4A3FG

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid and soaked with ampcpp
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 28
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3fG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3fG01
5FLMH 1VQAA 1P8LA 1TWHH 1K8GA 1VQJA 2JEAI 4C3HH 1EUJA 3J81c 2ZJQA 2Q2UA 1Q12A 3STBD 1VQ7A 1VS0A 1E1TA 4IJLA 3L7ZC 3M4QA 4OO1I 3HFZB 5IP9H 3RNUA 4BY7G 4A75A 1K0RA 4DR1Q 3PO3H 4GOPC 1N33L 1HZCA 4MNOA 4AQYL 4YWMA 4X6AH 4UPAA 1K9MC 2UXCL 1K8AC 5FLXc 2PQAA 1TWGH 2OQKA 2VQEQ 1VQMA 2ZTCA 1QVFA 1TWAH 2ATWA 3J80i 3KFUA 2D62A 2NZOA 2UUCQ 5IWAL 3J81i 3D0FA 2WFWA 2PMZE 1JE5A 1VQBA 3CW2C 1V9PA 2GN5A 2K52A 4H02A 4QJFA 5LMNL 2N8NA 1X54A 1OXUA 5BR8L 3U58A 1LM0A 2E2HH 5M3MH 2RHQB 5HY6A 3AFPA 4DV1Q 4OONA 1PYBA 3U50C 1UE6A 2I5HA 4NXNQ 2NN6I 3GTGH 4X64Q 3DM3A 3KF8B 3HOYH 3STBC 4JI4L 3I4NH 4A3CG 3AEVA 2OTJA 2R92G 5BR8Q 1L1OC 4X62L 3KF6B 3I4OA 4UP7A 5ELOA 3E9HA 4DV5Q 1AH9A 3KYHC 2N49A 1YHQA 3UDFA 4DNIA 4DUYL 4DV4Q 2B63H 3K80C 1HR0L 2KENA 1RIPA 4TVAB 3HOVG 4GOPB 5IYCH 4R4IA 5FJ8G 3CPWA 1U5KA 1Y1WG 1EIFA 2YYZA 1VCIA 4YWLA 4NPSA 4DAMA 2NN6G 4LF9Q 4AQYQ 3HOUH 4DK6C 1QZHA 1TWCH 5C3EH 1X65A 1Q86C 3J7A5 3PF4A 4A3BH 1H95A 3M85A 4HIMA 1PH1A 4AIMA 2Z0SA 4A3BG 2MO1A 4UY8C 1O7IA 1G6PA 2QEXA 2MQHA 1QVCA 4BBRH 4IOCA 2I5MX 4DV3L 1BVSA 1MJEA 4Y7NH 2R7DA 4IFDI 4P74A 1VQPA 2JA8H 4A3GG 4DR2L 1YIJA 1J5EQ 3NENA 3PUYA 3PO2H 1B70B 3UE0A 3CCMA 1PHJA 1FJGL 4IPHA 3GTLH 1T9HA 1NTGA 4AYBE 5IP9G 3CXCA 3S2DH 3OTOQ 4OO1G 5IY0A 3OW2A 2B63G 1IBLQ 4QIWE 4DR4L 2JK8A 3RZDH 3TS0A 2HHHL 2ES2A 1XNRL 2PQAB 3M4PA 5M5WH 1EQQA 2KHJA 1I50H 3PIPA 2ZTDA 3ULLA 2D0PA 1TXYA 1Y1VH 4J15A 1IZ6A 4KLKA 2E5LL 2HIVA 1XNQL 1QUQA 3A5ZB 4GN4B 1VQOA 3OYYA 4P75A 4JI3L 3TQYA 3FKIG 4OXPA 5M3MG 5C4JH 3PGZA 1YJNA 1PH5A 4LFCQ 1EIYB 1SR3A 3BJUA 4JCVE 2R92H 1JJCB 4K0KQ 1M90C 2K4KA 4A4IA 4LF4Q 3I4NG 2GVAA 2K5VA 2LSSA 3HOXH 4JI3Q 3ICEA 5H1SE 3JAMc 1MKHA 3K7UC 1NY4A 4A3EH 4AYBG 2VQFQ 2VQFL 1UE7A 1VQDA 2K50A 3RLOA 3G4SA 4A3MH 1PH7A 2PNHA 2VUMG 2Q2HA 1OXTA 2LXJA 4JI6Q 1KQSA 3CC4A 2K5NA 2L15A 1EOVA 3GTQH 1N32Q 1BBWA 1V43A 4P73A 3B6YA 4LF7Q 1Q81C 1JB7A 4DR4Q 4GKJL 2KBNA 4JI7L 4MZ9A 4DR7L 1E7ZA 5M3FH 4A3LG 4A93G 2IT1A 4BXXH 2I5LX 1PA6A 3GTJH 4A3FG 2KCMA 3ZJYC 1I3QH 2WB1E 1E24A 1J5EL 4A3DG 1OXSC 1IBKL 3HKZE 4DR3Q 1M1KC 5JJKA 3ERSX 4C3JH 4YHHL 1HNWL 4DV3Q 2YU9H 2AMCB 1E3PA 1UE5A 2DGYA 1L0WA 2ZJPA 3BU2A 3I7FA 5LMUL 1PV4A 1YHBA 3G48A 4IPCA 3S2HH 1C0AA 1KL9A 5IYBH 1PH8A 2IHEA 2EXDA 2YV5A 1IBML 3L2PA 4DR5Q 2QA4A 1NJIC 2RHSB 1YVCA 4X65L 1N34Q 5GROA 4LUVA 3CAMA 2MNAA 4GNXB 4JI0L 1VQHA 1K3RA 1QZGA 4BY7H 2H5XA 3T1YQ 4BY1G 2MFIA 1HR0W 2FXQA 4QGUA 3UDGA 1SE8A 3HOVH 4XTCS 3Q8DA 1Y1VG 5M5XH 1WYDA 3ULJA 1IBKQ 3WWVA 2IX1A 1NE3A 4JBJA 5JEAG 2VNUD 2VY3A 2LXKA 3EN2A 1WCMG 4L5TA 2ALYB 1NBWA 1HZ9A 2UXDQ 4JI8Q 1I5FA 2AWNA 3I2ZA 1HJPA 2IY5B 1SROA 1AE3A 3HOZH 1EQRA 3KF6A 3LGJA 5GAHC 3HKZG 1XMQL 1X55A 3H15A 1X3GA 1CKNB 2VZAA 4UP9A 1HZAA 3HOWH 1PH3A 2WB1G 3EBEA 1XTDA 1KHIA 3D31A 4A3FH 2E2JH 2NVXH 4LWCA 2JJQA 1YJWA 3GTOH 2AKWB 1KRTA 1SMXA 1S3OA 4RG1A 1N8RC 2RCNA 1PVOA 1KC8C 4B3RL 4IOAA 4JYAQ 5M5YH 4LFBL 4LF5L 1L1OB 5C44H 5IWAQ 1VQLA 2ASBA 1Z9FA 4WJ3M 4K0KL 4LF6L 2KCTA 4UP8A 3G6EA 1PH2A 3CC2A 1U0LA 3J81j 1XNRQ 3HKSA 4DV4L 1GO3E 3UE1A 1ASYA 4JYAL 1EWIA 1WCMH 2CWPA 4HIKA 1UEBA 2Y0SE 3S14H 4LFBQ 4DV5L 1I6HH 1CUKA 2PI2E 2RF4A 2BH8A 4AH6A 2E5LQ 4JI7Q 1VQKA 5C3EG 2JA9A 3DLLA 4LFAL 1J6QA 2F3IA 4A3IG 4OWXB 3G71A 1YJ9A 3IRBA 1PFSA 2VQEL 1VQ9A 4L5SA 3S16H 1N36L 4L5RC 3VDYA 4Y52H 1KD1C 4R1JA 1E1OA 3HOYG 2MO0A 4POFA 3H0GH 2UUBL 4DV7L 1L2FA 3UDXA 4APVA 1NMGA 5C4XH 1B8AA 2VL6A 4P72A 3EIVA 4O0AA 4NXML 1GKHA 1IL2A 3J80c 2A19A 2VW9A 4DV6L 4B3SQ 4X66L 4R4QA 5E7NA 1AE2A 3S1QH 2Z6KC 1K73C 2V1CC 4RMFA 1QUQB 3CD6A 2JE6I 4HJ7A 1R9TH 2F4VQ 3A0JA 2UUAQ 2CQOA 4P71A 1GD7A 3NELA 4JOIA 5IE8A 3CF5A 4DV6Q 4B3SL 4X65Q 3HOUG 1OTCA 4YY3Q 1UWVA 2ID0A 3S17H 1XJVA 2UU9L 2R93H 4GNXA 3PV0A 3CP0A 2GVBA 1QVGA 2NVTH 1PH9A 4DR2Q 3I4MG 3I4MH 4A3IH 4GKJQ 2K75A 3ULPA 2UUBQ 1JJ2A 1FVIA 1PH6A 2JA6G 2JA6H 2BH2A 4IFDG 2EQSA 3FKIH 1HR0Q 1VQGA 4A3EG 1A0IA 1WI5A 1YZ6A 4PZ6A 4PG3A 1IBMQ 4GN5A 4BA1I 3CQZH 2D0OA 3K0XA 1Q82C 3HOXG 3KOJA 2VS1A 5GAGC 4PZ7A 4GKKQ 4KHPQ 1CKNA 4EX5A 3CCUA 2JA5H 1N32L 4KHZA 1Q8KA 2CCZA 3CCQA 2JA5G 3CMAA 1N36Q 1VQ8A 1S72A 4NXNL 4LF6Q 4QQBX 2CFMA 3CCSA 4DUYQ 1FL0A 2A8VA 4TQUS 1Y14B 2R7ZH 5LMNQ 3I55A 4HJAA 2Z6KA 4DV2Q 3PF5A 3A5UA 4DV2L 1VQIA 3CPFA 4A76A 2R93G 4JC0A 4LF7L 4BBSH 4OWWB 5EAYA 5M3FG 4OX9L 3PUWA 4LF4L 2R7FA 4BBSG 2JA7G 3F2DA 4A3KH 4R4TA 5IYDH 3F2CA 4HJ5A 3AFQA 1BBUA 3RR5A 4LF5Q 1JJGA 1E22A 4A3KG 4JBKA 4A3CH 3K8AA 4JI2Q 3GTKH 3BZCA 4B3MQ 5GAEC 4JI1Q 2NVQH 1YNXA 3T1HL 2UXDL 1XPUA 3PUVA 4FDBA 4IO9A 1Q7YC 1Q1EA 3ER0A 3SGIA 4GLXA 3FP9A 1Y1WH 2UXCQ 3PUXA 1VQFA 1G51A 1CKMA 3GDEA 5ELNA 4MTNA 4DR6L 5AJ3L 1A8VA 1L1OA 2ZJRA 4A3LH 4X66Q 2NZHA 1WOCA 2AWOA 1NMFA 2WP8J 4C2MH 3S1RH 1HNZQ 2JA7H 5AJ3Q 2HT1A 2N3SA 1HZBA 1CSQA 5IYDG 1N33Q 4JI2L 1WJJA 1EYGA 1DGSA 1X3EA 1YI2A 4JI0Q 4IFDJ 3E0EA 4GN3B 1PH4A 1X56A 3K7AH 4DV0Q 1FJGQ 3L0OA 4DUZQ 2WAQG 3J7ZC 2K5HA 2JA8G 4A3GH 3BZKA 4NB3A 5FLMG 4NXMQ 1Q1BA 4YWKA 1FGUA 1G291 2ZM6L 4OX9Q 4JBWA 1XPRA 1Q46A 1PYSB 1SN8A 1ASZA 4LUZA 3KDFA 5GADC 4DV7Q 1WFQA 1TWFH 2E8GA 4YHHQ 2OWOA 1HNWQ 2VUMH 3A74A 1HNXL 5C44G 5GQOA 4DPGA 1XMOQ 2C35B 4POGA 1OXXK 4YCVA 4QY7A 4DV1L 1X3FA 2BA1A 1VQNA 4LF8Q 4ME3A 3F8TA 1C9OA 3GTPH 3KDFB 3RLNA 2B29A 4LW1A 4X62Q 3RZOH 3M9BA 4GS3A 1MJCA 5C0XI 1XPOA 4A93H 2F52A 5JJIA 4X64L 1P16A 1LUZA 1D7QA 4B3TL 5J3BA 1D8LA 2HQLA 1KAWA 4XIGS 3PIOA 3F2BA 5LMNW 1X6OA 3CCEA 4JV5Q 4HJ8A 5DLQE 1IXRA 3TRZA 2QGQA 2YTVA 2EIFA 3GO5A 2PI2A 1Z47A 2ZTEA 1SFOH 4A3MG 3W1BA 3PO2G 5IYBG 1MIUA 3CCLA 4JI5L 4LUOA 3AQQA 5JJLA 4LFCL 2K14A 4IPDA 2AHOB 1GM5A 1XMQQ 1SRUA 3M7NA 3AYHB 