4A3FG

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid and soaked with ampcpp
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 28
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3fG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3fG01
3OW2A 4AQYQ 1LUZA 5C4XH 1GM5A 3L0OA 1C7YA 2OTJA 1NMFA 1PH2A 4RMFA 4DV1L 1PV4A 1HZ9A 2JA9A 4A93G 4JI8Q 2IY5B 3A0JA 1S3OA 5IYCG 1VQLA 4A3KH 1FJGL 2YTYA 1M1KC 4HIOA 1WOCA 4GLVB 5AJ3L 1Q81C 4DUZQ 2WAQE 3BZCA 1OXXK 5EAYA 3W1BA 3KF6A 3PUXA 3W1GA 3RZOH 3PIPA 3STBD 1JJGA 4AYBE 4DR3L 3HOXH 1U5KA 3M85A 3DLLA 3RR5A 3PF4A 1QVGA 3AFPA 1IBLQ 3OYYA 5IWAQ 4A3GG 2HIXA 2BA1A 1Q7YC 4DR2L 2A1AA 5C0XI 4BY7G 2CQOA 3CW2C 3KFUA 3I2ZA 1IL2A 1YHQA 1HZBA 1IBKL 4X62Q 1A8VA 2DGYA 1E1TA 2Y0SE 1K9MC 4JYAQ 2JA6H 2UXBL 3PO3G 3RNUA 1FL0A 1D7QA 3B6YA 1CSQA 2GVAA 5IY0A 3M3YH 1XNRL 4KI0A 4A75A 3Q8DA 4QJFA 4JBKA 2MNAA 1UEBA 1N33Q 5GAHC 3S24A 4IOCA 3UE1A 2VQEL 4LF6Q 4OWWB 4HJ5A 2VS1A 2PQAA 2OQKA 2NVYH 2MO1A 3D31A 2Q2HA 1SR3A 1I94L 4JBMA 2B63H 3CCJA 4A76A 4A3EH 2JA5H 2N49A 1VQGA 2VUMG 4B3TL 4B3SQ 4JI1L 2RF4A 3KYHC 1SFOH 3UDFA 5LMNQ 4DK3C 1VQFA 2R7ZH 1P8LA 2KBNA 2AMCB 2UUBL 2NZOA 1PA6A 4X6AH 1I3QH 1HNXL 1L1OC 2JA7G 4DV3L 1VQ8A 1K8GA 4DR4Q 3H0GH 4YY3L 1XJVA 1O7IA 1EQQA 4P71A 2F3IA 2IT1A 1UE6A 4B3RL 1UE7A 4JI4L 3I4NH 1E7ZA 4P72A 3I55A 4HIDA 1XMOQ 1IBML 3HOZG 3RN5A 1WCMH 2N78A 3G6EA 1YI2A 1V43A 3CMEA 2IHFA 4A3CH 2OCEA 3CCQA 1N8RC 1A0IA 2UU9L 1TXYA 2XGTA 4C2MH 4DV0L 4DV5Q 2UUAQ 2YV5A 4LF7Q 3I4MG 1E22A 2ZTEA 5GQOA 1WYDA 3UDXA 5IP9G 4HIMA 4L5RC 1VQHA 3U50C 4ME3A 1K0RA 4BY1G 4OX9Q 3FHWA 4JV5Q 3PIOA 1Q46A 2NVXH 4JI7Q 3H3VI 3PGZA 4DV7L 4GN3B 3VDYA 1CKMA 1HJPA 1V9PA 3D0FA 4PZ6A 3CCMA 1R9TH 4C3HH 3T1YQ 3J80i 3HKZG 4DR7L 1XPUA 4IJLA 3CC7A 1WI5A 1HNZQ 4LFAQ 4JI0L 1OXVA 4TQUS 2UXDL 2A19A 2Z6KC 4DV6L 1T9HA 2LXJA 4IPHA 1L1OB 3A74A 1CUKA 1S72A 3PO2H 4GKJL 4JBWA 3E0EA 1Q8KA 4R1JA 1B70B 1YJ9A 3HOVG 1WFQA 5GROA 3ZJYC 1XMQQ 1HR0W 2ES2A 4DUYQ 3T1HQ 4LF5L 4A3LG 4B3ML 1PH9A 1SE8A 2I5HA 2AWOA 3GTGH 3G4SA 1Y1VH 1K83H 4LUZA 4BA1I 1Q82C 3S15H 1NBWA 3HOWH 1C9OA 2HQLA 2H5XA 4P75A 3AQQA 1X9NA 1I6HH 4DR1Q 4DV4Q 1AH9A 4LF9Q 2HHHQ 2Q2IA 3PUYA 1L1OA 3UE0A 5IYDG 2D0OA 3PCOB 1JJCB 1YIJA 1ASYA 1GVPA 1KRSA 2JEBI 1PFSA 1U0LA 3M4QA 1HR0L 1HZAA 1EUJA 4NXML 5C3EH 1VQKA 4A3BH 1VQOA 5C0XJ 1E1OA 2UUCL 2F4VL 4LF4Q 1TWCH 4JI3Q 3HKSA 3BJUA 2HT1A 2WB1E 1PH5A 4A3IG 3G48A 1YVCA 4X65L 2ZM6L 3PF5A 5C0XG 2D0PA 2IHEA 4IFDI 1Y1WG 4LW1A 2N8NA 5FJ8H 4LF8L 2JK8A 4UP7A 1JB7A 3HKZE 1BKBA 4DR6L 1IXRA 2CWAA 4MNOA 3DM3A 1X6OA 3F2DA 3KDFB 2R92G 1YEZA 2ATWA 1D8LA 5H1SE 2ZTDA 3BZKA 3EIVA 1AE3A 2GN5A 1VQ9A 4MTNA 4BBSG 2K50A 4BXXH 1TWHH 3KF8B 3KLWA 4EQ5A 4QY7A 3J7ZC 3CCSA 1QUQA 3U4VA 3S2HH 1HZCA 2OWOA 2VQFQ 4AQYL 1N34Q 4JI5Q 3S1MH 1HH2P 1EIYB 2N3SA 4R4OA 1K3RA 2KHJA 2Z6KA 3CXCA 1OXSC 2E5LQ 3KOJA 4YCVA 3F2CA 2IX0A 1SLJA 3F1ZA 4JI8L 1N9WA 2I5LX 4A3MH 5M3FG 2EXDA 2DUDA 3HOUH 4NXNQ 2WP8J 2YTVA 1B8AA 4KLKA 4JI6Q 3J7A5 1N32Q 4DUZL 2JA8G 2VNUD 4YWMA 1LTLA 1QZGA 3CCVA 2K4KA 3FKIH 4PZ7A 3H15A 1PVOA 1AE2A 3TS0A 1VQPA 1SROA 4JI2Q 1LYLA 1JJ2A 4L5SA 1IBLL 5IWAL 1MKHA 4A4IA 1JMCA 2E2IH 1UE5A 5BR8Q 4NB3A 4TVAB 4XTCS 1QVFA 5C44H 4AH6A 3TQYA 1KIXA 4X62L 1J6QA 2B3GA 2ZJRA 1XNQQ 4JYAL 1CKNB 4UP8A 1QVCA 2YYZA 3CD6A 3GTLH 2RHQB 2BH8A 2R6GA 4A3DG 5LMNW 1VQ7A 1MIUA 1VQ4A 3K80C 4DAYB 1OXTA 4BBRH 5M3MH 1N33L 4LFBQ 3CC4A 2R7DA 1Q1BA 4HJ7A 3L2PA 4LF6L 1VQIA 5LMUQ 2VZAA 1ASZA 1VQBA 5IE8A 3J81j 1KAWA 1I5FA 4GS3A 3ULJA 1KL9A 4J15A 4RG1A 4DR5Q 1TWGH 1BBUA 2JE6I 4QGUA 2UXDQ 3MXNB 5ELOA 4X64Q 4B3SL 2JQOA 3RLFA 2Z0SA 4YWLA 2K5HA 2CWPA 5FLMH 2R93G 4GN4B 5IYBH 5LMNL 3RZDH 1VQ5A 3S14H 3HOYH 4A3JH 3CAMA 4KHZA 3UDIA 3K8AA 4UP9A 3J80c 2JEAI 4A3FG 1G291 2K52A 3W5OA 4P73A 2PI2A 4A93H 4BA2I 1FGUA 2E2HH 4DR4L 2OQ0A 4JOIC 5IYCH 1CSPA 4GKKQ 1A62A 2FXQA 4POGA 4IJHA 1N36Q 1G6PA 2AKWB 5C4XG 1HNWQ 1VQDA 2K75A 3MEFA 4JBJA 1KD1C 4R4TA 4R4QA 1VQJA 1XMOL 5M5WH 1E3PA 2LXKA 4OO1I 3GO5A 3U58A 2MQHA 3I4OA 2VW9A 4A3KG 1GKHA 1P16A 1MJEA 2NN6I 3S17H 1EWIA 3CQZH 1G51A 3NEMA 4DV5L 2UUAL 4LF7L 2KENA 1VQEA 3AEVA 4A3GH 1MJCA 1L0WA 2ALYB 4OX9L 4JV5L 3GTOH 5JJLA 4BY7H 3HOXG 1DGSA 4YCWA 4IFDJ 4JI7L 3PUWA 1C0AA 4X66Q 2VY3A 3S2DH 3PO3H 1V1QA 3T1YL 1KQSA 4Y7NH 1HNZL 4LFAL 4IFDG 1JE5A 3NELA 3E9HA 1B7YB 1J5EQ 1VCIA 2JA6G 4Y52H 2IX1A 2HIVA 3GTKH 1EYGA 4KHPQ 1TWAH 4ALPA 1EFWA 4YHHQ 2QGQA 1XMQL 4L5QA 2UXCQ 4JC0A 2WAQG 4DUYL 4DV2Q 2BA0A 2VUMH 4IPGA 1H95A 5JEAJ 3STBC 4AYBG 3J81c 2B63G 2B29A 1X54A 3ERSX 3S1QH 4A3EG 2JA5G 2MFIA 4GOPC 4LFCQ 5JEAG 4UY8C 3I7FA 4DR1L 2K14A 2KCMA 3FP9A 4DV4L 1W2BA 3OTOQ 4LF9L 2BH2A 2HHHL 4K0KQ 3GTMH 3AFQA 1XPRA 1K8AC 2JA7H 1YJNA 4LNQA 1VQMA 1KXLA 2R7ZG 4JOIA 2Y0SG 1PH3A 2E2JH 4JI3L 4LF4L 4DV1Q 2CCZA 1YBYA 3J81i 4H02A 3HOZH 1YHAA 3H0GG 3CF5A 2CKZB 1FJGQ 4R4IA 3KF6B 3G71A 1NE3A 4HJAA 3I4NG 5AJ3Q 3M9BA 3I4MH 4YCUA 1WCMG 4AIMA 5IP9H 4DPGA 2NVQH 4A3CG 3EBEA 1YZ6A 1UWVA 4BY1H 1X56A 2C35B 4DR3Q 1XPOA 4O2DA 2MO0A 3PUZA 4FDBA 1VQ6A 1PYBA 3NBHB 2EQSA 1TWFH 1XTDA 4OONA 4DR2Q 3KDFA 3A5UA 2OTLA 4GOPB 3LGJA 2VQFL 1N34L 4JI5L 2NVTH 3JAMi 2JJQA 1IBKQ 2E5LL 5IP7H 4R4CA 5K36G 1PH6A 3HFZB 2UXBQ 2EIFA 4POFA 2VL6A 2YU9H 1KRTA 3S1RH 2PNHA 4DKAC 1PH7A 1XNRQ 3M7NA 4NXNL 3CPWA 4C3JH 3K0XA 2PQAB 4UPAA 3GTJH 4JI6L 3GTQH 3HOVH 1N32L 2VQEQ 3PO2G 4OWTB 4A3LH 2V1CC 5IT9c 2NZHA 1LM0A 5J3BA 3RN2A 4JI2L 2AWNA 3PUVA 1I94Q 2RCNA 1QZHA 2XTIA 4MZ9A 5E7NA 4GOPA 1SRUA 1E24A 3S1NH 5BR8L 1WJJA 1Z47A 3JC66 4B3TQ 1Y14B 5JJIA 1OXUA 2Q2UA 4JI1Q 1VQNA 3ULLA 1Y1VG 3IRBA 1EOVA 2E8GA 5IYDH 1Q12A 1SMXA 2A8VA 1XNQL 3EN2A 3CC2A 3HOWG 4OO1G 1PH4A 3ICEA 2UUBQ 2NN6G 3GTPH 2KCTA 1Q1EA 3F8TA 5M5XH 1HNXQ 4DV3Q 1BBWA 3S16H 4LFBL 2GVBA 1CKNA 2LSSA 4YY3Q 1VS0A 3I56A 3CMAA 1RL2A 4IPDA 5HGQA 4A3IH 4JCVE 5C3EG 5LMUL 4A3BG 4IOAA 1PH8A 1NJIC 2D62A 3F2BA 4OWXB 4JI4Q 4B3RQ 5GAGC 4PG3A 1Y1WH 2F52A 1IBMQ 4L5TA 3K7UC 4HIKA 1X3FA 2ID0A 4YWKA 3SGIA 2RHSB 4DR5L 4GNXC 1JT8A 2QA4A 2UU9Q 2R92H 5HY6A 4X64L 1L2FA 3RLOA 4DV0Q 3A5ZB 3CP0A 5FJ8G 1PHJA 1M90C 1FVIA 1VQCA 1GO3E 3E9IA 4NPSA 4BBSH 3L7ZC 2WFWA 3CCRA 1PYSB 1EIFA 1YITA 4APVA 1W3SA 1SN8A 3ER0A 1BVSA 2PI2E 4O0AA 2Q2TA 1NY4A 4DV7Q 3CCLA 4DAMA 4BXXG 4PZ8A 1X3EA 2ZTCA 4P74A 5M3FH 4GKKL 4EX5A 3TRZA 1NMGA 1N36L 4JI0Q 4QL5A 1HNWL 4GLAC 4DV6Q 1A63A 2JA8H 4A3MG 2WB1G 5GADC 1RIPA 2ASBA 4GKJQ 1PH1A 3HOUG 1Q86C 4PMWA 1YNXA 1OTCA 3PSIA 5C4JH 1YHBA 3CPFA 3TREA 3PV0A 4LF5Q 2R7FA 1YJWA 3FKIG 2YTXA 4B3MQ 1IYJB 1I50H 4WJ4A 1EQRA 3M4OH 4GNXB 1IZ6A 1NTGA 3K7AH 5IP7G 2QEXA 3BU2A 3CCEA 2KHIA 5DLQE 4X66L 3T1HL 4JG2A 2ZJPA 4A3DH 5GAEC 5C44G 3AYHB 4XIGS 2PMZE 4DK6C 3KJOA 4IO9A 4DR7Q 4OXPA 1J5EL 4QIWE 1X65A 1HR0Q 3K81C 4LUVA 4NXMQ 4LUOA 3UDGA 4KHPL 1UE1A 2K5NA 3M4PA 3RLNA 2UUCQ 2F4VQ 3GDEA 3H3VH 4GN5A 4YHHL 3CCUA 4BBRG 5M3MG 2UXCL 3TS2A 4IPCA 3WWVA 4X65Q 4DNIA 3NENA 2I5MX 3TEHB 2ZM6Q 4DV2L 4GNXA 3ULPA 1Z9FA 3GD7A 4LWCA 1S40A 2R93H 4LF8Q 2K5VA 1X55A 1K73C 5M5YH 1VQAA 4DR6Q 2I0QA 4LFCL 1X3GA 3U4ZA 1QUQB 4HJ9A 1GD7A 3JAMc 4A3FH 5FLMG 4HJ8A 3OTOL 1KC8C 1KHIA 2L15A 4QQBX 5ELNA 5IYBG 2CFMA 4K0KL 3KJPA 5FLXc 4WJ3M 5JJKA 3HOYG 4C3IH 4A3JG 4GLXA 1CKOA 2AHOB 2ZJQA
chains in the Genus database with same CATH superfamily
4AQYQ 1HFGA 1F2ZA 3FPUB 2NVYB 4UHVA 4RMFA 3SVMA 4A93G 2JA9A 2NBFA 4A3EB 3EVQA 1BF4A 1XMQH 3EPIA 4HIOA 2ZDHA 2W6ZA 1NSNS 5DQGA 1S5DD 5EAYA 2R7ZB 3MA2B 3K5OA 1F9QA 4RU9A 4DR3L 3HOXH 5EWGA 3M85A 2VXWA 2YZMA 3AFPA 3H09A 3IFTA 4A3GG 2BA1A 1Q7YC 2A1AA 5HGTA 4QMGA 2MGSA 3CHBD 2CQOA 3CW2C 1TS3A 3QZ7A 1B3QA 3NWSA 2Y0SE 2JA6H 3BQ0A 1CSQA 1RTOA 2HDLA 2UVWA 4GC7A 3UQ8A 1ZHSA 1KNEA 4JBKA 5DLFA 4RCOA 4IOCA 5KFAA 2RSNA 3A8IE 3ND8A 2R92A 4FF2A 3K57A 1EYDA 2XNAC 3MXUA 3NBIA 1S10A 4A76A 1ET9A 2JA5H 3F8NA 2F0VA 4RUAA 1XDNA 4DV1H 5JEAH 3GIKA 3Q8RB 1TY0A 4B3SQ 2NB0A 4JI1L 1F2YA 1SFOH 3UDFA 1I4XA 2AMCB 3I73A 5FLXL 5LOVF 4A3DB 1I3QH 3E3XA 1L1OC 4DV3L 5KEEA 3OHXC 4DR4Q 4BWGB 2WINB 1EQQA 2KCNA 4P71A 1SNQA 2EXZA 2F3IA 1GOZA 3WOFA 3RN5A 3S15B 3G6EA 4A3CH 3JAME 5CC4A 2Q8TA 2UU9L 2A69D 2UXBH 4C2MH 3L4KA 1EY8A 5ELBA 1EY5A 5GQOA 2SNSA 4HIMA 2RDGA 4L5RC 1VQHA 1Y8PB 4ME3A 5FOBB 3RAXA 4JV5Q 2RDHA 3FHWA 2KEEA 1XNQH 2NVXH 4LSAA 4C56C 4C1NK 1A3VA 4J8QA 1V9PA 1R9TH 5LL6b 1I94H 1XPUA 4IJLA 1HNZQ 1SEIA 1OXVA 4XYQA 5C4XB 2EPBA 3R5FA 1IOVA 2VB3X 1L1OB 1S72A 3PO2H 3MR2A 2CW0C 4GKJL 5IGDA 2K7VA 1FKAH 4A3KB 3RV4A 1Q8KA 4KK7A 4R1JA 3SK6A 1WFQA 3RUPA 1PRTC 1A2TA 3A56A 3R2TA 3RUZA 2ES2A 4J9KA 2EYMA 1HNXH 2BDOA 1SDFA 1PH9A 1SE8A 3S1MB 2AWOA 4NP5A 3GTGH 3G4SA 1Y1VH 1Q82C 4ILWA 2A68D 1NBWA 1FYCA 1C9OA 3SDZA 5CV6A 2NN6H 2SEBD 1NNXA 3U9SA 1AH9A 2C00A 1L1OA 5IYDG 2CZGA 1VQ7A 1ASYA 5JAVA 1GVPA 1KRSA 4K6DA 3M4QA 4ABNA 5JVH3 4J9PA 1HHVA 3QOJA 1UNSA 1UNNC 5C0XJ 1E1OA 2V59A 4JI3Q 3HKSA 4KV6A 1PH5A 2E2IB 2E75C 4O1NA 3PF5A 2PNRC 5C44B 4LW1A 4DL7A 5CBAE 4PQXA 2J6TA 1MSHA 1IXRA 1C30A 3SE0A 1X6OA 3SK8A 2BQRA 2ATWA 5H1SE 3H94A 3BZKA 3EIVA 4X66H 4ED0A 4ZAIA 1EUDB 2EYOA 5JPNC 3JSLA 3KALA 1QUQA 5KFQA 1O80A 4K14A 3R93A 2VQFQ 1J5EH 1ICWA 3D4RA 3LNNA 1K3RA 4R4OA 2E5LQ 2AU0A 4JI8L 2EYJA 2I5LX 1JIHA 3H0GB 2R82A 2WP8J 4HEDA 4AYBA 3I4NB 1N32Q 1JDEA 2JP1A 1JWSD 3NHHA 2VNUD 2DWCA 2LS01 4MV3A 1ZQ7A 2KVMA 1B9MA 2I80A 1GUNA 4Z9CB 3ERQA 1VQPA 2AQ4A 4JI2Q 1JJ2A 4A93B 3SXHA 1DOLA 2EY2A 1UE5A 1RJPA 2UXDH 4TVAB 4EYIB 3TQYA 1KIXA 4X62L 2XC9A 1TT2A 2Q8IB 4JW0A 2ZJRA 1CKNB 2QDLA 3GTLH 4EBDA 1NR4A 2ZXRA 4J1MA 3K80C 4BBRH 1WCMA 1N33L 4LFBQ 3CC4A 1GGOA 3A7LA 1BCPF 2AQ3B 3HS0C 2CHBD 1VQBA 2VZAA 3D6CA 1SYBA 4RH6A 4K5WA 3WDNA 1ASZA 3GTOB 4YAJB 2W6QA 4CDCC 5IGFA 1TWGH 4QGUA 4ZKCB 1B04A 4E4TA 2W9CA 1ILPA 1VQ5A 5L1JA 1B1ZA 3HOYH 1IW7C 3TP7A 3T53B 4FS1A 2NTSA 3T5LA 3J80c 4UP9A 4QW9A 1IBKH 3GP7A 4DGZA 4UCUA 3PR4A 2JEAI 4A3FG 2K52A 3W5OA 4P73A 4TRDA 3IN5A 2E2HH 2A74C 3VPBA 2OQ0A 3P75A 1SBBB 4JOIC 1CSPA 4GKKQ 1A62A 2HD3A 4POGA 1KDAA 1LT5D 1UEAB 1VQDA 3ZYYX 5F9NA 4R4QA 3J7AF 1H9SA 5E4XA 3I4OA 1GKHA 1WSCA 3H4BA 1MJEA 4JYAH 3C1EA 3S17H 4UCVA 3GIIA 1VQEA 4J0MA 4ME5A 2BOSA 1HA6A 3DWAA 4OX9L 3HOXG 5I2XA 5KFFA 4IFDJ 2HGSA 4RGOS 4ZUJA 2OF1A 3LWUA 2K5DA 3C3LA 2VY3A 1A15A 3T1YL 4Y7NH 4YR0A 4I50F 2V4QA 4MAMA 1E2VA 4LFAL 3E9HA 5FKAC 3P7JA 1G91A 1VCIA 5C8YF 2JA6G 2PMZA 4A3MB 4Y52H 2IX1A 4J9QA 2WB1B 4QIWA 1DD2A 3J80W 1VMPA 1EFWA 4YHHQ 2QGQA 4IHJF 1XMQL 1B3AA 3O13A 3GIQA 4CC6A 2UXCQ 2XD4A 3TMEA 2ASJA 4FF1A 3STBC 3IFDA 1UUPA 1NUCA 1X54A 2JA5G 4GOPC 1LTRD 5JEAG 5BMVF 3BA8A 1SXTA 2K14A 4DV4L 1W2BA 1LO5D 3OTOQ 4K0KQ 2HHHL 3GTQB 4O3OA 1XPRA 2JA7H 4LNQA 2EY5A 4JOIA 1L0XB 1SE2A 3BYYB 4KKSA 1IKLA 4F88A 2E2JH 4LF4L 3FPPA 3OUUA 3RMHA 2CCZA 2CW0D 2A6HC 4UCRA 1K8MA 3ND9A 4TQSA 4IRKA 4DFAA 3G71A 1NE3A 3T56B 1PRTD 1PTOH 3I4MH 2UVVA 3J7YW 4DPGA 3LWEA 2NVQH 4A3CG 3K6OA 4BY1H 1JCKB 3GTPB 1X56A 4DR3Q 4ZRZA 5M5XB 1KAAA 3S16B 3NBHB 1QOHA 4OONA 3BA9A 2EJGC 4GOPB 4DR7H 4EVOA 4DUYH 2V4RA 3MXGA 3KF8A 5CGKA 2OXPA 1PXUA 2YU9H 2FPPB 4MV7A 2Y0SA 3S1RH 2PNHA 4DKAC 1PH7A 4RCNA 3M7NA 4NXNL 4KMUC 3CPWA 2KJXA 3HOVH 1SYEA 4FU0A 3PO2G 4TV9F 3MFIA 1LT3D 3RN2A 1D5MC 1S5BD 2ZXOA 5JJZA 3PUVA 4PMBA 4MZ9A 4KN4C 4ZYSA 5E7NA 5K2MA 4GOPA 1E24A 5BR8L 1WJJA 3JC66 4EFEA 4JI1Q 1ESRA 2WACA 1CS0A 3ULLA 