1SE 4A3EG 4JYAQ 5AJ3Q 3H15A 4LF7Q 2JEAI 4X6AH 4YCVA 1Y1VG 1CKNA 3S2DH 3U58A 5C44G 1CUKA 5GQOA 4PMWA 3H0GH 3RNUA 1N34Q 3S2HH 1L0WA 1X3GA 2RCNA 4GNXA 3AQQA 1V43A 4DR3Q 5GAGC 4BXXH 2YTVA 4OO1I 3AFQA 4JI2Q 3JAMi 1E22A 1IBMQ 1V1QA 4NXNQ 1SMXA 1MJEA 3KJPA 2R7FA 1N36L 1KD1C 3B6YA 1SRUA 3HKZE 2VS1A 1VQJA 1GO3E 3G48A 1HH2P 1OXVA 3PGZA 4JI8L 4DV5L 1WYDA 2NVYH 2WFWA 5GROA 3OW2A 3GTPH 4LFBQ 4JV5L 5M3FH 5IYBH 2OQ0A 1W3SA 2MO1A 4DV3L 4HIOA 3RN2A 1VQOA 1PA6A 1QVFA 4A3DH 1JMCA 2IX0A 4B3SQ 2IX1A 1K3RA 2UXDL 1XMOQ 2OWOA 2F52A 3S1QH 1JT8A 1LUZA 3A74A 4XIGS 3GTJH 3CMEA 2ZTCA 4JI0L 1N32Q 4JBKA 1YITA 3H0GG 4YHHL 4UP7A 4AQYQ 1E1TA 3KF6B 2NVQH 1LTLA 2B29A 5IYDG 2UXCQ 4RG1A 4LFCQ 1CKNB 4BXXG 2NN6G 5IYCH 4IO9A 3UDFA 3KJOA 4DR2L 5GAHC 4NB3A 3J81c 1E3PA 1V9PA 1PH2A 3FP9A 1XMQL 4QY7A 1HNWQ 1L1OB 2PMZE 1YHQA 1X54A 4GN3B 5C3EH 1PV4A 1YZ6A 1IYJB 3HOXG 4DUYL 2YTYA 5IYBG 1G51A 2RF4A 3S24A 4A3DG 3KFUA 4NXMQ 3M4QA 2JA7H 2E8GA 1PH3A 3GO5A 3PF5A 4LF5L 3HFZB 1IBKL 3T1HL 2ALYB 1GD7A 4JC0A 1A0IA 3CPWA 4GN5A 3WWVA 4LF9Q 1I5FA 2BH8A 3HKSA 4LF8L 2JQOA 2BH2A 2R7ZH 4DUZL 1KL9A 1VQCA 5IYCG 3EIVA 2NZHA 4B3TQ 1UE1A 2PI2A 2A19A 1YBYA 2I0QA 3PUVA 1XJVA 1EUJA 1A62A 4R4TA 5M5YH 4AYBG 1WFQA 1Y1WG 2JEBI 4LF7L 4IPDA 3MXNB 3GTMH 5EAYA 1FL0A 3CPFA 2K14A 4H02A 1N34L 1IBLQ 1VQ6A 3ERSX 5GADC 4DR3L 3PSIA 4A3IG 3PUWA 2JA6H 4AH6A 4JI2L 1K83H 1VQHA 2NN6I 2WAQE 1IBML 4JG2A 2Q2HA 3I2ZA 2UUAQ 3L7ZC 3CCLA 1BVSA 1PVOA 2ID0A 5J3BA 2WP8J 2HQLA 2N49A 3OTOQ 3KDFB 1D8LA 3GTKH 2QGQA 3I4OA 4KHZA 3TQYA 4EX5A 1TWAH 2ZM6Q 2R7ZG 4DV0Q 4LFBL 1PH6A 4R4IA 1GM5A 1FJGL 2HHHL 4B3SL 4A3BH 4BBSH 1XMOL 2Z0SA 2UU9Q 4LWCA 1VQMA 1N32L 3T1YQ 3G71A 1Q81C 4AQYL 3PUZA 4P75A 1Q1BA 4KHPL 5C4JH 4B3RQ 1H95A 1EIFA 2UUBQ 2B63H 2UXCL 5C4XH 1KXLA 3HOZG 4YWMA 1YIJA 4DR7Q 1HNXL 4C3IH 3W1BA 5FJ8H 3A0JA 1YNXA 3K7AH 3OYYA 1Q1EA 1KRTA 4IPHA 4JI5Q 1WOCA 1U5KA 4IPCA 3TS2A 2ASBA 1G291 3ULPA 4BY7G 1VQPA 4UPAA 2CWAA 2R7DA 1HNWL 1E24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 Q;  1J6Q A;  1Z47 A;  4L5T A;  5IWA L;  2Z6K C;  4PZ7 A;  4BA1 I;  1W2B A;  5LMN Q;  2ZJR A;  2UXB Q;  1HZA A;  3G4S A;  4POG A;  1BKB A;  4JI3 Q;  1SFO H;  2KCT A;  4NXM L;  4IOA A;  2PQA B;  1VQ5 A;  1GVP A;  4DR6 L;  1NTG A;  2VQF L;  4BBR H;  2OQK A;  1QZG A;  2CCZ A;  4IJH A;  1KIX A;  2K75 A;  3TRZ A;  1E7Z A;  3I4M G;  1HJP A;  3CCV A;  4LF6 L;  4LF9 L;  4L5S A;  2LSS A;  2NVX H;  2YTX A;  4YWK A;  1BBU A;  4HIM A;  5FJ8 G;  1SRO A;  4OWT B;  4JI1 Q;  4GKJ Q;  4A3M H;  2R93 G;  4B3T L;  4DV6 Q;  5JJI A;  1XPU A;  1N9W A;  3W5O A;  1AE3 A;  3CMA A;  5E7N A;  4JBW A;  3UE0 A;  4GLV B;  4DV4 L;  4DV7 Q;  4X66 Q;  4X65 Q;  1EYG A;  4DNI A;  2JA9 A;  1PH5 A;  1TWC H;  4YWL A;  1K73 C;  3M7N A;  4GKK Q;  1G6P A;  1NBW A;  4A3G H;  1IBL L;  3S1N H;  4APV A;  4A75 A;  4LFA Q;  3PO3 H;  5M3M H;  1Q46 A;  2Y0S E;  3CCM A;  2IHF A;  4B3M Q;  1VQG A;  3RR5 A;  1JJC B;  2AKW B;  2Z6K A;  3NEL A;  4BBR G;  2F3I A;  2Q2T A;  4GNX B;  1HZC A;  3E9I A;  2HT1 A;  2UUA L;  3K8A A;  2LXJ A;  2YV5 A;  2DUD A;  3I55 A;  4HID A;  1A63 A;  4DV2 L;  3OTO L;  2QA4 A;  3CC4 A;  4A3L H;  2K52 A;  4GN4 B;  4JOI C;  2ZM6 L;  2MFI A;  2JE6 I;  3PCO B;  4ALP A;  4DV0 L;  2Q2I A;  4A3M G;  5M3F G;  1NMG A;  4ME3 A;  1PYB A;  2XGT A;  4DR5 Q;  4OXP A;  1VQL A;  2D62 A;  1XPO A;  2HIV A;  1XNR L;  4BA2 I;  2K50 A;  3K0X A;  1VQI A;  4A3J H;  5FLX c;  2VQE L;  4HJ8 A;  2R92 H;  4K0K Q;  1JJ2 A;  1EWI A;  4QQB X;  4C3H H;  3T1Y L;  2N3S A;  3TRE A;  5FLM H;  1TWG H;  4L5R C;  3CCS A;  4B3R L;  4JI6 Q;  3PO3 G;  3AEV A;  5M3M G;  1VQB A;  4A3F H;  4OX9 Q;  4DR7 L;  4A4I A;  3BJU A;  1NY4 A;  3U4V A;  2E5L Q;  1Y14 B;  5JJK A;  4JI5 L;  4UP8 A;  4OWX B;  3S14 H;  4JI4 Q;  3PO2 H;  3KYH C;  4FDB A;  4PZ6 A;  2E2H H;  1JJG A;  1UE7 A;  5JEA G;  4JYA L;  1BBW A;  5AJ3 L;  1I50 H;  1X6O A;  2WB1 G;  3GD7 A;  3CD6 A;  1Q7Y C;  4A3L G;  4EQ5 A;  4X62 L;  5C3E G;  4GLX A;  4HJ7 A;  5ELN A;  3RLN A;  1K8G A;  1EIY B;  2UXB L;  5LMN L;  3HOV H;  1WI5 A;  1PH1 A;  3GTL H;  4JOI A;  4JI3 L;  2ZJQ A;  1NE3 A;  2JA7 G;  4LUZ A;  3J80 c;  4L5Q A;  1I3Q H;  4HIK A;  3CC2 A;  4DV5 Q;  2ZTE A;  4JI8 Q;  4QGU A;  4LF4 Q;  2L15 A;  3CW2 C;  3KLW A;  4NPS A;  5IP7 H;  2VW9 A;  2OTL A;  4BY1 H;  4NXN L;  4A76 A;  4UY8 C;  4TVA B;  1HNX Q;  3I4N H;  1YEZ A;  5FLM G;  2GVA A;  1PYS B;  1HZ9 A;  1UEB A;  1HR0 Q;  4A93 H;  1UWV A;  3TEH B;  3IRB A;  1NMF A;  4IOC A;  3CCR A;  4A3F G;  4C3J H;  2UXD Q;  2AHO B;  3PV0 A;  5M5W H;  1C9O A;  1VQ4 A;  1VS0 A;  3M3Y H;  2OTJ A;  1QVG A;  3M4O H;  2DGY A;  2FXQ A;  1EQR A;  3FKI H;  3F8T A;  3HKZ G;  3K80 C;  5ELO A;  4DV6 L;  2JA5 H;  3CF5 A;  2IHE A;  4JI0 Q;  4YHH Q;  3CCU A;  1IZ6 A;  3M4P A;  3M9B A;  1OXX K;  1HNZ Q;  4X64 Q;  1FGU A;  2ZTD A;  3RZD H;  4GKK L;  2V1C C;  1YHA A;  1M1K C;  1GKH A;  1WJJ A;  2BA1 A;  4O0A A;  1U0L A;  3S17 H;  1EQQ A;  4HJ5 A;  3A5Z B;  1WCM H;  1EOV A;  4LFA L;  4HJ9 A;  1CKM A;  2ZJP A;  2JA6 G;  3J7A 5;  4TQU S;  4UP9 A;  4BBS G;  1B70 B;  2VL6 A;  3ER0 A;  4JI7 Q;  5C44 H;  1N33 Q;  3GDE A;  2ES2 A;  1QVC A;  1L1O C;  1X3F A;  3J80 i;  1LM0 A;  2AWN A;  3F2B A;  4GOP C;  4A93 G;  4MZ9 A;  4WJ3 M;  3JC6 6;  4IFD G;  2AWO A;  2I5L X;  4DPG A;  5IP9 H;  1I6H H;  4PG3 A;  3HOU H;  1C7Y A;  4P74 A;  3CC7 A;  3FKI G;  4AIM A;  5C0X G;  4P72 A;  1IBK Q;  3MEF A;  1X55 A;  1XTD A;  2JA5 G;  1VQN A;  1JB7 A;  4DR5 L;  3CP0 A;  2UUC Q;  5LMN W;  4DR1 Q;  1VQD A;  4A3B G;  4IJL A;  1S40 A;  1ASY A;  1CKO A;  1I94 Q;  3J7Z C;  4K0K L;  1TXY A;  1YHB A;  2VY3 A;  4GLA C;  1PFS A;  1X3E A;  4KI0 A;  2HIX A;  5DLQ E;  4R4O A;  4DUZ Q;  1XNQ Q;  2MNA A;  1X65 A;  4AYB E;  3GTG H;  4OON A;  1ASZ A;  3UDG A;  2KHI A;  2WB1 E;  3NEM A;  2NVT H;  3NBH B;  2B63 G;  1N8R C;  5C4X G;  1AE2 A;  4OX9 L;  3SGI A;  3KF6 A;  2E2I H;  3EN2 A;  2BA0 A;  3UDX A;  4O2D A;  1OXU A;  4YY3 Q;  4A3K H;  3S15 H;  2N8N A;  2E5L L;  4LUO A;  1QUQ A;  1OTC A;  2JA8 H;  4A3C H;  3BZK A;  4JBJ A;  4JI4 L;  1YVC A;  4LUV A;  3RN5 A;  4HJA A;  3ICE A;  1TWF H;  5IYD H;  4R4C A;  5JEA J;  4DR4 Q;  1MJC A;  3VDY A;  3PUY A;  2K5N A;  5IP9 G;  1X56 A;  2F4V Q;  3HOU G;  3L2P A;  3H3V H;  1L1O A;  2RHS B;  2F4V L;  1P8L A;  5IY0 A;  1Z9F A;  4GOP A;  1A8V A;  5HY6 A;  1EFW A;  4WJ4 A;  5M5X H;  4J15 A;  4PZ8 A;  1JE5 A;  4DK3 C;  1VQ7 A;  2CFM A;  4LF4 L;  5LMU Q;  3G6E A;  1VQF A;  5BR8 Q;  3HOX H;  1R9T H;  1VQA A;  1UE6 A;  1CSP A;  3KOJ A;  1O7I A;  4P71 A;  4QL5 A;  4LW1 A;  3U4Z A;  3LGJ A;  1NJI C;  1KHI A;  1HR0 L;  1P16 A;  1Q12 A;  2WAQ G;  3CAM A;  2HHH Q;  1FJG Q;  3HOW H;  2KEN A;  5IT9 c;  2N78 A;  4IFD I;  2I5M X;  2MO0 A;  1UE5 A;  3F2C A;  3CCJ A;  1XPR A;  4A3K G;  3ULL A;  4DV1 Q;  2VNU D;  3D0F A;  4A3C G;  3ZJY C;  