4L5QA 3U4ZA 2CKZB 1HNXQ 2UXBL 1KXLA 3JAMi 1VQCA 4R4OA 4JI8L 4EQ5A 4JBMA 2ZM6Q 2UUCL 2NVYH 1YITA 3S1NH 4A3JH 3E9IA 1YBYA 3FHWA 1VQEA 1KRSA 5C0XJ 2HIXA 4IJHA 4HIOA 1I94Q 1UE1A 2HHHQ 4DV0L 2DUDA 1CKOA 3W5OA 4A3DH 3HOZG 3MXNB 3S24A 4HIDA 2UXBQ 2Q2IA 1IBLL 3KLWA 2UUAL 4GLVB 4DR1L 4DKAC 3CCRA 3HOWG 1LYLA 5C4XG 4DR3L 3NEMA 3S1MH 1N34L 4YCUA 3I56A 1X9NA 1I94L 1C7YA 4OWTB 3S15H 1YEZA 3TREA 3CC7A 4JI5Q 3RN5A 4GNXC 2WAQE 3K81C 4BY1H 1BKBA 1HH2P 4LF9L 1VQ5A 2YTXA 2E2IH 4B3ML 1N9WA 2N78A 3UDIA 2Y0SG 4JG2A 3KJPA 1VQ4A 3RLFA 4JV5L 3TEHB 4HJ9A 1S40A 1LTLA 2R6GA 4GLAC 3NBHB 3F1ZA 2I0QA 4KI0A 2R7ZG 4DR7Q 4GOPA 4ALPA 3PSIA 4LFAQ 4A3JG 3T1HQ 4DK3C 2KHIA 2A1AA 4B3RQ 4PZ8A 5IP7G 2IX0A 5C0XG 3CCJA 5IP7H 4BXXG 1V1QA 3M4OH 2OQ0A 4JI6L 4B3TQ 1YHAA 4YCWA 3CCVA 1VQ6A 2OTLA 1JT8A 2JEBI 5K36G 2Q2TA 5HGQA 3KJOA 1A63A 3PUZA 3GD7A 1EFWA 1OXVA 3W1GA 3M3YH 2B3GA 4DAYB 4IPGA 1CSPA 2CWAA 1HNZL 4JI4Q 1K83H 4BA2I 2UU9Q 4JOIC 1W2BA 1KIXA 3PO3G 2JQOA 4DUZL 2YTYA 1JMCA 4PMWA 4DR6Q 4LNQA 5FJ8H 5IYCG 1A62A 3PCOB 1XNQQ 2OCEA 2IHFA 1SLJA 4QL5A 2XGTA 4GKKL 4KHPL 3TS2A 3T1YL 4R4CA 3CMEA 3OTOL 3RN2A 3JC66 2XTIA 4O2DA 4LF8L 4DR5L 3U4VA 1IYJB 4BBRG 4YY3L 3GTMH 3H3VI 3MEFA 3H3VH 1B7YB 4JI1L 4WJ4A 2BA0A 3H0GG 4C3IH 5IT9c 1W3SA 1RL2A 5LMUQ 1XMOL 2F4VL 1GVPA 5JEAJ
chains in the Genus database with same CATH superfamily
1BCPF 1P8LA 4PQXA 1K8GA 1SNPA 1EUJA 3J81c 2F03A 3LMLA 1MSHA 3V4SA 1PXUA 1Q12A 4JUZA 1S03G 4LMQD 1VBGA 2LKVA 1PTOB 5AFWA 1X3QA 3L7ZC 3M4QA 3N6RA 2NU8B 4O3RA 5IP9H 4CC5A 3CKIB 1EL0A 1S0NA 4K5VA 1N33L 4IALA 4YWMA 3HXLA 5KNDA 1LTSD 3OIPA 5FLXc 2F3WA 1KDAA 2PQAA 2YCHA 1TWGH 3KTMA 1VQMA 2ATWA 1AZQA 4ZAIA 5KG0A 2D62A 2NZOA 3J81i 2OEOA 1XMQH 1PLFA 2WFWA 5D3IB 2UVVA 3PW7A 1V1PA 5KYIA 1K8OA 5LMNL 2MCTA 1X54A 1EFID 3C0FB 2E2HH 5M3MH 5HY6A 1SE2A 1X3PA 1UE6A 2NN6I 4RUCA 2C2DA 4X64Q 3KF8B 1MHWC 3Q8SB 1EIGA 3GTJA 2R92G 2R7ZB 1L1OC 4X62L 1WSCA 3I4OA 2SNMA 4Q8EA 3NBIA 2N49A 4A3EB 3UDFA 3MXGA 2EOTA 3EPIA 1HR0L 3HOVG 4J6HA 1B4OA 4O3PA 3H91A 4CGYB 5J39A 2V58A 5KFMA 1EIFA 2YYZA 3GTMA 4DNTB 4XYLB 3HOUH 3M85A 1E4EA 1WR2A 2Z0SA 5C4HA 3T56B 4A3BG 1O7IA 2VQEH 4IOCA 4MTDA 3GTJB 2MGSA 2OT2A 4HNTA 1TWAB 1MJEA 2Y0SA 4Y7NH 2R7DA 2JYOA 2XN9C 1LACA 2NUCA 3WOEA 4A3GG 3PO2H 5M5YB 4IZ8A 1S97A 1PHJA 1LTBD 3J80E 4MHEA 5ELFA 4AYBE 3S2DH 4DUYH 3OTOQ 4O3NA 2OXPA 4DR4L 5C1OA 5KFWA 1Y1WA 5DQHA 4ME6A 2HHHL 2ES2A 3M4PA 5KFYA 2ZTDA 4QW9A 1HQRD 1H9MA 5M5WB 4J15A 4IURA 1K83A 4DV3H 3VR5A 2E5LL 3S15B 2VPSA 3TINA 1XNRH 4GN4B 4K6LA 1IL8A 1GHKA 4JI3L 3HOZB 5KRUA 1EYZA 1LT6D 3PGZA 1EIYB 1IW7C 3BJUA 2R92H 1BO0A 4JV0A 3I4NG 1UEAB 4OEMB 1ONLA 1MKHA 4A3EH 1NY4A 2EYLA 4AYBG 4C3HB 1PTOF 3GIDA 2UXCH 1UE7A 1VQDA 3I73A 5CAEB 4C1NI 1LTID 4J1MA 1H9SB 1U4LA 1ENFA 3CC4A 1S5FD 2HQEA 5J1ZA 2K5NA 3H0GA 1QWYA 2R7NA 2R7MA 2PW7A 4RZQA 1D6EC 4B3SH 1TY2A 4GKJL 2KBNA 4JI7L 1T36A 3JZIA 5KT5A 1E7ZA 5M3FH 4A3LG 4RU9A 3A8IE 2XCLA 3NE5B 2IT1A 3QR8A 5CV7A 4BXXH 2XVSA 4A93G 2M05A 2ZDGA 1PA6A 4A3FG 1I3QH 2WB1E 1SYXB 4EGQA 2CHBD 3HKZE 1AP0A 1C48A 5JJKA 2W6PA 4DV3Q 1EY7A 1UE5A 1LT3D 5LMUL 2EY6A 3MR5A 4ECTA 2FHTA 3Q22A 4LF6H 2EXDA 2UUBH 1TAEA 3L2PA 4DR5Q 1NJIC 2RHSB 5GROA 1B6SA 3R2IA 4LFBH 4JI0L 4ZRZA 2F0GA 3T1YQ 4OO1H 1WTPA 2FXQA 1S5BD 2H4OA 5LXTF 4QGUA 3BAAA 3G6YA 1EY0A 4A3GB 3Q8DA 5M5XH 2PVPA 4EGJA 1FNWA 3ULJA 1TKWB 2IX1A 2YW2A 4IAJA 4C5CA 3CU7A 4RGNA 2LXKA 1D1KA 5IWAH 1OWTA 1I5FA 1EEFD 1SROA 3EROA 1TWCB 3GQBA 1ML0D 3NHHA 3HKZG 1XMQL 4JI1H 2F3VA 1X3GA 1CKNB 5C0XH 4O3QA 2NVXH 4JI4H 2JXMB 2K04A 4BWGB 1N33H 2K28A 5JPMC 1TWGB 3HKZA 4J9QA 1DYQA 3TN2A 5T1IA 5C44B 1PVOA 1EQVA 3IG0A 4LF5L 3E3XA 1VQLA 2ASBA 2OH2A 4DXFA 4OL7A 4XYQA 4K0KL 1CQJB 2KCTA 4RCOA 2JA7B 3DWPA 3HKSA 1SNDA 1M0WA 1GO3E 3GV8B 3K59A 2JA7A 1SFOB 3PVXA 4JYAL 4C2MB 2CWPA 4HIKA 1UEBA 2Y0SE 3E5SA 5ELCA 4I4TF 4AH6A 2PI2E 2RF4A 1EY5A 4LF8H 1RDPD 5C3EG 2W6OA 4EFBA 2B2TA 3L3OC 5KFZA 1BCPB 1BF4A 5ISRA 1VQ9A 1K28A 4C3JB 2RA4A 1N36L 4L5RC 4Y52H 1KD1C 1KJJA 2FKLA 1E1OA 2L1BA 3UDXA 5KT4A 3PW4A 2SDFA 2OLSA 1S10A 1RJRA 1B8AA 1RKNA 4CHTB 3A55A 4O0AA 4NXML 1GKHA 3E5NA 2E2IB 1IL2A 4CDCC 3J80c 4B3SQ 2UVRA 4X66L 1R9TB 3S1QH 2E2JB 2Z6KC 3K5HA 3MFIA 4RMFA 2JE6I 1YNJD 3A0JA 1WTVA 4KY5A 1XWEA 2H1EA 5F9NA 4DV6Q 2L9HA 1UWVA 2ID0A 1XJVA 2R93H 3PV0A 4IUUA 3OUZA 1UUPA 1PH9A 1WTRA 4X64H 4UDUC 4UHVA 4PMCA 5BN4A 2QK4A 1JJ2A 2M00A 2NU9B 2BH2A 4IFDG 3FKIH 5JH7F 5L1IA 1A0IA 5KFEA 3I90A 4GN5A 4BA1I 2C5CA 2D0OA 1Q82C 1LO5D 1RD9D 3HOXG 1DIKA 2N88A 1EHIA 4O3OA 3RUZA 1JOQA 4KHZA 2NU7B 3QG1A 1I7NA 2W7OA 2PNRC 2EJFC 1N36Q 3HOYB 1G2SA 1S72A 4LF6Q 1MD2D 4DUYQ 2R7ZH 2O03A 4ZQIA 3I55A 4DV2Q 1ENCA 5KG4A 1O7YA 2R93G 4JC0A 1LTRD 1GOZA 4OX9L 3PUWA 2SCUB 4I65A 1WTQA 3GTKA 1JR0D 2JA7G 3F2DA 2BQUA 1I6VC 3F2CA 1B9MA 2F0HA 5KG6A 4RH6A 5CV5A 1STBA 5FLXE 4LF5Q 4YHHH 4A3KG 5FPOA 1N34H 3GTKH 3GV6A 3ND9A 3BZCA 4K8IA 2YYAA 2NVQH 3MWDA 5JVH3 5C3EB 1SNMA 3DF7A 3SGIA 3G6VA 2UXCQ 2HGSA 4Q43A 3M7GA 2K5WA 4FF2A 3RGXA 4N9PA 1VQFA 3GDEA 1E4FT 4DR6L 1A8VA 4EGVA 2PQEA 2F0DA 1FNUA 2NZHA 2WP8J 4RB0A 2C00A 2F0UA 2JA7H 1QILA 3GTGB 4ZK9B 3BDOA 3K5LA 1DGSA 4J9OA 4JI0Q 4NLGA 2EJMA 2EYOA 5F2DA 3K7AH 3Q8PB 4A3GH 1R4PB 3J7ZC 4HMJA 1KABA 3MFGA 1Q1BA 4J9LA 1NCVA 3Q23A 1WTOA 3L4KA 5LHY1 3X3NA 2ZM6L 4H13C 1GUGA 4JV5H 1Z2NX 2RCFA 1WFQA 1TWFH 4G7OC 5GQOA 1O80A 2C35B 1UNSA 4CDEC 4POGA 4DR4H 4YCVA 1DONA 3SE7A 5EBCA 1VQNA 3CVZA 4ME3A 4KN7C 1EY4A 1SNCA 2EZVA 1O7ZA 5A2QE 1IBKH 2B29A 4LW1A 3R3OA 3HOXB 2R8IA 4ECSA 2ATLA 4C56C 4L63B 5JJIA 4X64L 3OHAA 4FS2A 2X6GA 3J81W 3PIOA 3NPPA 5IGFA 4A3IB 4JV5Q 3ND8A 5DLQE 2VR1A 4F4YA 3SI8A 2V9WA 3Q8RB 3MEHA 4G7HC 1EYAA 1Z47A 4A3MG 2QCPX 3LWUA 1G8ZD 3X3MA 4JI5L 3N42B 3WNZA 2DN8A 2ZT9C 4LFCL 4HR7A 3NBHA 5KFSA 1MSGA 2QF7A 2NUAB 2NTSA 2EY1A 3S2HB 2PZWA 3M7NA 1SEIA 4ABNA 4JI5H 1L0XB 4DV4H 3NP8A 4UAIA 4JI8L 2JEFA 3VR3A 