1Y1VG 3IRBA 1EOVA 2E8GA 1CA5A 4Q5VA 1SMXA 4ZOLF 3M7GA 1XNQL 2A8VA 2W8KA 2E76C 5IOCA 1PH4A 3ICEA 4HSPA 1F9PA 4MTKA 2NN6G 2KCTA 1IHZA 4X3UA 5KYIA 1PLFA 2X6GA 4DV3Q 1BBWA 3Q24A 5KT6A 2IBKA 5HGQA 2FLPA 1JWUD 1FNWA 5LMUL 3GTKB 3UFXB 3V4SA 3KLSX 1ZXTA 1T5XD 3F2BA 1V4YA 1TWAB 5KG4A 4HQ6A 5GAGC 1Y1WH 3K3PA 2F52A 1L2ZA 3DEOA 4L5TA 2SDFA 2B8FA 2F0FA 2PPBC 1VAJA 5BN5A 2MPMA 2QA4A 2UU9Q 5IWAH 1IBLH 2AQ1B 4X64L 1M90C 2ENBA 2FLLA 1FVIA 4YQWA 2J7ZA 3CRKC 1PYSB 3Q1KA 2XCPA 2YRXA 1EIFA 2EY1A 4CDFC 1K1QA 5G3LD 2Q2TA 5FPRA 1DM0B 1V1PA 3DWQA 3BVZA 4DAMA 4P74A 3GTKA 5M3FH 3TRZA 3OSNA 3OHAA 4NKLA 1N36L 4QL5A 1EIHA 4U68A 4F50A 5GADC 4A2BA 2ASBA 4GKJQ 2EJMA 2VUMA 1PH1A 1Q86C 1AEXA 4A3FB 1YHBA 3OOCA 4OHJA 3TREA 2DLNA 1IL8A 2FK2A 1S03G 2NU8B 3QR8A 1D2BA 5LMNH 1JX4A 2VQDA 1IZ6A 5IP7G 4ECZA 3GTMA 1IW7D 4FVMA 2ZDGA 4X66L 4MA0A 4TKOB 4KY6A 4EEQA 3SI8A 3KLRA 5DG9A 1MBYA 4IO9A 4DK6C 4FBTA 4MTDA 2VPQA 1J5EL 2X69A 4KHVA 3K81C 1XMOH 4KHPL 1PFNA 4DXFA 2B2YC 3HOXB 3GDEA 2IWHA 3GTJB 4Q44A 4BBRG 1TY2A 3MFHA 3G6XA 1GLVA 3NENA 2BCOA 3ULPA 1MD2D 2UUAH 2BE5C 2GPSA 4J9LA 3Q8PB 2R93H 1E0BA 2F0EA 5BPHA 5M5YH 1DV1A 4LH6A 4CJ1B 1HNWH 2JA6B 3UI2A 4OEMB 4HJ9A 2C28A 1KJ9A 2QILA 2K04A 3JAMc 2UXDL 4MTEA 3R23A 4WJ3M 5ELCA 3HOYG 4C3IH 2ZJQA 3OW2A 3KLSA 3GV6A 2KSWA 3L0OA 5D65A 2OTJA 1NMFA 1DYQA 2D2CC 1UC9A 2W6PA 4JI8Q 2IY5B 4FYDA 2JA5B 3VPCA 2J0TD 3MC0B 3L4JA 1D5ZC 1ZKOA 3R5XA 5KFZA 3RB4A 2RDIA 3T1HH 4ECXA 1OXXK 1V1OA 1AZPA 3NTIA 3RZOH 3PUXA 3PIPA 1G2SA 3STBD 4AYBE 3W3AA 5KX5F 5KT5A 1I3QB 3PF4A 4OELB 1QVGA 5L1LA 4CC5A 3BDOA 2HIXA 5IGCA 4DR2L 3N42B 4LF9H 4CKBA 2C2DA 1PZKD 5C0XI 5C6AA 3KFUA 4NMZA 1WTOA 1IBKL 3K0YA 4X62Q 2IA6A 1LTGD 1E1TA 4IRDA 1K9MC 1EIGA 1RKNA 3M3YH 2GVAA 3AMUA 4KI0A 2L9HA 3MEHA 1EYCA 2A6HD 4C2MB 3H3VC 1I6UA 1GYFA 2MNAA 3JAMW 2R8GA 4RKLA 1N33Q 5GAHC 4ODGA 3N52A 4ZQ3A 3BG3A 5GONF 5DQIA 2VS1A 2NVXB 2Q2HA 4Q0YA 3V05A 3CCJA 2Z4IA 4ZHQF 1BOSA 2YRWA 3KHGA 3MWYW 3KYHC 4HR7B 1FJGH 2IMWP 4LMQD 5DQHA 3FEWX 1W6KA 1N34H 4JI5H 3PO2B 2MUYA 2AQ2B 2UUBL 3RGXA 2JA7G 4XZ3B 1VQ8A 1XJVA 3GV8B 5ELFA 2B2WC 4JI6H 5C5MA 1UE7A 4RB0A 1BCPC 1E7ZA 4P72A 3GTGB 2F0WA 3I55A 4HIDA 2XCLA 2M00A 1I50A 2IHFA 4QWDA 4HR7A 1A0IA 5DG8A 2XGTA 4DV0L 2YV5A 5CV9A 3I4MG 1E22A 2F0TA 2PYKA 3DXJC 4RA8A 4BY1G 4OX9Q 2YL2A 3PIOA 1Q46A 2ICEC 3H3VI 1SMYC 1C8CA 5K36H 1IYVA 2AUKA 2RKSA 3D0FA 4GN3B 4I65A 4PZ6A 3CCMA 4EBEA 3T1YQ 3HKZG 1WI5A 3PW2A 1JWMD 4LFAQ 5KG7A 5KFEA 2A19A 2Z6KC 3N44B 4ECRA 1RJTA 4IPHA 1CUKA 3G6VA 1WTVA 4JBWA 2KECA 1I4RA 2XRSD 1BCPB 3HOVG 5GROA 1GUOA 2B8GA 1XMQQ 1Y8NB 4R8IA 3T4AC 1SNCA 4YY3H 2C2EA 3AU7A 4KY5A 1JR0D 1BNCA 1SYDA 4B3RH 1CK1A 4OO1H 4RGMA 3RGZA 1I4HA 5EWEA 2HQLA 2H5XA 2XSCA 1X9NA 3V6JA 4DV4Q 5CV5A 2HHHQ 3MJFA 4DR7L 2D0OA 1JJCB 2JEBI 3VYTA 2B2WA 3V2TA 1EUJA 1HR0L 1XWEA 5C3EH 4NXML 1VQOA 5JH7F 2UUCL 2SCUB 4LF4Q 1TWCH 3OSOA 3BJUA 2WB1E 4WFN3 1PZJD 5D14A 1EY7A 2WAQB 1KBLA 2D0PA 3M4IA 4IFDI 1Y1WG 2N8NA 3HGBA 5FJ8H 4LF8L 5EBDA 2B63B 4DR6L 3GTLB 2R6FA 5EQ0A 3KDFB 1HQRD 2EY6A 1YEZA 4QUCA 1J8IA 5LYJF 2GN5A 2IW3A 4BBRB 1FR3A 1ILQA 2K50A 4BXXH 1TWHH 3KLWA 2YZGA 4QY7A 3J7ZC 3S2HH 1HZCA 2R87A 3T51B 1HH2P 3CXCA 2KHJA 1AP0A 2Z6KA 3JZIA 1SNPA 2KCCA 4YCVA 3F2CA 3F1ZA 1SLJA 2WAQA 1JLLB 4XQQA 5M3FG 4O4LF 1TWGB 4IR1A 3HOUH 4NXNQ 2NVYA 3OHBA 2YTVA 4ME6A 3J7A5 4DUZL 4G7OC 5DLGA 3X3MA 2R7LA 1GUWA 3HOYB 2BE5D 3CCVA 1EQTA 4PZ7A 3BJYA 4O4IF 3FDTA 3TS0A 1LYLA 4LFCH 3T5KA 1IBLL 5IWAL 4A4IA 2E2HB 3EA6A 1JMCA 2R7ZA 2CH4A 5BR8Q 4NB3A 1B6RA 4YP3A 3MR3A 3QWNA 5L1IA 4CKEA 1JQYD 3VR5A 4AH6A 4X65H 2WKCA 3K5LA 2FPIB 5DM63 3NQTA 1AN8A 2B3GA 1XNQQ 1B33N 5KFSA 3MWMA 1MIUA 3S17B 4RNOA 4DAYB 1S97A 1OXTA 5IGEA 1B50A 5M3MH 1EYAA 4HJ7A 1VQIA 4ED1A 5LMUQ 2W6MA 1BXTA 2V5AA 5IE8A 1SYFA 1KAWA 3N8DA 4X3SA 4EGJA 1F2LA 4ID6A 3ULJA 3VR3A 1BNZA 4DN4M 4RG1A 2XN9C 2K32A 4Y7NB 3V96A 3MXNB 4X64Q 2R93G 3QB3A 2Z9HA 4YWLA 1K83B 5IYBH 5LMNL 4R8UB 3OMCA 4OIJA 5CORA 3SEBA 3NTKA 3S14H 2WV6D 1ULZA 4F4XA 2XWJB 4ZUIA 5KFYA 3UDIA 1CZWA 5T14A 1G291 1I4PA 4J9MA 3DM1A 1FGUA 1XNRH 4C3IG 5IYCH 2FXQA 4IJHA 2H4OA 1N36Q 2ICIA 4JBJA 4R4TA 3GIDA 1XMOL 5M5WH 4YB8B 5KFGA 1S5ED 1JC7A 5DAUA 1V51A 2C22A 1EU4A 1K83A 3CQZH 4DV5L 5KIXA 2UUAL 4LF7L 2JA7B 2KENA 4ZQIA 5FO9B 1T5EA 4ZK9B 1CTMA 3GLKA 2ALYB 1QJOA 4BY7H 2E2JB 5KFTA 4JI7L 3H20A 3SK5A 4X66Q 3S2DH 2W9BB 3I12A 5FPOA 1V1QA 3DUZA 1KQSA 4QWCA 2DNEA 2FLNA 1MSGA 4JV1A 4OL7A 1JE5A 3I4MB 1E4GT 4YJ2F 1J5EQ 2F0OA 1JB3A 4HN7A 2RA4A 4KTAA 2HIVA 2K01A 1BCPD 1NAPA 4MV6A 1IBMH 4DNRB 4KHPQ 1L0YB 4X3TA 3GILA 5KFKA 1KDBA 2F0UA 4JC0A 4F7XA 3OIQA 5EDWA 2BA0A 1PFBA 3FKIB 3HKZB 4IPGA 4KN7C 5JEAJ 1H95A 3PW5A 4Y8VB 2EYFA 5CR3A 3S1QH 3P20A 2MFIA 3NE5B 2YU9B 5A2QW 3RB0A 3S1RB 1EHIA 2HCIA 4DR1L 1SMYD 2KCMA 2WDTA 4DV7H 1II3A 2BH2A 4LF9L 3H91A 2UXDQ 1YNNC 3AFQA 3MR5A 1LV9A 1ENCA 1YJNA 4JI0H 5TSSA 2Y0SG 4DV6H 1EEID 3PQIA 3HOZH 1YHAA 2R85A 3CF5A 3HB9A 3FKIA 2CKZB 4R4IA 1S0OA 3KF6B 2CH4W 2O5JC 4HJAA 2FPGB 4YR2A 1GJXA 4B3MH 1SSOA 3RTXA 2E2IA 5IP9H 3GIPA 3E6ZX 5D3DA 3EBEA 3EJIA 1UWVA 3GQCA 2C35B 1EYZA 1S9FA 4O2DA 3D4DA 5C1PA 2MO0A 3HRZC 1LTTD 3I72A 4FDBA 1VQ6A 2OTLA 1XTDA 4L63B 3SHLA 4DR2Q 4A3JB 3VMMA 3IAYA 1N34L 4JI5L 2NVTH 2K28A 4ED3A 1Y1WB 1IBKQ 4A2AA 5IP7H 4R4CA 5K36G 4JK1C 1PH6A 2F4VH 2EIFA 4POFA 2VL6A 4RAYA 4ETSA 3DHQA 4C3JH 1JOOA 2PQAB 3WOEA 4JI6L 1KEEA 3H0GA 3S9WA 2NZHA 1A3TA 2BDNA 2Z1CA 1XYIA 1BGWA 5D3IB 2AUJD 2RDJA 2L5TA 2AWNA 3TN2A 1WTHA 3S1NH 1SRUA 4JI3H 2C5CA 3J81L 5M3FB 1Z47A 4A3GB 5IGGA 4CBVA 1N48A 5JJIA 4I4TF 1VQNA 2ALZA 1WTWA 4OO1G 3EN2A 3RD4A 2JEJA 2UUBQ 5I4DA 4V0BA 1WTXA 3ORQA 4KJNA 5KFJA 1CKNA 3CMAA 4A3IH 1VS0A 3I56A 4O42A 5C3EG 2A5HA 4O3QA 3I90A 4ZLTF 4EFBA 4PG3A 3JRWA 1STGA 2VQFH 1KDCA 2DJGC 3FDSA 3BYTB 2PW5A 4DR5L 1MHWC 2E5LH 2RHSB 4RNMA 1JT8A 3GTOA 2R92H 5HY6A 3RLOA 1LABA 4DV0Q 3A5ZB 5FJ8G 1PHJA 1X3PA 1TIID 1VF7A 1GO3E 5KG0A 4BBSH 3L7ZC 2WFWA 3LWBA 4FO2A 3OIPA 4IR9A 1N32H 4ECVA 3KHRA 1E4FT 2KQ3A 3MHBA 1W3SA 3ER0A 1BVSA 2PI2E 3TIIA 2V9WA 2YZNA 4Q45A 5F9LA 3EPGA 4BXXG 3VPDA 4PZ8A 2ZTCA 4S3SA 2JEIA 3ETJA 1HFNA 3KTMA 2QF7A 3G6JB 2DNCA 5LHY1 4LF6H 2R93B 2JA8H 1E4EB 5M5YB 1CQJB 5EZYF 3D6WA 1JXLA 2QK4A 3OUZA 2R3ZA 4ULLA 3HOUG 1YNJC 1YNXA 4G57A 3TZDA 3K5NA 1OTCA 5IT9L 1LT4D 2FJ2A 1QE6A 2B39A 2BQUA 4C3IB 2R7FA 2YTXA 3R3OA 5IODA 4WJ4A 4LFBH 3M4OH 1NTGA 1SNMA 2QEXA 2KHIA 2QW7A 5DLQE 1AW7A 4WJWA 2ZJTA 4WORA 3RFCA 3PZPA 4JG2A 1TWFB 1DZ1A 2OEOA 4A3DH 3QG1A 1KC7A 2W6NA 5I47A 1EY0A 1Z6HA 3CKIB 3KJOA 4DR7Q 4RB1A 3GIMA 2NUAB 4I7AA 3BS1A 1VBHA 2HVSA 1HR0Q 4LUVA 4NXMQ 3RZOB 5DEHA 3UDGA 3M4PA 3RLNA 2UUCQ 2L1BA 2E74C 4UFZA 5M3MG 4M9UA 4WRDA 2VOBA 2WB1A 3WWVA 1LTID 4DNIA 3TEHB 2NZ1D 4C5BA 4PV1C 1KLUD 2FKLA 4LF8Q 2WTFA 1X55A 1K73C 1ENFA 4DR6Q 1TWFA 1E2WA 5KG6A 5IGBA 2I0QA 4LFCL 1X3GA 3M3YB 1DIKA 1C3OA 2HQEA 2IP4A 1GD7A 4JV0A 4QQBX 1FD7D 1KHIA 5ELNA 5IYBG 4APMA 3KJPA 5FLXc 1WH2A 5JJKA 1N56A 4GLXA 1CKOA 2AHOB 1LUZA 5C4XH 1GM5A 1C7YA 3GTQA 1PH2A 4DV1L 1PV4A 4MV4A 3G6YA 1CA6A 5IYCG 2YS6A 4A3KH 2F0QA 3TSSA 1LLRD 5CA1F 1M1KC 1R4PB 2KHSA 4LH7A 1Q81C 1WOCA 4DUZQ 1GHJA 2WAQE 4EG0A 2FMMA 3BZCA 4R7RA 3W1GA 4FF3A 1JJGA 1GSHA 3K58A 2V58A 1U5KA 3RR5A 1AUVA 3KXYT 1SE4A 2J4XA 4K2KA 1IBLQ 5IWAQ 1DONA 5IYZF 2PZWA 4C5CA 2KEDA 3A8KE 4YHHH 1EFID 3MFYA 5HV6A 5KFWA 4J9RA 3GTPA 5HBRB 1YNND 4BY7G 1IL2A 2FK3A 2WE6A 3NBHA 5C1OA 1RODA 2UXBL 1HQMC 3RNUA 1GUTA 4RGTA 1D7QA 5IY0A 5J2TF 1XNRL 4F4WA 4A75A 3Q8DA 4QJFA 1SCUB 3V4ZA 4PMCA 4OIKA 3S24A 3G8CA 3C1FA 3IG0A 4OWWB 5FLXW 4K0KH 3TQ1A 1PTOF 2OQKA 4QWEA 2MO1A 3D31A 1TS5A 4JBMA 4BS9A 1I94L 3TP8A 4HSVA 2N49A 1T36A 2WYOA 1M6VA 2D5DA 2KOLA 5J22A 2RF4A 1SJHD 2JEGA 2PO4A 2A73B 1EY6A 5LMNQ 3K7AB 5KFMA 4DK3C 1LTAD 1DCZA 4XDXA 3OW7A 2N88A 1CZGA 2KBNA 2R86A 4L1KA 2UVRA 2NZOA 4X6AH 3HG9A 3N6XA 4KJOA 1HNXL 1ZYRC 3H0GH 1HXYD 1O7IA 4XT1B 1UC8A 1XTCD 2IT1A 5EKIA 2B2UC 3I4NH 3U9TA 1IBML 1XMOQ 3PW0A 3HOZG 1WCMH 2XGPA 1YI2A 2H1EA 1QNUA 4X3KA 1V43A 4FF4A 4QWAA 1N8RC 3CCQA 1TWAA 1TXYA 4DV5Q 2UUAQ 4LF7Q 5LL6S 1WYDA 5IP9G 4IUQA 3AB9A 5AFWA 4IWYA 2B2VC 1LACA 4F4ZA 4I7HA 4JI7Q 3PGZA 3FMAA 4DV7L 4FBUA 3VDYA 1HJPA 1WVLA 5KFIA 4C3HH 4JI0L 2F0IA 4TQUS 4LJZC 1V8QA 4DV6L 1T9HA 2L55A 3EROA 1A3UA 1BDOA 3CU7A 4MA5A 1HUMA 4C3JG 1B70B 4M8AA 2YS7A 3KAKA 1U4PA 3NGDA 4K8JA 5D8DA 1TWHB 3T1HQ 1GUSA 4DA2A 4B3ML 5BN3A 4JUZA 2I5HA 2F0HA 1STHA 4LUZA 4BA1I 1PZID 2YW2A 5D1OB 3HOWH 1I6HH 4P75A 4G7ZC 3MZ5A 2WIIB 4DR1Q 5KFBA 1Z2NX 4ZI7F 1GHKA 4LF9Q 2Q2IA 3UE0A 1YIJA 1STNA 3D3RA 1JORA 4DAPA 2KUMA 5I6YA 1K28A 4TUYF 5KFVA 1HZAA 4A3BH 1IOWA 2B2UA 2F4VL 4ZCKA 1CFMA 2HT1A 1W93A 3VYRA 4A3IG 5DG7A 4EGQA 3G48A 4IWXA 1YVCA 1YNJD 1ZHQA 5L37A 1O7YA 3GTJA 4IUPA 1JB7A 4TV8F 3HKZE 1BKBA 5E1FA 3DM3A 3GV3A 3F2DA 4CKCA 2XIGA 2B2VA 4Q0FA 1NR2A 3TP6A 2R92G 4YAKB 5KT3A 2LY7A 4JV2A 4GKJH 2ZTDA 1SFOB 4BBSG 5M3MB 1PK8A 3K59A 2JA6A 4LMYA 4EQ5A 4O3PA 3PIP3 1TKWB 1TQOA 1K0SA 1N34Q 4JI5Q 4UCTA 2QDBA 1B4OA 2VB2X 3NSWA 1EIYB 1T94A 2N3SA 4ECWA 1PFMA 5DGAA 4A3MH 1N9WA 4J9SA 2R61A 2M05A 1BBXC 4UCSA 1EOTA 2EXDA 3PW7A 1B8AA 2Q8RE 4KLKA 4JI6Q 5J2UF 2JA8G 4DV2H 1HA5A 1LTLA 2I07B 4YWMA 4N8X1 3E5NA 1RYSA 2JA5A 4KY7A 3H15A 1PVOA 1AE2A 1EU3A 5I2YA 3MWEA 1SFOA 2B2YA 1SROA 3RAQA 3GQBA 4H0LC 1MKHA 2V4DA 3Q8SB 3P1HA 3NUCA 4XYLB 5H80A 1ZEQX 4G3IA 1I3QA 4U6PA 5M5WB 5C4HA 2PBZA 1J6QA 3BZDB 4MV9A 4JYAL 2YYZA 5EPJA 3CD6A 1R9TB 1EZ8A 1KTKA 2BH8A 4A3DG 4M7EA 1EEFD 3RBEA 4RHSA 1VQ4A 5KT4A 3CQZB 1G6ZA 2R7DA 1Q1BA 3L2PA 4LF6L 3C2PA 2G9HD 1HUNA 4C2MA 4BY7B 2PVPA 1I5FA 4GS3A 3LMLA 1KL9A 2RVLA 3S2DB 5LL6X 4DR5Q 2GLTA 2W7OA 1H9MA 2C2RA 2JE6I 4DLKA 5ELOA 2NVXA 1CM9A 1I4GA 2JQOA 2Z0SA 1FNUA 2K5HA 5FLMH 1TAEA 1Y1VB 4GN4B 3RZDH 4YBZB 5KFPA 1K8OA 1R9TA 1CHPD 2M9VA 3CAMA 3TQTA 1NCVA 3RB6A 1VDZA 1WTQA 4XQJA 1I7LA 2K6AA 2PI2A 5ELEA 1WTRA 4BA2I 4XYMB 2DPJA 5BN4A 1CHQD 3ITPA 2AKWB 4IURA 4LAAA 5C4XG 3PIO3 3MEFA 3PW4A 2VQEH 3NWTA 2FE3A 1E3PA 1CQIB 3GO5A 2G9DA 3U58A 3S1QB 1SNOA 2VW9A 4A3KG 1O75A 1P16A 3MWDA 3GTGA 2NN6I 1Y1VA 3NEMA 2KA7A 4B3TH 1MJCA 2HVRA 4HTHA 1L0WA 3OPOA 2F0PA 4B9XA 2Z4HA 4YCWA 1C48A 3PUWA 1C0AA 3QO2A 1JKJB 3PO3H 1MI2A 2W8LA 1ZYRD 4JPBW 3NELA 4O3RA 2FHTA 1Y69U 5HURA 3TP5A 4JI4H 3GTKH 1EYGA 1TWAH 4DL6A 4I55F 2OLSA 3I4LA 1AZQA 4RB3C 3Q6SA 2XRQD 4DUYL 3OMGA 2VUMH 4J9NA 2ASLA 2NVTB 4AYBG 3MR6A 2LFNA 4DAVA 3K5MA 4ECSA 1S5CD 2ATLA 3ERSX 3IL8A 3PR5B 4LFCQ 2ZDQA 1W96A 4C3JB 3J80L 3GTMH 1EY4A 4RAZA 4EEYA 3DEPA 2R7MA 2HCCA 4ED7A 1PH3A 2W71A 1HCZA 4ED6A 4KD4A 1STBA 4DV1Q 2EE1A 4OX9H 3H0GG 5CV4A 4MN3A 5KFRA 5JOBA 1TS4A 3N43B 1PDQA 3N41B 1C4QA 2HDMA 4G4KA 3I4NG 1XXGA 3TIGA 3M9BA 3T1YH 4LF5H 2MJ8A 1WCMG 4K6LA 4C1NI 4IQZA 4MIUA 3RF2A 3BAAA 1YZ6A 1M8AA 2I46A 1TS2A 1XPOA 1M0TA 3K5IA 2B63A 1AFPA 3GTLA 1PYBA 4A3IB 2EQSA 3KDFA 3A5UA 3LGJA 2JN4A 1EY9A 3H40A 5A35A 2JJQA 2ZXPA 5I9OA 3VYUA 2JSOA 3L9AX 2UXBQ 2J9GA 5T1GA 4C3HG 5DNFA 2JYOA 1XNRQ 3SE7A 2R92B 4DK1A 3GTJH 3K0XA 3HZXA 4UPAA 2ZM6H 2EYPA 4BBSB 4DV4H 4F4YA 4A3LH 4ECQA 3MXPA 5EGTA 2L0CA 1TWGA 2HHHH 1LM0A 2W70A 2RSOA 4NW2A 1RK6A 4L8JA 2QYZA 4N9PA 1I94Q 1QZHA 2XTIA 4YJ3F 5LXTF 4LF4H 3JRXA 3V6KA 2EYLA 3F2UA 1SNDA 1SYGA 1Y14B 1WR2A 2J6SA 2Q2UA 1FGBD 4R8NA 3OWFA 2JA8B 2E2HA 