5IE8 A;  5C0X I;  2JA8 G;  5K36 G;  2D0P A;  2K5V A;  3AYH B;  4MNO A;  2KCM A;  1VQ9 A;  4KHP Q;  1TWH H;  2UU9 L;  4LF5 Q;  5GAE C;  3FHW A;  3W1G A;  4X64 L;  3PUX A;  1QUQ B;  4YCW A;  1HNZ L;  1J5E Q;  1D7Q A;  4IPG A;  1PHJ A;  1S3O A;  1Q8K A;  1HZB A;  4R4Q A;  4A3G G;  2IY5 B;  3E9H A;  2UUB L;  4Y7N H;  3ULJ A;  1PH4 A;  3DM3 A;  2OCE A;  3PIO A;  3I56 A;  1VQK A;  1Y1W H;  1OXT A;  1VQ8 A;  3RLO A;  4GOP B;  4JI7 L;  1N33 L;  1KQS A;  5IWA Q;  1YJ9 A;  3RLF A;  2GVB A;  3HOW G;  2CKZ B;  1PH9 A;  4IFD J;  4A3I H;  4XTC S;  2VZA A;  1KRS A;  4DR6 Q;  2VQF Q;  1K8A C;  1YJW A;  2Q2U A;  1CSQ A;  2IT1 A;  3AFP A;  3KDF A;  5C0X J;  3A5U A;  1KC8 C;  3GTO H;  2JJQ A;  3NEN A;  2UUC L;  1B7Y B;  3L0O A;  2AMC B;  2XTI A;  4DR1 L;  1S72 A;  1N36 Q;  4LF6 Q;  3UE1 A;  4Y52 H;  4A3J G;  1I94 L;  1M90 C;  3CCQ A;  1YI2 A;  1YJN A;  2R6G A;  2R92 G;  3D31 A;  2PNH A;  4JV5 Q;  1XNQ L;  4QJF A;  3J81 j;  4DV3 Q;  4POF A;  4LNQ A;  2QEX A;  3Q8D A;  4DAY B;  1B8A A;  3RZO H;  2CWP A;  3HOY H;  2ATW A;  1HR0 W;  4MTN A;  4DV4 Q;  4JBM A;  1RL2 A;  2K5H A;  4YY3 L;  3CCE A;  4JI1 L;  3J81 i;  1Q82 C;  3S1M H;  2JK8 A;  1VQE A;  1AH9 A;  4P73 A;  3PO2 G;  1DGS A;  3TS0 A;  2D0O A;  4DV7 L;  2A8V A;  4C2M H;  4DR4 L;  4X66 L;  3HOZ H;  2VUM H;  4RMF A;  4QIW E;  4X65 L;  4OO1 G;  1QZH A;  2EQS A;  2YYZ A;  5HGQ A;  4OWW B;  3I7F A;  1IL2 A;  3STB C;  3STB D;  4DAM A;  1Q86 C;  2E2J H;  3H3V I;  4GKJ L;  4KLK A;  1RIP A;  2CQO A;  4DR2 Q;  3HOV G;  2H5X A;  4JCV E;  1C0A A;  2KBN A;  5JJL A;  4BY7 H;  3M85 A;  3GTQ H;  1XMQ Q;  4DV2 Q;  1FVI A;  4GNX C;  4A3E H;  4B3M L;  1SE8 A;  3E0E A;  4GS3 A;  1SN8 A;  3UDI A;  1Y1V H;  4DK6 C;  5IP7 G;  3CXC A;  4BY1 G;  5LMU L;  1IXR A;  2PQA A;  2Y0S G;  5BR8 L;  4DUY Q;  1K9M C;  3I4N G;  2B3G A;  3BZC A;  1XNR Q;  4LFC L;  1OXS C;  3JAM c;  2RHQ B;  1T9H A;  3HOY G;  3F1Z A;  2VQE Q;  2MQH A;  3BU2 A;  3CQZ H;  4DV1 L;  3S1R H;  4YCU A;  3F2D A;  1PH8 A;  3T1H Q;  2GN5 A;  2K4K A;  1K0R A;  2YU9 H;  2NZO A;  3PIP A;  3I4M H;  1LYL A;  2I5H A;  3K7U C;  2LXK A;  4DKA C;  1SLJ A;  1E1O A;  2C35 B;  1MIU A;  1VCI A;  2PI2 E;  3KF8 B;  4LF8 Q;  2A1A A;  2VUM G;  3S16 H;  1J5E L;  1MKH A;  3K81 C;  2EXD A;  3EBE A;  4R1J A;  3PF4 A;  2R93 H;  3U50 C;  1L2F A;  2EIF A;  3DLL A;  1PH7 A;  2KHJ A;  1SR3 A;  1WCM G;  4JI6 L;  1X9N A;  1KAW A;  5H1S E;  4A3E G;  4JYA Q;  5AJ3 Q;  3H15 A;  4LF7 Q;  2JEA I;  4X6A H;  4YCV A;  1Y1V G;  1CKN A;  3S2D H;  3U58 A;  5C44 G;  1CUK A;  5GQO A;  4PMW A;  3H0G H;  3RNU A;  1N34 Q;  3S2H H;  1L0W A;  1X3G A;  2RCN A;  4GNX A;  3AQQ A;  1V43 A;  4DR3 Q;  5GAG C;  4BXX H;  2YTV A;  4OO1 I;  3AFQ A;  4JI2 Q;  3JAM i;  1E22 A;  1IBM Q;  1V1Q A;  4NXN Q;  1SMX A;  1MJE A;  3KJP A;  2R7F A;  1N36 L;  1KD1 C;  3B6Y A;  1SRU A;  3HKZ E;  2VS1 A;  1VQJ A;  1GO3 E;  3G48 A;  1HH2 P;  1OXV A;  3PGZ A;  4JI8 L;  4DV5 L;  1WYD A;  2NVY H;  2WFW A;  5GRO A;  3OW2 A;  3GTP H;  4LFB Q;  4JV5 L;  5M3F H;  5IYB H;  2OQ0 A;  1W3S A;  2MO1 A;  4DV3 L;  4HIO A;  3RN2 A;  1VQO A;  1PA6 A;  1QVF A;  4A3D H;  1JMC A;  2IX0 A;  4B3S Q;  2IX1 A;  1K3R A;  2UXD L;  1XMO Q;  2OWO A;  2F52 A;  3S1Q H;  1JT8 A;  1LUZ A;  3A74 A;  4XIG S;  3GTJ H;  3CME A;  2ZTC A;  4JI0 L;  1N32 Q;  4JBK A;  1YIT A;  3H0G G;  4YHH L;  4UP7 A;  4AQY Q;  1E1T A;  3KF6 B;  2NVQ H;  1LTL A;  2B29 A;  5IYD G;  2UXC Q;  4RG1 A;  4LFC Q;  1CKN B;  4BXX G;  2NN6 G;  5IYC H;  4IO9 A;  3UDF A;  3KJO A;  4DR2 L;  5GAH C;  4NB3 A;  3J81 c;  1E3P A;  1V9P A;  1PH2 A;  3FP9 A;  1XMQ L;  4QY7 A;  1HNW Q;  1L1O B;  2PMZ E;  1YHQ A;  1X54 A;  4GN3 B;  5C3E H;  1PV4 A;  1YZ6 A;  1IYJ B;  3HOX G;  4DUY L;  2YTY A;  5IYB G;  1G51 A;  2RF4 A;  3S24 A;  4A3D G;  3KFU A;  4NXM Q;  3M4Q A;  2JA7 H;  2E8G A;  1PH3 A;  3GO5 A;  3PF5 A;  4LF5 L;  3HFZ B;  1IBK L;  3T1H L;  2ALY B;  1GD7 A;  4JC0 A;  1A0I A;  3CPW A;  4GN5 A;  3WWV A;  4LF9 Q;  1I5F A;  2BH8 A;  3HKS A;  4LF8 L;  2JQO A;  2BH2 A;  2R7Z H;  4DUZ L;  1KL9 A;  1VQC A;  5IYC G;  3EIV A;  2NZH A;  4B3T Q;  1UE1 A;  2PI2 A;  2A19 A;  1YBY A;  2I0Q A;  3PUV A;  1XJV A;  1EUJ A;  1A62 A;  4R4T A;  5M5Y H;  4AYB G;  1WFQ A;  1Y1W G;  2JEB I;  4LF7 L;  4IPD A;  3MXN B;  3GTM H;  5EAY A;  1FL0 A;  3CPF A;  2K14 A;  4H02 A;  1N34 L;  1IBL Q;  1VQ6 A;  3ERS X;  5GAD C;  4DR3 L;  3PSI A;  4A3I G;  3PUW A;  2JA6 H;  4AH6 A;  4JI2 L;  1K83 H;  1VQH A;  2NN6 I;  2WAQ E;  1IBM L;  4JG2 A;  2Q2H A;  3I2Z A;  2UUA Q;  3L7Z C;  3CCL A;  1BVS A;  1PVO A;  2ID0 A;  5J3B A;  2WP8 J;  2HQL A;  2N49 A;  3OTO Q;  3KDF B;  1D8L A;  3GTK H;  2QGQ A;  3I4O A;  4KHZ A;  3TQY A;  4EX5 A;  1TWA H;  2ZM6 Q;  2R7Z G;  4DV0 Q;  4LFB L;  1PH6 A;  4R4I A;  1GM5 A;  1FJG L;  2HHH L;  4B3S L;  4A3B H;  4BBS H;  1XMO L;  2Z0S A;  2UU9 Q;  4LWC A;  1VQM A;  1N32 L;  3T1Y Q;  3G71 A;  1Q81 C;  4AQY L;  3PUZ A;  4P75 A;  1Q1B A;  4KHP L;  5C4J H;  4B3R Q;  1H95 A;  1EIF A;  2UUB Q;  2B63 H;  2UXC L;  5C4X H;  1KXL A;  3HOZ G;  4YWM A;  1YIJ A;  4DR7 Q;  1HNX L;  4C3I H;  3W1B A;  5FJ8 H;  3A0J A;  1YNX A;  3K7A H;  3OYY A;  1Q1E A;  1KRT A;  4IPH A;  4JI5 Q;  1WOC A;  1U5K A;  4IPC A;  3TS2 A;  2ASB A;  1G29 1;  3ULP A;  4BY7 G;  1VQP A;  4UPA A;  2CWA A;  2R7D A;  1HNW L;  1E24 A; 
#chains in the Genus database with same CATH topology
 5JVL A;  1VKZ A;  4X62 Q;  1J6Q A;  2XCL A;  3D4R A;  3R93 A;  5IWA L;  2EJF C;  2Z6K C;  4IUU A;  4PZ7 A;  2NYZ D;  5KFQ A;  3FKI A;  4ECR A;  1MI2 A;  4POG A;  3C2P A;  2KCT A;  1GVP A;  4RUC A;  2OQK A;  3TRZ A;  1PRT D;  1E7Z A;  1K8M A;  3I4M G;  4EFE A;  3X3N A;  1HJP A;  2A73 B;  3CCV A;  3MR5 A;  4Q8F A;  4LF9 L;  2J7Z A;  5L1I A;  5M5Y B;  2LSS A;  5FO9 B;  2F0K A;  2EYF A;  4LMY A;  4DV0 H;  1SRO A;  4JI1 Q;  2F0N A;  4X64 H;  2RA4 A;  5JJI A;  2YZM A;  3W5O A;  3H3V C;  3C0F B;  5KFR A;  4EYI B;  4HMI A;  4JBW A;  4DV4 L;  4GLV B;  5CA1 F;  4X65 Q;  1EYG A;  5LL6 X;  2JA9 A;  1TWC H;  3RGX A;  1NBW A;  1G6Z A;  1IBL L;  1JWS D;  1LAB A;  4A75 A;  1Z2P X;  4JI7 H;  2JN4 A;  1N33 H;  4K6D A;  3RMH A;  4G7O C;  1AUV A;  2AKW B;  2Z6K A;  3KLS A;  2L0C A;  4GNX B;  3MFG A;  3OIQ A;  4RGO S;  2HT1 A;  4KN7 C;  3K5H A;  2VPS A;  2LXJ A;  3GTG A;  4LF5 H;  4DV2 L;  3OTO L;  5KFS A;  5TSS A;  4GN4 B;  4A3L H;  4DR1 H;  2MFI A;  2E2I A;  4ALP A;  2W9B A;  1RK6 A;  4WOR A;  1T5X D;  1F2Y A;  2HIV A;  2B63 B;  4BA2 I;  1GUT A;  2K50 A;  3K0X A;  3L4K A;  4IR1 A;  1XNQ H;  4KKS A;  4RGM A;  3VR2 A;  2R3Z A;  4E6I A;  4UCS A;  2SNS A;  1O7L A;  4IQZ A;  2NU8 B;  3RB6 A;  3M9N B;  1PFB A;  4J9M A;  1SEB D;  3HP3 A;  1MD2 D;  2FLP A;  4CJ0 B;  2B2U C;  1F2M A;  1SXT A;  5M3M G;  3AEV A;  3PO3 G;  2DJG C;  4A3F H;  3HG9 A;  3HOU B;  3BQ2 A;  2E5L