3KK7A 2F0WA 4IN3A 3BVMA 4DK0A 3RUPA 5E4XA 2UUCL 2AQ4A 1YBYA 3FHWA 1KRSA 5IIFA 5JPNC 2NVYB 4HIOA 1UE1A 1CKOA 3W5OA 3K6OA 1R9TA 3HOZG 3GTOA 3GTQA 1JKJB 2J6UA 4QWAA 2RVLA 1I50B 3KLWA 5LYJF 3VYRA 2VQFH 4LSXA 1A6XA 3MWMA 1SNOA 4FYDA 1I94L 3ONAB 4OWTB 4JI5Q 1GUWA 1TR5A 3RN5A 2W9CB 3GIQA 4HMIA 3K5OA 4BY1H 3BQ0A 4LF9H 2R8KA 3R8BA 2AGQA 2Y0SG 2V4QA 4JV5L 4IZOA 3TEHB 1S40A 2R6GA 1KNAA 4GLAC 3K5MA 2RGRA 1F2YA 4RNOA 2NN6H 1CQFA 2I0QA 2A69D 5KT6A 4DR7Q 2EY5A 4EEQA 4RAZA 4FXGC 2DY7A 4B3RQ 3R93A 4PZ8A 4RB1A 2IX0A 4FU0A 1V1QA 4WRDA 4YCWA 4L6TB 1GYFA 3QJYA 2OTLA 3BYYB 4FBUA 4O3SA 3BVZA 1GJXA 2HVSA 2IA6A 2F0QA 3I72A 4DAPA 4DAYB 1K0SA 3JRXA 3RB4A 4DL2A 4UCUA 1MI2A 1ZYRD 2VA2A 3VPBA 1A3VA 1H9RA 4NKLA 4BS9A 2HCIA 5KFJA 4B3TH 3CMEA 2XCPA 2WIIB 4DGZA 3MHBA 3HOWB 1NUCA 2XRSD 4BBRG 5J22A 4YY3L 2HDMA 4R8UA 4BBSB 1PZKD 2G9HD 2QEJC 1D5ZC 5LMUQ 1G6PA 2IP4A 1MGSA 4F87A 1TWHH 5CV9A 1VQJA 4E4TA 4C3HH 3KBXA 1KNEA 1PTOH 4C3HG 3KXYT 2Q2UA 4C3JG 2FB9A 2K32A 3HFZB 4YR3A 3RNUA 4A75A 3PO3H 1SE3A 4GOPC 2ASJA 4X3TA 5BPHA 3FKIB 4X6AH 2Z9HA 3JAME 2UXCL 2Z4HA 2V5AA 2VQEQ 4K8JA 1TWAH 1CT1D 5DM73 3V6JA 2F0TA 4A3FB 3FPUB 3CQZB 4EG0A 3CW2C 1V9PA 4H02A 1AUVA 1J5EH 2XIWA 2N8NA 4RCNA 1OXUA 3U9OA 2RHQB 3AFPA 4DV1Q 1ZXTA 1XDNA 3D8GA 3S2DB 3OHXC 4MA0A 1B44D 1BR9A 3QOJA 1I6HB 3AEVA 1JOOA 3H6MA 1JXLA 3KUPA 1GSOA 5ELOA 2XWJB 1AH9A 4DV5Q 1EU3A 4CBVA 1LTGD 3NK9A 1GXDC 3HOVB 3VR6A 1B1ZA 2RKSA 1TA8A 4IWXA 4EYHB 1TWHA 4DUYL 3K80C 4JI8H 4N8X1 1RIPA 4TVAB 4IRDA 1DOKA 4R4IA 3HP3A 4IHJF 3KHGA 3V96A 4DAMA 2MP1A 2NN6G 4AQYQ 1H95A 1QZHA 1M0TA 3PF4A 1X65A 3FDSA 2TSSA 4IUNA 3R5FA 1LTAD 4ID6A 5M9OA 4HIMA 1PH1A 1QOHA 1GLVA 4R7RA 4UY8C 1UC8A 2LMCB 4FNFA 4HR7B 4J9RA 4DR7H 1EU4A 1CHQD 2XNAC 1I4RA 2MQHA 4BBRH 2NVXB 1SYBA 2JN4A 1DJRD 2I5MX 1IBMH 2UUCH 3C1FA 3HB9A 4P74A 2D2CC 1VQPA 1SYGA 4R8NA 4DR2L 1KLGD 3NENA 5CYUA 3V6KA 4JPBW 5FO7B 1FJGL 5LOVF 1I7LA 4C5AA 1B9NA 5D3DA 4K0KH 1IBLQ 1PFBA 4N8FA 4QIWE 1JOKA 2JK8A 5KFVA 3LNNA 2WE6A 2I46A 4EEYA 2PQAB 5M5WH 2IW3A 1I50H 3BVGA 4A2AA 1Y1VH 1SYCA 4DR6H 2J6SA 2UUAH 3EJIA 4KLKA 3ORQA 3GTPA 2YS6A 4ODGA 4Y8VB 1RODA 3A5ZB 2W8LA 2EYFA 2DPJA 1HCZA 2Z1CA 2ASLA 2YRWA 4J9KA 4LK1C 2PN1A 2R92B 3FKIG 2DPIA 4OXPA 2WINB 4IUVA 3I4NB 1B3AA 4BWSC 3MFHA 4K0KQ 1M90C 4A4IA 4HNVA 1SYFA 5HURA 2JEIA 2C22A 4JI3Q 1BOSA 5DQGA 2K6AA 1EY6A 3KHHA 1HUMA 2VQFQ 4KJOA 2KSWA 3RLOA 4A3MH 1PH7A 2PNHA 1OXTA 2LXJA 3RB6A 2K5QA 4JI6Q 1WTHA 3J80L 3BQ2A 1EOVA 4ZYSA 3GTQH 1Z6HA 5NUCA 1BBWA 1N32Q 4A3BB 3FPPA 4P73A 3B6YA 1VMCA 2EY2A 4C2MA 4MZ9A 3I4LA 3R5HA 3MTSA 2RDIA 3H3VC 5KFCA 4DLKA 5M3FB 5BR8H 3PN1A 5KFKA 1BJTA 1O7LA 4P2CB 4B08A 4DR3Q 3S16B 4YHHL 2DGYA 1L0WA 2ZJPA 3BU2A 3I7FA 4DAYA 5J2UF 1PDQA 4XDXA 1TS4A 2KUMA 1YVCA 4KMUC 1R4QB 1QNUA 4GNXB 2WAQA 2H5XA 1HR0W 5M5XB 4DF7A 5A35A 4KN4C 4QWBA 1SE8A 4XTCS 5G3LF 2B2UC 2C28A 1IBKQ 5K2MA 3WWVA 1NE3A 3N43B 4JBJA 5IGDA 1AEXA 1II3A 2E76C 4QUCA 3EN2A 5JEAG 2VNUD 1JWMD 1TWHB 2ALYB 1EYCA 4UFZA 4JI8Q 1BCPD 3I2ZA 2PZUA 1HJPA 4J9SA 2QYZA 5EGTA 3KAKA 1EQRA 5EKIA 1I4XA 2FMAA 4OHJA 3LGJA 3VR2A 3HOWH 1PH3A 3A56A 5KFRA 2WB1G 5EBDA 5I2YA 3SR1A 2QKIC 2E5LH 1KHIA 2K1BA 4LWCA 2JJQA 1PZJD 3DMUA 1SMXA 2B63A 2NBFA 2W9CA 1S3OA 5IGCA 4A3MB 2RCNA 5ELDA 1KC8C 3SE0A 4B3RL 4O4IF 4IOAA 4JYAQ 5M5YH 2VOBA 4ECRA 4X65H 3Q8QB 4WJ3M 2L12A 2UVUA 1CE8A 2PZTA 3GP7A 4UP8A 1PH2A 1XNRQ 3J81j 4EBDA 3J81E 4DV4L 3PZPA 1Y8OB 1C8CA 3RFCA 1S0OA 2W6QA 2VUGA 1ILPA 4JI7Q 2BH8A 1EWHA 4JV1A 1STEA 1J6QA 1PFSA 2VQEL 3S1MB 2MO0A 1H9KA 4ME5A 4RKBA 2W6MA 2LY7A 3N52A 4YR0A 5KT3A 3S1NB 1KBLA 4HCSA 3A54A 5C4XH 1N36H 2F0IA 1CA6A 4KY7A 4Q44A 1C4QA 4DV6L 1A3UA 1VDZA 4G3IA 3TDQA 2Y0SB 2Q8IB 3CD6A 1XX8A 5I6WA 4NXMH 5T1GA 4HJ7A 3OPOA 4ULLA 1CA5A 2UUAQ 1VF7A 1BCPC 4P71A 3EYYA 5L1JA 4ZKBB 1ZETA 4X65Q 4YY3Q 2IL8A 4IWYA 3CP0A 3GILA 2GVBA 4C3IG 4RHSA 5I9PA 4DR2Q 1FYCA 2R93B 1XTCD 2WACA 2K75A 3OSNA 4OIKA 4IFDH 3PR5B 3OWFA 2FJ2A 2NB0A 2JA6H 3TIGA 1M6VA 3IKJA 1HR0Q 1JWUD 1HQMC 1UNNC 1L2ZA 2AUKA 2C9OA 1YZ6A 5LMUH 3MR3A 4CDFC 4E6IA 3TP5A 4OGQC 2MJ8A 2KEEA 4K2KA 1TWAA 2BDNA 2SNSA 4PZ7A 4GKKQ 4KHPQ 4DR3H 4LF5H 3SK4A 2LFNA 1HNXH 4EBEA 1KJQA 3CRKC 1Q8KA 2JA5G 3CCQA 5I9OA 3CMAA 1HFGA 2R6FA 3CCSA 2A8VA 2N55A 3P1HA 4QF4A 2HVQA 4HJAA 2Z6KA 3M4IA 4U673 4ECXA 3GTMB 3A5UA 4DV2L 1VQIA 3CPFA 4TQSA 1B2TA 1GGOA 2W9AA 4LF7L 4QWCA 4EQNA 5EAYA 4K2LA 4LF4L 4F4ZA 3GV5B 2R7FA 4TUYF 3RGZA 4BBSG 3SXHA 1CTMA 5GONF 4R4TA 2VA3A 4XYOA 1JLLB 3AFQA 4RAUC 3RR5A 2W8KA 2D5DA 2IBKA 3N8DA 4J9PA 1VMPA 4JI2Q 3OUUA 4Z9CB 2F0LA 2KCNA 3GTQB 1DZ1A 2FINB 4I50F 4YJ2F 2XD4A 2HUGA 3CRLC 5COYA 2IPKD 1ESRA 4IO9A 3K57A 4FS1A 5EPLA 4JI0H 1G91A 4IRCA 1Q1EA 3ER0A 4GLXA 1AFPA 4JI7H 3R23A 5CC4A 3QFFA 3PUXA 1G51A 1VBHA 1ZHSA 2K33A 2ZDHA 2HCCA 2DNCA 2P5ZX 2FP4B 1NMFA 4C2MH 4JI2H 4HN7A 4WBNF 4QMGA 2N3SA 4JI2L 5JUMA 1RJPA 3E0EA 4GN3B 2A74C 1X56A 1FJGQ 4DUZQ 1QB5D 5FLMG 4YWKA 1EYDA 1TWCA 4MV1A 4OX9Q 1TIID 4JBWA 1XPRA 1SN8A 2A6EC 1JDEA 3QIAA 4PNYA 4LH6A 1Y8NB 4YHHQ 3F2UA 5C44G 5J2TF 1XMOQ 5IGEA 1TWFB 1OXXK 3G8CA 2BA1A 2HHHH 2NVQB 2F1MA 4LF8Q 4TV8F 2UXBH 5EWEA 1ICFB 1D5MC 3BYTB 4UCVA 3RLNA 1Y1WB 4A3KB 4F7XA 3R5XA 2RDGA 2L55A 2F52A 4WJWA 5KFXA 1LUZA 3PIP3 2G9DA 2HQLA 5JJZA 3PW2A 5LMNW 1X6OA 4O4LF 3LX0A 4TKOB 3HOUB 2ASDA 2CQYA 4R9WA 2FLNA 3Q6SA 1ILQA 3NXWA 3RMHA 4ED3A 2JP1A 3GO5A 2PI2A 3I4MB 2CW0C 1A2UA 2ZXOA 1ZEQX 2WYOA 1D1IA 1MIUA 3F8NA 3KBGA 5JJLA 2K14A 2GLTA 2SOBA 4ECQA 1D5XC 1XMQQ 4NMZA 3T5LA 4QCLA 4L5QA 1HNXQ 5KG2A 3JAMi 4GKKH 4R4OA 3V2TA 4KHPH 4FO2A 4EQ5A 3PR4A 2R8HA 1IYUA 2J0TD 4JBMA 2ZM6Q 3M9MB 2NVYH 1YITA 3S1NH 4DL6A 4A3JH 3E9IA 1DV1A 1RYSA 5C0XJ 1I94Q 1FR3A 2TMPA 4B9XA 1SBBB 4DV0L 2C2EA 2EVBA 1SJED 1QE6A 3S24A 3FKIA 3HEJA 2EDGA 1GUOA 2A68C 5LL6S 2KECA 4DKAC 5C4XG 4DR3L 4DL7A 4YCUA 2B2WA 3I56A 1C7YA 3S15H 4YIJA 5K36H 4V190 1B6RA 1RK5A 5FO9B 1BKBA 5KGUA 