4AQYH 3LX0A 3CC2A 3HOWG 3L3OC 3RV3A 4Q8EA 3F8TA 1Q1EA 3M9MB 1HNXQ 4NDXA 4F87A 1SEBD 2GVBA 1U9RA 1RL2A 1Z7TA 4IPDA 4DK0A 4IOAA 3T13A 4A3BG 5C0XH 3J81E 2D62A 4OWXB 3M4OB 1PTOC 4DAYA 1IBMQ 1CQVA 4HIKA 4YWKA 4K5XA 3GV7B 1L2FA 1WTPA 5KNBA 1Y8OB 4NPSA 1Q90A 5KFLA 3DF7A 4NXNH 1Q8IA 3CCRA 5KFCA 1STAA 3MXNA 1YITA 4APVA 4G7HC 5CA0F 2QEJC 3MTSA 4R8UA 1KJQA 4DV7Q 3IKJA 5JPMC 4ED2A 3SK4A 4I7ZC 1KJIA 2IL8A 2AGQA 1NMGA 2W9AA 1XX8A 4JI0Q 1HNWL 4RWSC 5BR8H 4GLAC 4ED8A 4DV6Q 1A63A 4A3MG 4FS2A 2WB1G 3J7AK 1RIPA 2CW7A 4RGNA 4UCOA 4PMWA 5C4JH 1PTOB 5FD6A 3PV0A 4B3SH 4IN3A 1YJWA 4B3MQ 1IYJB 1I50H 2NVQB 1DXMA 1EQRA 1JICA 4BY1B 5LMUH 1RDPD 2AGPA 2JA7A 3BU2A 3CCEA 1F9SA 1KNAA 1RHPA 2E2DC 4IZ8A 4IZOA 5KKNB 3T1HL 3MVVA 2M2LA 2ZJPA 5M9OA 5GAEC 4DR4H 3AYHB 2R84A 1A9XA 4XIGS 4IAJA 4OXPA 5IT9E 4X64H 2W9BA 4FXGC 1H9KA 1UE1A 2K5NA 4N8FA 2F4VQ 3H3VH 4J9OA 3CCUA 2R7KA 3HOVB 1Z2PX 4H7BA 4O2AF 4O4HF 4DV2L 2CQAA 4H13C 1B44D 2QCPX 4L6TB 1HPCA 1S40A 5E4WC 2K5VA 5FD5A 1N36H 4JV5H 1VQAA 3A55A 1BXRA 3ONAB 3HKZA 3U4ZA 1LTBD 1QUQB 5EKLA 4FM9A 2FMCA 1ESFA 3KUPA 2C9OA 4EQOA 5FLMG 1KC8C 1BUVT 2F03A 2CFMA 1HNZH 4QB4A 1SJED 3HXLA 2YU9A 1GSAA 2K5WA 5DGBA 2F0MA 1EZ1A 4AYBB 1DOKA 2K33A 1HZ9A 3WO0A 3A0JA 3OWEB 4CJ0B 1PRTB 1S3OA 2W7PA 1VQLA 3C46A 1FJGL 3BABA 2YTYA 3KBGA 4RAUC 4GLVB 5AJ3L 2BR0A 2F0SA 3RJ0A 4QWBA 5LA6F 2G5DA 5J39A 2L4NA 3W1BA 3KF6A 5JQWA 3GIJA 3DLLA 2OT2A 4KHPH 1SYXB 3OYYA 2NTTA 2CW8A 5KYLA 5KG3A 2BQ3A 5EOYA 3N40P 3EQLC 4TSSA 5ELDA 1X3QA 4IFDH 3I2ZA 1YHQA 1HZBA 1A8VA 2DGYA 3VYSA 1CQFA 1WCMB 4JYAQ 5CB4F 3PO3G 3T5JA 3D8GA 1FL0A 3B6YA 4B08A 1Y1WA 2TMPA 1UEBA 2QKIC 5KRUA 2XWBB 3A7AB 3UE1A 2I87A 2NWGA 3Q22A 2VQEL 4LF6Q 4HJ5A 2JXMB 4RUCA 2PQAA 2WKDA 2NVYH 2W9CB 2R7NA 1SR3A 5FO8B 2B63H 4A3EH 2ASDA 2XIWA 3BVGA 4C3HB 1F9RA 1VQGA 4B3TL 2VUMG 5CYUA 4EQPA 1S4ZA 5CV7A 3Q0AA 3JSNA 2IJ0A 1U4LA 1VQFA 4RFBA 1BJTA 2R7ZH 1P8LA 3JAML 2TSSA 4FXKC 1J9OA 2PZTA 1PA6A 2NU7B 1FNVA 4DL4A 3OSPA 1K8GA 4YY3L 4KKTA 1H9SB 4M1UB 4B3RL 1UE6A 3RIZA 4JI4L 1H9RA 4DR2H 1HTPA 2EDGA 2N78A 2F0JA 3HOWB 3CMEA 1I6HB 4JI2H 1S0MA 2OCEA 4HYKA 1RCVD 2DJFC 2ZTEA 1PX2A 3UDXA 2FK1A 2O03A 4WD3A 1VF5C 5E3FA 3U50C 3Q2OA 1K0RA 4A3BB 3NXWA 3MFGA 4DNTB 1AN7A 2YCHA 3I70A 3PN1A 1CKMA 2F0GA 2PMZB 3J80i 3NP8A 2XCAA 4UAIA 4QIWB 3CC7A 3TBIB 1PYWD 4QF4A 2LXJA 3A74A 4KKUA 1I6VC 1PTOD 2MCTA 3E0EA 2FMAA 5KGUA 2R93A 1YJ9A 1E4EA 3ZJYC 1HR0W 1U4MA 2UUBH 1KJJA 1ENAA 5EPLA 2IPKD 4DUYQ 2LMCB 4LF5L 4A3LG 2FP4B 5C4ZA 3FVQA 1K83H 1OO9B 5FK9C 3S15H 4IUNA 1RJRA 2K1BA 4Q43A 2FB9A 3AQQA 1EWHA 2SOBA 3URYA 4K8IA 5IIFA 4RZQA 3D4WA 3PUYA 4GKKH 3PCOB 3HP3A 2PW7A 1PFSA 1U0LA 1U4RA 4RKBA 4DV0H 1VQKA 1CI3M 5KT2A 3TDQA 1H9JA 1EL0A 5I6WA 4LK1C 3E5SA 2VA3A 3T5HA 4X65L 2ZM6L 4B9WA 5C0XG 4U7CA 4ECTA 2IHEA 1GSOA 2JK8A 4UP7A 4EQNA 2CWAA 4HAEA 4MNOA 2F1MA 5C5JA 1SAPA 4HMJA 4XT3B 1D8LA 5EPKA 3LP8A 1AE3A 1VQ9A 4MTNA 1IYUA 4HCEA 3I8ZA 3KF8B 4YIJA 3CCSA 3U4VA 1A6XA 2OWOA 5T1IA 1TA8A 2Y0SB 5JVDF 4AQYL 3S1MH 2GA4B 4GZYC 5DM73 4P2CB 1QVFA 3K3VA 1OXSC 3KOJA 2IX0A 1BO0A 2AGOA 2DUDA 1KLGD 2R8HA 4CDDC 2UXCH 5J1ZA 3EFXD 1EQVA 3RZDB 2SNMA 1QZGA 4Q8FA 2K4KA 3FKIH 1WD0A 1B9NA 2CVRA 4IUUA 1RK5A 1HR0H 4NXMH 3QJYA 5A2QE 4L5SA 2UUCH 2E2IH 3G7LA 3DMUA 4XXEA 3OTOH 4CDEC 1BR9A 1KJ8A 4XTCS 1EWCA 3A54A 5C44H 3WNZA 4ZKBB 3I3CA 4UP8A 1Q3LA 1QVCA 3BQ2A 4LF8H 2RHQB 4WBNF 1ONLA 2R6GA 2LKVA 3RB3A 5LMNW 1DV2A 4LSXA 4DR6H 3H6MA 5KNCA 3J7AV 1I7NA 3H4DA 1QWYA 2P0AA 2NU6B 3NQIA 4CHTB 3J81j 2F0DA 3X3NA 4PDBA 2EJFC 1KABA 4IUTA 3HBLA 3K5HA 4J15A 3VR4A 5C3XA 4DR3H 1G8ZD 1RTNA 3PO3B 1M4VA 1BBUA 4HMIA 1SE3A 4TQRA 4B3SL 3Q8QB 4PWQA 2K05A 5EKKA 2DY8A 3RLFA 2L12A 2CWPA 1V1PB 5JUMA 4A3JH 3QZ8A 4KHZA 4DUZH 3K8AA 5D1PA 3VA5A 3V6HA 2NUCA 4A93H 4DR4L 4UDUC 3FMCA 1JOQA 2HJWA 1JDBB 4K5VA 1JOKA 2VUMB 5C3EB 1G6PA 5L1KA 1HNWQ 2K75A 1KD1C 1VQJA 1TWCB 4OO1I 2LXKA 5KFHA 1K3BC 2K5QA 2MQHA 5L9XA 3I91A 3MAQA 3KK7A 1EWIA 1PRTF 1G51A 2B2TC 4PNYA 3GTMB 1M0WA 1QILA 3BDLA 1RD9D 4JVZA 5ISRA 3AEVA 4A3GH 3PVXA 4JI1H 4RNNA 2F0NA 1MZBA 2DN8A 4JV5L 3GTOH 5JJLA 4BWSC 4DL5A 1DGSA 1CT1D 4KD3A 3WO1A 2A6EC 1WD1A 1T3NA 2DPIA 3S2HB 2F3WA 1HNZL 4DV3H 3BQ1A 4IFDG 1TWCA 3R5HA 2OH2A 1B53A 3U9OA 5C3WA 1VKZA 1E2ZA 1B7YB 2NU9B 3RBDA 2X0SA 3R2IA 2W6OA 3VR6A 4DF7A 2VA2A 3HOUB 3KHLA 4ALPA 3W2DA 2W57A 2FINB 4L5QA 1OWTA 2UVUA 4NLGA 2UU9H 2WAQG 1G2TA 2X6LA 4DV2Q 5KFNA 3J81c 1O7LA 5NUCA 2B63G 1HTLD 2B29A 2NYZD 1TWHA 4XX0B 2XGQA 3Q23A 4A3EG 1MGSA 2HUGA 3PMFA 4UY8C 3I7FA 2I8CA 2EOTA 2D9UA 4MV8A 3FP9A 1QB5D 2RQXA 2MP1A 1S0NA 1K8AC 1DJRD 5D1OA 1JE4A 1VQMA 1KXLA 1X32A 2R7ZG 3GV5B 4DV5H 2O5IC 4LF7H 5KFXA 1W6JA 3NTHA 5KG1A 4JI3L 4CJ2C 1YBYA 3J81i 4H02A 4EBCA 2ZT9C 3ORRA 3KBXA 1UAPA 2Z8LA 4HNUA 1FJGQ 4JI7H 3SR1A 1LT6D 2PCFB 2R8JA 5A2QL 1RYRA 5AJ3Q 1B2TA 2VPSA 2B2TA 4IALA 4YCUA 5CMDA 4AIMA 3J80E 4XQNA 5F2DA 4O2BF 2DZDA 2R8KA 2F0KA 4RB2C 3PUZA 2J6UA 4N9TA 3S14B 1TWFH 1S68A 1TVXA 4GC6A 2VQFL 2F3VA 4ECUA 2F0LA 3JAMi 3TZUA 4RHRA 2E5LL 2PN1A 5G3LF 1I4QA 3J81W 4H44C 1F2MA 3HFZB 1TR5A 4O3SA 1KRTA 2VR1A 1SYCA 2O2LD 3C0FB 5CBEE 5KFDA 3GTQH 1N32L 4DR1H 5FO7B 1STYA 2VQEQ 4OWTB 2V1CC 4MV1A 5IT9c 1QCBD 1VMCA 5J3BA 3E0JA 1EZ6A 4JI2L 3TINA 2A69C 1D5XC 2P5ZX 2RCNA 4J6HA 1Z2OX 4DL2A 2PZUA 4B3TQ 2GPWA 1OXUA 1STEA 1D1KA 4R9WA 5IYDH 4DXGA 1Q12A 3BG5A 3M9NB 1D1IA 2N55A 1ET6A 1QG7A 3GTPH 4JI8H 5C4JB 1ICFB 5M5XH 2EVBA 3S16H 4LFBL 2LSSA 4YY3Q 5C5LA 4JCVE 3VA7A 1I50B 2JEFA 1PH8A 1NJIC 4B3RQ 2FJZA 4JI4Q 2HVQA 2RCFA 1IKMA 1O78A 3CQZA 4FXDA 5CV8A 1GUGA 1F77A 3K7UC 3BDCA 4FP5D 1ML0D 5EWFA 1X3FA 2ID0A 3SGIA 1AUXA 4HNTA 5KFOA 4GNXC 1TU2B 2IX3A 5EJWA 3EYYA 4FNFA 3CP0A 1B6SA 1VQCA 3E9IA 2DIKA 2EYHA 3A8JE 1HRJA 1D6EC 4CGYB 2R8IA 2FFKB 2A68C 2L11A 4X62H 5IT9W 2F4IA 1SN8A 5K5PA 4O0AA 2PQEA 1NY4A 4U673 3CCLA 1K1SA 2RGRA 1X3EA 2Z6BA 4GKKL 2XVSA 4EX5A 1N33H 5FLXE 3KHHA 4HNVA 3HOZB 4F8MA 5KG5A 2RBMA 4V190 3PSIA 4IUVA 5LP6F 4YR3A 3BVMA 5KG2A 4E6IA 3CPFA 3R8BA 2MHVA 1QNKA 4LF5Q 1M7JA 5KFUA 3VR2A 3FKIG 1LTSD 1RF2D 3N6RA 4GNXB 1DOMA 1PMRA 1RJQA 2K03A 3K7AH 3QIAA 3CRLC 4DU9A 3CVZA 4O3NA 5COYA 1A2UA 5C44G 4DR5H 3M9OB 1ZETA 2PMZE 4QUFA 4EGVA 4QIWE 1GXDC 5EBCA 2RGVA 1X65A 4K2LA 2EZVA 4C5AA 3QOLA 4LUOA 1S5FD 4ECYA 3KAJA 4DL3A 2RDFA 3DWPA 4GN5A 4YHHL 3QFFA 5BPFA 5I9PA 4RZRA 3NPPA 2UXCL 3TS2A 4EYHB 4OGQC 5JVLA 4IPCA 5KNDA 3FRPB 4X65Q 2ZM6Q 2I5MX 4GNXA 1EUCB 5KT7A 4IRCA 1Z9FA 3GD7A 4LWCA 2CQYA 3HEJA 4QW8A 2YYAA 3ETHA 3T16A 3S1NB 1O7ZA 4MHEA 2VUGA 4HCSA 1BQQT 5CAEB 3M4YA 4A3FH 4QCLA 4HJ8A 2A6ED 2O4XA 3OTOL 2L15A 4K0KL 1R4QB 2DY7A 4XYOA 4A3JG 1CE8A 4LFAH 5JVG3 3NK9A 1VBGA
chains in the Genus database with same CATH topology
3OW2A 4AQYQ 1LUZA 5C4XH 1GM5A 3L0OA 1C7YA 2OTJA 1NMFA 1PH2A 4RMFA 4DV1L 1PV4A 1HZ9A 2JA9A 4A93G 4JI8Q 2IY5B 3A0JA 1S3OA 5IYCG 1VQLA 4A3KH 1FJGL 2YTYA 1M1KC 4HIOA 1WOCA 4GLVB 5AJ3L 1Q81C 4DUZQ 2WAQE 3BZCA 1OXXK 5EAYA 3W1BA 3KF6A 3PUXA 3W1GA 3RZOH 3PIPA 3STBD 1JJGA 4AYBE 4DR3L 3HOXH 1U5KA 3M85A 3DLLA 3RR5A 3PF4A 1QVGA 3AFPA 1IBLQ 3OYYA 5IWAQ 4A3GG 2HIXA 2BA1A 1Q7YC 4DR2L 2A1AA 5C0XI 4BY7G 2CQOA 3CW2C 3KFUA 3I2ZA 1IL2A 1YHQA 1HZBA 1IBKL 4X62Q 1A8VA 2DGYA 1E1TA 2Y0SE 1K9MC 4JYAQ 2JA6H 2UXBL 3PO3G 3RNUA 1FL0A 1D7QA 3B6YA 1CSQA 2GVAA 5IY0A 3M3YH 1XNRL 4KI0A 4A75A 3Q8DA 4QJFA 4JBKA 2MNAA 1UEBA 1N33Q 5GAHC 3S24A 4IOCA 3UE1A 2VQEL 4LF6Q 4OWWB 4HJ5A 2VS1A 2PQAA 2OQKA 2NVYH 2MO1A 3D31A 2Q2HA 1SR3A 1I94L 4JBMA 2B63H 3CCJA 4A76A 4A3EH 2JA5H 2N49A 1VQGA 2VUMG 4B3TL 4B3SQ 4JI1L 2RF4A 3KYHC 1SFOH 3UDFA 5LMNQ 4DK3C 1VQFA 2R7ZH 1P8LA 2KBNA 2AMCB 2UUBL 2NZOA 1PA6A 4X6AH 1I3QH 1HNXL 1L1OC 2JA7G 4DV3L 1VQ8A 1K8GA 4DR4Q 3H0GH 4YY3L 1XJVA 1O7IA 1EQQA 4P71A 2F3IA 2IT1A 1UE6A 4B3RL 1UE7A 4JI4L 3I4NH 1E7ZA 4P72A 3I55A 4HIDA 1XMOQ 1IBML 3HOZG 3RN5A 1WCMH 2N78A 3G6EA 1YI2A 1V43A 3CMEA 2IHFA 4A3CH 2OCEA 3CCQA 1N8RC 1A0IA 2UU9L 1TXYA 2XGTA 4C2MH 4DV0L 4DV5Q 2UUAQ 2YV5A 4LF7Q 3I4MG 1E22A 2ZTEA 5GQOA 1WYDA 3UDXA 5IP9G 4HIMA 4L5RC 1VQHA 3U50C 4ME3A 1K0RA 4BY1G 4OX9Q 3FHWA 4JV5Q 3PIOA 1Q46A 2NVXH 4JI7Q 3H3VI 3PGZA 4DV7L 4GN3B 3VDYA 1CKMA 1HJPA 1V9PA 3D0FA 4PZ6A 3CCMA 1R9TH 4C3HH 3T1YQ 3J80i 3HKZG 4DR7L 1XPUA 4IJLA 3CC7A 1WI5A 1HNZQ 4LFAQ 4JI0L 1OXVA 4TQUS 2UXDL 2A19A 2Z6KC 4DV6L 1T9HA 2LXJA 4IPHA 1L1OB 3A74A 1CUKA 1S72A 3PO2H 4GKJL 4JBWA 3E0EA 1Q8KA 4R1JA 1B70B 1YJ9A 3HOVG 1WFQA 5GROA 3ZJYC 1XMQQ 1HR0W 2ES2A 4DUYQ 3T1HQ 4LF5L 4A3LG 4B3ML 1PH9A 1SE8A 2I5HA 2AWOA 3GTGH 3G4SA 1Y1VH 1K83H 4LUZA 4BA1I 1Q82C 3S15H 1NBWA 3HOWH 1C9OA 2HQLA 2H5XA 4P75A 3AQQA 1X9NA 1I6HH 4DR1Q 4DV4Q 1AH9A 4LF9Q 2HHHQ 2Q2IA 3PUYA 1L1OA 3UE0A 5IYDG 2D0OA 3PCOB 1JJCB 1YIJA 1ASYA 1GVPA 1KRSA 2JEBI 1PFSA 1U0LA 3M4QA 1HR0L 1HZAA 1EUJA 4NXML 5C3EH 1VQKA 4A3BH 1VQOA 5C0XJ 1E1OA 2UUCL 2F4VL 4LF4Q 1TWCH 4JI3Q 3HKSA 3BJUA 2HT1A 2WB1E 1PH5A 4A3IG 3G48A 1YVCA 4X65L 2ZM6L 3PF5A 5C0XG 2D0PA 2IHEA 4IFDI 1Y1WG 4LW1A 2N8NA 5FJ8H 4LF8L 2JK8A 4UP7A 1JB7A 3HKZE 1BKBA 4DR6L 1IXRA 2CWAA 4MNOA 3DM3A 1X6OA 3F2DA 3KDFB 2R92G 1YEZA 2ATWA 1D8LA 5H1SE 2ZTDA 3BZKA 3EIVA 1AE3A 2GN5A 1VQ9A 4MTNA 4BBSG 2K50A 4BXXH 1TWHH 3KF8B 3KLWA 4EQ5A 4QY7A 3J7ZC 3CCSA 1QUQA 3U4VA 3S2HH 1HZCA 2OWOA 2VQFQ 4AQYL 1N34Q 4JI5Q 3S1MH 1HH2P 1EIYB 2N3SA 4R4OA 1K3RA 2KHJA 2Z6KA 3CXCA 1OXSC 2E5LQ 3KOJA 4YCVA 3F2CA 2IX0A 1SLJA 3F1ZA 4JI8L 1N9WA 2I5LX 4A3MH 5M3FG 2EXDA 2DUDA 3HOUH 4NXNQ 2WP8J 2YTVA 1B8AA 4KLKA 4JI6Q 3J7A5 1N32Q 4DUZL 2JA8G 2VNUD 4YWMA 1LTLA 1QZGA 3CCVA 2K4KA 3FKIH 4PZ7A 3H15A 1PVOA 1AE2A 3TS0A 1VQPA 1SROA 4JI2Q 1LYLA 1JJ2A 4L5SA 1IBLL 5IWAL 1MKHA 4A4IA 1JMCA 2E2IH 1UE5A 5BR8Q 4NB3A 4TVAB 4XTCS 1QVFA 5C44H 4AH6A 3TQYA 1KIXA 4X62L 1J6QA 2B3GA 2ZJRA 1XNQQ 4JYAL 1CKNB 4UP8A 1QVCA 2YYZA 3CD6A 3GTLH 2RHQB 2BH8A 2R6GA 4A3DG 5LMNW 1VQ7A 1MIUA 1VQ4A 3K80C 4DAYB 1OXTA 4BBRH 5M3MH 1N33L 4LFBQ 3CC4A 2R7DA 1Q1BA 4HJ7A 3L2PA 4LF6L 1VQIA 5LMUQ 2VZAA 1ASZA 1VQBA 5IE8A 3J81j 1KAWA 1I5FA 4GS3A 3ULJA 1KL9A 4J15A 4RG1A 4DR5Q 1TWGH 1BBUA 2JE6I 4QGUA 2UXDQ 3MXNB 5ELOA 4X64Q 4B3SL 2JQOA 3RLFA 2Z0SA 4YWLA 2K5HA 2CWPA 5FLMH 2R93G 4GN4B 5IYBH 5LMNL 3RZDH 1VQ5A 3S14H 3HOYH 4A3JH 3CAMA 4KHZA 3UDIA 3K8AA 4UP9A 3J80c 2JEAI 4A3FG 1G291 2K52A 3W5OA 4P73A 2PI2A 4A93H 4BA2I 1FGUA 2E2HH 4DR4L 2OQ0A 4JOIC 5IYCH 1CSPA 4GKKQ 1A62A 2FXQA 4POGA 4IJHA 1N36Q 1G6PA 2AKWB 5C4XG 1HNWQ 1VQDA 2K75A 3MEFA 4JBJA 1KD1C 4R4TA 4R4QA 1VQJA 1XMOL 5M5WH 1E3PA 2LXKA 4OO1I 3GO5A 3U58A 2MQHA 3I4OA 2VW9A 4A3KG 1GKHA 1P16A 1MJEA 2NN6I 3S17H 1EWIA 3CQZH 1G51A 3NEMA 4DV5L 2UUAL 4LF7L 2KENA 1VQEA 3AEVA 4A3GH 1MJCA 1L0WA 2ALYB 4OX9L 4JV5L 3GTOH 5JJLA 4BY7H 3HOXG 1DGSA 4YCWA 4IFDJ 4JI7L 3PUWA 1C0AA 4X66Q 2VY3A 3S2DH 3PO3H 1V1QA 3T1YL 1KQSA 4Y7NH 1HNZL 4LFAL 4IFDG 1JE5A 3NELA 3E9HA 1B7YB 1J5EQ 1VCIA 2JA6G 4Y52H 2IX1A 2HIVA 3GTKH 1EYGA 4KHPQ 1TWAH 4ALPA 1EFWA 4YHHQ 2QGQA 1XMQL 4L5QA 2UXCQ 4JC0A 2WAQG 4DUYL 4DV2Q 2BA0A 2VUMH 4IPGA 1H95A 5JEAJ 3STBC 4AYBG 3J81c 2B63G 2B29A 1X54A 3ERSX 3S1QH 4A3EG 2JA5G 2MFIA 4GOPC 4LFCQ 5JEAG 4UY8C 3I7FA 4DR1L 2K14A 2KCMA 3FP9A 4DV4L 1W2BA 3OTOQ 4LF9L 2BH2A 2HHHL 4K0KQ 3GTMH 3AFQA 1XPRA 1K8AC 2JA7H 1YJNA 4LNQA 1VQMA 1KXLA 2R7ZG 4JOIA 2Y0SG 1PH3A 2E2JH 4JI3L 4LF4L 4DV1Q 2CCZA 1YBYA 3J81i 