Q;  1KLU D;  5JJK A;  4JI5 L;  2DNE A;  3K5I A;  3PO2 H;  3URY A;  3A8J E;  2D2C C;  3KAK A;  1JJG A;  1I7L A;  4HED A;  1BBW A;  5AJ3 L;  3GD7 A;  3CD6 A;  2I46 A;  5C3E G;  5ELE A;  2M00 A;  3G6V A;  1WI5 A;  2WAQ B;  4ZK9 B;  5LMU H;  3RJ0 A;  3T16 A;  1STE A;  1EUC B;  3GTL H;  3K5O A;  4JI3 L;  2ZJQ A;  1NE3 A;  2K01 A;  4LUZ A;  4HIK A;  1I3Q H;  2BE5 C;  2BE5 D;  5HBR B;  2L15 A;  4BY1 H;  1Q8I A;  5EPJ A;  3T53 B;  2OTL A;  4C56 C;  3MWY W;  3I4N H;  1N48 A;  5FLM G;  1PYS B;  5KFZ A;  2PN1 A;  3MFH A;  1A6X A;  1NMF A;  3Q24 A;  1B6S A;  4C3J H;  1Z2O X;  3M4O H;  1TWC B;  4KHP H;  1EQR A;  2F0O A;  3FKI H;  5C0X H;  2DIK A;  1Y1W A;  4DV6 L;  2XC9 A;  1H9J A;  4KV6 A;  1HNZ Q;  1FGU A;  2ZTD A;  4H7B A;  3OMG A;  2NTT A;  4GKK L;  2V1C C;  2B2Y C;  1GKH A;  3VYS A;  4XYL B;  1LTB D;  2BA1 A;  1SNQ A;  2C9O A;  1LAC A;  3Q8P B;  2YW2 A;  4HJ5 A;  4YBZ B;  3GTO A;  2CQY A;  2RDJ A;  1TS2 A;  3ETH A;  4UP9 A;  2VL6 A;  3ER0 A;  2FMA A;  2ASL A;  4O4L F;  1QVC A;  1JQY D;  1LM0 A;  4WJ3 M;  2SDF A;  4MZ9 A;  2PO4 A;  1PK8 A;  2I5L X;  4DPG A;  2BQR A;  3KLS X;  1AFP A;  4XQJ A;  5CYU A;  3H6M A;  1KDC A;  1XYI A;  5IOD A;  3D8G A;  2UUC Q;  2K05 A;  4F4W A;  4JV5 H;  3TBI B;  1I94 Q;  1B9N A;  4Q43 A;  4J9P A;  2XSC A;  3GV6 A;  3GV8 B;  2HCC A;  4GLA C;  2W9C A;  5KNB A;  4DUZ Q;  4CKB A;  2UXD H;  1X65 A;  1KAA A;  3P20 A;  3GTG H;  3PO2 B;  3DF7 A;  3QZ7 A;  1CTM A;  5KFO A;  4QWE A;  4IRK A;  3H40 A;  2B63 G;  3RGZ A;  1N8R C;  4JI0 H;  1PLF A;  1AE2 A;  4OX9 L;  2E2I H;  5F9N A;  1OXU A;  1WSC A;  4JUZ A;  3BDC A;  4A3C H;  1QUQ A;  3BZK A;  4JI4 L;  1TS3 A;  3ORR A;  5J2U F;  2HGS A;  1I3Q B;  1MJC A;  3SVM A;  4DR2 H;  1GSH A;  4KY6 A;  4BY1 B;  2F4V Q;  3HOU G;  3L2P A;  3H3V H;  4K5X A;  3MWD A;  1P8L A;  3EFX D;  3I4N B;  4O3O A;  3P7J A;  1Z6H A;  2NU9 B;  4DGZ A;  2RBM A;  5LL6 b;  4DUY H;  4PZ8 A;  1JE5 A;  4DK3 C;  3M4O B;  1MHW C;  3RBE A;  3PW2 A;  2AU0 A;  5D3I B;  3U4Z A;  3KOJ A;  1R4Q B;  2R93 A;  4EGQ A;  2NB0 A;  3VA7 A;  3LGJ A;  2F0D A;  2FFK B;  4LFC Q;  2IBK A;  2WAQ G;  1BOS A;  2K5D A;  2KEN A;  1BXT A;  1T3N A;  4G57 A;  4IFD I;  2I5M X;  1ENA A;  1TAE A;  1BNZ A;  1XPR A;  1TII D;  3ULL A;  4DV1 Q;  1GUO A;  2VNU D;  1SCU B;  2FPI B;  3NUC A;  1ILP A;  1WD0 A;  5C0X I;  5JQW A;  3H4D A;  4MTE A;  5K36 G;  3NXW A;  1VQ9 A;  3AYH B;  2CZG A;  3VR4 A;  2UU9 L;  4K8J A;  2P0A A;  4DA2 A;  4YCW A;  1PHJ A;  1CQV A;  5L9X A;  2NUC A;  3EYY A;  1PZK D;  1Q8K A;  1S3O A;  2UUB L;  4QCL A;  3ULJ A;  1HQR D;  4JV2 A;  2OCE A;  5JUM A;  1WR2 A;  1K1S A;  1Y1W H;  3S1R B;  5IGB A;  5KT3 A;  1TY0 A;  5IWA Q;  3EPG A;  3RLF A;  1TY2 A;  1ZXT A;  1IBM H;  1KAB A;  4IFD J;  3KBG A;  2L9H A;  5DEH A;  1Y69 U;  2FB9 A;  5C0X J;  1KC8 C;  3I8Z A;  3GTO H;  4LK1 C;  3L0O A;  2AMC B;  3RTX A;  4Y52 H;  4LJZ C;  1IHZ A;  2K32 A;  2QIL A;  3CCQ A;  1YI2 A;  2SEB D;  1YJN A;  3OW7 A;  5IOC A;  4ECW A;  1H9M A;  1NUC A;  1S5F D;  3FPU B;  5LL6 S;  3T51 B;  3UI2 A;  5FPR A;  3R5X A;  4B9W A;  4DV4 Q;  1RL2 A;  2K5H A;  4YY3 L;  4AQY H;  1EYA A;  2WB1 A;  1KC7 A;  1HA6 A;  1DXM A;  1Q82 C;  4YB8 B;  4EYH B;  4FO2 A;  3PO2 G;  2D0O A;  4ZYS A;  1DYQ A;  5KFT A;  4DR4 L;  2DY7 A;  4MIU A;  3E5N A;  2LKV A;  5HGQ A;  1QZH A;  3H3V I;  3RAX A;  3KTM A;  1PXU A;  4A3D B;  4ZUI A;  1SAP A;  3GV3 A;  2YRW A;  4DV2 Q;  1FVI A;  4A3E H;  1STB A;  2C00 A;  5KFM A;  1KJ8 A;  3CXC A;  4BY1 G;  4UFZ A;  4RU9 A;  2R7Z A;  2PQA A;  1FR3 A;  2EY6 A;  4OIK A;  4K2K A;  3I4N G;  2B3G A;  2D9U A;  3P1H A;  4CDC C;  4R8U A;  2E2D C;  1M7J A;  2RSN A;  2X6L A;  4LF6 H;  4YCU A;  5E1F A;  2XN9 C;  2GPW A;  1E1O A;  4LF8 Q;  1Y1W B;  4U6P A;  2F0V A;  2A1A A;  2VUM G;  2EXD A;  3EBE A;  4R1J A;  2R93 H;  4O3R A;  3TN2 A;  3N52 A;  3I90 A;  5ISR A;  4RNM A;  1PH7 A;  4K5W A;  1IL8 A;  4PMB A;  3K58 A;  3OOC A;  5AJ3 Q;  2R6F A;  4LF7 Q;  3S2D H;  4UCT A;  3GTO B;  1AW7 A;  1TVX A;  3RNU A;  5KG0 A;  1N34 Q;  1JOO A;  4EEY A;  4DR3 Q;  5JJZ A;  2KJX A;  2F0H A;  4BXX H;  4ETS A;  2PQE A;  3D6C A;  3AFQ A;  3Q8Q B;  5FKA C;  2R7K A;  5KFE A;  4ECX A;  1EZ6 A;  2M2L A;  2ZM6 H;  4IHJ F;  1SRU A;  3HKZ E;  1TQO A;  3V96 A;  1XNR H;  4DV5 L;  2GA4 B;  4ZQI A;  3GID A;  1L0Y B;  1F9S A;  3BYY B;  1RHP A;  2EYL A;  1JMC A;  2IX0 A;  2IX1 A;  2W9C B;  1KTK A;  1TS4 A;  2PZW A;  1XMO Q;  3BDO A;  2F52 A;  2W71 A;  1HUN A;  3FRP B;  1AN8 A;  5T1G A;  1N32 Q;  4MV6 A;  4JBK A;  1ILQ A;  4CJ2 C;  3PW5 A;  4IAL A;  1F2Z A;  1JWM D;  1FNV A;  4F88 A;  1CQJ B;  3TZU A;  5IYZ F;  4X62 H;  3QO2 A;  1XMQ L;  3HS0 C;  2PYK A;  1MGS A;  3N6X A;  2AUJ D;  1YHQ A;  3JSL A;  2NVX A;  4GN3 B;  4KD3 A;  4S3S A;  5KYL A;  2F0P A;  4A3D G;  4DL2 A;  4NXM Q;  1ESF A;  5KFX A;  2R93 B;  3PF5 A;  5KT2 A;  3KUP A;  3HFZ B;  2R84 A;  3CPW A;  1RJP A;  2IW3 A;  3U9S A;  2W8L A;  3WWV A;  2XGQ A;  2BH8 A;  2FK3 A;  2R7Z H;  3S2D B;  1EY9 A;  3E3X A;  2NZH A;  4B3T Q;  2I0Q A;  3PUV A;  3J7Y W;  1A3T A;  1AEX A;  2WKC A;  3NPP A;  4ILW A;  1Y1W G;  1B44 D;  2HVR A;  4BBR B;  3MXN B;  3VR3 A;  3CPF A;  2K14 A;  3IFT A;  4H02 A;  3BVM A;  2W6O A;  2M9V A;  3PSI A;  3PUW A;  3QFF A;  3SE0 A;  1EU3 A;  5KX5 F;  4JI2 L;  2WDT A;  2FMC A;  1VQH A;  5EKI A;  2NN6 I;  3GLK A;  2W8K A;  3QOJ A;  3M9O B;  1CFM A;  4V19 0;  3ITP A;  3CCL A;  1UC8 A;  5JAV A;  5FLX L;  2WP8 J;  1M8A A;  1BNC A;  4XXE A;  2AGQ A;  4DV0 Q;  5FPO A;  3C1E A;  1XDN A;  3KHL A;  1AN7 A;  1FJG L;  2HHH L;  5G3L F;  4A3B H;  5D14 A;  2UU9 Q;  2Z0S A;  4O2B F;  4MV3 A;  4ZRZ A;  3T1Y Q;  5KFN A;  4RB0 A;  2YZN A;  2AQ1 B;  4ECQ A;  4MV1 A;  5C4J H;  1E2W A;  2E5L H;  2UUB Q;  2UXC L;  2WB1 B;  5C4X H;  1KXL A;  1SBB B;  1O75 A;  4YWM A;  4B08 A;  5KNC A;  4MA0 A;  3W1B A;  1NCV A;  3A0J A;  1YNX A;  2QDL A;  3L3O C;  5E3F A;  1KRT A;  2IL8 A;  3TS2 A;  2EE1 A;  3ULP A;  1EL0 A;  1G91 A;  3J80 L;  2KVM A;  4UPA A;  2R7D A;  1HNW L;  2ZJT A;  1M4V A;  1E24 A;  1PMR A;  2W70 A;  1Z47 A;  1ZQ7 A;  5CR3 A;  5KT4 A;  1W2B A;  1TWG B;  2ZJR A;  5LMN Q;  2L11 A;  1HZA A;  2SNM A;  2B2V C;  4F87 A;  2B2T C;  2CQA A;  2PQA B;  1CA6 A;  2LMC B;  4DR6 L;  4RNN A;  1NTG A;  2VQF L;  1QZG A;  4MTK A;  4IJH A;  2K75 A;  4YQW A;  2HUG A;  4EGV A;  4L5S A;  2E2H B;  2FKL A;  1E4G T;  1W96 A;  1B3Q A;  2NVX H;  3Q0A A;  2O4X A;  4OWT B;  4GKJ Q;  2R93 G;  3H94 A;  3M9M B;  5KFL A;  1HNZ H;  3GP7 A;  3E5S A;  4KD4 A;  3DMU A;  4O4H F;  5J2T F;  2W7P A;  5E7N A;  5DG9 A;  3PVX A;  2EXZ A;  2R8K A;  3UE0 A;  4N9P A;  3Q1K A;  1TR5 A;  2K5W A;  1PH5 A;  1RK5 A;  1K73 C;  1MZB A;  4RAU C;  3SK4 A;  4G7Z C;  1H9S A;  4A93 B;  3S1N H;  3HXL A;  3PO3 H;  5M3M H;  1EZ1 A;  4LMQ D;  2Y0S E;  5I47 