1K1QA 2RDJA 1VQ5A 1BDOA 1N9WA 4B3ML 1W93A 4AQYH 4JG2A 3KJPA 4DV2H 4S3SA 4EFEA 1N56A 1LTLA 2VUMA 3NBHB 1QG7A 3F1ZA 4U68A 1SFOA 3PSIA 4LFAQ 4A3JG 2KHIA 3TQTA 4DV0H 4I7AA 1B3QA 5C0XG 3CCJA 1ZYRC 5IP7H 2R84A 4KKUA 3RD4A 4V0BA 2YU9A 3W3AA 2OQ0A 5CGKA 1YHAA 3CCVA 2DY8A 3IL8A 4DR5H 5C5LA 2JEBI 3BQ1A 4ZLTF 5K36G 2XC9A 5CV8A 2Q2TA 5HGQA 1A63A 1EFWA 3N40P 4G57A 2A5HA 4JI4Q 4HQ6A 2CWAA 3RZDB 3RAXA 5KEEA 3S9WA 4XXEA 3PO3G 4DUZL 1GUTA 2F0MA 2B2YC 4O1NA 1JMCA 4LMYA 4DR6Q 1Y69U 4LNQA 5FJ8H 5IYCG 3VA5A 4B3RH 5I4DA 1SYEA 4HEDA 1XNQQ 1PMRA 2B2VA 2CH4A 1SLJA 2QILA 1HNZH 2KEDA 1YNJC 4GKKL 4KHPL 4ZOLF 3RB3A 2A69C 1XMOH 4FXKC 2B2TC 2XWBB 3EFXD 1PFMA 3GIPA 1IYJB 3MEFA 3K3VA 1B7YB 1B33N 4C3IH 4HTHA 2F0EA 3HBLA 2R8JA 1PRTC 4EVOA 5KT2A 2XSCA 2PPBC 2ZJQA 3AU7A 1CQIB 3GIIA 3STBD 1VQ7A 2GA4B 4IJLA 4OO1I 4IR9A 2YZNA 2BE5D 5KT7A 4DR1Q 4ZUIA 3EPGA 1HZCA 1K8AC 2EXZA 4QB4A 3HZXA 2NYZD 3RV3A 2KCCA 2ZTCA 3VYUA 3M3YB 3KFUA 1QNKA 4RB2C 2PMZE 1VQBA 3TZDA 5BMVF 3TSSA 4MTKA 2GN5A 2K52A 3U58A 4QJFA 1VF5C 4A3FH 5BR8L 1O78A 1LM0A 3RIZA 3H94A 3U50C 4NXNQ 3DM3A 3DEOA 2MPMA 3STBC 1WD0A 3HOYH 1PTOC 4A3JB 3O13A 4A3CG 5I6YA 2OTJA 2WKCA 3WO0A 4DL4A 4YBZB 2L5TA 1Q90A 1X32A 4BY7B 4RGOS 3E9HA 2R8GA 5D8DA 3ETJA 4DV4Q 3D4WA 2KENA 1GHJA 3CPWA 1UAPA 1S9FA 2YZGA 2I8CA 5C4JB 1VCIA 2ZJTA 1SJHD 4DK1A 4TV9F 5CA1F 2RSNA 3S1QB 3A7AB 3MFYA 5LP6F 2QEXA 1ICWA 2B8FA 4X62H 2R61A 3A7LA 4IFDI 1BVSA 1VKZA 2NU6B 3A8KE 2JA8H 3RAQA 4PMBA 1YIJA 2KJXA 1DM0B 3MZ5A 1HTLD 3OSPA 3MAQA 3CCMA 5KNCA 4IPHA 1WCMA 2R87A 1T9HA 1NTGA 4B3MH 2NVYA 2YL2A 4B9WA 5C8YF 3M4YA 2KHSA 1TVXA 1EY8A 3QOLA 3S14B 1E4EB 3U9TA 3LWEA 2D0PA 1H9SA 1S68A 1MZBA 4MV8A 1IZ6A 5TSSA 3BG5A 4O2BF 4O4HF 1KTKA 5EPJA 2HIVA 3DWQA 1XNQL 1QUQA 1VQOA 4F88A 3OHBA 1DOLA 5ELBA 1HHVA 3TQYA 3MXUA 1T5XD 1YJNA 2QDLA 4LFCQ 1YNNC 2XRQD 4Q0FA 4JCVE 1JX4A 4APMA 2K4KA 2K5VA 2LSSA 4CKEA 1F9QA 5H1SE 5FD5A 2VQFL 4YR2A 2K50A 4QUFA 3G4SA 4DV6H 3BJYA 3TQ1A 3EVQA 4HSVA 4RWSC 5D14A 2VUMG 3G6JB 2B8GA 1KQSA 1GUSA 4DNRB 4R8UB 1ESFA 4A2BA 1V43A 1CZGA 4KK7A 4LF7Q 4DR4Q 1JB7A 5C5MA 3T53B 4IR1A 3RB0A 5KIXA 3RV4A 3GTJH 4ED0A 3DHQA 3ZJYC 4UCRA 3L4JA 1J5EL 1E24A 4KD4A 4A3DG 3H20A 2HD3A 2ENBA 3GIMA 2YZMA 3ERSX 2O5IC 4C3JH 1HNWL 2YU9H 2AMCB 1E3PA 1PV4A 3S2HH 4YQWA 3TP8A 4IPCA 1Y8PB 1KEEA 1KL9A 5IYBH 1PH8A 2IHEA 2FLPA 3NTKA 1IBML 1I6UA 1M7JA 3MXPA 2QA4A 2E74C 1N34Q 2RGVA 4X65L 3K5NA 4X3SA 1VQHA 3J80W 1KC7A 5DAUA 2KVMA 4QWDA 4EQOA 2NVXA 3H40A 3UDGA 3HOVH 3Q1KA 2MUYA 4CJ0B 1WYDA 1BQQT 2VY3A 4X3UA 1WCMG 5DGBA 4L5TA 1V1OA 1NBWA 3ETHA 2AWNA 3ERQA 4IUPA 1AE3A 1U4PA 3HOZH 3KLSX 3KF6A 3NTIA 2R7ZA 2CZGA 2O4XA 3K3PA 3VPCA 1HZAA 2A6ED 3JAMW 1TS3A 4K6DA 5IT9W 1XTDA 4RFBA 3GTOH 2JEJA 2AKWB 1KRTA 1RF2D 4RGTA 4RG1A 1N8RC 5DQIA 1JE4A 4A93B 2EYPA 4TRDA 5KFDA 4HSPA 4DN4M 3IFTA 3NGDA 5ELEA 1EZ8A 4H44C 3G6EA 3CC2A 5DGAA 3QO2A 1U0LA 3PO2B 1ASYA 4M1UB 4LFBQ 1WCMH 2V4DA 1FKAH 1A3TA 4DV5L 4MV3A 1CUKA 2E5LQ 1KAAA 2BE5C 3DLLA 4LFAL 2F3IA 2W6ZA 3G71A 1YJ9A 3C2PA 1SCUB 4GC6A 4ED8A 3HOYG 4POFA 4I7HA 3VPDA 3MWYW 4DV7L 1W6JA 1L2FA 4APVA 5M3MB 2E2HB 5C4XB 4ETSA 4FM9A 1PRTD 2VL6A 4P72A 5C3WA 1SYDA 3SVMA 5EDWA 4ZQ3A 2GPWA 2BQRA 2A19A 1S4ZA 2HJWA 3GIKA 4MIUA 1AE2A 2L11A 1F2MA 2V1CC 4YJ3F 3D4DA 1L0YB 2F4VQ 1LABA 4O2AF 2KQ3A 4F50A 4JOIA 5IE8A 3CF5A 1TWFA 1Z7TA 3S17H 1JICA 5BN5A 2UU9L 1Z2PX 4RHRA 2NVTH 1K3BC 5LA6F 3KHLA 4GKJQ 2ICEC 3S1RB 5L9XA 3ULPA 2EYJA 3C3LA 4JW0A 3I12A 4J9NA 5JVG3 3H4DA 1VQGA 2JA6B 1WI5A 1STNA 4TSSA 1U4RA 1KJIA 4PG3A 2EYHA 1IBMQ 2F4VH 4ECZA 3K58A 3KOJA 2JA5B 3MXNA 1Q8IA 3PW0A 2VS1A 5I47A 3OSOA 1I4HA 1CKNA 3V05A 3M4OB 1S5ED 3CCUA 4Q8FA 1N32L 2YU9B 4GZYC 5HV6A 1VQ8A 1ET6A 4NXNL 3J7YW 4QQBX 3NSWA 2CFMA 4U6PA 3VR4A 4TQUS 1Y14B 1SSOA 4KY6A 3J81L 3BZDB 5LMNQ 4WD3A 3PF5A 1XYIA 1SAPA 1JDBB 4RGMA 3PMFA 4OWWB 4BBSH 1RJTA 5EKLA 2FPPB 1JB3A 4ED7A 3T1HH 5EWFA 1STHA 1JIHA 2B63B 1E22A 2FFKB 2GPSA 4ZHQF 1IKLA 4JBKA 3BDLA 3K8AA 4A3CH 3BA8A 1DD2A 4DR2H 5GAEC 4JI1Q 3CQZA 2UXDL 3H09A 1XPUA 2IWHA 1YNND 4FDBA 5CV4A 3TP7A 3MR6A 4Y7NB 3FP9A 3OOCA 1Y1WH 1EUDB 1EUCB 3GTOB 5DLFA 1STAA 3WOFA 2UXDH 5ELNA 1CKMA 1SMYC 4MTNA 5AJ3L 2DIKA 2ZJRA 2NZ1D 1WOCA 3S1RH 2W6NA 5JAVA 2V4RA 2J4XA 4HCEA 3KALA 5HGTA 5BN3A 1QCBD 5KFQA 1CSQA 1GUNA 5IYDG 1N33Q 2HDLA 1X3EA 1YI2A 1XXGA 1IOVA 1PH4A 1SDFA 3OIQA 4DV0Q 3L0OA 2JA8G 5FLXL 4NXMQ 1FGUA 1EZ6A 4ED6A 1B53A 5FPRA 1Q46A 4ECUA 1ASZA 4LUZA 4XT3B 4DV7Q 2OWOA 1HNWQ 2E8GA 1N32H 3T4AC 3FMAA 1BNZA 4BY1B 4DPGA 1T3NA 1OO9B 5FD6A 2W7PA 3OMGA 4QY7A 4NW2A 5IGGA 4RAYA 1ZKOA 1TU2B 1X3FA 2FMCA 1E2ZA 4AYBB 4DA2A 4ZI7F 4ILWA 4EQPA 3OW7A 4I7ZC 1NNXA 5IGBA 1LLRD 3KDFB 4X62Q 3GTPH 3GQCA 2G5DA 1A9XA 1U4MA 3RZOH 1F9PA 1MJCA 1G2TA 4A93H 5KG3A 4B3TL 2BDOA 4XIGS 1KAWA 3F2BA 2RDFA 2MHVA 1HFNA 4EYIB 3AMUA 2QGQA 2XCAA 3LWBA 2F0NA 2YTVA 2EIFA 1J8IA 2ZTEA 1SFOH 3W1BA 3C46A 2QW7A 5IYBG 5E3FA 2F0OA 4LUOA 3AQQA 5FKAC 4R8IA 1PZID 4RNMA 1IHZA 1K83B 5KFLA 3MR2A 3GTGA 3IN5A 1SRUA 4OX9H 3U4ZA 1KXLA 2CKZB 1VAJA 1VQCA 4X3KA 1CQVA 3SK8A 4GKJH 1JC7A 4ECYA 1STGA 4ECVA 3P7JA 1VQEA 4FXDA 4LF7H 4IJHA 1KJ9A 2DUDA 5FOBB 3SK5A 5JVLA 2B39A 2UXBQ 2Q2IA 2UUAL 1V4YA 4CJ2C 1IYVA 4DR1L 4UCTA 5KFTA 1LYLA 3H4BA 2FMMA 2Q8RE 4K5XA 4IUTA 3D3RA 1N34L 1X9NA 5IOCA 1YEZA 2F0SA 3TREA 4HNUA 2WAQE 3K81C 2RDHA 4KHVA 1UC9A 4LF9L 2YTXA 2E2IH 3TIIA 2N78A 4X66H 3UDIA 4O42A 1VQ4A 3FEWX 3RLFA 2BCOA 4KKSA 4PV1C 3PO3B 1A15A 2JEGA 4C3IB 4KV6A 3QZ8A 5D1OA 2WB1B 1EOTA 5KFIA 5KG7A 2PBZA 4ALPA 3T1HQ 4DK3C 2A1AA 4C5BA 1AUXA 4UCSA 1E0BA 2RBMA 4I55F 3KHRA 5BPFA 3M4OH 2JA6A 1G6ZA 1TS5A 3IAYA 3UFXB 1JT8A 1NAPA 5KFPA 1I94H 4YAKB 1CM9A 2R3ZA 3KJOA 3PUZA 1QJOA 3GD7A 4XT1B 3W1GA 4CKCA 2IX3A 3J7AF 3M3YH 1CSPA 1HNZL 4BA2I 1K83H 1HXYD 4L8JA 1RJQA 2B2WC 3NQIA 1W2BA 1BBXC 4PMWA 2WB1A 3K7AB 4XYMB 1A62A 3PCOB 5IODA 1I4QA 3MC0B 2W57A 4FBTA 5I2XA 2OCEA 4PDBA 