4H02A 3HOZH 1YHAA 3H0GG 3CF5A 2CKZB 1FJGQ 4R4IA 3KF6B 3G71A 1NE3A 4HJAA 3I4NG 5AJ3Q 3M9BA 3I4MH 4YCUA 1WCMG 4AIMA 5IP9H 4DPGA 2NVQH 4A3CG 3EBEA 1YZ6A 1UWVA 4BY1H 1X56A 2C35B 4DR3Q 1XPOA 4O2DA 2MO0A 3PUZA 4FDBA 1VQ6A 1PYBA 3NBHB 2EQSA 1TWFH 1XTDA 4OONA 4DR2Q 3KDFA 3A5UA 2OTLA 4GOPB 3LGJA 2VQFL 1N34L 4JI5L 2NVTH 3JAMi 2JJQA 1IBKQ 2E5LL 5IP7H 4R4CA 5K36G 1PH6A 3HFZB 2UXBQ 2EIFA 4POFA 2VL6A 2YU9H 1KRTA 3S1RH 2PNHA 4DKAC 1PH7A 1XNRQ 3M7NA 4NXNL 3CPWA 4C3JH 3K0XA 2PQAB 4UPAA 3GTJH 4JI6L 3GTQH 3HOVH 1N32L 2VQEQ 3PO2G 4OWTB 4A3LH 2V1CC 5IT9c 2NZHA 1LM0A 5J3BA 3RN2A 4JI2L 2AWNA 3PUVA 1I94Q 2RCNA 1QZHA 2XTIA 4MZ9A 5E7NA 4GOPA 1SRUA 1E24A 3S1NH 5BR8L 1WJJA 1Z47A 3JC66 4B3TQ 1Y14B 5JJIA 1OXUA 2Q2UA 4JI1Q 1VQNA 3ULLA 1Y1VG 3IRBA 1EOVA 2E8GA 5IYDH 1Q12A 1SMXA 2A8VA 1XNQL 3EN2A 3CC2A 3HOWG 4OO1G 1PH4A 3ICEA 2UUBQ 2NN6G 3GTPH 2KCTA 1Q1EA 3F8TA 5M5XH 1HNXQ 4DV3Q 1BBWA 3S16H 4LFBL 2GVBA 1CKNA 2LSSA 4YY3Q 1VS0A 3I56A 3CMAA 1RL2A 4IPDA 5HGQA 4A3IH 4JCVE 5C3EG 5LMUL 4A3BG 4IOAA 1PH8A 1NJIC 2D62A 3F2BA 4OWXB 4JI4Q 4B3RQ 5GAGC 4PG3A 1Y1WH 2F52A 1IBMQ 4L5TA 3K7UC 4HIKA 1X3FA 2ID0A 4YWKA 3SGIA 2RHSB 4DR5L 4GNXC 1JT8A 2QA4A 2UU9Q 2R92H 5HY6A 4X64L 1L2FA 3RLOA 4DV0Q 3A5ZB 3CP0A 5FJ8G 1PHJA 1M90C 1FVIA 1VQCA 1GO3E 3E9IA 4NPSA 4BBSH 3L7ZC 2WFWA 3CCRA 1PYSB 1EIFA 1YITA 4APVA 1W3SA 1SN8A 3ER0A 1BVSA 2PI2E 4O0AA 2Q2TA 1NY4A 4DV7Q 3CCLA 4DAMA 4BXXG 4PZ8A 1X3EA 2ZTCA 4P74A 5M3FH 4GKKL 4EX5A 3TRZA 1NMGA 1N36L 4JI0Q 4QL5A 1HNWL 4GLAC 4DV6Q 1A63A 2JA8H 4A3MG 2WB1G 5GADC 1RIPA 2ASBA 4GKJQ 1PH1A 3HOUG 1Q86C 4PMWA 1YNXA 1OTCA 3PSIA 5C4JH 1YHBA 3CPFA 3TREA 3PV0A 4LF5Q 2R7FA 1YJWA 3FKIG 2YTXA 4B3MQ 1IYJB 1I50H 4WJ4A 1EQRA 3M4OH 4GNXB 1IZ6A 1NTGA 3K7AH 5IP7G 2QEXA 3BU2A 3CCEA 2KHIA 5DLQE 4X66L 3T1HL 4JG2A 2ZJPA 4A3DH 5GAEC 5C44G 3AYHB 4XIGS 2PMZE 4DK6C 3KJOA 4IO9A 4DR7Q 4OXPA 1J5EL 4QIWE 1X65A 1HR0Q 3K81C 4LUVA 4NXMQ 4LUOA 3UDGA 4KHPL 1UE1A 2K5NA 3M4PA 3RLNA 2UUCQ 2F4VQ 3GDEA 3H3VH 4GN5A 4YHHL 3CCUA 4BBRG 5M3MG 2UXCL 3TS2A 4IPCA 3WWVA 4X65Q 4DNIA 3NENA 2I5MX 3TEHB 2ZM6Q 4DV2L 4GNXA 3ULPA 1Z9FA 3GD7A 4LWCA 1S40A 2R93H 4LF8Q 2K5VA 1X55A 1K73C 5M5YH 1VQAA 4DR6Q 2I0QA 4LFCL 1X3GA 3U4ZA 1QUQB 4HJ9A 1GD7A 3JAMc 4A3FH 5FLMG 4HJ8A 3OTOL 1KC8C 1KHIA 2L15A 4QQBX 5ELNA 5IYBG 2CFMA 4K0KL 3KJPA 5FLXc 4WJ3M 5JJKA 3HOYG 4C3IH 4A3JG 4GLXA 1CKOA 2AHOB 2ZJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 A;  4AQY Q;  1LUZ A;  5C4X H;  1GM5 A;  3L0O A;  1C7Y A;  2OTJ A;  1NMF A;  1PH2 A;  4RMF A;  4DV1 L;  1PV4 A;  1HZ9 A;  2JA9 A;  4A93 G;  4JI8 Q;  2IY5 B;  3A0J A;  1S3O A;  5IYC G;  1VQL A;  4A3K H;  1FJG L;  2YTY A;  1M1K C;  4HIO A;  1WOC A;  4GLV B;  5AJ3 L;  1Q81 C;  4DUZ Q;  2WAQ E;  3BZC A;  1OXX K;  5EAY A;  3W1B A;  3KF6 A;  3PUX A;  3W1G A;  3RZO H;  3PIP A;  3STB D;  1JJG A;  4AYB E;  4DR3 L;  3HOX H;  1U5K A;  3M85 A;  3DLL A;  3RR5 A;  3PF4 A;  1QVG A;  3AFP A;  1IBL Q;  3OYY A;  5IWA Q;  4A3G G;  2HIX A;  2BA1 A;  1Q7Y C;  4DR2 L;  2A1A A;  5C0X I;  4BY7 G;  2CQO A;  3CW2 C;  3KFU A;  3I2Z A;  1IL2 A;  1YHQ A;  1HZB A;  1IBK L;  4X62 Q;  1A8V A;  2DGY A;  1E1T A;  2Y0S E;  1K9M C;  4JYA Q;  2JA6 H;  2UXB L;  3PO3 G;  3RNU A;  1FL0 A;  1D7Q A;  3B6Y A;  1CSQ A;  2GVA A;  5IY0 A;  3M3Y H;  1XNR L;  4KI0 A;  4A75 A;  3Q8D A;  4QJF A;  4JBK A;  2MNA A;  1UEB A;  1N33 Q;  5GAH C;  3S24 A;  4IOC A;  3UE1 A;  2VQE L;  4LF6 Q;  4OWW B;  4HJ5 A;  2VS1 A;  2PQA A;  2OQK A;  2NVY H;  2MO1 A;  3D31 A;  2Q2H A;  1SR3 A;  1I94 L;  4JBM A;  2B63 H;  3CCJ A;  4A76 A;  4A3E H;  2JA5 H;  2N49 A;  1VQG A;  2VUM G;  4B3T L;  4B3S Q;  4JI1 L;  2RF4 A;  3KYH C;  1SFO H;  3UDF A;  5LMN Q;  4DK3 C;  1VQF A;  2R7Z H;  1P8L A;  2KBN A;  2AMC B;  2UUB L;  2NZO A;  1PA6 A;  4X6A H;  1I3Q H;  1HNX L;  1L1O C;  2JA7 G;  4DV3 L;  1VQ8 A;  1K8G A;  4DR4 Q;  3H0G H;  4YY3 L;  1XJV A;  1O7I A;  1EQQ A;  4P71 A;  2F3I A;  2IT1 A;  1UE6 A;  4B3R L;  1UE7 A;  4JI4 L;  3I4N H;  1E7Z A;  4P72 A;  3I55 A;  4HID A;  1XMO Q;  1IBM L;  3HOZ G;  3RN5 A;  1WCM H;  2N78 A;  3G6E A;  1YI2 A;  1V43 A;  3CME A;  2IHF A;  4A3C H;  2OCE A;  3CCQ A;  1N8R C;  1A0I A;  2UU9 L;  1TXY A;  2XGT A;  4C2M H;  4DV0 L;  4DV5 Q;  2UUA Q;  2YV5 A;  4LF7 Q;  3I4M G;  1E22 A;  2ZTE A;  5GQO A;  1WYD A;  3UDX A;  5IP9 G;  4HIM A;  4L5R C;  1VQH A;  3U50 C;  4ME3 A;  1K0R A;  4BY1 G;  4OX9 Q;  3FHW A;  4JV5 Q;  3PIO A;  1Q46 A;  2NVX H;  4JI7 Q;  3H3V I;  3PGZ A;  4DV7 L;  4GN3 B;  3VDY A;  1CKM A;  1HJP A;  1V9P A;  3D0F A;  4PZ6 A;  3CCM A;  1R9T H;  4C3H H;  3T1Y Q;  3J80 i;  3HKZ G;  4DR7 L;  1XPU A;  4IJL A;  3CC7 A;  1WI5 A;  1HNZ Q;  4LFA Q;  4JI0 L;  1OXV A;  4TQU S;  2UXD L;  2A19 A;  2Z6K C;  4DV6 L;  1T9H A;  2LXJ A;  4IPH A;  1L1O B;  3A74 A;  1CUK A;  1S72 A;  3PO2 H;  4GKJ L;  4JBW A;  3E0E A;  1Q8K A;  4R1J A;  1B70 B;  1YJ9 A;  3HOV G;  1WFQ A;  5GRO A;  3ZJY C;  1XMQ Q;  1HR0 W;  2ES2 A;  4DUY Q;  3T1H Q;  4LF5 L;  4A3L G;  4B3M L;  1PH9 A;  1SE8 A;  2I5H A;  2AWO A;  3GTG H;  3G4S A;  1Y1V H;  1K83 H;  4LUZ A;  4BA1 I;  1Q82 C;  3S15 H;  1NBW A;  3HOW H;  1C9O A;  2HQL A;  2H5X A;  4P75 A;  3AQQ A;  1X9N A;  1I6H H;  4DR1 Q;  4DV4 Q;  1AH9 A;  4LF9 Q;  2HHH Q;  2Q2I A;  3PUY A;  1L1O A;  3UE0 A;  5IYD G;  2D0O A;  3PCO B;  1JJC B;  1YIJ A;  1ASY A;  1GVP A;  1KRS A;  2JEB I;  1PFS A;  1U0L A;  3M4Q A;  1HR0 L;  1HZA A;  1EUJ A;  4NXM L;  5C3E H;  1VQK A;  4A3B H;  1VQO A;  5C0X J;  1E1O A;  2UUC L;  2F4V L;  4LF4 Q;  1TWC H;  4JI3 Q;  3HKS A;  3BJU A;  2HT1 A;  2WB1 E;  1PH5 A;  4A3I G;  3G48 A;  1YVC A;  4X65 L;  2ZM6 L;  3PF5 A;  5C0X G;  2D0P A;  2IHE A;  4IFD I;  1Y1W G;  4LW1 A;  2N8N A;  5FJ8 H;  4LF8 L;  2JK8 A;  4UP7 A;  1JB7 A;  3HKZ E;  1BKB A;  4DR6 L;  1IXR A;  2CWA A;  4MNO A;  3DM3 A;  1X6O A;  3F2D A;  3KDF B;  2R92 G;  1YEZ A;  2ATW A;  1D8L A;  5H1S E;  2ZTD A;  3BZK A;  3EIV A;  1AE3 A;  2GN5 A;  1VQ9 A;  4MTN A;  4BBS G;  2K50 A;  4BXX H;  1TWH H;  3KF8 B;  3KLW A;  4EQ5 A;  4QY7 A;  3J7Z C;  3CCS A;  1QUQ A;  3U4V A;  3S2H H;  1HZC A;  2OWO A;  2VQF Q;  4AQY L;  1N34 Q;  4JI5 Q;  3S1M H;  1HH2 P;  1EIY B;  2N3S A;  4R4O A;  1K3R A;  2KHJ A;  2Z6K A;  3CXC A;  1OXS C;  2E5L Q;  3KOJ A;  4YCV A;  3F2C A;  2IX0 A;  1SLJ A;  3F1Z A;  4JI8 L;  1N9W A;  2I5L X;  4A3M H;  5M3F G;  2EXD A;  2DUD A;  3HOU H;  4NXN Q;  2WP8 J;  2YTV A;  1B8A A;  4KLK A;  4JI6 Q;  3J7A 5;  1N32 Q;  4DUZ L;  2JA8 G;  2VNU D;  4YWM A;  1LTL A;  1QZG A;  3CCV A;  2K4K A;  3FKI H;  4PZ7 A;  3H15 A;  1PVO A;  1AE2 A;  3TS0 A;  1VQP A;  1SRO A;  4JI2 Q;  1LYL A;  1JJ2 A;  4L5S A;  1IBL L;  5IWA L;  1MKH A;  4A4I A;  1JMC A;  2E2I H;  1UE5 A;  5BR8 Q;  4NB3 A;  4TVA B;  4XTC S;  1QVF A;  5C44 H;  4AH6 A;  3TQY A;  1KIX A;  4X62 L;  1J6Q A;  2B3G A;  2ZJR A;  1XNQ Q;  4JYA L;  1CKN B;  4UP8 A;  1QVC A;  2YYZ A;  3CD6 A;  3GTL H;  2RHQ B;  2BH8 A;  2R6G A;  4A3D G;  5LMN W;  1VQ7 A;  1MIU A;  1VQ4 A;  3K80 C;  4DAY B;  1OXT A;  4BBR H;  5M3M H;  1N33 L;  4LFB Q;  3CC4 A;  2R7D A;  1Q1B A;  4HJ7 A;  3L2P A;  4LF6 L;  1VQI A;  5LMU Q;  2VZA A;  1ASZ A;  1VQB A;  5IE8 A;  3J81 j;  1KAW A;  1I5F A;  4GS3 A;  3ULJ A;  1KL9 A;  4J15 A;  4RG1 A;  4DR5 Q;  1TWG H;  1BBU A;  2JE6 I;  4QGU A;  2UXD Q;  3MXN B;  5ELO A;  4X64 Q;  4B3S L;  2JQO A;  3RLF A;  2Z0S A;  4YWL A;  2K5H A;  2CWP A;  5FLM H;  2R93 G;  4GN4 B;  5IYB H;  5LMN L;  3RZD H;  1VQ5 A;  3S14 H;  3HOY H;  4A3J H;  3CAM A;  4KHZ A;  3UDI A;  3K8A A;  4UP9 A;  3J80 c;  2JEA I;  4A3F G;  1G29 1;  2K52 A;  3W5O A;  4P73 A;  2PI2 A;  4A93 H;  4BA2 I;  1FGU A;  2E2H H;  4DR4 L;  2OQ0 A;  4JOI C;  5IYC H;  1CSP A;  4GKK Q;  1A62 A;  2FXQ A;  4POG A;  4IJH A;  1N36 Q;  1G6P A;  2AKW B;  5C4X G;  1HNW Q;  1VQD A;  2K75 A;  3MEF A;  4JBJ A;  1KD1 C;  4R4T A;  4R4Q A;  1VQJ A;  1XMO L;  5M5W H;  1E3P A;  2LXK A;  4OO1 I;  3GO5 A;  3U58 A;  2MQH A;  3I4O A;  2VW9 A;  4A3K G;  1GKH A;  1P16 A;  1MJE A;  2NN6 I;  3S17 H;  1EWI A;  3CQZ H;  1G51 A;  3NEM A;  4DV5 L;  2UUA L;  4LF7 L;  2KEN A;  1VQE A;  3AEV A;  4A3G H;  1MJC A;  1L0W A;  2ALY B;  4OX9 L;  4JV5 L;  3GTO H;  5JJL A;  4BY7 H;  3HOX G;  1DGS A;  4YCW A;  4IFD J;  4JI7 L;  3PUW A;  1C0A A;  4X66 Q;  2VY3 A;  3S2D H;  3PO3 H;  1V1Q A;  3T1Y L;  1KQS A;  4Y7N H;  1HNZ L;  4LFA L;  4IFD G;  1JE5 A;  3NEL A;  3E9H A;  1B7Y B;  1J5E Q;  1VCI A;  2JA6 G;  4Y52 H;  2IX1 A;  2HIV A;  3GTK H;  1EYG A;  4KHP Q;  1TWA H;  4ALP A;  1EFW A;  4YHH Q;  2QGQ A;  1XMQ L;  4L5Q A;  2UXC Q;  4JC0 A;  2WAQ G;  4DUY L;  4DV2 Q;  2BA0 A;  2VUM H;  4IPG A;  1H95 A;  5JEA J;  3STB C;  4AYB G;  3J81 c;  2B63 G;  2B29 A;  1X54 A;  3ERS X;  3S1Q H;  4A3E G;  2JA5 G;  2MFI A;  4GOP C;  4LFC Q;  5JEA G;  4UY8 C;  3I7F A;  4DR1 L;  2K14 A;  2KCM A;  3FP9 A;  4DV4 L;  1W2B A;  3OTO Q;  4LF9 L;  2BH2 A;  2HHH L;  4K0K Q;  3GTM H;  3AFQ A;  1XPR A;  1K8A C;  2JA7 H;  1YJN A;  4LNQ A;  1VQM A;  1KXL A;  2R7Z G;  4JOI A;  2Y0S G;  1PH3 A;  2E2J H;  4JI3 L;  4LF4 L;  4DV1 Q;  2CCZ A;  1YBY A;  3J81 i;  4H02 A;  3HOZ H;  1YHA A;  3H0G G;  3CF5 A;  2CKZ B;  1FJG Q;  4R4I A;  3KF6 B;  3G71 A;  1NE3 A;  4HJA A;  3I4N G;  5AJ3 Q;  3M9B A;  3I4M H;  4YCU A;  1WCM G;  4AIM A;  5IP9 H;  4DPG A;  2NVQ H;  4A3C G;  3EBE A;  1YZ6 A;  1UWV A;  4BY1 H;  1X56 A;  2C35 B;  4DR3 Q;  1XPO A;  4O2D A;  2MO0 A;  3PUZ A;  4FDB A;  1VQ6 A;  1PYB A;  3NBH B;  2EQS A;  1TWF H;  1XTD A;  4OON A;  4DR2 Q;  3KDF A;  3A5U A;  2OTL A;  4GOP B;  3LGJ A;  2VQF L;  1N34 L;  4JI5 L;  2NVT H;  3JAM i;  2JJQ A;  1IBK Q;  2E5L L;  5IP7 H;  4R4C A;  5K36 G;  1PH6 A;  3HFZ B;  2UXB Q;  2EIF A;  4POF A;  2VL6 A;  2YU9 H;  1KRT A;  3S1R H;  2PNH A;  4DKA C;  1PH7 A;  1XNR Q;  3M7N A;  4NXN L;  3CPW A;  4C3J H;  3K0X A;  2PQA B;  4UPA A;  3GTJ H;  4JI6 L;  3GTQ H;  3HOV H;  1N32 L;  2VQE Q;  3PO2 G;  4OWT B;  4A3L H;  2V1C C;  5IT9 c;  2NZH A;  1LM0 A;  5J3B A;  3RN2 A;  4JI2 L;  2AWN A;  3PUV A;  1I94 Q;  2RCN A;  1QZH A;  2XTI A;  4MZ9 A;  5E7N A;  4GOP A;  1SRU A;  1E24 A;  3S1N H;  5BR8 L;  1WJJ A;  1Z47 A;  3JC6 6;  4B3T Q;  1Y14 B;  5JJI A;  1OXU A;  2Q2U A;  4JI1 Q;  1VQN A;  3ULL A;  1Y1V G;  3IRB A;  1EOV A;  2E8G A;  5IYD H;  1Q12 A;  1SMX A;  2A8V A;  1XNQ L;  3EN2 A;  3CC2 A;  3HOW G;  4OO1 G;  1PH4 A;  3ICE A;  2UUB Q;  2NN6 G;  3GTP H;  2KCT A;  1Q1E A;  3F8T A;  5M5X H;  1HNX Q;  4DV3 Q;  1BBW A;  3S16 H;  4LFB L;  2GVB A;  1CKN A;  2LSS A;  4YY3 Q;  1VS0 A;  3I56 A;  3CMA A;  1RL2 A;  4IPD A;  5HGQ A;  4A3I H;  4JCV E;  5C3E G;  5LMU L;  4A3B G;  4IOA A;  1PH8 A;  1NJI C;  2D62 A;  3F2B A;  4OWX B;  4JI4 Q;  4B3R Q;  5GAG C;  4PG3 A;  1Y1W H;  2F52 A;  1IBM Q;  4L5T A;  3K7U C;  4HIK A;  1X3F A;  2ID0 A;  4YWK A;  3SGI A;  2RHS B;  4DR5 L;  4GNX C;  1JT8 A;  2QA4 A;  2UU9 Q;  2R92 H;  5HY6 A;  4X64 L;  1L2F A;  3RLO A;  4DV0 Q;  3A5Z B;  3CP0 A;  5FJ8 G;  1PHJ A;  1M90 C;  1FVI A;  1VQC A;  1GO3 E;  3E9I A;  4NPS A;  4BBS H;  3L7Z C;  2WFW A;  3CCR A;  1PYS B;  1EIF A;  1YIT A;  4APV A;  1W3S A;  1SN8 A;  3ER0 A;  1BVS A;  2PI2 E;  4O0A A;  2Q2T A;  1NY4 A;  4DV7 Q;  3CCL A;  4DAM A;  4BXX G;  4PZ8 A;  1X3E A;  2ZTC A;  4P74 A;  5M3F H;  4GKK L;  4EX5 A;  3TRZ A;  1NMG A;  1N36 L;  4JI0 Q;  4QL5 A;  1HNW L;  4GLA C;  4DV6 Q;  1A63 A;  2JA8 H;  4A3M G;  2WB1 G;  5GAD C;  1RIP A;  2ASB A;  4GKJ Q;  1PH1 A;  3HOU G;  1Q86 C;  4PMW A;  1YNX A;  1OTC A;  3PSI A;  5C4J H;  1YHB A;  3CPF A;  3TRE A;  3PV0 A;  4LF5 Q;  2R7F A;  1YJW A;  3FKI G;  2YTX A;  4B3M Q;  1IYJ B;  1I50 H;  4WJ4 A;  1EQR A;  3M4O H;  4GNX B;  1IZ6 A;  1NTG A;  3K7A H;  5IP7 G;  2QEX A;  3BU2 A;  3CCE A;  2KHI A;  5DLQ E;  4X66 L;  3T1H L;  4JG2 A;  2ZJP A;  4A3D H;  5GAE C;  5C44 G;  3AYH B;  4XIG S;  2PMZ E;  4DK6 C;  3KJO A;  4IO9 A;  4DR7 Q;  4OXP A;  1J5E L;  4QIW E;  1X65 A;  1HR0 Q;  3K81 C;  4LUV A;  4NXM Q;  4LUO A;  3UDG A;  4KHP L;  1UE1 A;  2K5N A;  3M4P A;  3RLN A;  2UUC Q;  2F4V Q;  3GDE A;  3H3V H;  4GN5 A;  4YHH L;  3CCU A;  4BBR G;  5M3M G;  2UXC L;  3TS2 A;  4IPC A;  3WWV A;  4X65 Q;  4DNI A;  3NEN A;  2I5M X;  3TEH B;  2ZM6 Q;  4DV2 L;  4GNX A;  3ULP A;  1Z9F A;  3GD7 A;  4LWC A;  1S40 A;  2R93 H;  4LF8 Q;  2K5V A;  1X55 A;  1K73 C;  5M5Y H;  1VQA A;  4DR6 Q;  2I0Q A;  4LFC L;  1X3G A;  3U4Z A;  1QUQ B;  4HJ9 A;  1GD7 A;  3JAM c;  4A3F H;  5FLM G;  4HJ8 A;  3OTO L;  1KC8 C;  1KHI A;  2L15 A;  4QQB X;  5ELN A;  5IYB G;  2CFM A;  4K0K L;  3KJP A;  5FLX c;  4WJ3 M;  5JJK A;  3HOY G;  4C3I H;  4A3J G;  4GLX A;  1CKO A;  2AHO B;  2ZJQ A; 