A;  2IHF A;  4RHS A;  3MJF A;  1MSH A;  2Z6B A;  1QIL A;  4BBR G;  2XIW A;  2PMZ B;  3E9I A;  2B2V A;  2UUA L;  2C5C A;  4DL3 A;  3K8A A;  3OMC A;  3DM1 A;  4HID A;  4A3B B;  2B2T A;  1A63 A;  3FDT A;  5KFV A;  2WAQ A;  1C8C A;  1D5Z C;  1WVL A;  3VPB A;  4JOI C;  2UUC H;  1L0X B;  1I94 H;  4ME3 A;  1PYB A;  2XGT A;  4DR5 Q;  5C4J B;  1VQL A;  1SNC A;  1XPO A;  3V4Z A;  3JZI A;  5C4X B;  1VQI A;  3J80 E;  5FLX c;  2VQE L;  2CH4 W;  2ICE C;  2K04 A;  4K0K Q;  2ALZ A;  3KBX A;  1CS0 A;  3E0J A;  1QNK A;  2KHS A;  1GUW A;  2IWH A;  3RF2 A;  4EBE A;  3P75 A;  5FLM H;  3BS1 A;  1GLV A;  4DL6 A;  3CCS A;  4B3R L;  5COR A;  2Q8T A;  4DR7 L;  5CBE E;  1NY4 A;  1DV2 A;  5DQH A;  3TDQ A;  4U7C A;  2JEF A;  4DV7 H;  4HTH A;  1Y14 B;  4UP8 A;  1HA5 A;  4OWX B;  2I80 A;  4X66 H;  2F4V H;  4JYA L;  4YR2 A;  3OSN A;  2WB1 G;  1IKM A;  3A7L A;  4OO1 H;  1GJX A;  4XQN A;  3MXU A;  5K5P A;  4WFN 3;  3D4D A;  1AZP A;  2P5Z X;  2UXB L;  1EEI D;  4B3M H;  1PH1 A;  3WO0 A;  2MGS A;  3CKI B;  2NVX B;  3SI8 A;  4JOI A;  3J80 c;  4L5Q A;  2KED A;  4O42 A;  1S10 A;  4DV5 Q;  4LF4 Q;  4FP5 D;  5IGD A;  4LFC H;  2OXP A;  3CW2 C;  4NPS A;  2JA8 B;  3QWN A;  3S17 H;  3OHX C;  4NXN L;  1IYU A;  4UY8 C;  3KAJ A;  1HNX Q;  3OUU A;  1YEZ A;  1TWF B;  1HR0 Q;  4DV1 H;  1UWV A;  3TEH B;  3N44 B;  3OHA A;  1TKW B;  2VB2 X;  4DFA A;  1VQ4 A;  1VS0 A;  3M3Y H;  2OTJ A;  1QVG A;  4M9U A;  3F8T A;  2YRX A;  3CF5 A;  4RHR A;  3S1N B;  3R23 A;  1YNJ D;  1U4R A;  4DXG A;  3PO3 B;  2W9A A;  3M9B A;  3BJY A;  1OXX K;  3ONA B;  5ELC A;  2K6A A;  4XT3 B;  4L63 B;  4TV8 F;  4JI6 H;  1I4H A;  4FYD A;  1FNW A;  1XWE A;  1EQQ A;  3HOW B;  3A5Z B;  4LFA L;  2IMW P;  3N41 B;  3FVQ A;  5C3W A;  3J7A 5;  2R8I A;  3HZX A;  2WYO A;  1IOV A;  1X32 A;  5C44 H;  1SEI A;  3GDE A;  1V1P A;  1X3F A;  5T1I A;  3J80 i;  1UNS A;  2O2L D;  3F2B A;  3MFI A;  4A93 G;  4Z9C B;  2W6P A;  3QG1 A;  3BAB A;  1VMP A;  3HOU H;  4I4T F;  4P74 A;  2GLT A;  1D5X C;  1STN A;  3MEF A;  1X55 A;  1XTD A;  1VBG A;  4JI8 H;  5LMN W;  4Y7N B;  4A3B G;  5I6Y A;  1ASY A;  3X3M A;  1DZ1 A;  4NDX A;  1ZYR C;  1ZYR D;  3O13 A;  2R7L A;  3BA9 A;  1PFS A;  2IJ0 A;  4FF4 A;  1HFN A;  2VUM A;  4NLG A;  2K1B A;  2QF7 A;  4AYB E;  4OON A;  1ASZ A;  3UDG A;  1LTR D;  2NWG A;  5C4X G;  3UQ8 A;  3GTQ A;  3TIG A;  3VYT A;  3M7G A;  4YHH H;  1CI3 M;  4O2D A;  4WD3 A;  2KSW A;  2OLS A;  4LUO A;  1EY0 A;  1STH A;  5K36 H;  4I7H A;  2CH4 A;  4LUV A;  4HJA A;  5IYD H;  1UEA B;  4Q5V A;  2IPK D;  5DLF A;  1EY5 A;  3S17 B;  2K5N A;  3HEJ A;  3TIN A;  3OIP A;  4G3I A;  2RHS B;  2FE3 A;  3JAM L;  4YJ3 F;  2OEO A;  3HOY B;  4J15 A;  5JPM C;  3M3Y B;  2KEE A;  5GON F;  1SMY C;  1SMY D;  1MBY A;  1GYF A;  1L2Z A;  5BR8 Q;  2RDI A;  2EJG C;  4P71 A;  4JK1 C;  4QL5 A;  4LW1 A;  1NJI C;  4ME6 A;  5BN4 A;  1FJG Q;  2RDF A;  2HHH Q;  5IT9 c;  3CU7 A;  5L1J A;  1NAP A;  3CCJ A;  5C8Y F;  3F2C A;  1SYE A;  4ECZ A;  4R8I A;  4A3K G;  1XX8 A;  3IKJ A;  1Z2N X;  2JA8 G;  4LF8 H;  4U67 3;  4EVO A;  5KFG A;  1F9R A;  5GAE C;  3FHW A;  1HTL D;  4X64 L;  3RB0 A;  1J5E Q;  2DZD A;  5C44 B;  2R8G A;  3DEP A;  5A2Q L;  2XWB B;  4R4Q A;  4LF7 H;  5G3L D;  2MPM A;  2A69 C;  2A69 D;  3PW4 A;  3DM3 A;  1N34 H;  1OXT A;  4GOP B;  2DPI A;  1H9S B;  4JI7 L;  1N33 L;  2YU9 B;  3W3A A;  2CW8 A;  4DR3 H;  3I3C A;  2B8G A;  2FLL A;  1YJ9 A;  1E2V A;  2PZU A;  3HOW G;  2Z1C A;  2IX3 A;  3Q8R B;  2CKZ B;  4F4Z A;  4UDU C;  4XTC S;  3CVZ A;  3BDL A;  3KHG A;  1DJR D;  4DR6 Q;  2VQF Q;  1YJW A;  4FS1 A;  2F3V A;  3MWE A;  1JXL A;  3NTH A;  2NBF A;  2XGP A;  2JJQ A;  4YP3 A;  2MP1 A;  4BS9 A;  4K5V A;  4DR1 L;  1S72 A;  1N36 Q;  3UE1 A;  5J39 A;  1GUS A;  1KNA A;  1LTT D;  1SYG A;  2LFN A;  3QR8 A;  4FXG C;  5ELF A;  2MUY A;  1XNQ L;  4MV4 A;  4LSA A;  4DV3 Q;  4POF A;  3V6J A;  1XMO H;  1S5E D;  2XWJ B;  2CWP A;  3WOF A;  1HR0 W;  1N32 H;  1HQM C;  2EYP A;  1RTO A;  3K5N A;  4UHV A;  2JSO A;  2O5J C;  3J81 i;  1K0S A;  1SE3 A;  4M7E A;  5KT7 A;  1EFI D;  1Y8P B;  1JIH A;  1TA8 A;  5KFP A;  2A8V A;  2VUM H;  4RMF A;  4UCU A;  4OO1 G;  2EQS A;  3I7F A;  3AMU A;  4KLK A;  2A6E C;  2A6E D;  4I50 F;  4JCV E;  2KBN A;  3GTQ H;  2HJW A;  1S97 A;  3WNZ A;  4GS3 A;  1SN8 A;  4DK6 C;  1ENF A;  5LMU L;  1BCP F;  1RYR A;  2K03 A;  1WTQ A;  2JEJ A;  4NXM H;  2NVQ B;  5KG5 A;  1OXS C;  3JAM c;  1T9H A;  3HOY G;  1K28 A;  4ZUJ A;  2VQE Q;  1G2T A;  3S1R H;  3BVZ A;  3F2D A;  5IIF A;  3T1H Q;  2XRS D;  1GHJ A;  2GN5 A;  4OEM B;  1PH8 A;  3ERQ A;  5FK9 C;  4TV9 F;  1LYL A;  2DWC A;  4PDB A;  1STA A;  3K7U C;  2LXK A;  4P2C B;  4DKA C;  1SLJ A;  2PI2 E;  4B3T H;  5EBC A;  1V8Q A;  3S16 H;  3N40 P;  4EBD A;  2JA6 A;  3DUZ A;  4IRD A;  3U50 C;  1L2F A;  1KBL A;  2FPG B;  4HCS A;  2KHJ A;  1B6R A;  5DGA A;  2XCA A;  2XVS A;  1KAW A;  3L9A X;  3MWM A;  4JYA Q;  2RSO A;  3BYT B;  2V9W A;  5COY A;  4X6A H;  3LWU A;  4N8F A;  4O4I F;  2MJ8 A;  3GTK A;  5C44 G;  4O2A F;  2WE6 A;  1HHV A;  4OIJ A;  4GC7 A;  3BQ0 A;  2UVW A;  2RCN A;  1U4M A;  3M4I A;  2VPQ A;  1DOK A;  5GAG C;  3QIA A;  4WJW A;  5DAU A;  1V1P B;  3HB9 A;  4IUN A;  5F2D A;  4KK7 A;  3JAM i;  1E22 A;  1B33 N;  3GV5 B;  1PFM A;  4NXN Q;  1S68 A;  2IP4 A;  5D1P A;  5H80 A;  3KLR A;  1MJE A;  1TT2 A;  1DV1 A;  2W6N A;  2R7F A;  1YNN C;  1YNN D;  2CW0 C;  2CW0 D;  3SXH A;  3EA6 A;  2VS1 A;  1KD1 C;  1VQJ A;  3BG5 A;  1GO3 E;  3G48 A;  2BQU A;  2OF1 A;  2ASD A;  4K6L A;  3GTM B;  1VF7 A;  2HQE A;  2WFW A;  3NHH A;  4JV5 L;  3SEB A;  4LFB Q;  2JEG A;  4HIO A;  1B1Z A;  5ELD A;  2H1E A;  4A3D H;  4B3S Q;  1RJT A;  3T1Y H;  2UXD L;  2VUM B;  2OWO A;  2F0W A;  2XRQ D;  4CKC A;  1LUZ A;  3A74 A;  4XIG S;  4I7Z C;  4JI0 L;  3G6Y A;  1BQQ T;  2PZT A;  3NTK A;  4HCE A;  3GTQ B;  3TP6 A;  1IKL A;  2B29 A;  5IYD G;  1NR4 A;  4G4K A;  5KFU A;  3UFX B;  3Q23 A;  4WBN F;  4G7H C;  1SFO A;  4IO9 A;  2F3W A;  3KJO A;  4FNF A;  3MXN A;  5GAH C;  4DR2 L;  4NB3 A;  1D5M C;  2O03 A;  1JE4 A;  1ZHQ A;  4QY7 A;  5JEA H;  5EQ0 A;  1CM9 A;  5LMN H;  4NW2 A;  3G6X A;  2QK4 A;  1PV4 A;  3NE5 B;  4L1K A;  2EOT A;  4DUY L;  1ICW A;  1PTO F;  5EOY A;  5IYB G;  1G51 A;  3GIP A;  2YL2 A;  3S16 B;  2JA7 H;  1PH3 A;  2FK1 A;  3MXG A;  2KCN A;  2YS7 A;  3VPC A;  1IBK L;  1LTA D;  3LNN A;  1KJ9 A;  4JC0 A;  1GD7 A;  1EOT A;  2AUK A;  1T36 A;  4GN5 A;  3TP7 A;  4LF9 Q;  4GKJ H;  1M6V A;  3HKS A;  2L4N A;  3L4J A;  3H09 A;  2F0E A;  4F4Y A;  4HYK A;  3VR6 A;  2R7N A;  2CVR A;  2VXW A;  5EWG A;  1VQC A;  1JOR A;  2DPJ A;  4DK0 A;  4XYQ A;  2R8J A;  3V4S A;  5CV7 A;  1UE1 A;  1C48 A;  1QCB D;  5AFW A;  1F77 A;  2E75 C;  1EU4 A;  1EUJ A;  1A62 A;  1FGB D;  4R4T A;  2FK2 A;  2JEB I;  4EQP A;  2WV6 D;  4K14 A;  4RWS C;  1FL0 A;  5KFK A;  