4QL5A 2XGTA 5F9LA 4R4CA 3MJFA 4NXNH 4FF4A 1NR2A 4O2DA 4M9UA 4DR5L 3U4VA 3KAJA 2VB2X 4WJ4A 3H3VH 4JI1L 4F4WA 4RB3C 4J9MA 3H0GG 3UI2A 2F0VA 2F4VL 4HYKA 5JEAJ 5FLMH 2CQAA 1VQAA 3T5HA 2K5DA 2ALZA 2JEAI 4RNNA 1JORA 5DG9A 2E2IA 1IW7D 2FPIB 2WKDA 5EZYF 2NVTB 1VS0A 1E1TA 3RBEA 4NP5A 3J7AV 3DWAA 5L1KA 2A68D 4BY7G 1K0RA 1SNQA 3AB9A 5DEHA 4WORA 5CBAE 1I50A 1RTOA 4MNOA 4AQYL 4UPAA 1I3QA 1K9MC 2CH4W 2ZXPA 1HRJA 4MA5A 3GV7B 5IYZF 3M9NB 2OQKA 3T51B 5HBRB 5CA0F 1QVFA 3J80i 2W70A 1IKMA 2UUCQ 5IWAL 3D0FA 1JE5A 2EE1A 2F0JA 1SE4A 4M8AA 5KG5A 4YY3H 1JCKB 1LTTD 4HAEA 2BOSA 4OONA 1PYBA 2ZM6H 2I5HA 3GTGH 1JQYD 2W71A 4DR1H 2WTFA 1EIHA 4JI4L 3I4NH 2CVRA 4ED2A 3V4ZA 2XGQA 5BR8Q 2JA5A 3KF6B 1EY9A 3D6WA 4UP7A 2XIGA 5KKNB 3KYHC 3N6XA 4ZCKA 2M9VA 2RSOA 4K14A 2BQ3A 1YHQA 4XQJA 4DNIA 4H7BA 4XQQA 2B63H 3IFDA 3I3CA 5E1FA 4GOPB 5IYCH 5FJ8G 3M9OB 1U5KA 1I4PA 1Y1WG 5D1PA 4YWLA 1C3OA 4LF9Q 4NPSA 3JAML 3U9SA 4DK6C 1TWCH 3DUZA 4FP5D 1S5CD 5C3EH 3I91A 1Q86C 3J7A5 4A3BH 1C30A 1BUVT 5JOBA 4AIMA 2MO1A 1ZQ7A 2K03A 3VA7A 5C5JA 3URYA 4JI3H 4CKBA 4MV9A 1QVCA 4OELB 3ORRA 4GC7A 4DV3L 4TQRA 4LFAH 1IOWA 3GTLA 1PTOD 4OIJA 2YS7A 4RKLA 1J5EQ 3PUYA 1DV2A 1FNVA 1B70B 1HA5A 3UE0A 5C1PA 4RUAA 4RZRA 1ENAA 5A2QW 1ZHQA 3GTLH 1EZ1A 3CXCA 5IP9G 4OO1G 4EBCA 5IY0A 1H9JA 3OW2A 2B63G 3T16A 3RZDH 2ZDQA 1B04A 2F0FA 2M2LA 2IMWP 3TS0A 1CFMA 2A6HD 1XNRL 3D4RA 1EQQA 1KDBA 2KHJA 3PIPA 1SEBD 3ULLA 3LP8A 1TXYA 2J7ZA 2AGOA 2O2LD 2X0SA 3I8ZA 4IRKA 1O75A 1F2ZA 5LL6b 2E75C 3OYYA 4P75A 5EQ0A 4MAMA 3QB3A 1Z2OX 5C4JH 2SEBD 5M3MG 1PH5A 2AGPA 2CW8A 5H80A 2X6LA 1SR3A 2R7KA 1JJCB 3KLRA 1JWSD 5C3XA 4LF4Q 2AU0A 4F4XA 5KFBA 2GVAA 3HOXH 2R82A 5CORA 3ICEA 5JVDF 3JAMc 3K7UC 1KLUD 3RBDA 1WVLA 1FJGH 3BG3A 2O5JC 2Q2HA 2OF1A 4DU9A 1U9RA 2ICIA 2I87A 3SDZA 5DNFA 2JA8B 1ULZA 2L15A 3NQTA 5KG1A 2AQ2B 2FK2A 2L4NA 4H0LC 4YP3A 1Q81C 5FLXW 2DLNA 4DR7L 3UQ8A 1I3QB 1DCZA 2I5LX 1LV9A 4BBRB 2KCMA 1GSHA 4LH7A 2B2YA 1OXSC 1IBKL 2EYMA 2C2RA 1M1KC 2FPGB 1LT4D 4Q5VA 4ZKCB 3FRPB 5FK9C 3QZ7A 1YHBA 3G48A 5C4ZA 1C0AA 3T5JA 2YV5A 4LUVA 3CAMA 2MNAA 3VMMA 3OMCA 1K3RA 1F77A 5EJWA 1QZGA 4BY7H 4BY1G 2MFIA 2BR0A 1CI3M 1Y1VG 3NWTA 5L37A 2UU9H 3DEPA 2R85A 4JYAH 3FVQA 2UXDQ 1HZ9A 5KFNA 2K01A 2IY5B 5L1LA 4DV1H 5GAHC 2F0KA 1X55A 3H15A 5KFOA 2VZAA 1EEID 4DL3A 2KA7A 3EQLC 4UP9A 5FO8B 4MV6A 5CV6A 5KNBA 3EBEA 3D31A 2E2JH 2NTTA 4MV4A 4JK1C 1YJWA 1E4GT 2F0PA 2V59A 2RQXA 2J9GA 3MVVA 4CJ1B 3VYSA 4LFBL 1L1OB 1HPCA 5C44H 5IWAQ 2W9BB 1Z9FA 4LF6L 3VYTA 2R7LA 5EPKA 3UE1A 2K05A 1PK8A 1WH2A 1PFNA 1EWIA 1CK1A 3E0JA 4ECWA 4FVMA 3S14H 3OTOH 4F8MA 3T1YH 1LT5D 4A3DB 1I6HH 3P20A 3PQIA 3Q0AA 4DFAA 1VQKA 2FK1A 2JA9A 2AQ3B 2F4IA 1FGBD 4XZ3B 2DWCA 4XQNA 4OWXB 4A3IG 4L5SA 3IRBA 3S16H 3I70A 1RK6A 4MV7A 5CB4F 3VDYA 2CW0D 4Q0YA 4R1JA 3H0GH 2UUBL 4DV7H 3L9AX 4FF1A 4MTEA 5KFFA 1NMGA 4RA8A 4ED1A 4YB8B 1E2VA 3EIVA 2LS01 4KKTA 4KD3A 1AZPA 1AN8A 3W2DA 3NWSA 2VW9A 4IQZA 3D6CA 2I80A 1RTNA 4R4QA 5E7NA 5LL6X 2NWGA 1K73C 1QUQB 2A73B 4NDXA 1R9TH 2HVRA 3C1EA 1WTXA 2CQOA 4FF3A 1HA6A 1W6KA 1GD7A 3NELA 3TP6A 4QWEA 4B3SL 3HOUG 3GIJA 1OTCA 4KTAA 1CHPD 5JQWA 2WAQB 4GNXA 1EWCA 1QVGA 3I4MG 4AYBA 3I4MH 4A3IH 1Y1VA 2CW7A 2K7VA 2UUBQ 2DJGC 3GTLB 1FVIA 1T5EA 1PH6A 2JA6G 5IT9E 2EQSA 4A3EG 2PO4A 3KLSA 5C6AA 4PZ6A 1CZWA 3CQZH 4UCOA 4JI6H 3K0XA 3JRWA 5EWGA 5GAGC 1V1PB 5CBEE 4LSAA 4EX5A 2JA5H 3RTXA 2CCZA 2VQDA 1D2BA 2VUMB 3ZYYX 1BXRA 5DLGA 1FL0A 3NTHA 3SEBA 1F9SA 2VB3X 2FLLA 4M7EA 2PMZA 2PYKA 3RF2A 4QW8A 4K5WA 4A76A 4G7ZC 2DNEA 3BABA 3E6ZX 2W9BA 2I07B 5M3FG 3CHBD 4IUQA 5IT9L 3EA6A 3H0GB 5EKKA 2AUJD 4A3KH 5IYDH 4HJ5A 3HKZB 1TWGA 1BBUA 1DXMA 2B2VC 1HNWH 1PYWD 2KOLA 1TT2A 3BDCA 2Z6BA 1ET9A 4B3MQ 3SK6A 4LFCH 1YNXA 3J7AK 3T1HL 1IBLH 3GTKB 5KX5F 3PUVA 5DM63 1STYA 2Z4IA 2YRXA 1Q7YC 1TQOA 3GTPB 2WV6D 4L1KA 4DUZH 2XGPA 1AN7A 3BA9A 3P75A 4U7CA 4Q45A 1NSNS 2ZXRA 3DXJC 5JEAH 4J8QA 1L1OA 3TMEA 5K5PA 4A3LH 4X66Q 2AWOA 1HNZQ 1K1SA 1WCMB 2A6HC 3HS0C 5CMDA 4ZUJA 1HTPA 3HRZC 5AJ3Q 2HT1A 4J0MA 4LF4H 4KJNA 1HZBA 5KFGA 1WJJA 1EYGA 3V6HA 4IFDJ 1T94A 5CR3A 1JJGA 2WAQG 2K5HA 4DL5A 3BZKA 4NB3A 3T13A 3PIO3 4LAAA 1KDCA 1G291 2R93A 4N9TA 3QWNA 1PYSB 3KDFA 5GADC 1AW7A 3WO1A 1F9RA 2E2DC 2VUMH 3A74A 1HNXL 2Q8TA 1V51A 3DM1A 3FMCA 1V8QA 4DV1L 3JSNA 1FD7D 1RCVD 3MWEA 3F8TA 2DZDA 1C9OA 4YAJB 4XX0B 3NUCA 5KFUA 1DOMA 3G7LA 1EQTA 1B50A 1F2LA 2PCFB 3M9BA 4GS3A 3S17B 5C0XI 1XPOA 1XNQH 1SXTA 2D9UA 2EPBA 1P16A 1D7QA 2FE3A 5J3BA 1D8LA 1E2WA 4CDDC 3CCEA 4HJ8A 2IJ0A 1IXRA 3TRZA 4C1NK 1GSAA 4QIWB 3Q2OA 3PO2G 3CCLA 3BS1A 4CC6A 2DJFC 2QDBA 1RHPA 3KF8A 4IPDA 4DV5H 2AHOB 1GM5A 4DAVA 1WD1A 3AYHB 1SMYD 5A2QL 2UXBL 2L0CA 1BNCA 3TZUA 3Q24A 2VPQA 2VXWA 1KJ8A 2HIXA 4A3DH 2HHHQ 3HG9A 3RJ0A 4LJZC 2AQ1B 3FDTA 3MXNB 4HIDA 1PX2A 5DG8A 4JV2A 1TS2A 1IBLL 3OWEB 4QIWA 4GLVB 3G6XA 2PW5A 3WDNA 3CCRA 3HOWG 3NEMA 3S1MH 2R86A 2J6TA 1M8AA 1HUNA 3CC7A 4GNXC 2UVWA 5EOYA 4JVZA 1HH2P 1WTWA 2R92A 4MN3A 1TY0A 4DXGA 2WDTA 1PRTF 3N41B 1BXTA 4HJ9A 5KFHA 2FJZA 1Q3LA 4KI0A 2R7ZG 4GOPA 3ITPA 2PMZB 3MA2B 5DG7A 3SHLA 3JSLA 1BGWA 5IP7G 5T14A 1N48A 4G4KA 4BXXG 4WFN3 3PW5A 3GV3A 2JSOA 4JI6L 4B3TQ 1VQ6A 3GLKA 2P0AA 3K0YA 3A8JE 3TBIB 2E2HA 1MBYA 1A2TA 1OXVA 1HR0H 2B3GA 4PWQA 4IPGA 1M4VA 2UU9Q 3N44B 4JOIC 1S5DD 3R2TA 2JQOA 5D65A 1KIXA 2YTYA 1PRTB 2X69A 2B2UA 2Z8LA 5KFAA 1J9OA 1Y1VB 3K5IA 2FK3A 3HGBA 2IHFA 2EJGC 3TS2A 5KYLA 3T1YL 3RN2A 3OTOL 5E4WC 3T5KA 3JC66 5G3LD 2XTIA 5D1OB 4LF8L 3GTMH 3H3VI 5LMNH 1RYRA 1S0MA 1K8MA 1NR4A 2BA0A 5IT9c 1W3SA 3RZOB 1RL2A 1CS0A 1W96A 1XMOL 1I4GA 1GVPA
chains in the Genus database with same CATH topology