#chains in the Genus database with same CATH topology
 4AQY Q;  1HFG A;  1F2Z A;  3FPU B;  2NVY B;  4UHV A;  4RMF A;  3SVM A;  4A93 G;  2JA9 A;  2NBF A;  4A3E B;  3EVQ A;  1BF4 A;  1XMQ H;  3EPI A;  4HIO A;  2ZDH A;  2W6Z A;  1NSN S;  5DQG A;  1S5D D;  5EAY A;  2R7Z B;  3MA2 B;  3K5O A;  1F9Q A;  4RU9 A;  4DR3 L;  3HOX H;  5EWG A;  3M85 A;  2VXW A;  2YZM A;  3AFP A;  3H09 A;  3IFT A;  4A3G G;  2BA1 A;  1Q7Y C;  2A1A A;  5HGT A;  4QMG A;  2MGS A;  3CHB D;  2CQO A;  3CW2 C;  1TS3 A;  3QZ7 A;  1B3Q A;  3NWS A;  2Y0S E;  2JA6 H;  3BQ0 A;  1CSQ A;  1RTO A;  2HDL A;  2UVW A;  4GC7 A;  3UQ8 A;  1ZHS A;  1KNE A;  4JBK A;  5DLF A;  4RCO A;  4IOC A;  5KFA A;  2RSN A;  3A8I E;  3ND8 A;  2R92 A;  4FF2 A;  3K57 A;  1EYD A;  2XNA C;  3MXU A;  3NBI A;  1S10 A;  4A76 A;  1ET9 A;  2JA5 H;  3F8N A;  2F0V A;  4RUA A;  1XDN A;  4DV1 H;  5JEA H;  3GIK A;  3Q8R B;  1TY0 A;  4B3S Q;  2NB0 A;  4JI1 L;  1F2Y A;  1SFO H;  3UDF A;  1I4X A;  2AMC B;  3I73 A;  5FLX L;  5LOV F;  4A3D B;  1I3Q H;  3E3X A;  1L1O C;  4DV3 L;  5KEE A;  3OHX C;  4DR4 Q;  4BWG B;  2WIN B;  1EQQ A;  2KCN A;  4P71 A;  1SNQ A;  2EXZ A;  2F3I A;  1GOZ A;  3WOF A;  3RN5 A;  3S15 B;  3G6E A;  4A3C H;  3JAM E;  5CC4 A;  2Q8T A;  2UU9 L;  2A69 D;  2UXB H;  4C2M H;  3L4K A;  1EY8 A;  5ELB A;  1EY5 A;  5GQO A;  2SNS A;  4HIM A;  2RDG A;  4L5R C;  1VQH A;  1Y8P B;  4ME3 A;  5FOB B;  3RAX A;  4JV5 Q;  2RDH A;  3FHW A;  2KEE A;  1XNQ H;  2NVX H;  4LSA A;  4C56 C;  4C1N K;  1A3V A;  4J8Q A;  1V9P A;  1R9T H;  5LL6 b;  1I94 H;  1XPU A;  4IJL A;  1HNZ Q;  1SEI A;  1OXV A;  4XYQ A;  5C4X B;  2EPB A;  3R5F A;  1IOV A;  2VB3 X;  1L1O B;  1S72 A;  3PO2 H;  3MR2 A;  2CW0 C;  4GKJ L;  5IGD A;  2K7V A;  1FKA H;  4A3K B;  3RV4 A;  1Q8K A;  4KK7 A;  4R1J A;  3SK6 A;  1WFQ A;  3RUP A;  1PRT C;  1A2T A;  3A56 A;  3R2T A;  3RUZ A;  2ES2 A;  4J9K A;  2EYM A;  1HNX H;  2BDO A;  1SDF A;  1PH9 A;  1SE8 A;  3S1M B;  2AWO A;  4NP5 A;  3GTG H;  3G4S A;  1Y1V H;  1Q82 C;  4ILW A;  2A68 D;  1NBW A;  1FYC A;  1C9O A;  3SDZ A;  5CV6 A;  2NN6 H;  2SEB D;  1NNX A;  3U9S A;  1AH9 A;  2C00 A;  1L1O A;  5IYD G;  2CZG A;  1VQ7 A;  1ASY A;  5JAV A;  1GVP A;  1KRS A;  4K6D A;  3M4Q A;  4ABN A;  5JVH 3;  4J9P A;  1HHV A;  3QOJ A;  1UNS A;  1UNN C;  5C0X J;  1E1O A;  2V59 A;  4JI3 Q;  3HKS A;  4KV6 A;  1PH5 A;  2E2I B;  2E75 C;  4O1N A;  3PF5 A;  2PNR C;  5C44 B;  4LW1 A;  4DL7 A;  5CBA E;  4PQX A;  2J6T A;  1MSH A;  1IXR A;  1C30 A;  3SE0 A;  1X6O A;  3SK8 A;  2BQR A;  2ATW A;  5H1S E;  3H94 A;  3BZK A;  3EIV A;  4X66 H;  4ED0 A;  4ZAI A;  1EUD B;  2EYO A;  5JPN C;  3JSL A;  3KAL A;  1QUQ A;  5KFQ A;  1O80 A;  4K14 A;  3R93 A;  2VQF Q;  1J5E H;  1ICW A;  3D4R A;  3LNN A;  1K3R A;  4R4O A;  2E5L Q;  2AU0 A;  4JI8 L;  2EYJ A;  2I5L X;  1JIH A;  3H0G B;  2R82 A;  2WP8 J;  4HED A;  4AYB A;  3I4N B;  1N32 Q;  1JDE A;  2JP1 A;  1JWS D;  3NHH A;  2VNU D;  2DWC A;  2LS0 1;  4MV3 A;  1ZQ7 A;  2KVM A;  1B9M A;  2I80 A;  1GUN A;  4Z9C B;  3ERQ A;  1VQP A;  2AQ4 A;  4JI2 Q;  1JJ2 A;  4A93 B;  3SXH A;  1DOL A;  2EY2 A;  1UE5 A;  1RJP A;  2UXD H;  4TVA B;  4EYI B;  3TQY A;  1KIX A;  4X62 L;  2XC9 A;  1TT2 A;  2Q8I B;  4JW0 A;  2ZJR A;  1CKN B;  2QDL A;  3GTL H;  4EBD A;  1NR4 A;  2ZXR A;  4J1M A;  3K80 C;  4BBR H;  1WCM A;  1N33 L;  4LFB Q;  3CC4 A;  1GGO A;  3A7L A;  1BCP F;  2AQ3 B;  3HS0 C;  2CHB D;  1VQB A;  2VZA A;  3D6C A;  1SYB A;  4RH6 A;  4K5W A;  3WDN A;  1ASZ A;  3GTO B;  4YAJ B;  2W6Q A;  4CDC C;  5IGF A;  1TWG H;  4QGU A;  4ZKC B;  1B04 A;  4E4T A;  2W9C A;  1ILP A;  1VQ5 A;  5L1J A;  1B1Z A;  3HOY H;  1IW7 C;  3TP7 A;  3T53 B;  4FS1 A;  2NTS A;  3T5L A;  3J80 c;  4UP9 A;  4QW9 A;  1IBK H;  3GP7 A;  4DGZ A;  4UCU A;  3PR4 A;  2JEA I;  4A3F G;  2K52 A;  3W5O A;  4P73 A;  4TRD A;  3IN5 A;  2E2H H;  2A74 C;  3VPB A;  2OQ0 A;  3P75 A;  1SBB B;  4JOI C;  1CSP A;  4GKK Q;  1A62 A;  2HD3 A;  4POG A;  1KDA A;  1LT5 D;  1UEA B;  1VQD A;  3ZYY X;  5F9N A;  4R4Q A;  3J7A F;  1H9S A;  5E4X A;  3I4O A;  1GKH A;  1WSC A;  3H4B A;  1MJE A;  4JYA H;  3C1E A;  3S17 H;  4UCV A;  3GII A;  1VQE A;  4J0M A;  4ME5 A;  2BOS A;  1HA6 A;  3DWA A;  4OX9 L;  3HOX G;  5I2X A;  5KFF A;  4IFD J;  2HGS A;  4RGO S;  4ZUJ A;  2OF1 A;  3LWU A;  2K5D A;  3C3L A;  2VY3 A;  1A15 A;  3T1Y L;  4Y7N H;  4YR0 A;  4I50 F;  2V4Q A;  4MAM A;  1E2V A;  4LFA L;  3E9H A;  5FKA C;  3P7J A;  1G91 A;  1VCI A;  5C8Y F;  2JA6 G;  2PMZ A;  4A3M B;  4Y52 H;  2IX1 A;  4J9Q A;  2WB1 B;  4QIW A;  1DD2 A;  3J80 W;  1VMP A;  1EFW A;  4YHH Q;  2QGQ A;  4IHJ F;  1XMQ L;  1B3A A;  3O13 A;  3GIQ A;  4CC6 A;  2UXC Q;  2XD4 A;  3TME A;  2ASJ A;  4FF1 A;  3STB C;  3IFD A;  1UUP A;  1NUC A;  1X54 A;  2JA5 G;  4GOP C;  1LTR D;  5JEA G;  5BMV F;  3BA8 A;  1SXT A;  2K14 A;  4DV4 L;  1W2B A;  1LO5 D;  3OTO Q;  4K0K Q;  2HHH L;  3GTQ B;  4O3O A;  1XPR A;  2JA7 H;  4LNQ A;  2EY5 A;  4JOI A;  1L0X B;  1SE2 A;  3BYY B;  4KKS A;  1IKL A;  4F88 A;  2E2J H;  4LF4 L;  3FPP A;  3OUU A;  3RMH A;  2CCZ A;  2CW0 D;  2A6H C;  4UCR A;  1K8M A;  3ND9 A;  4TQS A;  4IRK A;  4DFA A;  3G71 A;  1NE3 A;  3T56 B;  1PRT D;  1PTO H;  3I4M H;  2UVV A;  3J7Y W;  4DPG A;  3LWE A;  2NVQ H;  4A3C G;  3K6O A;  4BY1 H;  1JCK B;  3GTP B;  1X56 A;  4DR3 Q;  4ZRZ A;  5M5X B;  1KAA A;  3S16 B;  3NBH B;  1QOH A;  4OON A;  3BA9 A;  2EJG C;  4GOP B;  4DR7 H;  4EVO A;  4DUY H;  2V4R A;  3MXG A;  3KF8 A;  5CGK A;  2OXP A;  1PXU A;  2YU9 H;  2FPP B;  4MV7 A;  2Y0S A;  3S1R H;  2PNH A;  4DKA C;  1PH7 A;  4RCN A;  3M7N A;  4NXN L;  4KMU C;  3CPW A;  2KJX A;  3HOV H;  1SYE A;  4FU0 A;  3PO2 G;  4TV9 F;  3MFI A;  1LT3 D;  3RN2 A;  1D5M C;  1S5B D;  2ZXO A;  5JJZ A;  3PUV A;  4PMB A;  4MZ9 A;  4KN4 C;  4ZYS A;  5E7N A;  5K2M A;  4GOP A;  1E24 A;  5BR8 L;  1WJJ A;  3JC6 6;  4EFE A;  4JI1 Q;  1ESR A;  2WAC A;  1CS0 A;  3ULL A;  1Y1V G;  3IRB A;  1EOV A;  2E8G A;  1CA5 A;  4Q5V A;  1SMX A;  4ZOL F;  3M7G A;  1XNQ L;  2A8V A;  2W8K A;  2E76 C;  5IOC A;  1PH4 A;  3ICE A;  4HSP A;  1F9P A;  4MTK A;  2NN6 G;  2KCT A;  1IHZ A;  4X3U A;  5KYI A;  1PLF A;  2X6G A;  4DV3 Q;  1BBW A;  3Q24 A;  5KT6 A;  2IBK A;  5HGQ A;  2FLP A;  1JWU D;  1FNW A;  5LMU L;  3GTK B;  3UFX B;  3V4S A;  3KLS X;  1ZXT A;  1T5X D;  3F2B A;  1V4Y A;  1TWA B;  5KG4 A;  4HQ6 A;  5GAG C;  1Y1W H;  3K3P A;  2F52 A;  1L2Z A;  3DEO A;  4L5T A;  2SDF A;  2B8F A;  2F0F A;  2PPB C;  1VAJ A;  5BN5 A;  2MPM A;  2QA4 A;  2UU9 Q;  5IWA H;  1IBL H;  2AQ1 B;  4X64 L;  1M90 C;  2ENB A;  2FLL A;  1FVI A;  4YQW A;  2J7Z A;  3CRK C;  1PYS B;  3Q1K A;  2XCP A;  2YRX A;  1EIF A;  2EY1 A;  4CDF C;  1K1Q A;  5G3L D;  2Q2T A;  5FPR A;  1DM0 B;  1V1P A;  3DWQ A;  3BVZ A;  4DAM A;  4P74 A;  3GTK A;  5M3F H;  3TRZ A;  3OSN A;  3OHA A;  4NKL A;  1N36 L;  4QL5 A;  1EIH A;  4U68 A;  4F50 A;  5GAD C;  4A2B A;  2ASB A;  4GKJ Q;  2EJM A;  2VUM A;  1PH1 A;  1Q86 C;  1AEX A;  4A3F B;  1YHB A;  3OOC A;  4OHJ A;  3TRE A;  2DLN A;  1IL8 A;  2FK2 A;  1S03 G;  2NU8 B;  3QR8 A;  1D2B A;  5LMN H;  1JX4 A;  2VQD A;  1IZ6 A;  5IP7 G;  4ECZ A;  3GTM A;  1IW7 D;  4FVM A;  2ZDG A;  4X66 L;  4MA0 A;  4TKO B;  4KY6 A;  4EEQ A;  3SI8 A;  3KLR A;  5DG9 A;  1MBY A;  4IO9 A;  4DK6 C;  4FBT A;  4MTD A;  2VPQ A;  1J5E L;  2X69 A;  4KHV A;  3K81 C;  1XMO H;  4KHP L;  1PFN A;  4DXF A;  2B2Y C;  3HOX B;  3GDE A;  2IWH A;  3GTJ B;  4Q44 A;  4BBR G;  1TY2 A;  3MFH A;  3G6X A;  1GLV A;  3NEN A;  2BCO A;  3ULP A;  1MD2 D;  2UUA H;  2BE5 C;  2GPS A;  4J9L A;  3Q8P B;  2R93 H;  1E0B A;  2F0E A;  5BPH A;  5M5Y H;  1DV1 A;  4LH6 A;  4CJ1 B;  1HNW H;  2JA6 B;  3UI2 A;  4OEM B;  4HJ9 A;  2C28 A;  1KJ9 A;  2QIL A;  2K04 A;  3JAM c;  2UXD L;  4MTE A;  3R23 A;  4WJ3 M;  5ELC A;  3HOY G;  4C3I H;  2ZJQ A;  3OW2 A;  3KLS A;  3GV6 A;  2KSW A;  3L0O A;  5D65 A;  2OTJ A;  1NMF A;  1DYQ A;  2D2C C;  1UC9 A;  2W6P A;  4JI8 Q;  2IY5 B;  4FYD A;  2JA5 B;  3VPC A;  2J0T D;  3MC0 B;  3L4J A;  1D5Z C;  1ZKO A;  3R5X A;  5KFZ A;  3RB4 A;  2RDI A;  3T1H H;  4ECX A;  1OXX K;  1V1O A;  1AZP A;  3NTI A;  3RZO H;  3PUX A;  3PIP A;  1G2S A;  3STB D;  4AYB E;  3W3A A;  5KX5 F;  5KT5 A;  1I3Q B;  3PF4 A;  4OEL B;  1QVG A;  5L1L A;  4CC5 A;  3BDO A;  2HIX A;  5IGC A;  4DR2 L;  3N42 B;  4LF9 H;  4CKB A;  2C2D A;  1PZK D;  5C0X I;  5C6A A;  3KFU A;  4NMZ A;  1WTO A;  1IBK L;  3K0Y A;  4X62 Q;  2IA6 A;  1LTG D;  1E1T A;  4IRD A;  1K9M C;  1EIG A;  1RKN A;  3M3Y H;  2GVA A;  3AMU A;  4KI0 A;  2L9H A;  3MEH A;  1EYC A;  2A6H D;  4C2M B;  3H3V C;  1I6U A;  1GYF A;  2MNA A;  3JAM W;  2R8G A;  4RKL A;  1N33 Q;  5GAH C;  4ODG A;  3N52 A;  4ZQ3 A;  3BG3 A;  5GON F;  5DQI A;  2VS1 A;  2NVX B;  2Q2H A;  4Q0Y A;  3V05 A;  3CCJ A;  2Z4I A;  4ZHQ F;  1BOS A;  2YRW A;  3KHG A;  3MWY W;  3KYH C;  4HR7 B;  1FJG H;  2IMW P;  4LMQ D;  5DQH A;  3FEW X;  1W6K A;  1N34 H;  4JI5 H;  3PO2 B;  2MUY A;  2AQ2 B;  2UUB L;  3RGX A;  2JA7 G;  4XZ3 B;  1VQ8 A;  1XJV A;  3GV8 B;  5ELF A;  2B2W C;  4JI6 H;  5C5M A;  1UE7 A;  4RB0 A;  1BCP C;  1E7Z A;  4P72 A;  3GTG B;  2F0W A;  3I55 A;  4HID A;  2XCL A;  2M00 A;  1I50 A;  2IHF A;  4QWD A;  4HR7 A;  1A0I A;  5DG8 A;  2XGT A;  4DV0 L;  2YV5 A;  5CV9 A;  3I4M G;  1E22 A;  2F0T A;  2PYK A;  3DXJ C;  4RA8 A;  4BY1 G;  4OX9 Q;  2YL2 A;  3PIO A;  1Q46 A;  2ICE C;  3H3V I;  1SMY C;  1C8C A;  5K36 H;  1IYV A;  2AUK A;  2RKS A;  3D0F A;  4GN3 B;  4I65 A;  4PZ6 