3G7L A;  1IBL Q;  1KDA A;  4IZ8 A;  3K57 A;  4RB3 C;  2JA6 H;  3H91 A;  2L12 A;  2FHT A;  3NBI A;  4A3M B;  4J6H A;  2W6Q A;  1IBM L;  4JG2 A;  2Q2H A;  3I2Z A;  3L7Z C;  3BZD B;  4C5A A;  1LO5 D;  2R8H A;  5J3B A;  3T13 A;  1DOM A;  1TWG A;  3OTO Q;  1D8L A;  3GTK H;  4DR5 H;  3I4O A;  4KHZ A;  4NP5 A;  4EX5 A;  4Q0F A;  3I72 A;  3GII A;  4ED2 A;  4R4I A;  4K0K H;  3DWA A;  4ABN A;  4YR3 A;  4ZI7 F;  2E2H A;  2W6M A;  5C4Z A;  3RUZ A;  1I50 A;  3MTS A;  1VQM A;  2KA7 A;  1ET9 A;  4AQY L;  2FP4 B;  1Q1B A;  3JRX A;  1S0O A;  3KXY T;  1OWT A;  1Y8O B;  4CDE C;  2KEC A;  4IUV A;  4DAP A;  5J1Z A;  5BMV F;  2RDG A;  4EFB A;  1Q1E A;  4HMJ A;  4IPH A;  4JI5 Q;  2J9G A;  3VPD A;  1U5K A;  4H44 C;  4EEQ A;  2Y0S A;  2J6T A;  1VQP A;  2JA7 B;  4HNU A;  1I4X A;  5KG6 A;  2E76 C;  1DOL A;  4L5T A;  3VA5 A;  5CAE B;  1BBX C;  4EQO A;  4BA1 I;  4LF4 H;  2PMZ A;  4PNY A;  2N55 A;  4JI3 Q;  1SFO H;  1HNX H;  1CT1 D;  1WD1 A;  1VQ5 A;  2SCU B;  3HKZ B;  4BBR H;  1HR0 H;  3NSW A;  4DL4 A;  1KIX A;  2FJ2 A;  2PCF B;  5L1K A;  1ULZ A;  3MC0 B;  3Q6S A;  2BDO A;  4LF6 L;  1RD9 D;  2PPB C;  4KY7 A;  1WCM A;  2YTX A;  4YWK A;  1BBU A;  1GSO A;  5FJ8 G;  3N42 B;  2LS0 1;  4QW9 A;  4DV6 Q;  1SJH D;  1X3Q A;  1N9W A;  2BR0 A;  1AE3 A;  3CMA A;  4A2A A;  4ZLT F;  2JA6 B;  4UCO A;  5HUR A;  2W6Z A;  4GKK Q;  4DF7 A;  1SYC A;  4RKB A;  3M7N A;  2A6H C;  2A6H D;  2YYA A;  5KFA A;  2Q8R E;  1I7N A;  2JYO A;  4XQQ A;  1FKA H;  1STY A;  1Q46 A;  3GTK B;  3CCM A;  3GIQ A;  4X3S A;  4PV1 C;  4EGJ A;  2DY8 A;  3RR5 A;  1JJC B;  2F3I A;  4KY5 A;  3F2U A;  1HZC A;  3A8I E;  4TRD A;  3QJY A;  2R85 A;  3I55 A;  1JKJ B;  4HSP A;  4JW0 A;  2QA4 A;  1EHI A;  1W6J A;  2K52 A;  2ZM6 L;  1STG A;  2JE6 I;  4UCR A;  4A3M G;  5D1O B;  2V58 A;  1NMG A;  4J9S A;  1XNR L;  4OXP A;  2D62 A;  5LYJ F;  5KT6 A;  3FMC A;  3H20 A;  2C2E A;  1LT3 D;  4HJ8 A;  1TWF A;  1RJQ A;  1BCP C;  1BCP D;  1JJ2 A;  1EWI A;  3ORQ A;  5FD6 A;  4C3H H;  1WTX A;  3TRE A;  1TWG H;  4L5R C;  4LSX A;  2ZDQ A;  4JI1 H;  4ED6 A;  3RUP A;  4OX9 Q;  3WOE A;  5KT5 A;  4A4I A;  1SNP A;  3BJU A;  2FJZ A;  4CC5 A;  5KFD A;  3U4V A;  3A8K E;  3IN5 A;  3WO1 A;  3GV7 B;  4J9N A;  2KCC A;  3S14 H;  4JI4 Q;  4X65 H;  4FDB A;  3PIO 3;  4RNO A;  1R9T A;  3PZP A;  2E2H H;  1SFO B;  5JEA G;  5JPN C;  1I50 H;  3MHB A;  1Q7Y C;  1KNE A;  5C1P A;  4X62 L;  1LTS D;  3PW0 A;  4GLX A;  4HJ7 A;  5ELN A;  3FPP A;  1K8G A;  5HGT A;  3T56 B;  2QYZ A;  3HOV H;  2XNA C;  1QE6 A;  1CQF A;  3EVQ A;  5BR8 H;  2JA7 G;  3KK7 A;  3R5H A;  4XYM B;  4O3S A;  3CC2 A;  1TWH A;  2EYM A;  4QGU A;  3KLW A;  2VW9 A;  4A76 A;  1JX4 A;  4TVA B;  3TP8 A;  1WH2 A;  3J7A F;  1CQI B;  1HXY D;  2GVA A;  5KEE A;  3MAQ A;  5HV6 A;  4A93 H;  1BF4 A;  3I12 A;  2F0T A;  4IOC A;  3A56 A;  3CCR A;  1SJE D;  5A35 A;  2UXD Q;  2AHO B;  3PV0 A;  5M5W H;  1NSN S;  1C3O A;  2WII B;  3HKZ G;  3S9W A;  5ELO A;  1BDO A;  5JVH 3;  4JI0 Q;  3C3L A;  2IHE A;  5KKN B;  4J1M A;  1J5E H;  4ED8 A;  4IRC A;  1E2Z A;  2BCO A;  4ZKC B;  1JLL B;  4RA8 A;  1YHA A;  1M1K C;  1WJJ A;  1PDQ A;  4RZQ A;  3PMF A;  3MA2 B;  1HUM A;  1EOV A;  1U9R A;  1WCM H;  5J22 A;  2FPP B;  5IGE A;  1CKM A;  2Z4I A;  4V0B A;  2JA6 G;  4BBS G;  3DWP A;  2EY1 A;  1I6V C;  3JRW A;  5KRU A;  5EWF A;  1L1O C;  3J7A V;  2AWN A;  4GOP C;  1I4R A;  5I4D A;  2AWO A;  1ICF B;  4FXK C;  4YR0 A;  1I6H H;  4C3H B;  1N36 H;  1C7Y A;  4FF2 A;  4AIM A;  2JA5 G;  4P72 A;  1IBK Q;  4ZOL F;  4TQR A;  3K5M A;  2K7V A;  4QUC A;  1JB7 A;  4OGQ C;  4Q8E A;  5CGK A;  4FBT A;  1VQD A;  1CKO A;  1T5E A;  1JIC A;  2HCI A;  4DV3 H;  1TXY A;  3E6Z X;  1YHB A;  2VY3 A;  4KI0 A;  4C2M A;  2PBZ A;  2BQ3 A;  5DLQ E;  1PTO C;  1PTO D;  4R4O A;  3S14 B;  3ERO A;  4Q0Y A;  2KHI A;  2WB1 E;  1QJO A;  2NVT H;  2HVS A;  2IA6 A;  1I50 B;  1EZ8 A;  4C1N I;  3KF6 A;  3EN2 A;  1CZW A;  2BA0 A;  4A3K H;  4YY3 Q;  3S15 H;  2E5L L;  4ECS A;  5CV6 A;  1OTC A;  2JA8 H;  3DWQ A;  3HOV B;  1O7Y A;  1RF2 D;  1EYZ A;  2RQX A;  4ED0 A;  1YVC A;  2R86 A;  4RGT A;  1TWF H;  1R4P B;  1RTN A;  5FLX E;  5D65 A;  5KG1 A;  2EYO A;  4DR4 Q;  4C1N K;  2J4X A;  3PUY A;  3VDY A;  1B04 A;  1LTG D;  5IP9 G;  1X56 A;  5EDW A;  2Y0S B;  1L1O A;  5BPH A;  5IY0 A;  4MA5 A;  1Z9F A;  4GOP A;  3RZO B;  5C1O A;  2YU9 A;  5HY6 A;  5CV5 A;  5C4H A;  1EFW A;  5CV9 A;  4WJ4 A;  3IG0 A;  3U9O A;  5M5W B;  1RDP D;  5KYI A;  1NR2 A;  3W2D A;  2CFM A;  5CV8 A;  3EJI A;  3HOX H;  1R9T H;  4Q45 A;  1LT6 D;  4EQ5 A;  1G6P A;  2ICI A;  2K33 A;  2VQD A;  3ETJ A;  3HOW H;  2K5Q A;  3CAM A;  3T1H H;  2AQ4 A;  1SE2 A;  2MO0 A;  1UE5 A;  4EG0 A;  5KFB A;  5I2X A;  4B9X A;  1S5C D;  4RB1 A;  3D0F A;  2EYH A;  3ZJY C;  4DAV A;  2RCF A;  4FBU A;  4ECU A;  3K0Y A;  1WCM B;  2K5V A;  2R82 A;  5CB4 F;  4DUZ H;  3BA8 A;  1WTO A;  1TWH H;  4HNV A;  1HNZ L;  1A15 A;  1Y1V B;  4ECT A;  4IPG A;  5KGU A;  1K3B C;  3R2T A;  4DU9 A;  1XTC D;  1HZB A;  1WTP A;  3PR4 A;  4JPB W;  4Y7N H;  3PIO A;  2AGO A;  1I6H B;  1WTR A;  1VQ8 A;  5CV4 A;  1EUD B;  1KQS A;  2WKD A;  1HPC A;  4CJ1 B;  1JOK A;  1J9O A;  3ND8 A;  3RBD A;  4HN7 A;  2HDL A;  2EJM A;  3VMM A;  3OSP A;  3WDN A;  2Z4H A;  3N6R A;  3LML A;  2VZA A;  1E4E A;  3T4A C;  1KRS A;  2IT1 A;  3AFP A;  3KDF A;  3TQT A;  3A5U A;  2NVT B;  3NEN A;  5DM7 3;  2UUC L;  5IT9 L;  4LF6 Q;  2XTI A;  3R5F A;  3TQ1 A;  4LFB H;  1I94 L;  3NTI A;  4A3K B;  1M90 C;  3S15 B;  3D31 A;  4XYO A;  4B3S H;  4C3H G;  3AU7 A;  1Q3L A;  4QJF A;  1PZJ D;  3J81 j;  2QEX A;  3Q8D A;  1VDZ A;  1B8A A;  3IFD A;  1A3U A;  2EDG A;  3HOY H;  4RFB A;  2ATW A;  4H13 C;  3CCE A;  1S4Z A;  3AB9 A;  1C30 A;  2EZV A;  3S1M H;  4IUR A;  1VQE A;  3D3R A;  4KTA A;  4ODG A;  4P73 A;  3J81 L;  1AH9 A;  3N8D A;  1SDF A;  1CHQ D;  2X0S A;  2R87 A;  2EY2 A;  4OHJ A;  4DV7 L;  4E4T A;  4C2M H;  2V59 A;  4X66 L;  4QIW E;  2YYZ A;  2F4V L;  1R9T B;  3HOX B;  1EY7 A;  2F4I A;  4DAM A;  5BN3 A;  3HOV G;  5KFY A;  2H5X A;  4BY7 H;  3M85 A;  1JB3 A;  1I4P A;  1XMQ Q;  5IWA H;  5I6W A;  4B3M L;  1SE8 A;  3E0E A;  4ED3 A;  2NTS A;  3MR2 A;  1IXR A;  2Y0S G;  2MHV A;  2ZXR A;  1K9M C;  1CK1 A;  1EWC A;  3BZC A;  3DEO A;  4LFC L;  1XNR Q;  2G9H D;  2C2R A;  1TWH B;  4LH7 A;  1O78 A;  3LX0 A;  1IW7 C;  1IW7 D;  4LF9 H;  2FMM A;  4DV1 L;  3N43 B;  1ML0 D;  1KJJ A;  4X3K A;  2K4K A;  1K0R A;  2YU9 H;  3PIP A;  1BCP B;  5E4W C;  3GTM A;  2I5H A;  5JVD F;  1SYF A;  4X3T A;  4AYB B;  4OL7 A;  2C35 B;  1MIU A;  1VCI A;  3KF8 B;  4I55 F;  4TKO B;  2ZXP A;  1E4F T;  1CZG A;  4PMC A;  2EPB A;  4DV4 H;  1UAP A;  2EIF A;  1K83 A;  3R3O A;  1WCM G;  5IT9 E;  4JI6 L;  1PTO H;  3FDS A;  3H15 A;  1IBL H;  5E4X A;  2JEA I;  4YCV A;  1Y1V G;  2L5T A;  1CUK A;  1TWA A;  4PMW A;  