5FLMH 1VQAA 1P8LA 1TWHH 1K8GA 1VQJA 2JEAI 4C3HH 1EUJA 3J81c 2ZJQA 2Q2UA 1Q12A 3STBD 1VQ7A 1VS0A 1E1TA 4IJLA 3L7ZC 3M4QA 4OO1I 3HFZB 5IP9H 3RNUA 4BY7G 4A75A 1K0RA 4DR1Q 3PO3H 4GOPC 1N33L 1HZCA 4MNOA 4AQYL 4YWMA 4X6AH 4UPAA 1K9MC 2UXCL 1K8AC 5FLXc 2PQAA 1TWGH 2OQKA 2VQEQ 1VQMA 2ZTCA 1QVFA 1TWAH 2ATWA 3J80i 3KFUA 2D62A 2NZOA 2UUCQ 5IWAL 3J81i 3D0FA 2WFWA 2PMZE 1JE5A 1VQBA 3CW2C 1V9PA 2GN5A 2K52A 4H02A 4QJFA 5LMNL 2N8NA 1X54A 1OXUA 5BR8L 3U58A 1LM0A 2E2HH 5M3MH 2RHQB 5HY6A 3AFPA 4DV1Q 4OONA 1PYBA 3U50C 1UE6A 2I5HA 4NXNQ 2NN6I 3GTGH 4X64Q 3DM3A 3KF8B 3HOYH 3STBC 4JI4L 3I4NH 4A3CG 3AEVA 2OTJA 2R92G 5BR8Q 1L1OC 4X62L 3KF6B 3I4OA 4UP7A 5ELOA 3E9HA 4DV5Q 1AH9A 3KYHC 2N49A 1YHQA 3UDFA 4DNIA 4DUYL 4DV4Q 2B63H 3K80C 1HR0L 2KENA 1RIPA 4TVAB 3HOVG 4GOPB 5IYCH 4R4IA 5FJ8G 3CPWA 1U5KA 1Y1WG 1EIFA 2YYZA 1VCIA 4YWLA 4NPSA 4DAMA 2NN6G 4LF9Q 4AQYQ 3HOUH 4DK6C 1QZHA 1TWCH 5C3EH 1X65A 1Q86C 3J7A5 3PF4A 4A3BH 1H95A 3M85A 4HIMA 1PH1A 4AIMA 2Z0SA 4A3BG 2MO1A 4UY8C 1O7IA 1G6PA 2QEXA 2MQHA 1QVCA 4BBRH 4IOCA 2I5MX 4DV3L 1BVSA 1MJEA 4Y7NH 2R7DA 4IFDI 4P74A 1VQPA 2JA8H 4A3GG 4DR2L 1YIJA 1J5EQ 3NENA 3PUYA 3PO2H 1B70B 3UE0A 3CCMA 1PHJA 1FJGL 4IPHA 3GTLH 1T9HA 1NTGA 4AYBE 5IP9G 3CXCA 3S2DH 3OTOQ 4OO1G 5IY0A 3OW2A 2B63G 1IBLQ 4QIWE 4DR4L 2JK8A 3RZDH 3TS0A 2HHHL 2ES2A 1XNRL 2PQAB 3M4PA 5M5WH 1EQQA 2KHJA 1I50H 3PIPA 2ZTDA 3ULLA 2D0PA 1TXYA 1Y1VH 4J15A 1IZ6A 4KLKA 2E5LL 2HIVA 1XNQL 1QUQA 3A5ZB 4GN4B 1VQOA 3OYYA 4P75A 4JI3L 3TQYA 3FKIG 4OXPA 5M3MG 5C4JH 3PGZA 1YJNA 1PH5A 4LFCQ 1EIYB 1SR3A 3BJUA 4JCVE 2R92H 1JJCB 4K0KQ 1M90C 2K4KA 4A4IA 4LF4Q 3I4NG 2GVAA 2K5VA 2LSSA 3HOXH 4JI3Q 3ICEA 5H1SE 3JAMc 1MKHA 3K7UC 1NY4A 4A3EH 4AYBG 2VQFQ 2VQFL 1UE7A 1VQDA 2K50A 3RLOA 3G4SA 4A3MH 1PH7A 2PNHA 2VUMG 2Q2HA 1OXTA 2LXJA 4JI6Q 1KQSA 3CC4A 2K5NA 2L15A 1EOVA 3GTQH 1N32Q 1BBWA 1V43A 4P73A 3B6YA 4LF7Q 1Q81C 1JB7A 4DR4Q 4GKJL 2KBNA 4JI7L 4MZ9A 4DR7L 1E7ZA 5M3FH 4A3LG 4A93G 2IT1A 4BXXH 2I5LX 1PA6A 3GTJH 4A3FG 2KCMA 3ZJYC 1I3QH 2WB1E 1E24A 1J5EL 4A3DG 1OXSC 1IBKL 3HKZE 4DR3Q 1M1KC 5JJKA 3ERSX 4C3JH 4YHHL 1HNWL 4DV3Q 2YU9H 2AMCB 1E3PA 1UE5A 2DGYA 1L0WA 2ZJPA 3BU2A 3I7FA 5LMUL 1PV4A 1YHBA 3G48A 4IPCA 3S2HH 1C0AA 1KL9A 5IYBH 1PH8A 2IHEA 2EXDA 2YV5A 1IBML 3L2PA 4DR5Q 2QA4A 1NJIC 2RHSB 1YVCA 4X65L 1N34Q 5GROA 4LUVA 3CAMA 2MNAA 4GNXB 4JI0L 1VQHA 1K3RA 1QZGA 4BY7H 2H5XA 3T1YQ 4BY1G 2MFIA 1HR0W 2FXQA 4QGUA 3UDGA 1SE8A 3HOVH 4XTCS 3Q8DA 1Y1VG 5M5XH 1WYDA 3ULJA 1IBKQ 3WWVA 2IX1A 1NE3A 4JBJA 5JEAG 2VNUD 2VY3A 2LXKA 3EN2A 1WCMG 4L5TA 2ALYB 1NBWA 1HZ9A 2UXDQ 4JI8Q 1I5FA 2AWNA 3I2ZA 1HJPA 2IY5B 1SROA 1AE3A 3HOZH 1EQRA 3KF6A 3LGJA 5GAHC 3HKZG 1XMQL 1X55A 3H15A 1X3GA 1CKNB 2VZAA 4UP9A 1HZAA 3HOWH 1PH3A 2WB1G 3EBEA 1XTDA 1KHIA 3D31A 4A3FH 2E2JH 2NVXH 4LWCA 2JJQA 1YJWA 3GTOH 2AKWB 1KRTA 1SMXA 1S3OA 4RG1A 1N8RC 2RCNA 1PVOA 1KC8C 4B3RL 4IOAA 4JYAQ 5M5YH 4LFBL 4LF5L 1L1OB 5C44H 5IWAQ 1VQLA 2ASBA 1Z9FA 4WJ3M 4K0KL 4LF6L 2KCTA 4UP8A 3G6EA 1PH2A 3CC2A 1U0LA 3J81j 1XNRQ 3HKSA 4DV4L 1GO3E 3UE1A 1ASYA 4JYAL 1EWIA 1WCMH 2CWPA 4HIKA 1UEBA 2Y0SE 3S14H 4LFBQ 4DV5L 1I6HH 1CUKA 2PI2E 2RF4A 2BH8A 4AH6A 2E5LQ 4JI7Q 1VQKA 5C3EG 2JA9A 3DLLA 4LFAL 1J6QA 2F3IA 4A3IG 4OWXB 3G71A 1YJ9A 3IRBA 1PFSA 2VQEL 1VQ9A 4L5SA 3S16H 1N36L 4L5RC 3VDYA 4Y52H 1KD1C 4R1JA 1E1OA 3HOYG 2MO0A 4POFA 3H0GH 2UUBL 4DV7L 1L2FA 3UDXA 4APVA 1NMGA 5C4XH 1B8AA 2VL6A 4P72A 3EIVA 4O0AA 4NXML 1GKHA 1IL2A 3J80c 2A19A 2VW9A 4DV6L 4B3SQ 4X66L 4R4QA 5E7NA 1AE2A 3S1QH 2Z6KC 1K73C 2V1CC 4RMFA 1QUQB 3CD6A 2JE6I 4HJ7A 1R9TH 2F4VQ 3A0JA 2UUAQ 2CQOA 4P71A 1GD7A 3NELA 4JOIA 5IE8A 3CF5A 4DV6Q 4B3SL 4X65Q 3HOUG 1OTCA 4YY3Q 1UWVA 2ID0A 3S17H 1XJVA 2UU9L 2R93H 4GNXA 3PV0A 3CP0A 2GVBA 1QVGA 2NVTH 1PH9A 4DR2Q 3I4MG 3I4MH 4A3IH 4GKJQ 2K75A 3ULPA 2UUBQ 1JJ2A 1FVIA 1PH6A 2JA6G 2JA6H 2BH2A 4IFDG 2EQSA 3FKIH 1HR0Q 1VQGA 4A3EG 1A0IA 1WI5A 1YZ6A 4PZ6A 4PG3A 1IBMQ 4GN5A 4BA1I 3CQZH 2D0OA 3K0XA 1Q82C 3HOXG 3KOJA 2VS1A 5GAGC 4PZ7A 4GKKQ 4KHPQ 1CKNA 4EX5A 3CCUA 2JA5H 1N32L 4KHZA 1Q8KA 2CCZA 3CCQA 2JA5G 3CMAA 1N36Q 1VQ8A 1S72A 4NXNL 4LF6Q 4QQBX 2CFMA 3CCSA 4DUYQ 1FL0A 2A8VA 4TQUS 1Y14B 2R7ZH 5LMNQ 3I55A 4HJAA 2Z6KA 4DV2Q 3PF5A 3A5UA 4DV2L 1VQIA 3CPFA 4A76A 2R93G 4JC0A 4LF7L 4BBSH 4OWWB 5EAYA 5M3FG 4OX9L 3PUWA 4LF4L 2R7FA 4BBSG 2JA7G 3F2DA 4A3KH 4R4TA 5IYDH 3F2CA 4HJ5A 3AFQA 1BBUA 3RR5A 4LF5Q 1JJGA 1E22A 4A3KG 4JBKA 4A3CH 3K8AA 4JI2Q 3GTKH 3BZCA 4B3MQ 5GAEC 4JI1Q 2NVQH 1YNXA 3T1HL 2UXDL 1XPUA 3PUVA 4FDBA 4IO9A 1Q7YC 1Q1EA 3ER0A 3SGIA 4GLXA 3FP9A 1Y1WH 2UXCQ 3PUXA 1VQFA 1G51A 1CKMA 3GDEA 5ELNA 4MTNA 4DR6L 5AJ3L 1A8VA 1L1OA 2ZJRA 4A3LH 4X66Q 2NZHA 1WOCA 2AWOA 1NMFA 2WP8J 4C2MH 3S1RH 1HNZQ 2JA7H 5AJ3Q 2HT1A 2N3SA 1HZBA 1CSQA 5IYDG 1N33Q 4JI2L 1WJJA 1EYGA 1DGSA 1X3EA 1YI2A 4JI0Q 4IFDJ 3E0EA 4GN3B 1PH4A 1X56A 3K7AH 4DV0Q 1FJGQ 3L0OA 4DUZQ 2WAQG 3J7ZC 2K5HA 2JA8G 4A3GH 3BZKA 4NB3A 5FLMG 4NXMQ 1Q1BA 4YWKA 1FGUA 1G291 2ZM6L 4OX9Q 4JBWA 1XPRA 1Q46A 1PYSB 1SN8A 1ASZA 4LUZA 3KDFA 5GADC 4DV7Q 1WFQA 1TWFH 2E8GA 4YHHQ 2OWOA 1HNWQ 2VUMH 3A74A 1HNXL 5C44G 5GQOA 4DPGA 1XMOQ 2C35B 4POGA 1OXXK 4YCVA 4QY7A 4DV1L 1X3FA 2BA1A 1VQNA 4LF8Q 4ME3A 3F8TA 1C9OA 3GTPH 3KDFB 3RLNA 2B29A 4LW1A 4X62Q 3RZOH 3M9BA 4GS3A 1MJCA 5C0XI 1XPOA 4A93H 2F52A 5JJIA 4X64L 1P16A 1LUZA 1D7QA 4B3TL 5J3BA 1D8LA 2HQLA 1KAWA 4XIGS 3PIOA 3F2BA 5LMNW 1X6OA 3CCEA 4JV5Q 4HJ8A 5DLQE 1IXRA 3TRZA 2QGQA 2YTVA 2EIFA 3GO5A 2PI2A 1Z47A 2ZTEA 1SFOH 4A3MG 3W1BA 3PO2G 5IYBG 1MIUA 3CCLA 4JI5L 4LUOA 3AQQA 5JJLA 4LFCL 2K14A 4IPDA 2AHOB 1GM5A 1XMQQ 1SRUA 3M7NA 3AYHB 4L5QA 3U4ZA 2CKZB 1HNXQ 2UXBL 1KXLA 3JAMi 1VQCA 4R4OA 4JI8L 4EQ5A 4JBMA 2ZM6Q 2UUCL 2NVYH 1YITA 3S1NH 4A3JH 3E9IA 1YBYA 3FHWA 1VQEA 1KRSA 5C0XJ 2HIXA 4IJHA 4HIOA 1I94Q 1UE1A 2HHHQ 4DV0L 2DUDA 1CKOA 3W5OA 4A3DH 3HOZG 3MXNB 3S24A 4HIDA 2UXBQ 2Q2IA 1IBLL 3KLWA 2UUAL 4GLVB 4DR1L 4DKAC 3CCRA 3HOWG 1LYLA 5C4XG 4DR3L 3NEMA 3S1MH 1N34L 4YCUA 3I56A 1X9NA 1I94L 1C7YA 4OWTB 3S15H 1YEZA 3TREA 3CC7A 4JI5Q 3RN5A 4GNXC 2WAQE 3K81C 4BY1H 1BKBA 1HH2P 4LF9L 1VQ5A 2YTXA 2E2IH 4B3ML 1N9WA 2N78A 3UDIA 2Y0SG 4JG2A 