A;  3CCM A;  4EBE A;  3T1Y Q;  3HKZ G;  1WI5 A;  3PW2 A;  1JWM D;  4LFA Q;  5KG7 A;  5KFE A;  2A19 A;  2Z6K C;  3N44 B;  4ECR A;  1RJT A;  4IPH A;  1CUK A;  3G6V A;  1WTV A;  4JBW A;  2KEC A;  1I4R A;  2XRS D;  1BCP B;  3HOV G;  5GRO A;  1GUO A;  2B8G A;  1XMQ Q;  1Y8N B;  4R8I A;  3T4A C;  1SNC A;  4YY3 H;  2C2E A;  3AU7 A;  4KY5 A;  1JR0 D;  1BNC A;  1SYD A;  4B3R H;  1CK1 A;  4OO1 H;  4RGM A;  3RGZ A;  1I4H A;  5EWE A;  2HQL A;  2H5X A;  2XSC A;  1X9N A;  3V6J A;  4DV4 Q;  5CV5 A;  2HHH Q;  3MJF A;  4DR7 L;  2D0O A;  1JJC B;  2JEB I;  3VYT A;  2B2W A;  3V2T A;  1EUJ A;  1HR0 L;  1XWE A;  5C3E H;  4NXM L;  1VQO A;  5JH7 F;  2UUC L;  2SCU B;  4LF4 Q;  1TWC H;  3OSO A;  3BJU A;  2WB1 E;  4WFN 3;  1PZJ D;  5D14 A;  1EY7 A;  2WAQ B;  1KBL A;  2D0P A;  3M4I A;  4IFD I;  1Y1W G;  2N8N A;  3HGB A;  5FJ8 H;  4LF8 L;  5EBD A;  2B63 B;  4DR6 L;  3GTL B;  2R6F A;  5EQ0 A;  3KDF B;  1HQR D;  2EY6 A;  1YEZ A;  4QUC A;  1J8I A;  5LYJ F;  2GN5 A;  2IW3 A;  4BBR B;  1FR3 A;  1ILQ A;  2K50 A;  4BXX H;  1TWH H;  3KLW A;  2YZG A;  4QY7 A;  3J7Z C;  3S2H H;  1HZC A;  2R87 A;  3T51 B;  1HH2 P;  3CXC A;  2KHJ A;  1AP0 A;  2Z6K A;  3JZI A;  1SNP A;  2KCC A;  4YCV A;  3F2C A;  3F1Z A;  1SLJ A;  2WAQ A;  1JLL B;  4XQQ A;  5M3F G;  4O4L F;  1TWG B;  4IR1 A;  3HOU H;  4NXN Q;  2NVY A;  3OHB A;  2YTV A;  4ME6 A;  3J7A 5;  4DUZ L;  4G7O C;  5DLG A;  3X3M A;  2R7L A;  1GUW A;  3HOY B;  2BE5 D;  3CCV A;  1EQT A;  4PZ7 A;  3BJY A;  4O4I F;  3FDT A;  3TS0 A;  1LYL A;  4LFC H;  3T5K A;  1IBL L;  5IWA L;  4A4I A;  2E2H B;  3EA6 A;  1JMC A;  2R7Z A;  2CH4 A;  5BR8 Q;  4NB3 A;  1B6R A;  4YP3 A;  3MR3 A;  3QWN A;  5L1I A;  4CKE A;  1JQY D;  3VR5 A;  4AH6 A;  4X65 H;  2WKC A;  3K5L A;  2FPI B;  5DM6 3;  3NQT A;  1AN8 A;  2B3G A;  1XNQ Q;  1B33 N;  5KFS A;  3MWM A;  1MIU A;  3S17 B;  4RNO A;  4DAY B;  1S97 A;  1OXT A;  5IGE A;  1B50 A;  5M3M H;  1EYA A;  4HJ7 A;  1VQI A;  4ED1 A;  5LMU Q;  2W6M A;  1BXT A;  2V5A A;  5IE8 A;  1SYF A;  1KAW A;  3N8D A;  4X3S A;  4EGJ A;  1F2L A;  4ID6 A;  3ULJ A;  3VR3 A;  1BNZ A;  4DN4 M;  4RG1 A;  2XN9 C;  2K32 A;  4Y7N B;  3V96 A;  3MXN B;  4X64 Q;  2R93 G;  3QB3 A;  2Z9H A;  4YWL A;  1K83 B;  5IYB H;  5LMN L;  4R8U B;  3OMC A;  4OIJ A;  5COR A;  3SEB A;  3NTK A;  3S14 H;  2WV6 D;  1ULZ A;  4F4X A;  2XWJ B;  4ZUI A;  5KFY A;  3UDI A;  1CZW A;  5T14 A;  1G29 1;  1I4P A;  4J9M A;  3DM1 A;  1FGU A;  1XNR H;  4C3I G;  5IYC H;  2FXQ A;  4IJH A;  2H4O A;  1N36 Q;  2ICI A;  4JBJ A;  4R4T A;  3GID A;  1XMO L;  5M5W H;  4YB8 B;  5KFG A;  1S5E D;  1JC7 A;  5DAU A;  1V51 A;  2C22 A;  1EU4 A;  1K83 A;  3CQZ H;  4DV5 L;  5KIX A;  2UUA L;  4LF7 L;  2JA7 B;  2KEN A;  4ZQI A;  5FO9 B;  1T5E A;  4ZK9 B;  1CTM A;  3GLK A;  2ALY B;  1QJO A;  4BY7 H;  2E2J B;  5KFT A;  4JI7 L;  3H20 A;  3SK5 A;  4X66 Q;  3S2D H;  2W9B B;  3I12 A;  5FPO A;  1V1Q A;  3DUZ A;  1KQS A;  4QWC A;  2DNE A;  2FLN A;  1MSG A;  4JV1 A;  4OL7 A;  1JE5 A;  3I4M B;  1E4G T;  4YJ2 F;  1J5E Q;  2F0O A;  1JB3 A;  4HN7 A;  2RA4 A;  4KTA A;  2HIV A;  2K01 A;  1BCP D;  1NAP A;  4MV6 A;  1IBM H;  4DNR B;  4KHP Q;  1L0Y B;  4X3T A;  3GIL A;  5KFK A;  1KDB A;  2F0U A;  4JC0 A;  4F7X A;  3OIQ A;  5EDW A;  2BA0 A;  1PFB A;  3FKI B;  3HKZ B;  4IPG A;  4KN7 C;  5JEA J;  1H95 A;  3PW5 A;  4Y8V B;  2EYF A;  5CR3 A;  3S1Q H;  3P20 A;  2MFI A;  3NE5 B;  2YU9 B;  5A2Q W;  3RB0 A;  3S1R B;  1EHI A;  2HCI A;  4DR1 L;  1SMY D;  2KCM A;  2WDT A;  4DV7 H;  1II3 A;  2BH2 A;  4LF9 L;  3H91 A;  2UXD Q;  1YNN C;  3AFQ A;  3MR5 A;  1LV9 A;  1ENC A;  1YJN A;  4JI0 H;  5TSS A;  2Y0S G;  4DV6 H;  1EEI D;  3PQI A;  3HOZ H;  1YHA A;  2R85 A;  3CF5 A;  3HB9 A;  3FKI A;  2CKZ B;  4R4I A;  1S0O A;  3KF6 B;  2CH4 W;  2O5J C;  4HJA A;  2FPG B;  4YR2 A;  1GJX A;  4B3M H;  1SSO A;  3RTX A;  2E2I A;  5IP9 H;  3GIP A;  3E6Z X;  5D3D A;  3EBE A;  3EJI A;  1UWV A;  3GQC A;  2C35 B;  1EYZ A;  1S9F A;  4O2D A;  3D4D A;  5C1P A;  2MO0 A;  3HRZ C;  1LTT D;  3I72 A;  4FDB A;  1VQ6 A;  2OTL A;  1XTD A;  4L63 B;  3SHL A;  4DR2 Q;  4A3J B;  3VMM A;  3IAY A;  1N34 L;  4JI5 L;  2NVT H;  2K28 A;  4ED3 A;  1Y1W B;  1IBK Q;  4A2A A;  5IP7 H;  4R4C A;  5K36 G;  4JK1 C;  1PH6 A;  2F4V H;  2EIF A;  4POF A;  2VL6 A;  4RAY A;  4ETS A;  3DHQ A;  4C3J H;  1JOO A;  2PQA B;  3WOE A;  4JI6 L;  1KEE A;  3H0G A;  3S9W A;  2NZH A;  1A3T A;  2BDN A;  2Z1C A;  1XYI A;  1BGW A;  5D3I B;  2AUJ D;  2RDJ A;  2L5T A;  2AWN A;  3TN2 A;  1WTH A;  3S1N H;  1SRU A;  4JI3 H;  2C5C A;  3J81 L;  5M3F B;  1Z47 A;  4A3G B;  5IGG A;  4CBV A;  1N48 A;  5JJI A;  4I4T F;  1VQN A;  2ALZ A;  1WTW A;  4OO1 G;  3EN2 A;  3RD4 A;  2JEJ A;  2UUB Q;  5I4D A;  4V0B A;  1WTX A;  3ORQ A;  4KJN A;  5KFJ A;  1CKN A;  3CMA A;  4A3I H;  1VS0 A;  3I56 A;  4O42 A;  5C3E G;  2A5H A;  4O3Q A;  3I90 A;  4ZLT F;  4EFB A;  4PG3 A;  3JRW A;  1STG A;  2VQF H;  1KDC A;  2DJG C;  3FDS A;  3BYT B;  2PW5 A;  4DR5 L;  1MHW C;  2E5L H;  2RHS B;  4RNM A;  1JT8 A;  3GTO A;  2R92 H;  5HY6 A;  3RLO A;  1LAB A;  4DV0 Q;  3A5Z B;  5FJ8 G;  1PHJ A;  1X3P A;  1TII D;  1VF7 A;  1GO3 E;  5KG0 A;  4BBS H;  3L7Z C;  2WFW A;  3LWB A;  4FO2 A;  3OIP A;  4IR9 A;  1N32 H;  4ECV A;  3KHR A;  1E4F T;  2KQ3 A;  3MHB A;  1W3S A;  3ER0 A;  1BVS A;  2PI2 E;  3TII A;  2V9W A;  2YZN A;  4Q45 A;  5F9L A;  3EPG A;  4BXX G;  3VPD A;  4PZ8 A;  2ZTC A;  4S3S A;  2JEI A;  3ETJ A;  1HFN A;  3KTM A;  2QF7 A;  3G6J B;  2DNC A;  5LHY 1;  4LF6 H;  2R93 B;  2JA8 H;  1E4E B;  5M5Y B;  1CQJ B;  5EZY F;  3D6W A;  1JXL A;  2QK4 A;  3OUZ A;  2R3Z A;  4ULL A;  3HOU G;  1YNJ C;  1YNX A;  4G57 A;  3TZD A;  3K5N A;  1OTC A;  5IT9 L;  1LT4 D;  2FJ2 A;  1QE6 A;  2B39 A;  2BQU A;  4C3I B;  2R7F A;  2YTX A;  3R3O A;  5IOD A;  4WJ4 A;  4LFB H;  3M4O H;  1NTG A;  1SNM A;  2QEX A;  2KHI A;  2QW7 A;  5DLQ E;  1AW7 A;  4WJW A;  2ZJT A;  4WOR A;  3RFC A;  3PZP A;  4JG2 A;  1TWF B;  1DZ1 A;  2OEO A;  4A3D H;  3QG1 A;  1KC7 A;  2W6N A;  5I47 A;  1EY0 A;  1Z6H A;  3CKI B;  3KJO A;  4DR7 Q;  4RB1 A;  3GIM A;  2NUA B;  4I7A A;  3BS1 A;  1VBH A;  2HVS A;  1HR0 Q;  4LUV A;  4NXM Q;  3RZO B;  5DEH A;  3UDG A;  3M4P A;  3RLN A;  2UUC Q;  2L1B A;  2E74 C;  4UFZ A;  5M3M G;  4M9U A;  4WRD A;  2VOB A;  2WB1 A;  3WWV A;  1LTI D;  4DNI A;  3TEH B;  2NZ1 D;  4C5B A;  4PV1 C;  1KLU D;  2FKL A;  4LF8 Q;  2WTF A;  1X55 A;  1K73 C;  1ENF A;  4DR6 Q;  1TWF A;  1E2W A;  5KG6 A;  5IGB A;  2I0Q A;  4LFC L;  1X3G A;  3M3Y B;  1DIK A;  1C3O A;  2HQE A;  2IP4 A;  1GD7 A;  4JV0 A;  4QQB X;  1FD7 D;  1KHI A;  5ELN A;  5IYB G;  4APM A;  3KJP A;  5FLX c;  1WH2 A;  5JJK A;  1N56 A;  4GLX A;  1CKO A;  2AHO B;  1LUZ A;  5C4X H;  1GM5 A;  1C7Y A;  3GTQ A;  1PH2 A;  4DV1 L;  1PV4 A;  4MV4 A;  3G6Y A;  1CA6 A;  5IYC G;  2YS6 A;  4A3K H;  2F0Q A;  3TSS A;  1LLR D;  5CA1 F;  1M1K C;  1R4P B;  2KHS A;  4LH7 A;  1Q81 C;  1WOC A;  4DUZ Q;  1GHJ A;  2WAQ E;  4EG0 A;  2FMM A;  3BZC A;  4R7R A;  3W1G A;  4FF3 A;  1JJG A;  1GSH A;  3K58 A;  2V58 A;  1U5K A;  3RR5 A;  1AUV A;  3KXY T;  1SE4 A;  2J4X A;  4K2K A;  1IBL Q;  5IWA Q;  1DON A;  5IYZ F;  2PZW A;  4C5C A;  2KED A;  3A8K E;  4YHH H;  1EFI D;  3MFY A;  5HV6 A;  5KFW A;  4J9R A;  3GTP A;  5HBR B;  1YNN D;  4BY7 G;  1IL2 A;  2FK3 A;  2WE6 A;  3NBH A;  5C1O A;  1ROD A;  2UXB L;  1HQM C;  3RNU A;  1GUT A;  4RGT A;  1D7Q A;  5IY0 A;  5J2T F;  1XNR L;  4F4W A;  4A75 A;  3Q8D A;  4QJF A;  1SCU B;  3V4Z A;  4PMC A;  4OIK A;  3S24 A;  3G8C A;  3C1F A;  3IG0 A;  4OWW B;  5FLX W;  4K0K H;  3TQ1 A;  1PTO F;  2OQK A;  4QWE A;  2MO1 A;  3D31 A;  1TS5 A;  4JBM A;  4BS9 A;  1I94 L;  3TP8 A;  4HSV A;  2N49 A;  1T36 A;  2WYO A;  1M6V A;  2D5D A;  2KOL A;  5J22 A;  2RF4 A;  1SJH D;  2JEG A;  2PO4 A;  2A73 B;  1EY6 A;  5LMN Q;  3K7A B;  5KFM A;  4DK3 C;  1LTA D;  1DCZ A;  4XDX A;  3OW7 A;  2N88 A;  1CZG A;  2KBN A;  2R86 A;  4L1K A;  2UVR A;  2NZO A;  4X6A H;  3HG9 A;  3N6X A;  4KJO A;  1HNX L;  1ZYR C;  3H0G H;  1HXY D;  1O7I A;  4XT1 B;  1UC8 A;  1XTC D;  2IT1 A;  5EKI A;  2B2U C;  3I4N H;  3U9T A;  1IBM L;  1XMO Q;  3PW0 A;  3HOZ G;  1WCM H;  2XGP A;  1YI2 A;  2H1E A;  1QNU A;  4X3K A;  1V43 A;  4FF4 A;  4QWA A;  1N8R C;  3CCQ A;  1TWA A;  1TXY A;  4DV5 Q;  2UUA Q;  4LF7 Q;  5LL6 S;  1WYD A;  5IP9 G;  4IUQ A;  3AB9 A;  5AFW A;  4IWY A;  2B2V C;  1LAC A;  4F4Z A;  4I7H A;  4JI7 Q;  3PGZ A;  3FMA A;  4DV7 L;  4FBU A;  3VDY A;  1HJP A;  1WVL A;  5KFI A;  4C3H H;  4JI0 L;  2F0I A;  4TQU S;  4LJZ C;  1V8Q A;  4DV6 L;  1T9H A;  2L55 A;  3ERO A;  1A3U A;  1BDO A;  3CU7 A;  4MA5 A;  1HUM A;  4C3J G;  1B70 B;  4M8A A;  2YS7 A;  3KAK A;  1U4P A;  3NGD A;  4K8J A;  5D8D A;  1TWH B;  3T1H Q;  1GUS A;  4DA2 A;  4B3M L;  5BN3 A;  4JUZ A;  2I5H A;  2F0H A;  1STH A;  4LUZ A;  4BA1 I;  1PZI D;  2YW2 A;  5D1O B;  3HOW H;  1I6H H;  4P75 A;  4G7Z C;  3MZ5 A;  2WII B;  4DR1 Q;  5KFB A;  1Z2N X;  4ZI7 F;  1GHK A;  4LF9 Q;  2Q2I A;  3UE0 A;  1YIJ A;  1STN A;  3D3R A;  1JOR A;  4DAP A;  2KUM A;  5I6Y A;  1K28 A;  4TUY F;  5KFV A;  1HZA A;  4A3B H;  1IOW A;  2B2U A;  2F4V L;  4ZCK A;  1CFM A;  2HT1 A;  1W93 A;  3VYR A;  4A3I G;  5DG7 A;  4EGQ A;  3G48 A;  4IWX A;  1YVC A;  1YNJ D;  1ZHQ A;  5L37 A;  1O7Y A;  3GTJ A;  4IUP A;  1JB7 A;  4TV8 F;  3HKZ E;  1BKB A;  5E1F A;  3DM3 A;  3GV3 A;  3F2D A;  4CKC A;  2XIG A;  2B2V A;  4Q0F A;  1NR2 A;  3TP6 A;  2R92 G;  4YAK B;  5KT3 A;  2LY7 A;  4JV2 A;  4GKJ H;  2ZTD A;  1SFO B;  4BBS G;  5M3M B;  1PK8 A;  3K59 A;  2JA6 A;  4LMY A;  4EQ5 A;  4O3P A;  3PIP 3;  1TKW B;  1TQO A;  1K0S A;  1N34 Q;  4JI5 Q;  4UCT A;  2QDB A;  1B4O A;  2VB2 X;  3NSW A;  1EIY B;  1T94 A;  2N3S A;  4ECW A;  1PFM A;  5DGA A;  4A3M H;  1N9W A;  4J9S A;  2R61 A;  2M05 A;  1BBX C;  4UCS A;  1EOT A;  2EXD A;  3PW7 A;  1B8A A;  2Q8R E;  4KLK A;  4JI6 Q;  5J2U F;  2JA8 G;  4DV2 H;  1HA5 A;  1LTL A;  2I07 B;  4YWM A;  4N8X 1;  3E5N A;  1RYS A;  2JA5 A;  4KY7 A;  3H15 A;  1PVO A;  1AE2 A;  1EU3 A;  5I2Y A;  3MWE A;  1SFO A;  2B2Y A;  1SRO A;  3RAQ A;  3GQB A;  4H0L C;  1MKH A;  2V4D A;  3Q8S B;  3P1H A;  3NUC A;  4XYL B;  5H80 A;  1ZEQ X;  4G3I A;  1I3Q A;  4U6P A;  5M5W B;  5C4H A;  2PBZ A;  1J6Q A;  3BZD B;  4MV9 A;  4JYA L;  2YYZ A;  5EPJ A;  3CD6 A;  1R9T B;  1EZ8 A;  1KTK A;  2BH8 A;  4A3D G;  4M7E A;  1EEF D;  3RBE A;  4RHS A;  1VQ4 A;  5KT4 A;  3CQZ B;  1G6Z A;  2R7D A;  1Q1B A;  3L2P A;  4LF6 L;  3C2P A;  2G9H D;  1HUN A;  4C2M A;  4BY7 B;  2PVP A;  1I5F A;  4GS3 A;  3LML A;  1KL9 A;  2RVL A;  3S2D B;  5LL6 X;  4DR5 Q;  2GLT A;  2W7O A;  1H9M A;  2C2R A;  2JE6 I;  4DLK A;  5ELO A;  2NVX A;  1CM9 A;  1I4G A;  2JQO A;  2Z0S A;  1FNU A;  2K5H A;  5FLM H;  1TAE A;  1Y1V B;  4GN4 B;  3RZD H;  4YBZ B;  5KFP A;  1K8O A;  1R9T A;  1CHP D;  2M9V A;  3CAM A;  3TQT A;  1NCV A;  3RB6 A;  1VDZ A;  1WTQ A;  4XQJ A;  1I7L A;  2K6A A;  2PI2 A;  5ELE A;  1WTR A;  4BA2 I;  4XYM B;  2DPJ A;  5BN4 A;  1CHQ D;  3ITP A;  2AKW B;  4IUR A;  4LAA A;  5C4X