1I6U A;  4PQX A;  3SDZ A;  5LXT F;  4ECY A;  4OO1 I;  4JI2 Q;  3A7A B;  4DV2 H;  2NUA B;  1PRT C;  1VMC A;  1V1Q A;  3OTO H;  1SMX A;  3J81 E;  3KJP A;  1IOW A;  1KJI A;  1DIK A;  4BWS C;  3B6Y A;  4CDD C;  1SSO A;  1HH2 P;  1OXV A;  2V4D A;  4JI8 L;  4J8Q A;  4NKL A;  5GRO A;  3S1M B;  1UNN C;  5DM6 3;  5M3F H;  5IYB H;  3RN2 A;  1VQO A;  1M0T A;  1K8O A;  3OHB A;  1ROD A;  1QVF A;  5C5J A;  4MN3 A;  4C2M B;  4APM A;  1K3R A;  4IN3 A;  2A5H A;  2UVR A;  3CME A;  5C3X A;  3K3P A;  2QEJ C;  1H9K A;  3H0G G;  4YHH L;  1T94 A;  4UP7 A;  4J9O A;  2NVQ H;  1U4P A;  3HRZ C;  1LTL A;  3KF6 B;  4BY7 B;  2UXC Q;  4RG1 A;  1CKN B;  4QWA A;  4JI5 H;  4BWG B;  5EWE A;  1EQV A;  4QW8 A;  4QWB A;  3PN1 A;  3J81 c;  1V9P A;  1PH2 A;  3FP9 A;  3RV3 A;  1HNW Q;  2WTF A;  1L1O B;  2A68 C;  2A68 D;  1X54 A;  1C4Q A;  4TQS A;  4FM9 A;  4O1N A;  5IGF A;  4JI3 H;  3HOX G;  3K6O A;  3U9T A;  2YTY A;  2SOB A;  2RF4 A;  5CA0 F;  3S24 A;  1TU2 B;  1JDB B;  4DNR B;  3GO5 A;  3TSS A;  2F0M A;  3K7A B;  4RGN A;  4LF5 L;  5DLG A;  3F8N A;  2V4R A;  1A0I A;  5CMD A;  1EY6 A;  4WRD A;  1PTO B;  4LF8 L;  4DV6 H;  2BH2 A;  4MV9 A;  2RGR A;  3C46 A;  1K1Q A;  4N9T A;  4FVM A;  5IYC G;  2V4Q A;  4L6T B;  5FOB B;  2HVQ A;  1B2T A;  1UC9 A;  3JAM E;  2A19 A;  1YBY A;  1XJV A;  2L55 A;  4GKK H;  4AYB G;  4F8M A;  4LF7 L;  4IPD A;  4Q44 A;  3MZ5 A;  3GTM H;  4F50 A;  5FO7 B;  4J9K A;  1N34 L;  3BAA A;  1VQ6 A;  5KFI A;  1GSA A;  2EY5 A;  3ERS X;  5GAD C;  1EY4 A;  4DR3 L;  4NMZ A;  4K2L A;  4AH6 A;  4QMG A;  2JA7 A;  2R92 A;  1K83 H;  2WAQ E;  3NK9 A;  5M3F B;  3Q2O A;  2B2W C;  4DK1 A;  2UUA Q;  1SYX B;  3OWF A;  1GHK A;  1E4E B;  1PFN A;  1JCK B;  5C6A A;  2HQL A;  2N49 A;  4IFD H;  2NZ1 D;  3KDF B;  3TQY A;  1TWA H;  5A2Q E;  1PH6 A;  3MXP A;  2YZG A;  3HKZ A;  2B2U A;  2ASJ A;  1F9Q A;  3VYU A;  1XMO L;  5I2Y A;  1O7Z A;  4UAI A;  2X69 A;  1JDE A;  3NBH A;  3IAY A;  3RB3 A;  2O5I C;  3TII A;  4FF1 A;  1N32 L;  2CW7 A;  2GPS A;  4C5C A;  2NU7 B;  3G71 A;  4OX9 H;  2KOL A;  4C5B A;  1Q81 C;  4P75 A;  4KHP L;  3RFC A;  4B3R Q;  1H95 A;  5IGG A;  4KKT A;  5JH7 F;  5EKL A;  4DR7 Q;  4JI4 H;  2Z8L A;  4C3I H;  1EEF D;  5FJ8 H;  4CGY B;  3OYY A;  3C1F A;  1V51 A;  1D6E C;  3TP5 A;  1WOC A;  4LAA A;  4YJ2 F;  1G29 1;  4BY7 G;  3I70 A;  4YAJ B;  2CWA A;  2L1B A;  4XZ3 B;  1EIG A;  2B2W A;  4DXF A;  3SE7 A;  4IUQ A;  1WTV A;  1EY8 A;  1ZHS A;  2UXB Q;  4IWY A;  1ONL A;  2JA5 A;  5D3D A;  3G4S A;  2ZDH A;  1BKB A;  4A3F B;  1VBH A;  4NXM L;  4IOA A;  2CCZ A;  4J9Q A;  2F0G A;  2I87 A;  5D1O A;  4YIJ A;  4K8I A;  5FLX W;  5EJW A;  3V6H A;  2B2Y A;  5M9O A;  1SE4 A;  3CRL C;  4HIM A;  1UUP A;  4A3M H;  2UU9 H;  4B3T L;  3K3V A;  2A74 C;  2ENB A;  1XPU A;  3HBL A;  4KJO A;  1HCZ A;  3GTL B;  1DON A;  4DV7 Q;  1LTI D;  1ESR A;  3T5L A;  4X66 Q;  2RGV A;  1K83 B;  1S0N A;  2E74 C;  4RKL A;  4DNI A;  2UUB H;  4YWL A;  4RAY A;  4A3G H;  4APV A;  4LFA Q;  1B4O A;  4C3J B;  4H0L C;  4ZAI A;  4B3M Q;  1TWA B;  1VQG A;  1BO0 A;  1DCZ A;  2Q2T A;  3FKI B;  1NNX A;  3NEL A;  1S0M A;  5K2M A;  2OH2 A;  1JOQ A;  1FD7 D;  2YV5 A;  2DUD A;  1IBK H;  4ULL A;  3CC4 A;  4R9W A;  3J80 W;  4GC6 A;  5EPL A;  2F0Q A;  1QG7 A;  3PCO B;  1LT5 D;  4DV0 L;  2Q2I A;  1A2U A;  5M3F G;  3G6J B;  2Z9H A;  3FEW X;  4HNT A;  4N8X 1;  3ND9 A;  3T5K A;  1G8Z D;  4DAY A;  4A3J H;  2WAC A;  1MSG A;  4C3I B;  2R92 H;  2QDB A;  2RDH A;  4XDX A;  1FNU A;  4QQB X;  3TZD A;  2K28 A;  3T1Y L;  2N3S A;  1RJR A;  1ZET A;  2C22 A;  4YY3 H;  3BQ1 A;  1N56 A;  4JI6 Q;  3K59 A;  1VQB A;  4IUT A;  4ED1 A;  1ZKO A;  3JSN A;  1AP0 A;  2F0I A;  2QCP X;  1HFG A;  4TUY F;  4DR4 H;  1LLR D;  4O3P A;  3KYH C;  4PZ6 A;  1UE7 A;  1X6O A;  3PR5 B;  4DN4 M;  4A3L G;  2N88 A;  2JXM B;  5LP6 F;  2YCH A;  3RLN A;  1EIY B;  3GTG B;  1A3V A;  5LMN L;  5C5L A;  5NUC A;  2DNC A;  1PRT B;  4J9L A;  2E2I B;  4ME5 A;  4XX0 B;  4BBS H;  2W9B B;  5DQI A;  2ZTE A;  4JI8 Q;  2J6U A;  2CHB D;  3BG3 A;  3HGB A;  4KHV A;  5IP7 H;  1HZ9 A;  1UEB A;  1EWH A;  1DD2 A;  3V2T A;  1O80 A;  3IRB A;  5L37 A;  1AZQ A;  4A3F G;  3GQB A;  1C9O A;  1TS5 A;  2DGY A;  2FXQ A;  4GKJ L;  2JA5 H;  4CC6 A;  3K80 C;  4MHE A;  5LHY 1;  4RZR A;  1JR0 D;  4A3G B;  3GIJ A;  3T5J A;  4YHH Q;  3CCU A;  1IZ6 A;  3M4P A;  3SK6 A;  4J0M A;  4L8J A;  3MFY A;  2G9D A;  4X64 Q;  4A2B A;  3RZD H;  1VAJ A;  4FF3 A;  5EKK A;  4QWD A;  1BR9 A;  4O0A A;  4UCV A;  1W93 A;  1U0L A;  2V5A A;  4MV8 A;  4J9R A;  1D2B A;  4HJ9 A;  1GOZ A;  1B3A A;  3V05 A;  2ZJP A;  3H4B A;  4TQU S;  1B70 B;  2NU6 B;  4IZO A;  4ZKB B;  4JI7 Q;  2F03 A;  1N33 Q;  2ES2 A;  3MR6 A;  1JC7 A;  3JC6 6;  4A3J B;  3NWT A;  4IFD G;  2R92 B;  2KQ3 A;  4C3J G;  3J7A K;  5D8D A;  5IP9 H;  5BPF A;  2JEI A;  3DXJ C;  4PG3 A;  4LF5 Q;  3CC7 A;  3FKI G;  3MEH A;  5C0X G;  1VQN A;  1SNM A;  2RVL A;  4DR5 L;  3CP0 A;  1GGO A;  1PYW D;  2R7M A;  4DR1 Q;  4DV5 H;  4IJL A;  1S40 A;  1BUV T;  3VR5 A;  3TME A;  3EPI A;  1S9F A;  3A54 A;  3J7Z C;  5IT9 W;  4K0K L;  4HR7 A;  3PQI A;  1X3E A;  4RCN A;  4QUF A;  2HIX A;  3T5H A;  4U68 A;  1XNQ Q;  2MNA A;  1RKN A;  5DG7 A;  3NEM A;  4M1U B;  3NBH B;  4XT1 B;  2BDN A;  3SGI A;  2X6G A;  4C3I G;  3UDX A;  4CKE A;  2N8N A;  1XXG A;  5KG7 A;  1Y1V A;  1EYD A;  4JBJ A;  4O3Q A;  4ZCK A;  4X3U A;  3RN5 A;  3ICE A;  3J81 W;  4M8A A;  4R4C A;  3RD4 A;  5JEA J;  4YAK B;  4BBS B;  1CE8 A;  3GQC A;  2ZXO A;  3EQL C;  3LWB A;  3RIZ A;  5T14 A;  2AGP A;  2NN6 H;  1XMQ H;  3CQZ A;  3K5L A;  1A8V A;  1HTP A;  4IR9 A;  3R8B A;  4MTD A;  5M5X H;  2H4O A;  2EVB A;  1I4Q A;  2C28 A;  1VQ7 A;  4LF4 L;  5LMU Q;  1WTW A;  2JA5 B;  2YS6 A;  4IUP A;  3G6E A;  1GUG A;  1VQF A;  4F7X A;  1PX2 A;  1HNX L;  1VQA A;  1UE6 A;  1CSP A;  1O7I A;  1W6K A;  1HR0 L;  1KHI A;  1P16 A;  1Q12 A;  4FS2 A;  1EYC A;  5IGC A;  2N78 A;  3RZD B;  1GXD C;  5ELB A;  1B50 A;  2AQ2 B;  4A3C G;  5IE8 A;  2D0P A;  4DL5 A;  2UVV A;  4MNO A;  2KCM A;  3H0G A;  4KHP Q;  3SR1 A;  4A3E B;  2ZDG A;  3W1G A;  1D7Q A;  3PUX A;  1QUQ B;  5L1L A;  1I4G A;  1J8I A;  4TSS A;  1SYB A;  3SHL A;  1E0B A;  2J6S A;  1QB5 D;  4A3G G;  2IY5 B;  3E9H A;  2PW5 A;  1KLG D;  4QIW A;  1PH4 A;  2F0F A;  2PNR C;  3BVG A;  1Q90 A;  3I56 A;  1VQK A;  4EBC A;  4ZQ3 A;  3RLO A;  1A2T A;  2VA2 A;  1PRT F;  2NVY A;  3GTP A;  1S5B D;  3D4W A;  4Y8V B;  2GVB A;  4JI2 H;  1QWY A;  2KUM A;  2J0T D;  1PH9 A;  1F2L A;  4A3I H;  5DNF A;  3KHR A;  3QOL A;  4MAM A;  4CHT B;  2I07 B;  3SK8 A;  2W57 A;  1DM0 B;  1II3 A;  1K8A C;  2Q2U A;  1CSQ A;  2HD3 A;  3GTJ A;  4ID6 A;  1VF5 C;  2TMP A;  2XD4 A;  1B7Y B;  3JAM W;  5F9L A;  2ATL A;  3NGD A;  4A3J G;  5C5M A;  1M0W A;  2R92 G;  2R6G A;  3OPO A;  1FJG H;  1QNU A;  2HHH H;  2BOS A;  2PNH