3KJPA 1VQ4A 3RLFA 4JV5L 3TEHB 4HJ9A 1S40A 1LTLA 2R6GA 4GLAC 3NBHB 3F1ZA 2I0QA 4KI0A 2R7ZG 4DR7Q 4GOPA 4ALPA 3PSIA 4LFAQ 4A3JG 3T1HQ 4DK3C 2KHIA 2A1AA 4B3RQ 4PZ8A 5IP7G 2IX0A 5C0XG 3CCJA 5IP7H 4BXXG 1V1QA 3M4OH 2OQ0A 4JI6L 4B3TQ 1YHAA 4YCWA 3CCVA 1VQ6A 2OTLA 1JT8A 2JEBI 5K36G 2Q2TA 5HGQA 3KJOA 1A63A 3PUZA 3GD7A 1EFWA 1OXVA 3W1GA 3M3YH 2B3GA 4DAYB 4IPGA 1CSPA 2CWAA 1HNZL 4JI4Q 1K83H 4BA2I 2UU9Q 4JOIC 1W2BA 1KIXA 3PO3G 2JQOA 4DUZL 2YTYA 1JMCA 4PMWA 4DR6Q 4LNQA 5FJ8H 5IYCG 1A62A 3PCOB 1XNQQ 2OCEA 2IHFA 1SLJA 4QL5A 2XGTA 4GKKL 4KHPL 3TS2A 3T1YL 4R4CA 3CMEA 3OTOL 3RN2A 3JC66 2XTIA 4O2DA 4LF8L 4DR5L 3U4VA 1IYJB 4BBRG 4YY3L 3GTMH 3H3VI 3MEFA 3H3VH 1B7YB 4JI1L 4WJ4A 2BA0A 3H0GG 4C3IH 5IT9c 1W3SA 1RL2A 5LMUQ 1XMOL 2F4VL 1GVPA 5JEAJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLM H;  1VQA A;  1P8L A;  1TWH H;  1K8G A;  1VQJ A;  2JEA I;  4C3H H;  1EUJ A;  3J81 c;  2ZJQ A;  2Q2U A;  1Q12 A;  3STB D;  1VQ7 A;  1VS0 A;  1E1T A;  4IJL A;  3L7Z C;  3M4Q A;  4OO1 I;  3HFZ B;  5IP9 H;  3RNU A;  4BY7 G;  4A75 A;  1K0R A;  4DR1 Q;  3PO3 H;  4GOP C;  1N33 L;  1HZC A;  4MNO A;  4AQY L;  4YWM A;  4X6A H;  4UPA A;  1K9M C;  2UXC L;  1K8A C;  5FLX c;  2PQA A;  1TWG H;  2OQK A;  2VQE Q;  1VQM A;  2ZTC A;  1QVF A;  1TWA H;  2ATW A;  3J80 i;  3KFU A;  2D62 A;  2NZO A;  2UUC Q;  5IWA L;  3J81 i;  3D0F A;  2WFW A;  2PMZ E;  1JE5 A;  1VQB A;  3CW2 C;  1V9P A;  2GN5 A;  2K52 A;  4H02 A;  4QJF A;  5LMN L;  2N8N A;  1X54 A;  1OXU A;  5BR8 L;  3U58 A;  1LM0 A;  2E2H H;  5M3M H;  2RHQ B;  5HY6 A;  3AFP A;  4DV1 Q;  4OON A;  1PYB A;  3U50 C;  1UE6 A;  2I5H A;  4NXN Q;  2NN6 I;  3GTG H;  4X64 Q;  3DM3 A;  3KF8 B;  3HOY H;  3STB C;  4JI4 L;  3I4N H;  4A3C G;  3AEV A;  2OTJ A;  2R92 G;  5BR8 Q;  1L1O C;  4X62 L;  3KF6 B;  3I4O A;  4UP7 A;  5ELO A;  3E9H A;  4DV5 Q;  1AH9 A;  3KYH C;  2N49 A;  1YHQ A;  3UDF A;  4DNI A;  4DUY L;  4DV4 Q;  2B63 H;  3K80 C;  1HR0 L;  2KEN A;  1RIP A;  4TVA B;  3HOV G;  4GOP B;  5IYC H;  4R4I A;  5FJ8 G;  3CPW A;  1U5K A;  1Y1W G;  1EIF A;  2YYZ A;  1VCI A;  4YWL A;  4NPS A;  4DAM A;  2NN6 G;  4LF9 Q;  4AQY Q;  3HOU H;  4DK6 C;  1QZH A;  1TWC H;  5C3E H;  1X65 A;  1Q86 C;  3J7A 5;  3PF4 A;  4A3B H;  1H95 A;  3M85 A;  4HIM A;  1PH1 A;  4AIM A;  2Z0S A;  4A3B G;  2MO1 A;  4UY8 C;  1O7I A;  1G6P A;  2QEX A;  2MQH A;  1QVC A;  4BBR H;  4IOC A;  2I5M X;  4DV3 L;  1BVS A;  1MJE A;  4Y7N H;  2R7D A;  4IFD I;  4P74 A;  1VQP A;  2JA8 H;  4A3G G;  4DR2 L;  1YIJ A;  1J5E Q;  3NEN A;  3PUY A;  3PO2 H;  1B70 B;  3UE0 A;  3CCM A;  1PHJ A;  1FJG L;  4IPH A;  3GTL H;  1T9H A;  1NTG A;  4AYB E;  5IP9 G;  3CXC A;  3S2D H;  3OTO Q;  4OO1 G;  5IY0 A;  3OW2 A;  2B63 G;  1IBL Q;  4QIW E;  4DR4 L;  2JK8 A;  3RZD H;  3TS0 A;  2HHH L;  2ES2 A;  1XNR L;  2PQA B;  3M4P A;  5M5W H;  1EQQ A;  2KHJ A;  1I50 H;  3PIP A;  2ZTD A;  3ULL A;  2D0P A;  1TXY A;  1Y1V H;  4J15 A;  1IZ6 A;  4KLK A;  2E5L L;  2HIV A;  1XNQ L;  1QUQ A;  3A5Z B;  4GN4 B;  1VQO A;  3OYY A;  4P75 A;  4JI3 L;  3TQY A;  3FKI G;  4OXP A;  5M3M G;  5C4J H;  3PGZ A;  1YJN A;  1PH5 A;  4LFC Q;  1EIY B;  1SR3 A;  3BJU A;  4JCV E;  2R92 H;  1JJC B;  4K0K Q;  1M90 C;  2K4K A;  4A4I A;  4LF4 Q;  3I4N G;  2GVA A;  2K5V A;  2LSS A;  3HOX H;  4JI3 Q;  3ICE A;  5H1S E;  3JAM c;  1MKH A;  3K7U C;  1NY4 A;  4A3E H;  4AYB G;  2VQF Q;  2VQF L;  1UE7 A;  1VQD A;  2K50 A;  3RLO A;  3G4S A;  4A3M H;  1PH7 A;  2PNH A;  2VUM G;  2Q2H A;  1OXT A;  2LXJ A;  4JI6 Q;  1KQS A;  3CC4 A;  2K5N A;  2L15 A;  1EOV A;  3GTQ H;  1N32 Q;  1BBW A;  1V43 A;  4P73 A;  3B6Y A;  4LF7 Q;  1Q81 C;  1JB7 A;  4DR4 Q;  4GKJ L;  2KBN A;  4JI7 L;  4MZ9 A;  4DR7 L;  1E7Z A;  5M3F H;  4A3L G;  4A93 G;  2IT1 A;  4BXX H;  2I5L X;  1PA6 A;  3GTJ H;  4A3F G;  2KCM A;  3ZJY C;  1I3Q H;  2WB1 E;  1E24 A;  1J5E L;  4A3D G;  1OXS C;  1IBK L;  3HKZ E;  4DR3 Q;  1M1K C;  5JJK A;  3ERS X;  4C3J H;  4YHH L;  1HNW L;  4DV3 Q;  2YU9 H;  2AMC B;  1E3P A;  1UE5 A;  2DGY A;  1L0W A;  2ZJP A;  3BU2 A;  3I7F A;  5LMU L;  1PV4 A;  1YHB A;  3G48 A;  4IPC A;  3S2H H;  1C0A A;  1KL9 A;  5IYB H;  1PH8 A;  2IHE A;  2EXD A;  2YV5 A;  1IBM L;  3L2P A;  4DR5 Q;  2QA4 A;  1NJI C;  2RHS B;  1YVC A;  4X65 L;  1N34 Q;  5GRO A;  4LUV A;  3CAM A;  2MNA A;  4GNX B;  4JI0 L;  1VQH A;  1K3R A;  1QZG A;  4BY7 H;  2H5X A;  3T1Y Q;  4BY1 G;  2MFI A;  1HR0 W;  2FXQ A;  4QGU A;  3UDG A;  1SE8 A;  3HOV H;  4XTC S;  3Q8D A;  1Y1V G;  5M5X H;  1WYD A;  3ULJ A;  1IBK Q;  3WWV A;  2IX1 A;  1NE3 A;  4JBJ A;  5JEA G;  2VNU D;  2VY3 A;  2LXK A;  3EN2 A;  1WCM G;  4L5T A;  2ALY B;  1NBW A;  1HZ9 A;  2UXD Q;  4JI8 Q;  1I5F A;  2AWN A;  3I2Z A;  1HJP A;  2IY5 B;  1SRO A;  1AE3 A;  3HOZ H;  1EQR A;  3KF6 A;  3LGJ A;  5GAH C;  3HKZ G;  1XMQ L;  1X55 A;  3H15 A;  1X3G A;  1CKN B;  2VZA A;  4UP9 A;  1HZA A;  3HOW H;  1PH3 A;  2WB1 G;  3EBE A;  1XTD A;  1KHI A;  3D31 A;  4A3F H;  2E2J H;  2NVX H;  4LWC A;  2JJQ A;  1YJW A;  3GTO H;  2AKW B;  1KRT A;  1SMX A;  1S3O A;  4RG1 A;  1N8R C;  2RCN A;  1PVO A;  1KC8 C;  4B3R L;  4IOA A;  4JYA Q;  5M5Y H;  4LFB L;  4LF5 L;  1L1O B;  5C44 H;  5IWA Q;  1VQL A;  2ASB A;  1Z9F A;  4WJ3 M;  4K0K L;  4LF6 L;  2KCT A;  4UP8 A;  3G6E A;  1PH2 A;  3CC2 A;  1U0L A;  3J81 j;  1XNR Q;  3HKS A;  4DV4 L;  1GO3 E;  3UE1 A;  1ASY A;  4JYA L;  1EWI A;  1WCM H;  2CWP A;  4HIK A;  1UEB A;  2Y0S E;  3S14 H;  4LFB Q;  4DV5 L;  1I6H H;  1CUK A;  2PI2 E;  2RF4 A;  2BH8 A;  4AH6 A;  2E5L Q;  4JI7 Q;  1VQK A;  5C3E G;  2JA9 A;  3DLL A;  4LFA L;  1J6Q A;  2F3I A;  4A3I G;  4OWX B;  3G71 A;  1YJ9 A;  3IRB A;  1PFS A;  2VQE L;  1VQ9 A;  4L5S A;  3S16 H;  1N36 L;  4L5R C;  3VDY A;  4Y52 H;  1KD1 C;  4R1J A;  1E1O A;  3HOY G;  2MO0 A;  4POF A;  3H0G H;  