G;  3PIO 3;  3MEF A;  3PW4 A;  2VQE H;  3NWT A;  2FE3 A;  1E3P A;  1CQI B;  3GO5 A;  2G9D A;  3U58 A;  3S1Q B;  1SNO A;  2VW9 A;  4A3K G;  1O75 A;  1P16 A;  3MWD A;  3GTG A;  2NN6 I;  1Y1V A;  3NEM A;  2KA7 A;  4B3T H;  1MJC A;  2HVR A;  4HTH A;  1L0W A;  3OPO A;  2F0P A;  4B9X A;  2Z4H A;  4YCW A;  1C48 A;  3PUW A;  1C0A A;  3QO2 A;  1JKJ B;  3PO3 H;  1MI2 A;  2W8L A;  1ZYR D;  4JPB W;  3NEL A;  4O3R A;  2FHT A;  1Y69 U;  5HUR A;  3TP5 A;  4JI4 H;  3GTK H;  1EYG A;  1TWA H;  4DL6 A;  4I55 F;  2OLS A;  3I4L A;  1AZQ A;  4RB3 C;  3Q6S A;  2XRQ D;  4DUY L;  3OMG A;  2VUM H;  4J9N A;  2ASL A;  2NVT B;  4AYB G;  3MR6 A;  2LFN A;  4DAV A;  3K5M A;  4ECS A;  1S5C D;  2ATL A;  3ERS X;  3IL8 A;  3PR5 B;  4LFC Q;  2ZDQ A;  1W96 A;  4C3J B;  3J80 L;  3GTM H;  1EY4 A;  4RAZ A;  4EEY A;  3DEP A;  2R7M A;  2HCC A;  4ED7 A;  1PH3 A;  2W71 A;  1HCZ A;  4ED6 A;  4KD4 A;  1STB A;  4DV1 Q;  2EE1 A;  4OX9 H;  3H0G G;  5CV4 A;  4MN3 A;  5KFR A;  5JOB A;  1TS4 A;  3N43 B;  1PDQ A;  3N41 B;  1C4Q A;  2HDM A;  4G4K A;  3I4N G;  1XXG A;  3TIG A;  3M9B A;  3T1Y H;  4LF5 H;  2MJ8 A;  1WCM G;  4K6L A;  4C1N I;  4IQZ A;  4MIU A;  3RF2 A;  3BAA A;  1YZ6 A;  1M8A A;  2I46 A;  1TS2 A;  1XPO A;  1M0T A;  3K5I A;  2B63 A;  1AFP A;  3GTL A;  1PYB A;  4A3I B;  2EQS A;  3KDF A;  3A5U A;  3LGJ A;  2JN4 A;  1EY9 A;  3H40 A;  5A35 A;  2JJQ A;  2ZXP A;  5I9O A;  3VYU A;  2JSO A;  3L9A X;  2UXB Q;  2J9G A;  5T1G A;  4C3H G;  5DNF A;  2JYO A;  1XNR Q;  3SE7 A;  2R92 B;  4DK1 A;  3GTJ H;  3K0X A;  3HZX A;  4UPA A;  2ZM6 H;  2EYP A;  4BBS B;  4DV4 H;  4F4Y A;  4A3L H;  4ECQ A;  3MXP A;  5EGT A;  2L0C A;  1TWG A;  2HHH H;  1LM0 A;  2W70 A;  2RSO A;  4NW2 A;  1RK6 A;  4L8J A;  2QYZ A;  4N9P A;  1I94 Q;  1QZH A;  2XTI A;  4YJ3 F;  5LXT F;  4LF4 H;  3JRX A;  3V6K A;  2EYL A;  3F2U A;  1SND A;  1SYG A;  1Y14 B;  1WR2 A;  2J6S A;  2Q2U A;  1FGB D;  4R8N A;  3OWF A;  2JA8 B;  2E2H A;  4AQY H;  3LX0 A;  3CC2 A;  3HOW G;  3L3O C;  3RV3 A;  4Q8E A;  3F8T A;  1Q1E A;  3M9M B;  1HNX Q;  4NDX A;  4F87 A;  1SEB D;  2GVB A;  1U9R A;  1RL2 A;  1Z7T A;  4IPD A;  4DK0 A;  4IOA A;  3T13 A;  4A3B G;  5C0X H;  3J81 E;  2D62 A;  4OWX B;  3M4O B;  1PTO C;  4DAY A;  1IBM Q;  1CQV A;  4HIK A;  4YWK A;  4K5X A;  3GV7 B;  1L2F A;  1WTP A;  5KNB A;  1Y8O B;  4NPS A;  1Q90 A;  5KFL A;  3DF7 A;  4NXN H;  1Q8I A;  3CCR A;  5KFC A;  1STA A;  3MXN A;  1YIT A;  4APV A;  4G7H C;  5CA0 F;  2QEJ C;  3MTS A;  4R8U A;  1KJQ A;  4DV7 Q;  3IKJ A;  5JPM C;  4ED2 A;  3SK4 A;  4I7Z C;  1KJI A;  2IL8 A;  2AGQ A;  1NMG A;  2W9A A;  1XX8 A;  4JI0 Q;  1HNW L;  4RWS C;  5BR8 H;  4GLA C;  4ED8 A;  4DV6 Q;  1A63 A;  4A3M G;  4FS2 A;  2WB1 G;  3J7A K;  1RIP A;  2CW7 A;  4RGN A;  4UCO A;  4PMW A;  5C4J H;  1PTO B;  5FD6 A;  3PV0 A;  4B3S H;  4IN3 A;  1YJW A;  4B3M Q;  1IYJ B;  1I50 H;  2NVQ B;  1DXM A;  1EQR A;  1JIC A;  4BY1 B;  5LMU H;  1RDP D;  2AGP A;  2JA7 A;  3BU2 A;  3CCE A;  1F9S A;  1KNA A;  1RHP A;  2E2D C;  4IZ8 A;  4IZO A;  5KKN B;  3T1H L;  3MVV A;  2M2L A;  2ZJP A;  5M9O A;  5GAE C;  4DR4 H;  3AYH B;  2R84 A;  1A9X A;  4XIG S;  4IAJ A;  4OXP A;  5IT9 E;  4X64 H;  2W9B A;  4FXG C;  1H9K A;  1UE1 A;  2K5N A;  4N8F A;  2F4V Q;  3H3V H;  4J9O A;  3CCU A;  2R7K A;  3HOV B;  1Z2P X;  4H7B A;  4O2A F;  4O4H F;  4DV2 L;  2CQA A;  4H13 C;  1B44 D;  2QCP X;  4L6T B;  1HPC A;  1S40 A;  5E4W C;  2K5V A;  5FD5 A;  1N36 H;  4JV5 H;  1VQA A;  3A55 A;  1BXR A;  3ONA B;  3HKZ A;  3U4Z A;  1LTB D;  1QUQ B;  5EKL A;  4FM9 A;  2FMC A;  1ESF A;  3KUP A;  2C9O A;  4EQO A;  5FLM G;  1KC8 C;  1BUV T;  2F03 A;  2CFM A;  1HNZ H;  4QB4 A;  1SJE D;  3HXL A;  2YU9 A;  1GSA A;  2K5W A;  5DGB A;  2F0M A;  1EZ1 A;  4AYB B;  1DOK A;  2K33 A;  1HZ9 A;  3WO0 A;  3A0J A;  3OWE B;  4CJ0 B;  1PRT B;  1S3O A;  2W7P A;  1VQL A;  3C46 A;  1FJG L;  3BAB A;  2YTY A;  3KBG A;  4RAU C;  4GLV B;  5AJ3 L;  2BR0 A;  2F0S A;  3RJ0 A;  4QWB A;  5LA6 F;  2G5D A;  5J39 A;  2L4N A;  3W1B A;  3KF6 A;  5JQW A;  3GIJ A;  3DLL A;  2OT2 A;  4KHP H;  1SYX B;  3OYY A;  2NTT A;  2CW8 A;  5KYL A;  5KG3 A;  2BQ3 A;  5EOY A;  3N40 P;  3EQL C;  4TSS A;  5ELD A;  1X3Q A;  4IFD H;  3I2Z A;  1YHQ A;  1HZB A;  1A8V A;  2DGY A;  3VYS A;  1CQF A;  1WCM B;  4JYA Q;  5CB4 F;  3PO3 G;  3T5J A;  3D8G A;  1FL0 A;  3B6Y A;  4B08 A;  1Y1W A;  2TMP A;  1UEB A;  2QKI C;  5KRU A;  2XWB B;  3A7A B;  3UE1 A;  2I87 A;  2NWG A;  3Q22 A;  2VQE L;  4LF6 Q;  4HJ5 A;  2JXM B;  4RUC A;  2PQA A;  2WKD A;  2NVY H;  2W9C B;  2R7N A;  1SR3 A;  5FO8 B;  2B63 H;  4A3E H;  2ASD A;  2XIW A;  3BVG A;  4C3H B;  1F9R A;  1VQG A;  4B3T L;  2VUM G;  5CYU A;  4EQP A;  1S4Z A;  5CV7 A;  3Q0A A;  3JSN A;  2IJ0 A;  1U4L A;  1VQF A;  4RFB A;  1BJT A;  2R7Z H;  1P8L A;  3JAM L;  2TSS A;  4FXK C;  1J9O A;  2PZT A;  1PA6 A;  2NU7 B;  1FNV A;  4DL4 A;  3OSP A;  1K8G A;  4YY3 L;  4KKT A;  1H9S B;  4M1U B;  4B3R L;  1UE6 A;  3RIZ A;  4JI4 L;  1H9R A;  4DR2 H;  1HTP A;  2EDG A;  2N78 A;  2F0J A;  3HOW B;  3CME A;  1I6H B;  4JI2 H;  1S0M A;  2OCE A;  4HYK A;  1RCV D;  2DJF C;  2ZTE A;  1PX2 A;  3UDX A;  2FK1 A;  2O03 A;  4WD3 A;  1VF5 C;  5E3F A;  3U50 C;  3Q2O A;  1K0R A;  4A3B B;  3NXW A;  3MFG A;  4DNT B;  1AN7 A;  2YCH A;  3I70 A;  3PN1 A;  1CKM A;  2F0G A;  2PMZ B;  3J80 i;  3NP8 A;  2XCA A;  4UAI A;  4QIW B;  3CC7 A;  3TBI B;  1PYW D;  4QF4 A;  2LXJ A;  3A74 A;  4KKU A;  1I6V C;  1PTO D;  2MCT A;  3E0E A;  2FMA A;  5KGU A;  2R93 A;  1YJ9 A;  1E4E A;  3ZJY C;  1HR0 W;  1U4M A;  2UUB H;  1KJJ A;  1ENA A;  5EPL A;  2IPK D;  4DUY Q;  2LMC B;  4LF5 L;  4A3L G;  2FP4 B;  5C4Z A;  3FVQ A;  1K83 H;  1OO9 B;  5FK9 C;  3S15 H;  4IUN A;  1RJR A;  2K1B A;  4Q43 A;  2FB9 A;  3AQQ A;  1EWH A;  2SOB A;  3URY A;  4K8I A;  5IIF A;  4RZQ A;  3D4W A;  3PUY A;  4GKK H;  3PCO B;  3HP3 A;  2PW7 A;  1PFS A;  1U0L A;  1U4R A;  4RKB A;  4DV0 H;  1VQK A;  1CI3 M;  5KT2 A;  3TDQ A;  1H9J A;  1EL0 A;  5I6W A;  4LK1 C;  3E5S A;  2VA3 A;  3T5H A;  4X65 L;  2ZM6 L;  4B9W A;  5C0X G;  4U7C A;  4ECT A;  2IHE A;  1GSO A;  2JK8 A;  4UP7 A;  4EQN A;  2CWA A;  4HAE A;  4MNO A;  2F1M A;  5C5J A;  1SAP A;  4HMJ A;  4XT3 B;  1D8L A;  5EPK A;  3LP8 A;  1AE3 A;  1VQ9 A;  4MTN A;  1IYU A;  4HCE A;  3I8Z A;  3KF8 B;  4YIJ A;  3CCS A;  3U4V A;  1A6X A;  2OWO A;  5T1I A;  1TA8 A;  2Y0S B;  5JVD F;  4AQY L;  3S1M H;  2GA4 B;  4GZY C;  5DM7 3;  4P2C B;  1QVF A;  3K3V A;  1OXS C;  3KOJ A;  2IX0 A;  1BO0 A;  2AGO A;  2DUD A;  1KLG D;  2R8H A;  4CDD C;  2UXC H;  5J1Z A;  3EFX D;  1EQV A;  3RZD B;  2SNM A;  1QZG A;  4Q8F A;  2K4K A;  3FKI H;  1WD0 A;  1B9N A;  2CVR A;  4IUU A;  1RK5 A;  1HR0 H;  4NXM H;  3QJY A;  5A2Q E;  4L5S A;  2UUC H;  2E2I H;  3G7L A;  3DMU A;  4XXE A;  3OTO H;  4CDE C;  1BR9 A;  1KJ8 A;  4XTC S;  1EWC A;  3A54 A;  5C44 H;  3WNZ A;  4ZKB B;  3I3C A;  4UP8 A;  1Q3L A;  1QVC A;  3BQ2 A;  4LF8 H;  2RHQ B;  4WBN F;  1ONL A;  2R6G A;  2LKV A;  3RB3 A;  5LMN W;  1DV2 A;  4LSX A;  4DR6 H;  3H6M A;  5KNC A;  3J7A V;  1I7N A;  3H4D A;  1QWY A;  2P0A A;  2NU6 B;  3NQI A;  4CHT B;  3J81 j;  2F0D A;  3X3N A;  4PDB A;  2EJF C;  1KAB A;  4IUT A;  3HBL A;  3K5H A;  4J15 A;  3VR4 A;  5C3X A;  4DR3 H;  1G8Z D;  1RTN A;  3PO3 B;  1M4V A;  1BBU A;  4HMI A;  1SE3 A;  4TQR A;  4B3S L;  3Q8Q B;  4PWQ A;  2K05 A;  5EKK A;  2DY8 A;  3RLF A;  2L12 A;  2CWP A;  1V1P B;  5JUM A;  4A3J H;  3QZ8 A;  4KHZ A;  4DUZ H;  3K8A A;  5D1P A;  3VA5 A;  3V6H A;  2NUC A;  4A93 H;  4DR4 L;  4UDU C;  3FMC A;  1JOQ A;  2HJW A;  1JDB B;  4K5V A;  1JOK A;  2VUM B;  5C3E B;  1G6P A;  5L1K A;  1HNW Q;  2K75 A;  1KD1 C;  1VQJ A;  1TWC B;  4OO1 I;  2LXK A;  5KFH A;  1K3B C;  2K5Q A;  2MQH A;  5L9X A;  3I91 A;  3MAQ A;  3KK7 A;  1EWI A;  1PRT F;  1G51 A;  2B2T C;  4PNY A;  3GTM B;  1M0W A;  1QIL A;  3BDL A;  1RD9 D;  4JVZ A;  5ISR A;  3AEV A;  4A3G H;  3PVX A;  4JI1 H;  4RNN A;  2F0N A;  1MZB A;  2DN8 A;  4JV5 L;  3GTO H;  5JJL A;  4BWS C;  4DL5 A;  1DGS A;  1CT1 D;  4KD3 A;  3WO1 A;  2A6E C;  1WD1 A;  1T3N A;  2DPI A;  3S2H B;  2F3W A;  1HNZ L;  4DV3 H;  3BQ1 A;  4IFD G;  1TWC A;  3R5H A;  2OH2 A;  1B53 A;  3U9O A;  5C3W A;  1VKZ A;  1E2Z A;  1B7Y B;  2NU9 B;  3RBD A;  2X0S A;  3R2I A;  2W6O A;  3VR6 A;  4DF7 A;  2VA2 A;  3HOU B;  3KHL A;  4ALP A;  3W2D A;  2W57 A;  2FIN B;  4L5Q A;  1OWT A;  2UVU A;  4NLG A;  2UU9 H;  2WAQ G;  1G2T A;  2X6L A;  4DV2 Q;  5KFN A;  3J81 c;  1O7L A;  5NUC A;  2B63 G;  1HTL D;  2B29 A;  2NYZ D;  1TWH A;  4XX0 B;  2XGQ A;  3Q23 A;  4A3E G;  1MGS A;  2HUG A;  3PMF A;  4UY8 C;  3I7F A;  2I8C A;  2EOT A;  2D9U A;  4MV8 A;  3FP9 A;  1QB5 D;  2RQX A;  2MP1 A;  1S0N A;  1K8A C;  1DJR D;  5D1O A;  1JE4 A;  1VQM A;  1KXL A;  1X32 A;  2R7Z G;  3GV5 B;  4DV5 H;  2O5I C;  4LF7 H;  5KFX A;  1W6J A;  3NTH A;  5KG1 A;  4JI3 L;  4CJ2 C;  1YBY A;  3J81 i;  4H02 A;  4EBC A;  2ZT9 C;  3ORR A;  3KBX A;  1UAP A;  2Z8L A;  4HNU A;  1FJG Q;  4JI7 H;  3SR1 A;  1LT6 D;  2PCF B;  2R8J A;  5A2Q L;  1RYR A;  5AJ3 Q;  1B2T A;  2VPS A;  2B2T A;  4IAL A;  4YCU A;  5CMD A;  4AIM A;  3J80 E;  4XQN A;  5F2D A;  4O2B F;  2DZD A;  2R8K A;  2F0K A;  4RB2 C;  3PUZ A;  2J6U A;  4N9T A;  3S14 B;  1TWF H;  1S68 A;  1TVX A;  4GC6 A;  2VQF L;  2F3V A;  4ECU A;  2F0L A;  3JAM i;  3TZU A;  4RHR A;  2E5L L;  2PN1 A;  5G3L F;  1I4Q A;  3J81 W;  4H44 C;  1F2M A;  3HFZ B;  1TR5 A;  4O3S A;  1KRT A;  2VR1 A;  1SYC A;  2O2L D;  3C0F B;  5CBE E;  5KFD A;  3GTQ H;  1N32 L;  4DR1 H;  5FO7 B;  1STY A;  2VQE Q;  4OWT B;  2V1C C;  4MV1 A;  5IT9 c;  1QCB D;  1VMC A;  5J3B A;  3E0J A;  1EZ6 A;  4JI2 L;  3TIN A;  2A69 C;  1D5X C;  2P5Z X;  2RCN A;  4J6H A;  1Z2O X;  4DL2 A;  2PZU A;  4B3T Q;  2GPW A;  1OXU A;  1STE A;  1D1K A;  4R9W A;  5IYD H;  4DXG A;  1Q12 A;  3BG5 A;  3M9N B;  1D1I A;  2N55 A;  1ET6 A;  1QG7 A;  3GTP H;  4JI8 H;  5C4J B;  1ICF B;  5M5X H;  2EVB A;  3S16 H;  4LFB L;  2LSS A;  4YY3 Q;  5C5L A;  4JCV E;  3VA7 A;  1I50 B;  2JEF A;  1PH8 A;  1NJI C;  4B3R Q;  2FJZ A;  4JI4 Q;  2HVQ A;  2RCF A;  1IKM A;  1O78 A;  3CQZ A;  4FXD A;  5CV8 A;  1GUG A;  1F77 A;  3K7U C;  3BDC A;  4FP5 D;  1ML0 D;  5EWF A;  1X3F A;  2ID0 A;  3SGI A;  1AUX A;  4HNT A;  5KFO A;  4GNX C;  1TU2 B;  2IX3 A;  5EJW A;  3EYY A;  4FNF A;  3CP0 A;  1B6S A;  1VQC A;  3E9I A;  2DIK A;  2EYH A;  3A8J E;  1HRJ A;  1D6E C;  4CGY B;  2R8I A;  2FFK B;  2A68 C;  2L11 A;  4X62 H;  5IT9 W;  2F4I A;  1SN8 A;  5K5P A;  4O0A A;  2PQE A;  1NY4 A;  4U67 3;  3CCL A;  1K1S A;  2RGR A;  1X3E A;  2Z6B A;  4GKK L;  2XVS A;  4EX5 A;  1N33 H;  5FLX E;  3KHH A;  4HNV A;  3HOZ B;  4F8M A;  5KG5 A;  2RBM A;  4V19 0;  3PSI A;  4IUV A;  5LP6 F;  4YR3 A;  3BVM A;  5KG2 A;  4E6I A;  3CPF A;  3R8B A;  2MHV A;  1QNK A;  4LF5 Q;  1M7J A;  5KFU A;  3VR2 A;  3FKI G;  1LTS D;  1RF2 D;  3N6R A;  4GNX B;  1DOM A;  1PMR A;  1RJQ A;  2K03 A;  3K7A H;  3QIA A;  3CRL C;  4DU9 A;  3CVZ A;  4O3N A;  5COY A;  1A2U A;  5C44 G;  4DR5 H;  3M9O B;  1ZET A;  2PMZ E;  4QUF A;  4EGV A;  4QIW E;  1GXD C;  5EBC A;  2RGV A;  1X65 A;  4K2L A;  2EZV A;  4C5A A;  3QOL A;  4LUO A;  1S5F D;  4ECY A;  3KAJ A;  4DL3 A;  2RDF A;  3DWP A;  4GN5 A;  4YHH L;  3QFF A;  5BPF A;  5I9P A;  4RZR A;  3NPP A;  2UXC L;  3TS2 A;  4EYH B;  4OGQ C;  5JVL A;  4IPC A;  5KND A;  3FRP B;  4X65 Q;  2ZM6 Q;  2I5M X;  4GNX A;  1EUC B;  5KT7 A;  4IRC A;  1Z9F A;  3GD7 A;  4LWC A;  2CQY A;  3HEJ A;  4QW8 A;  2YYA A;  3ETH A;  3T16 A;  3S1N B;  1O7Z A;  4MHE A;  2VUG A;  4HCS A;  1BQQ T;  5CAE B;  3M4Y A;  4A3F H;  4QCL A;  4HJ8 A;  2A6E D;  2O4X A;  3OTO L;  2L15 A;  4K0K L;  1R4Q B;  2DY7 A;  4XYO A;  4A3J G;  1CE8 A;  4LFA H;  5JVG 3;  3NK9 A;  1VBG A; 