A;  4JV5 Q;  4LNQ A;  4DAY B;  3RZO H;  3R2I A;  3A55 A;  1Y8N B;  2TSS A;  5JOB A;  2F0J A;  4MTN A;  2WIN B;  4JBM A;  4AYB A;  3KF8 A;  4JI1 L;  5KFC A;  3PW7 A;  2UXC H;  2JK8 A;  1AUX A;  4KN4 C;  1DGS A;  3TS0 A;  1RCV D;  5M5X B;  1A9X A;  1B9M A;  2B8F A;  3HOZ H;  1BXR A;  4KMU C;  4X65 L;  5KG2 A;  1RYS A;  2EYJ A;  1IL2 A;  3MR3 A;  4OWW B;  2VB3 X;  3STB C;  1LV9 A;  3STB D;  1Q86 C;  2E2J H;  1HNW H;  1RIP A;  2CQO A;  4DR2 Q;  5A2Q W;  4F4X A;  1C0A A;  5JJL A;  4GZY C;  4GNX C;  1V4Y A;  3UDI A;  1Y1V H;  5JVG 3;  5IP7 G;  5EZY F;  4JVZ A;  5EGT A;  4R8N A;  5BR8 L;  4DUY Q;  4DR6 H;  2VQF H;  2RHQ B;  2VUG A;  3F1Z A;  4EQN A;  5DG8 A;  2MQH A;  3BU2 A;  3CQZ H;  3GIL A;  3I4M H;  2NZO A;  3CRK C;  5KFH A;  2HDM A;  1ENC A;  2B39 A;  1J5E L;  1MKH A;  3K81 C;  3PIP 3;  3PF4 A;  5CC4 A;  3G8C A;  1KDB A;  3DLL A;  2M05 A;  3IL8 A;  3LWE A;  5DGB A;  1SR3 A;  1X9N A;  2RKS A;  4A3I B;  5H1S E;  4A3E G;  2XCP A;  3KHH A;  1CKN A;  5I9O A;  3U58 A;  1SNO A;  3GIK A;  5GQO A;  3H0G H;  3CHB D;  4HAE A;  2DJF C;  2VOB A;  3S2H H;  1L0W A;  1X3G A;  2D5D A;  4GNX A;  3FMA A;  4ECV A;  3AQQ A;  2UVU A;  3NQT A;  1V43 A;  2UUA H;  5KFW A;  2R7Z B;  1B53 A;  2YTV A;  2FIN B;  4R8U B;  2G5D A;  4DLK A;  1IBM Q;  2QKI C;  5EPK A;  1N36 L;  2PW7 A;  3OUZ A;  5BN5 A;  3I91 A;  2B63 A;  4MV7 A;  3PGZ A;  3RAQ A;  1WYD A;  1D1K A;  2NVY H;  3OW2 A;  3GTP H;  4DV3 L;  3M4Y A;  2OQ0 A;  1W3S A;  2MO1 A;  1PA6 A;  4IAJ A;  2VQE H;  1G2S A;  2AQ3 B;  3D6W A;  4HR7 B;  1ZEQ X;  4DNT B;  3HOZ B;  4RCO A;  3QZ8 A;  3S1Q H;  1JT8 A;  3OWE B;  4I65 A;  3GTJ H;  2F1M A;  3I4L A;  2E2J B;  4CDF C;  4QF4 A;  4B3R H;  2ZTC A;  5KIX A;  3VYR A;  1YIT A;  3ZYY X;  4DR7 H;  4AQY Q;  1E1T A;  3NP8 A;  4KKU A;  3OSO A;  1WTH A;  5EBD A;  4BXX G;  4KJN A;  1IYV A;  3RB4 A;  2DLN A;  2NN6 G;  5IYC H;  5FD5 A;  3UDF A;  4JYA H;  2XIG A;  4CBV A;  1SND A;  1E3P A;  1BJT A;  1EQT A;  2F0L A;  2UXB H;  2PMZ E;  3CQZ B;  5KND A;  3DHQ A;  1S03 G;  1SYD A;  5C3E H;  3Q22 A;  3I4M B;  1YZ6 A;  1Z7T A;  1IYJ B;  5I9P A;  4ED7 A;  5CBA E;  4QB4 A;  1D1I A;  3KAL A;  3KFU A;  1HRJ A;  4NXN H;  3M4Q A;  4RUA A;  2E8G A;  4O3N A;  1F9P A;  4ZHQ F;  2VA3 A;  1PZI D;  3T1H L;  2OT2 A;  2ALY B;  1TWC A;  1I5F A;  3RV4 A;  4QWC A;  1FYC A;  2JQO A;  1CA5 A;  2PVP A;  1OO9 B;  1BGW A;  4DUZ L;  2JP1 A;  1S5D D;  1KL9 A;  4FXD A;  1X3P A;  3EIV A;  3H0G B;  3GIM A;  2ZT9 C;  2W7O A;  3S2H B;  2PI2 A;  5KFJ A;  2R61 A;  5M5Y H;  1WFQ A;  5FO8 B;  1V1O A;  4IWX A;  4LFA H;  5EAY A;  4QIW B;  3NQI A;  2I8C A;  2Q8I B;  4PWQ A;  1LT4 D;  4A3I G;  2F0S A;  2NVY B;  3NWS A;  3GTP B;  3LP8 A;  1CHP D;  4HQ6 A;  5KG3 A;  4FU0 A;  1BVS A;  1PVO A;  4JV0 A;  2ID0 A;  2FLN A;  3S1Q B;  1EIH A;  3QB3 A;  2QGQ A;  3GTJ B;  2R7Z G;  2ZM6 Q;  5LA6 F;  4HSV A;  3Q8S B;  4LFB L;  5KG4 A;  4I7A A;  4LH6 A;  4R7R A;  4RAZ A;  3SK5 A;  1GM5 A;  1YNJ C;  5M3M B;  4B3S L;  1GUN A;  2VR1 A;  1QOH A;  2LY7 A;  4JV1 A;  4LWC A;  2MCT A;  2F0U A;  1U4L A;  5LOV F;  3PUZ A;  3V6K A;  1EIF A;  2B63 H;  2C2D A;  2DN8 A;  3I73 A;  3HOZ G;  1YIJ A;  1JWU D;  3GTL A;  5C3E B;  2QW7 A;  1H9R A;  4RB2 C;  1ET6 A;  5DQG A;  3K7A H;  1I3Q A;  4OEL B;  3MVV A;  1KEE A;  4IPC A;  2ASB A;  4DL7 A;  4RH6 A;  1KJQ A;  5KFF A; 
#chains in the Genus database with same CATH homology
 4X62 Q;  1J6Q A;  1Z47 A;  4L5T A;  5IWA L;  2Z6K C;  4PZ7 A;  4BA1 I;  1W2B A;  5LMN Q;  2ZJR A;  2UXB Q;  1HZA A;  3G4S A;  4POG A;  1BKB A;  4JI3 Q;  1SFO H;  2KCT A;  4NXM L;  4IOA A;  2PQA B;  1VQ5 A;  1GVP A;  4DR6 L;  1NTG A;  2VQF L;  4BBR H;  2OQK A;  1QZG A;  2CCZ A;  4IJH A;  1KIX A;  2K75 A;  3TRZ A;  1E7Z A;  3I4M G;  1HJP A;  3CCV A;  4LF6 L;  4LF9 L;  4L5S A;  2LSS A;  2NVX H;  2YTX A;  4YWK A;  1BBU A;  4HIM A;  5FJ8 G;  1SRO A;  4OWT B;  4JI1 Q;  4GKJ Q;  4A3M H;  2R93 G;  4B3T L;  4DV6 Q;  5JJI A;  1XPU A;  1N9W A;  3W5O A;  1AE3 A;  3CMA A;  5E7N A;  4JBW A;  3UE0 A;  4GLV B;  4DV4 L;  4DV7 Q;  4X66 Q;  4X65 Q;  1EYG A;  4DNI A;  2JA9 A;  1PH5 A;  1TWC H;  4YWL A;  1K73 C;  3M7N A;  4GKK Q;  1G6P A;  1NBW A;  4A3G H;  1IBL L;  3S1N H;  4APV A;  4A75 A;  4LFA Q;  3PO3 H;  5M3M H;  1Q46 A;  2Y0S E;  3CCM A;  2IHF A;  4B3M Q;  1VQG A;  3RR5 A;  1JJC B;  2AKW B;  2Z6K A;  3NEL A;  4BBR G;  2F3I A;  2Q2T A;  4GNX B;  1HZC A;  3E9I A;  2HT1 A;  2UUA L;  3K8A A;  2LXJ A;  2YV5 A;  2DUD A;  3I55 A;  4HID A;  1A63 A;  4DV2 L;  3OTO L;  2QA4 A;  3CC4 A;  4A3L H;  2K52 A;  4GN4 B;  4JOI C;  2ZM6 L;  2MFI A;  2JE6 I;  3PCO B;  4ALP A;  4DV0 L;  2Q2I A;  4A3M G;  5M3F G;  1NMG A;  4ME3 A;  1PYB A;  2XGT A;  4DR5 Q;  4OXP A;  1VQL A;  2D62 A;  1XPO A;  2HIV A;  1XNR L;  4BA2 I;  2K50 A;  3K0X A;  1VQI A;  4A3J H;  5FLX c;  2VQE L;  4HJ8 A;  2R92 H;  4K0K Q;  1JJ2 A;  1EWI A;  4QQB X;  4C3H H;  3T1Y L;  2N3S A;  3TRE A;  5FLM H;  1TWG H;  4L5R C;  3CCS A;  4B3R L;  4JI6 Q;  3PO3 G;  3AEV A;  5M3M G;  1VQB A;  4A3F H;  4OX9 Q;  4DR7 L;  4A4I A;  3BJU A;  1NY4 A;  3U4V A;  2E5L Q;  1Y14 B;  5JJK A;  4JI5 L;  4UP8 A;  4OWX B;  3S14 H;  4JI4 Q;  3PO2 H;  3KYH C;  4FDB A;  4PZ6 A;  2E2H H;  1JJG A;  1UE7 A;  5JEA G;  4JYA L;  1BBW A;  5AJ3 L;  1I50 H;  1X6O A;  2WB1 G;  3GD7 A;  3CD6 A;  1Q7Y C;  4A3L G;  4EQ5 A;  4X62 L;  5C3E G;  4GLX A;  4HJ7 A;  5ELN A;  3RLN A;  1K8G A;  1EIY B;  2UXB L;  5LMN L;  3HOV H;  1WI5 A;  1PH1 A;  3GTL H;  4JOI A;  4JI3 L;  2ZJQ A;  1NE3 A;  2JA7 G;  4LUZ A;  3J80 c;  4L5Q A;  1I3Q H;  4HIK A;  3CC2 A;  4DV5 Q;  2ZTE A;  4JI8 Q;  4QGU A;  4LF4 Q;  2L15 A;  3CW2 C;  3KLW A;  4NPS A;  5IP7 H;  2VW9 A;  2OTL A;  4BY1 H;  4NXN L;  4A76 A;  4UY8 C;  4TVA B;  1HNX Q;  3I4N H;  1YEZ A;  5FLM G;  2GVA A;  1PYS B;  1HZ9 A;  1UEB A;  1HR0 Q;  4A93 H;  1UWV A;  3TEH B;  3IRB A;  1NMF A;  4IOC A;  3CCR A;  4A3F G;  4C3J H;  2UXD Q;  2AHO B;  3PV0 A;  5M5W H;  1C9O A;  1VQ4 A;  1VS0 A;  3M3Y H;  2OTJ A;  1QVG A;  3M4O H;  2DGY A;  2FXQ A;  1EQR A;  3FKI H;  3F8T A;  3HKZ G;  3K80 C;  5ELO A;  4DV6 L;  2JA5 H;  3CF5 A;  2IHE A;  4JI0 Q;  4YHH Q;  3CCU A;  1IZ6 A;  3M4P A;  3M9B A;  1OXX K;  1HNZ Q;  4X64 Q;  1FGU A;  2ZTD A;  3RZD H;  4GKK L;  2V1C C;  1YHA A;  1M1K C;  1GKH A;  1WJJ A;  2BA1 A;  4O0A A;  1U0L A;  3S17 H;  1EQQ A;  4HJ5 A;  3A5Z B;  1WCM H;  1EOV A;  4LFA L;  4HJ9 A;  1CKM A;  2ZJP A;  2JA6 G;  3J7A 5;  4TQU S;  4UP9 A;  4BBS G;  1B70 B;  2VL6 A;  3ER0 A;  4JI7 Q;  5C44 H;  1N33 Q;  3GDE A;  2ES2 A;  1QVC A;  1L1O C;  1X3F A;  3J80 i;  1LM0 A;  2AWN A;  3F2B A;  4GOP C;  4A93 G;  4MZ9 A;  4WJ3 M;  3JC6 6;  4IFD G;  2AWO A;  2I5L X;  4DPG A;  5IP9 H;  1I6H H;  4PG3 A;  3HOU H;  1C7Y A;  4P74 A;  3CC7 A;  3FKI G;  4AIM A;  5C0X G;  4P72 A;  1IBK Q;  3MEF