#chains in the Genus database with same CATH homology
 3OW2 A;  4AQY Q;  1LUZ A;  5C4X H;  1GM5 A;  3L0O A;  1C7Y A;  2OTJ A;  1NMF A;  1PH2 A;  4RMF A;  4DV1 L;  1PV4 A;  1HZ9 A;  2JA9 A;  4A93 G;  4JI8 Q;  2IY5 B;  3A0J A;  1S3O A;  5IYC G;  1VQL A;  4A3K H;  1FJG L;  2YTY A;  1M1K C;  4HIO A;  1WOC A;  4GLV B;  5AJ3 L;  1Q81 C;  4DUZ Q;  2WAQ E;  3BZC A;  1OXX K;  5EAY A;  3W1B A;  3KF6 A;  3PUX A;  3W1G A;  3RZO H;  3PIP A;  3STB D;  1JJG A;  4AYB E;  4DR3 L;  3HOX H;  1U5K A;  3M85 A;  3DLL A;  3RR5 A;  3PF4 A;  1QVG A;  3AFP A;  1IBL Q;  3OYY A;  5IWA Q;  4A3G G;  2HIX A;  2BA1 A;  1Q7Y C;  4DR2 L;  2A1A A;  5C0X I;  4BY7 G;  2CQO A;  3CW2 C;  3KFU A;  3I2Z A;  1IL2 A;  1YHQ A;  1HZB A;  1IBK L;  4X62 Q;  1A8V A;  2DGY A;  1E1T A;  2Y0S E;  1K9M C;  4JYA Q;  2JA6 H;  2UXB L;  3PO3 G;  3RNU A;  1FL0 A;  1D7Q A;  3B6Y A;  1CSQ A;  2GVA A;  5IY0 A;  3M3Y H;  1XNR L;  4KI0 A;  4A75 A;  3Q8D A;  4QJF A;  4JBK A;  2MNA A;  1UEB A;  1N33 Q;  5GAH C;  3S24 A;  4IOC A;  3UE1 A;  2VQE L;  4LF6 Q;  4OWW B;  4HJ5 A;  2VS1 A;  2PQA A;  2OQK A;  2NVY H;  2MO1 A;  3D31 A;  2Q2H A;  1SR3 A;  1I94 L;  4JBM A;  2B63 H;  3CCJ A;  4A76 A;  4A3E H;  2JA5 H;  2N49 A;  1VQG A;  2VUM G;  4B3T L;  4B3S Q;  4JI1 L;  2RF4 A;  3KYH C;  1SFO H;  3UDF A;  5LMN Q;  4DK3 C;  1VQF A;  2R7Z H;  1P8L A;  2KBN A;  2AMC B;  2UUB L;  2NZO A;  1PA6 A;  4X6A H;  1I3Q H;  1HNX L;  1L1O C;  2JA7 G;  4DV3 L;  1VQ8 A;  1K8G A;  4DR4 Q;  3H0G H;  4YY3 L;  1XJV A;  1O7I A;  1EQQ A;  4P71 A;  2F3I A;  2IT1 A;  1UE6 A;  4B3R L;  1UE7 A;  4JI4 L;  3I4N H;  1E7Z A;  4P72 A;  3I55 A;  4HID A;  1XMO Q;  1IBM L;  3HOZ G;  3RN5 A;  1WCM H;  2N78 A;  3G6E A;  1YI2 A;  1V43 A;  3CME A;  2IHF A;  4A3C H;  2OCE A;  3CCQ A;  1N8R C;  1A0I A;  2UU9 L;  1TXY A;  2XGT A;  4C2M H;  4DV0 L;  4DV5 Q;  2UUA Q;  2YV5 A;  4LF7 Q;  3I4M G;  1E22 A;  2ZTE A;  5GQO A;  1WYD A;  3UDX A;  5IP9 G;  4HIM A;  4L5R C;  1VQH A;  3U50 C;  4ME3 A;  1K0R A;  4BY1 G;  4OX9 Q;  3FHW A;  4JV5 Q;  3PIO A;  1Q46 A;  2NVX H;  4JI7 Q;  3H3V I;  3PGZ A;  4DV7 L;  4GN3 B;  3VDY A;  1CKM A;  1HJP A;  1V9P A;  3D0F A;  4PZ6 A;  3CCM A;  1R9T H;  4C3H H;  3T1Y Q;  3J80 i;  3HKZ G;  4DR7 L;  1XPU A;  4IJL A;  3CC7 A;  1WI5 A;  1HNZ Q;  4LFA Q;  4JI0 L;  1OXV A;  4TQU S;  2UXD L;  2A19 A;  2Z6K C;  4DV6 L;  1T9H A;  2LXJ A;  4IPH A;  1L1O B;  3A74 A;  1CUK A;  1S72 A;  3PO2 H;  4GKJ L;  4JBW A;  3E0E A;  1Q8K A;  4R1J A;  1B70 B;  1YJ9 A;  3HOV G;  1WFQ A;  5GRO A;  3ZJY C;  1XMQ Q;  1HR0 W;  2ES2 A;  4DUY Q;  3T1H Q;  4LF5 L;  4A3L G;  4B3M L;  1PH9 A;  1SE8 A;  2I5H A;  2AWO A;  3GTG H;  3G4S A;  1Y1V H;  1K83 H;  4LUZ A;  4BA1 I;  1Q82 C;  3S15 H;  1NBW A;  3HOW H;  1C9O A;  2HQL A;  2H5X A;  4P75 A;  3AQQ A;  1X9N A;  1I6H H;  4DR1 Q;  4DV4 Q;  1AH9 A;  4LF9 Q;  2HHH Q;  2Q2I A;  3PUY A;  1L1O A;  3UE0 A;  5IYD G;  2D0O A;  3PCO B;  1JJC B;  1YIJ A;  1ASY A;  1GVP A;  1KRS A;  2JEB I;  1PFS A;  1U0L A;  3M4Q A;  1HR0 L;  1HZA A;  1EUJ A;  4NXM L;  5C3E H;  1VQK A;  4A3B H;  1VQO A;  5C0X J;  1E1O A;  2UUC L;  2F4V L;  4LF4 Q;  1TWC H;  4JI3 Q;  3HKS A;  3BJU A;  2HT1 A;  2WB1 E;  1PH5 A;  4A3I G;  3G48 A;  1YVC A;  4X65 L;  2ZM6 L;  3PF5 A;  5C0X G;  2D0P A;  2IHE A;  4IFD I;  1Y1W G;  4LW1 A;  2N8N A;  5FJ8 H;  4LF8 L;  2JK8 A;  4UP7 A;  1JB7 A;  3HKZ E;  1BKB A;  4DR6 L;  1IXR A;  2CWA A;  4MNO A;  3DM3 A;  1X6O A;  3F2D A;  3KDF B;  2R92 G;  1YEZ A;  2ATW A;  1D8L A;  5H1S E;  2ZTD A;  3BZK A;  3EIV A;  1AE3 A;  2GN5 A;  1VQ9 A;  4MTN A;  4BBS G;  2K50 A;  4BXX H;  1TWH H;  3KF8 B;  3KLW A;  4EQ5 A;  4QY7 A;  3J7Z C;  3CCS A;  1QUQ A;  3U4V A;  3S2H H;  1HZC A;  2OWO A;  2VQF Q;  4AQY L;  1N34 Q;  4JI5 Q;  3S1M H;  1HH2 P;  1EIY B;  2N3S A;  4R4O A;  1K3R A;  2KHJ A;  2Z6K A;  3CXC A;  1OXS C;  2E5L Q;  3KOJ A;  4YCV A;  3F2C A;  2IX0 A;  1SLJ A;  3F1Z A;  4JI8 L;  1N9W A;  2I5L X;  4A3M H;  5M3F G;  2EXD A;  2DUD A;  3HOU H;  4NXN Q;  2WP8 J;  2YTV A;  1B8A A;  4KLK A;  4JI6 Q;  3J7A 5;  1N32 Q;  4DUZ L;  2JA8 G;  2VNU D;  4YWM A;  1LTL A;  1QZG A;  3CCV A;  2K4K A;  3FKI H;  4PZ7 A;  3H15 A;  1PVO A;  1AE2 A;  3TS0 A;  1VQP A;  1SRO A;  4JI2 Q;  1LYL A;  1JJ2 A;  4L5S A;  1IBL L;  5IWA L;  1MKH A;  4A4I A;  1JMC A;  2E2I H;  1UE5 A;  5BR8 Q;  4NB3 A;  4TVA B;  4XTC S;  1QVF A;  5C44 H;  4AH6 A;  3TQY A;  1KIX A;  4X62 L;  1J6Q A;  2B3G A;  2ZJR A;  1XNQ Q;  4JYA L;  1CKN B;  4UP8 A;  1QVC A;  2YYZ A;  3CD6 A;  3GTL H;  2RHQ B;  2BH8 A;  2R6G A;  4A3D G;  5LMN W;  1VQ7 A;  1MIU A;  1VQ4 A;  3K80 C;  4DAY B;  1OXT A;  4BBR H;  5M3M H;  1N33 L;  4LFB Q;  3CC4 A;  2R7D A;  1Q1B A;  4HJ7 A;  3L2P A;  4LF6 L;  1VQI A;  5LMU Q;  2VZA A;  1ASZ A;  1VQB A;  5IE8 A;  3J81 j;  1KAW A;  1I5F A;  4GS3 A;  3ULJ A;  1KL9 A;  4J15 A;  4RG1 A;  4DR5 Q;  1TWG H;  1BBU A;  2JE6 I;  4QGU A;  2UXD Q;  3MXN B;  5ELO A;  4X64 Q;  4B3S L;  2JQO A;  3RLF A;  2Z0S A;  4YWL A;  2K5H A;  2CWP A;  5FLM H;  2R93 G;  4GN4 B;  5IYB H;  5LMN L;  3RZD H;  1VQ5 A;  3S14 H;  3HOY H;  4A3J H;  3CAM A;  4KHZ A;  3UDI A;  3K8A A;  4UP9 A;  3J80 c;  2JEA I;  4A3F G;  1G29 1;  2K52 A;  3W5O A;  4P73 A;  2PI2 A;  4A93 H;  4BA2 I;  1FGU A;  2E2H H;  4DR4 L;  2OQ0 A;  4JOI C;  5IYC H;  1CSP A;  4GKK Q;  1A62 A;  2FXQ A;  4POG A;  4IJH A;  1N36 Q;  1G6P A;  2AKW B;  5C4X G;  1HNW Q;  1VQD A;  2K75 A;  3MEF A;  4JBJ A;  1KD1 C;  4R4T A;  4R4Q A;  1VQJ A;  1XMO L;  5M5W H;  1E3P A;  2LXK A;  4OO1 I;  3GO5 A;  3U58 A;  2MQH A;  3I4O A;  2VW9 A;  4A3K G;  1GKH A;  1P16 A;  1MJE A;  2NN6 I;  3S17 H;  1EWI A;  3CQZ H;  1G51 A;  3NEM A;  4DV5 L;  2UUA L;  4LF7 L;  2KEN A;  1VQE A;  3AEV A;  4A3G H;  1MJC A;  1L0W A;  2ALY B;  4OX9 L;  4JV5 L;  3GTO H;  5JJL A;  4BY7 H;  3HOX G;  1DGS A;  4YCW A;  4IFD J;  4JI7 L;  3PUW A;  1C0A A;  4X66 Q;  2VY3 A;  3S2D H;  3PO3 H;  1V1Q A;  3T1Y L;  1KQS A;  4Y7N H;  1HNZ L;  4LFA L;  4IFD G;  1JE5 A;  3NEL A;  3E9H A;  1B7Y B;  1J5E Q;  1VCI A;  2JA6 G;  4Y52 H;  2IX1 A;  2HIV A;  3GTK H;  1EYG A;  4KHP Q;  1TWA H;  4ALP A;  1EFW A;  4YHH Q;  2QGQ A;  1XMQ L;  4L5Q A;  2UXC Q;  4JC0 A;  2WAQ G;  4DUY L;  4DV2 Q;  2BA0 A;  2VUM H;  4IPG A;  1H95 A;  5JEA J;  3STB C;  4AYB G;  3J81 c;  2B63 G;  2B29 A;  1X54 A;  3ERS X;  3S1Q H;  4A3E G;  2JA5 G;  2MFI A;  4GOP C;  4LFC Q;  5JEA G;  4UY8 C;  3I7F A;  4DR1 L;  2K14 A;  2KCM A;  3FP9 A;  4DV4 L;  1W2B A;  3OTO Q;  4LF9 L;  2BH2 A;  2HHH L;  4K0K Q;  3GTM H;  3AFQ A;  1XPR A;  1K8A C;  2JA7 H;  1YJN A;  4LNQ A;  1VQM A;  1KXL A;  2R7Z G;  4JOI A;  2Y0S G;  1PH3 A;  2E2J H;  4JI3 L;  4LF4 L;  4DV1 Q;  2CCZ A;  1YBY A;  3J81 i;  4H02 A;  3HOZ H;  1YHA A;  3H0G G;  3CF5 A;  2CKZ B;  1FJG Q;  4R4I A;  3KF6 B;  3G71 A;  1NE3 A;  4HJA A;  3I4N G;  5AJ3 Q;  3M9B A;  3I4M H;  4YCU A;  1WCM G;  4AIM A;  5IP9 H;  4DPG A;  2NVQ H;  4A3C G;  3EBE A;  1YZ6 A;  1UWV A;  4BY1 H;  1X56 A;  2C35 B;  4DR3 Q;  1XPO A;  4O2D A;  2MO0 A;  3PUZ A;  4FDB A;  1VQ6 A;  1PYB A;  3NBH B;  2EQS A;  1TWF H;  1XTD A;  4OON A;  4DR2 Q;  3KDF A;  3A5U A;  2OTL A;  4GOP B;  3LGJ A;  2VQF L;  1N34 L;  4JI5 L;  2NVT H;  3JAM i;  2JJQ A;  1IBK Q;  2E5L L;  5IP7 H;  4R4C A;  5K36 G;  1PH6 A;  3HFZ B;  2UXB Q;  2EIF A;  4POF A;  2VL6 A;  2YU9 H;  1KRT A;  3S1R H;  2PNH A;  4DKA C;  1PH7 A;  1XNR Q;  3M7N A;  4NXN L;  3CPW A;  4C3J H;  3K0X A;  2PQA B;  4UPA A;  3GTJ H;  4JI6 L;  3GTQ H;  3HOV H;  1N32 L;  2VQE Q;  3PO2 G;  4OWT B;  4A3L H;  2V1C C;  5IT9 c;  2NZH A;  1LM0 A;  5J3B A;  3RN2 A;  4JI2 L;  2AWN A;  3PUV A;  1I94 Q;  2RCN A;  1QZH A;  2XTI A;  4MZ9 A;  5E7N A;  4GOP A;  1SRU A;  1E24 A;  3S1N H;  5BR8 L;  1WJJ A;  1Z47 A;  3JC6 6;  4B3T Q;  1Y14 B;  5JJI A;  1OXU A;  2Q2U A;  4JI1 Q;  1VQN A;  3ULL A;  1Y1V G;  3IRB A;  1EOV A;  2E8G A;  5IYD H;  1Q12 A;  1SMX A;  2A8V A;  1XNQ L;  3EN2 A;  3CC2 A;  3HOW G;  4OO1 G;  1PH4 A;  3ICE A;  2UUB Q;  2NN6 G;  3GTP H;  2KCT A;  1Q1E A;  3F8T A;  5M5X H;  1HNX Q;  4DV3 Q;  1BBW A;  3S16 H;  4LFB L;  2GVB A;  1CKN A;  2LSS A;  4YY3 Q;  1VS0 A;  3I56 A;  3CMA A;  1RL2 A;  4IPD A;  5HGQ A;  4A3I H;  4JCV E;  5C3E G;  5LMU L;  4A3B G;  4IOA A;  1PH8 A;  1NJI C;  2D62 A;  3F2B A;  4OWX B;  4JI4 Q;  4B3R Q;  5GAG C;  4PG3 A;  1Y1W H;  2F52 A;  1IBM Q;  4L5T A;  3K7U C;  4HIK A;  1X3F A;  2ID0 A;  4YWK A;  3SGI A;  2RHS B;  4DR5 L;  4GNX C;  1JT8 A;  2QA4 A;  2UU9 Q;  2R92 H;  5HY6 A;  4X64 L;  1L2F A;  3RLO A;  4DV0 Q;  3A5Z B;  3CP0 A;  5FJ8 G;  1PHJ A;  1M90 C;  1FVI A;  1VQC A;  1GO3 E;  3E9I A;  4NPS A;  4BBS H;  3L7Z C;  2WFW A;  3CCR A;  1PYS B;  1EIF A;  1YIT A;  4APV A;  1W3S A;  1SN8 A;  3ER0 A;  1BVS A;  2PI2 E;  4O0A A;  2Q2T A;  1NY4 A;  4DV7 Q;  3CCL A;  4DAM A;  4BXX G;  4PZ8 A;  1X3E A;  2ZTC A;  4P74 A;  5M3F H;  4GKK L;  4EX5 A;  3TRZ A;  1NMG A;  1N36 L;  4JI0 Q;  4QL5 A;  1HNW L;  4GLA C;  4DV6 Q;  1A63 A;  2JA8 H;  4A3M G;  2WB1 G;  5GAD C;  1RIP A;  2ASB A;  4GKJ Q;  1PH1 A;  3HOU G;  1Q86 C;  4PMW A;  1YNX A;  1OTC A;  3PSI A;  5C4J H;  1YHB A;  3CPF A;  3TRE A;  3PV0 A;  4LF5 Q;  2R7F A;  1YJW A;  3FKI G;  2YTX A;  4B3M Q;  1IYJ B;  1I50 H;  4WJ4 A;  1EQR A;  3M4O H;  4GNX B;  1IZ6 A;  1NTG A;  3K7A H;  5IP7 G;  2QEX A;  3BU2 A;  3CCE A;  2KHI A;  5DLQ E;  4X66 L;  3T1H L;  4JG2 A;  2ZJP A;  4A3D H;  5GAE C;  5C44 G;  3AYH B;  4XIG S;  2PMZ E;  4DK6 C;  3KJO A;  4IO9 A;  4DR7 Q;  4OXP A;  1J5E L;  4QIW E;  1X65 A;  1HR0 Q;  3K81 C;  4LUV A;  4NXM Q;  4LUO A;  3UDG A;  4KHP L;  1UE1 A;  2K5N A;  3M4P A;  3RLN A;  2UUC Q;  2F4V Q;  3GDE A;  3H3V H;  4GN5 A;  4YHH L;  3CCU A;  4BBR G;  5M3M G;  2UXC L;  3TS2 A;  4IPC A;  3WWV A;  4X65 Q;  4DNI A;  3NEN A;  2I5M X;  3TEH B;  2ZM6 Q;  4DV2 L;  4GNX A;  3ULP A;  1Z9F A;  3GD7 A;  4LWC A;  1S40 A;  2R93 H;  4LF8 Q;  2K5V A;  1X55 A;  1K73 C;  5M5Y H;  1VQA A;  4DR6 Q;  2I0Q A;  4LFC L;  1X3G A;  3U4Z A;  1QUQ B;  4HJ9 A;  1GD7 A;  3JAM c;  4A3F H;  5FLM G;  4HJ8 A;  3OTO L;  1KC8 C;  1KHI A;  2L15 A;  4QQB X;  5ELN A;  5IYB G;  2CFM A;  4K0K L;  3KJP A;  5FLX c;  4WJ3 M;  5JJK A;  3HOY G;  4C3I H;  4A3J G;  4GLX A;  1CKO A;  2AHO B;  2ZJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...