A;  1X55 A;  1XTD A;  2JA5 G;  1VQN A;  1JB7 A;  4DR5 L;  3CP0 A;  2UUC Q;  5LMN W;  4DR1 Q;  1VQD A;  4A3B G;  4IJL A;  1S40 A;  1ASY A;  1CKO A;  1I94 Q;  3J7Z C;  4K0K L;  1TXY A;  1YHB A;  2VY3 A;  4GLA C;  1PFS A;  1X3E A;  4KI0 A;  2HIX A;  5DLQ E;  4R4O A;  4DUZ Q;  1XNQ Q;  2MNA A;  1X65 A;  4AYB E;  3GTG H;  4OON A;  1ASZ A;  3UDG A;  2KHI A;  2WB1 E;  3NEM A;  2NVT H;  3NBH B;  2B63 G;  1N8R C;  5C4X G;  1AE2 A;  4OX9 L;  3SGI A;  3KF6 A;  2E2I H;  3EN2 A;  2BA0 A;  3UDX A;  4O2D A;  1OXU A;  4YY3 Q;  4A3K H;  3S15 H;  2N8N A;  2E5L L;  4LUO A;  1QUQ A;  1OTC A;  2JA8 H;  4A3C H;  3BZK A;  4JBJ A;  4JI4 L;  1YVC A;  4LUV A;  3RN5 A;  4HJA A;  3ICE A;  1TWF H;  5IYD H;  4R4C A;  5JEA J;  4DR4 Q;  1MJC A;  3VDY A;  3PUY A;  2K5N A;  5IP9 G;  1X56 A;  2F4V Q;  3HOU G;  3L2P A;  3H3V H;  1L1O A;  2RHS B;  2F4V L;  1P8L A;  5IY0 A;  1Z9F A;  4GOP A;  1A8V A;  5HY6 A;  1EFW A;  4WJ4 A;  5M5X H;  4J15 A;  4PZ8 A;  1JE5 A;  4DK3 C;  1VQ7 A;  2CFM A;  4LF4 L;  5LMU Q;  3G6E A;  1VQF A;  5BR8 Q;  3HOX H;  1R9T H;  1VQA A;  1UE6 A;  1CSP A;  3KOJ A;  1O7I A;  4P71 A;  4QL5 A;  4LW1 A;  3U4Z A;  3LGJ A;  1NJI C;  1KHI A;  1HR0 L;  1P16 A;  1Q12 A;  2WAQ G;  3CAM A;  2HHH Q;  1FJG Q;  3HOW H;  2KEN A;  5IT9 c;  2N78 A;  4IFD I;  2I5M X;  2MO0 A;  1UE5 A;  3F2C A;  3CCJ A;  1XPR A;  4A3K G;  3ULL A;  4DV1 Q;  2VNU D;  3D0F A;  4A3C G;  3ZJY C;  5IE8 A;  5C0X I;  2JA8 G;  5K36 G;  2D0P A;  2K5V A;  3AYH B;  4MNO A;  2KCM A;  1VQ9 A;  4KHP Q;  1TWH H;  2UU9 L;  4LF5 Q;  5GAE C;  3FHW A;  3W1G A;  4X64 L;  3PUX A;  1QUQ B;  4YCW A;  1HNZ L;  1J5E Q;  1D7Q A;  4IPG A;  1PHJ A;  1S3O A;  1Q8K A;  1HZB A;  4R4Q A;  4A3G G;  2IY5 B;  3E9H A;  2UUB L;  4Y7N H;  3ULJ A;  1PH4 A;  3DM3 A;  2OCE A;  3PIO A;  3I56 A;  1VQK A;  1Y1W H;  1OXT A;  1VQ8 A;  3RLO A;  4GOP B;  4JI7 L;  1N33 L;  1KQS A;  5IWA Q;  1YJ9 A;  3RLF A;  2GVB A;  3HOW G;  2CKZ B;  1PH9 A;  4IFD J;  4A3I H;  4XTC S;  2VZA A;  1KRS A;  4DR6 Q;  2VQF Q;  1K8A C;  1YJW A;  2Q2U A;  1CSQ A;  2IT1 A;  3AFP A;  3KDF A;  5C0X J;  3A5U A;  1KC8 C;  3GTO H;  2JJQ A;  3NEN A;  2UUC L;  1B7Y B;  3L0O A;  2AMC B;  2XTI A;  4DR1 L;  1S72 A;  1N36 Q;  4LF6 Q;  3UE1 A;  4Y52 H;  4A3J G;  1I94 L;  1M90 C;  3CCQ A;  1YI2 A;  1YJN A;  2R6G A;  2R92 G;  3D31 A;  2PNH A;  4JV5 Q;  1XNQ L;  4QJF A;  3J81 j;  4DV3 Q;  4POF A;  4LNQ A;  2QEX A;  3Q8D A;  4DAY B;  1B8A A;  3RZO H;  2CWP A;  3HOY H;  2ATW A;  1HR0 W;  4MTN A;  4DV4 Q;  4JBM A;  1RL2 A;  2K5H A;  4YY3 L;  3CCE A;  4JI1 L;  3J81 i;  1Q82 C;  3S1M H;  2JK8 A;  1VQE A;  1AH9 A;  4P73 A;  3PO2 G;  1DGS A;  3TS0 A;  2D0O A;  4DV7 L;  2A8V A;  4C2M H;  4DR4 L;  4X66 L;  3HOZ H;  2VUM H;  4RMF A;  4QIW E;  4X65 L;  4OO1 G;  1QZH A;  2EQS A;  2YYZ A;  5HGQ A;  4OWW B;  3I7F A;  1IL2 A;  3STB C;  3STB D;  4DAM A;  1Q86 C;  2E2J H;  3H3V I;  4GKJ L;  4KLK A;  1RIP A;  2CQO A;  4DR2 Q;  3HOV G;  2H5X A;  4JCV E;  1C0A A;  2KBN A;  5JJL A;  4BY7 H;  3M85 A;  3GTQ H;  1XMQ Q;  4DV2 Q;  1FVI A;  4GNX C;  4A3E H;  4B3M L;  1SE8 A;  3E0E A;  4GS3 A;  1SN8 A;  3UDI A;  1Y1V H;  4DK6 C;  5IP7 G;  3CXC A;  4BY1 G;  5LMU L;  1IXR A;  2PQA A;  2Y0S G;  5BR8 L;  4DUY Q;  1K9M C;  3I4N G;  2B3G A;  3BZC A;  1XNR Q;  4LFC L;  1OXS C;  3JAM c;  2RHQ B;  1T9H A;  3HOY G;  3F1Z A;  2VQE Q;  2MQH A;  3BU2 A;  3CQZ H;  4DV1 L;  3S1R H;  4YCU A;  3F2D A;  1PH8 A;  3T1H Q;  2GN5 A;  2K4K A;  1K0R A;  2YU9 H;  2NZO A;  3PIP A;  3I4M H;  1LYL A;  2I5H A;  3K7U C;  2LXK A;  4DKA C;  1SLJ A;  1E1O A;  2C35 B;  1MIU A;  1VCI A;  2PI2 E;  3KF8 B;  4LF8 Q;  2A1A A;  2VUM G;  3S16 H;  1J5E L;  1MKH A;  3K81 C;  2EXD A;  3EBE A;  4R1J A;  3PF4 A;  2R93 H;  3U50 C;  1L2F A;  2EIF A;  3DLL A;  1PH7 A;  2KHJ A;  1SR3 A;  1WCM G;  4JI6 L;  1X9N A;  1KAW A;  5H1S E;  4A3E G;  4JYA Q;  5AJ3 Q;  3H15 A;  4LF7 Q;  2JEA I;  4X6A H;  4YCV A;  1Y1V G;  1CKN A;  3S2D H;  3U58 A;  5C44 G;  1CUK A;  5GQO A;  4PMW A;  3H0G H;  3RNU A;  1N34 Q;  3S2H H;  1L0W A;  1X3G A;  2RCN A;  4GNX A;  3AQQ A;  1V43 A;  4DR3 Q;  5GAG C;  4BXX H;  2YTV A;  4OO1 I;  3AFQ A;  4JI2 Q;  3JAM i;  1E22 A;  1IBM Q;  1V1Q A;  4NXN Q;  1SMX A;  1MJE A;  3KJP A;  2R7F A;  1N36 L;  1KD1 C;  3B6Y A;  1SRU A;  3HKZ E;  2VS1 A;  1VQJ A;  1GO3 E;  3G48 A;  1HH2 P;  1OXV A;  3PGZ A;  4JI8 L;  4DV5 L;  1WYD A;  2NVY H;  2WFW A;  5GRO A;  3OW2 A;  3GTP H;  4LFB Q;  4JV5 L;  5M3F H;  5IYB H;  2OQ0 A;  1W3S A;  2MO1 A;  4DV3 L;  4HIO A;  3RN2 A;  1VQO A;  1PA6 A;  1QVF A;  4A3D H;  1JMC A;  2IX0 A;  4B3S Q;  2IX1 A;  1K3R A;  2UXD L;  1XMO Q;  2OWO A;  2F52 A;  3S1Q H;  1JT8 A;  1LUZ A;  3A74 A;  4XIG S;  3GTJ H;  3CME A;  2ZTC A;  4JI0 L;  1N32 Q;  4JBK A;  1YIT A;  3H0G G;  4YHH L;  4UP7 A;  4AQY Q;  1E1T A;  3KF6 B;  2NVQ H;  1LTL A;  2B29 A;  5IYD G;  2UXC Q;  4RG1 A;  4LFC Q;  1CKN B;  4BXX G;  2NN6 G;  5IYC H;  4IO9 A;  3UDF A;  3KJO A;  4DR2 L;  5GAH C;  4NB3 A;  3J81 c;  1E3P A;  1V9P A;  1PH2 A;  3FP9 A;  1XMQ L;  4QY7 A;  1HNW Q;  1L1O B;  2PMZ E;  1YHQ A;  1X54 A;  4GN3 B;  5C3E H;  1PV4 A;  1YZ6 A;  1IYJ B;  3HOX G;  4DUY L;  2YTY A;  5IYB G;  1G51 A;  2RF4 A;  3S24 A;  4A3D G;  3KFU A;  4NXM Q;  3M4Q A;  2JA7 H;  2E8G A;  1PH3 A;  3GO5 A;  3PF5 A;  4LF5 L;  3HFZ B;  1IBK L;  3T1H L;  2ALY B;  1GD7 A;  4JC0 A;  1A0I A;  3CPW A;  4GN5 A;  3WWV A;  4LF9 Q;  1I5F A;  2BH8 A;  3HKS A;  4LF8 L;  2JQO A;  2BH2 A;  2R7Z H;  4DUZ L;  1KL9 A;  1VQC A;  5IYC G;  3EIV A;  2NZH A;  4B3T Q;  1UE1 A;  2PI2 A;  2A19 A;  1YBY A;  2I0Q A;  3PUV A;  1XJV A;  1EUJ A;  1A62 A;  4R4T A;  5M5Y H;  4AYB G;  1WFQ A;  1Y1W G;  2JEB I;  4LF7 L;  4IPD A;  3MXN B;  3GTM H;  5EAY A;  1FL0 A;  3CPF A;  2K14 A;  4H02 A;  1N34 L;  1IBL Q;  1VQ6 A;  3ERS X;  5GAD C;  4DR3 L;  3PSI A;  4A3I G;  3PUW A;  2JA6 H;  4AH6 A;  4JI2 L;  1K83 H;  1VQH A;  2NN6 I;  2WAQ E;  1IBM L;  4JG2 A;  2Q2H A;  3I2Z A;  2UUA Q;  3L7Z C;  3CCL A;  1BVS A;  1PVO A;  2ID0 A;  5J3B A;  2WP8 J;  2HQL A;  2N49 A;  3OTO Q;  3KDF B;  1D8L A;  3GTK H;  2QGQ A;  3I4O A;  4KHZ A;  3TQY A;  4EX5 A;  1TWA H;  2ZM6 Q;  2R7Z G;  4DV0 Q;  4LFB L;  1PH6 A;  4R4I A;  1GM5 A;  1FJG L;  2HHH L;  4B3S L;  4A3B H;  4BBS H;  1XMO L;  2Z0S A;  2UU9 Q;  4LWC A;  1VQM A;  1N32 L;  3T1Y Q;  3G71 A;  1Q81 C;  4AQY L;  3PUZ A;  4P75 A;  1Q1B A;  4KHP L;  5C4J H;  4B3R Q;  1H95 A;  1EIF A;  2UUB Q;  2B63 H;  2UXC L;  5C4X H;  1KXL A;  3HOZ G;  4YWM A;  1YIJ A;  4DR7 Q;  1HNX L;  4C3I H;  3W1B A;  5FJ8 H;  3A0J A;  1YNX A;  3K7A H;  3OYY A;  1Q1E A;  1KRT A;  4IPH A;  4JI5 Q;  1WOC A;  1U5K A;  4IPC A;  3TS2 A;  2ASB A;  1G29 1;  3ULP A;  4BY7 G;  1VQP A;  4UPA A;  2CWA A;  2R7D A;  1HNW L;  1E24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...