2UUB L;  4DV7 L;  1L2F A;  3UDX A;  4APV A;  1NMG A;  5C4X H;  1B8A A;  2VL6 A;  4P72 A;  3EIV A;  4O0A A;  4NXM L;  1GKH A;  1IL2 A;  3J80 c;  2A19 A;  2VW9 A;  4DV6 L;  4B3S Q;  4X66 L;  4R4Q A;  5E7N A;  1AE2 A;  3S1Q H;  2Z6K C;  1K73 C;  2V1C C;  4RMF A;  1QUQ B;  3CD6 A;  2JE6 I;  4HJ7 A;  1R9T H;  2F4V Q;  3A0J A;  2UUA Q;  2CQO A;  4P71 A;  1GD7 A;  3NEL A;  4JOI A;  5IE8 A;  3CF5 A;  4DV6 Q;  4B3S L;  4X65 Q;  3HOU G;  1OTC A;  4YY3 Q;  1UWV A;  2ID0 A;  3S17 H;  1XJV A;  2UU9 L;  2R93 H;  4GNX A;  3PV0 A;  3CP0 A;  2GVB A;  1QVG A;  2NVT H;  1PH9 A;  4DR2 Q;  3I4M G;  3I4M H;  4A3I H;  4GKJ Q;  2K75 A;  3ULP A;  2UUB Q;  1JJ2 A;  1FVI A;  1PH6 A;  2JA6 G;  2JA6 H;  2BH2 A;  4IFD G;  2EQS A;  3FKI H;  1HR0 Q;  1VQG A;  4A3E G;  1A0I A;  1WI5 A;  1YZ6 A;  4PZ6 A;  4PG3 A;  1IBM Q;  4GN5 A;  4BA1 I;  3CQZ H;  2D0O A;  3K0X A;  1Q82 C;  3HOX G;  3KOJ A;  2VS1 A;  5GAG C;  4PZ7 A;  4GKK Q;  4KHP Q;  1CKN A;  4EX5 A;  3CCU A;  2JA5 H;  1N32 L;  4KHZ A;  1Q8K A;  2CCZ A;  3CCQ A;  2JA5 G;  3CMA A;  1N36 Q;  1VQ8 A;  1S72 A;  4NXN L;  4LF6 Q;  4QQB X;  2CFM A;  3CCS A;  4DUY Q;  1FL0 A;  2A8V A;  4TQU S;  1Y14 B;  2R7Z H;  5LMN Q;  3I55 A;  4HJA A;  2Z6K A;  4DV2 Q;  3PF5 A;  3A5U A;  4DV2 L;  1VQI A;  3CPF A;  4A76 A;  2R93 G;  4JC0 A;  4LF7 L;  4BBS H;  4OWW B;  5EAY A;  5M3F G;  4OX9 L;  3PUW A;  4LF4 L;  2R7F A;  4BBS G;  2JA7 G;  3F2D A;  4A3K H;  4R4T A;  5IYD H;  3F2C A;  4HJ5 A;  3AFQ A;  1BBU A;  3RR5 A;  4LF5 Q;  1JJG A;  1E22 A;  4A3K G;  4JBK A;  4A3C H;  3K8A A;  4JI2 Q;  3GTK H;  3BZC A;  4B3M Q;  5GAE C;  4JI1 Q;  2NVQ H;  1YNX A;  3T1H L;  2UXD L;  1XPU A;  3PUV A;  4FDB A;  4IO9 A;  1Q7Y C;  1Q1E A;  3ER0 A;  3SGI A;  4GLX A;  3FP9 A;  1Y1W H;  2UXC Q;  3PUX A;  1VQF A;  1G51 A;  1CKM A;  3GDE A;  5ELN A;  4MTN A;  4DR6 L;  5AJ3 L;  1A8V A;  1L1O A;  2ZJR A;  4A3L H;  4X66 Q;  2NZH A;  1WOC A;  2AWO A;  1NMF A;  2WP8 J;  4C2M H;  3S1R H;  1HNZ Q;  2JA7 H;  5AJ3 Q;  2HT1 A;  2N3S A;  1HZB A;  1CSQ A;  5IYD G;  1N33 Q;  4JI2 L;  1WJJ A;  1EYG A;  1DGS A;  1X3E A;  1YI2 A;  4JI0 Q;  4IFD J;  3E0E A;  4GN3 B;  1PH4 A;  1X56 A;  3K7A H;  4DV0 Q;  1FJG Q;  3L0O A;  4DUZ Q;  2WAQ G;  3J7Z C;  2K5H A;  2JA8 G;  4A3G H;  3BZK A;  4NB3 A;  5FLM G;  4NXM Q;  1Q1B A;  4YWK A;  1FGU A;  1G29 1;  2ZM6 L;  4OX9 Q;  4JBW A;  1XPR A;  1Q46 A;  1PYS B;  1SN8 A;  1ASZ A;  4LUZ A;  3KDF A;  5GAD C;  4DV7 Q;  1WFQ A;  1TWF H;  2E8G A;  4YHH Q;  2OWO A;  1HNW Q;  2VUM H;  3A74 A;  1HNX L;  5C44 G;  5GQO A;  4DPG A;  1XMO Q;  2C35 B;  4POG A;  1OXX K;  4YCV A;  4QY7 A;  4DV1 L;  1X3F A;  2BA1 A;  1VQN A;  4LF8 Q;  4ME3 A;  3F8T A;  1C9O A;  3GTP H;  3KDF B;  3RLN A;  2B29 A;  4LW1 A;  4X62 Q;  3RZO H;  3M9B A;  4GS3 A;  1MJC A;  5C0X I;  1XPO A;  4A93 H;  2F52 A;  5JJI A;  4X64 L;  1P16 A;  1LUZ A;  1D7Q A;  4B3T L;  5J3B A;  1D8L A;  2HQL A;  1KAW A;  4XIG S;  3PIO A;  3F2B A;  5LMN W;  1X6O A;  3CCE A;  4JV5 Q;  4HJ8 A;  5DLQ E;  1IXR A;  3TRZ A;  2QGQ A;  2YTV A;  2EIF A;  3GO5 A;  2PI2 A;  1Z47 A;  2ZTE A;  1SFO H;  4A3M G;  3W1B A;  3PO2 G;  5IYB G;  1MIU A;  3CCL A;  4JI5 L;  4LUO A;  3AQQ A;  5JJL A;  4LFC L;  2K14 A;  4IPD A;  2AHO B;  1GM5 A;  1XMQ Q;  1SRU A;  3M7N A;  3AYH B;  4L5Q A;  3U4Z A;  2CKZ B;  1HNX Q;  2UXB L;  1KXL A;  3JAM i;  1VQC A;  4R4O A;  4JI8 L;  4EQ5 A;  4JBM A;  2ZM6 Q;  2UUC L;  2NVY H;  1YIT A;  3S1N H;  4A3J H;  3E9I A;  1YBY A;  3FHW A;  1VQE A;  1KRS A;  5C0X J;  2HIX A;  4IJH A;  4HIO A;  1I94 Q;  1UE1 A;  2HHH Q;  4DV0 L;  2DUD A;  1CKO A;  3W5O A;  4A3D H;  3HOZ G;  3MXN B;  3S24 A;  4HID A;  2UXB Q;  2Q2I A;  1IBL L;  3KLW A;  2UUA L;  4GLV B;  4DR1 L;  4DKA C;  3CCR A;  3HOW G;  1LYL A;  5C4X G;  4DR3 L;  3NEM A;  3S1M H;  1N34 L;  4YCU A;  3I56 A;  1X9N A;  1I94 L;  1C7Y A;  4OWT B;  3S15 H;  1YEZ A;  3TRE A;  3CC7 A;  4JI5 Q;  3RN5 A;  4GNX C;  2WAQ E;  3K81 C;  4BY1 H;  1BKB A;  1HH2 P;  4LF9 L;  1VQ5 A;  2YTX A;  2E2I H;  4B3M L;  1N9W A;  2N78 A;  3UDI A;  2Y0S G;  4JG2 A;  3KJP A;  1VQ4 A;  3RLF A;  4JV5 L;  3TEH B;  4HJ9 A;  1S40 A;  1LTL A;  2R6G A;  4GLA C;  3NBH B;  3F1Z A;  2I0Q A;  4KI0 A;  2R7Z G;  4DR7 Q;  4GOP A;  4ALP A;  3PSI A;  4LFA Q;  4A3J G;  3T1H Q;  4DK3 C;  2KHI A;  2A1A A;  4B3R Q;  4PZ8 A;  5IP7 G;  2IX0 A;  5C0X G;  3CCJ A;  5IP7 H;  4BXX G;  1V1Q A;  3M4O H;  2OQ0 A;  4JI6 L;  4B3T Q;  1YHA A;  4YCW A;  3CCV A;  1VQ6 A;  2OTL A;  1JT8 A;  2JEB I;  5K36 G;  2Q2T A;  5HGQ A;  3KJO A;  1A63 A;  3PUZ A;  3GD7 A;  1EFW A;  1OXV A;  3W1G A;  3M3Y H;  2B3G A;  4DAY B;  4IPG A;  1CSP A;  2CWA A;  1HNZ L;  4JI4 Q;  1K83 H;  4BA2 I;  2UU9 Q;  4JOI C;  1W2B A;  1KIX A;  3PO3 G;  2JQO A;  4DUZ L;  2YTY A;  1JMC A;  4PMW A;  4DR6 Q;  4LNQ A;  5FJ8 H;  5IYC G;  1A62 A;  3PCO B;  1XNQ Q;  2OCE A;  2IHF A;  1SLJ A;  4QL5 A;  2XGT A;  4GKK L;  4KHP L;  3TS2 A;  3T1Y L;  4R4C A;  3CME A;  3OTO L;  3RN2 A;  3JC6 6;  2XTI A;  4O2D A;  4LF8 L;  4DR5 L;  3U4V A;  1IYJ B;  4BBR G;  4YY3 L;  3GTM H;  3H3V I;  3MEF A;  3H3V H;  1B7Y B;  4JI1 L;  4WJ4 A;  2BA0 A;  3H0G G;  4C3I H;  5IT9 c;  1W3S A;  1RL2 A;  5LMU Q;  1XMO L;  2F4V L;  1GVP A;  5JEA J; 
#chains in the Genus database with same CATH topology
 1BCP F;  1P8L A;  4PQX A;  1K8G A;  1SNP A;  1EUJ A;  3J81 c;  2F03 A;  3LML A;  1MSH A;  3V4S A;  1PXU A;  1Q12 A;  4JUZ A;  1S03 G;  4LMQ D;  1VBG A;  2LKV A;  1PTO B;  5AFW A;  1X3Q A;  3L7Z C;  3M4Q A;  3N6R A;  2NU8 B;  4O3R A;  5IP9 H;  4CC5 A;  3CKI B;  1EL0 A;  1S0N A;  4K5V A;  1N33 L;  4IAL A;  4YWM A;  3HXL A;  5KND A;  1LTS D;  3OIP A;  5FLX c;  2F3W A;  1KDA A;  2PQA A;  2YCH A;  1TWG H;  3KTM A;  1VQM A;  2ATW A;  1AZQ A;  4ZAI A;  5KG0 A;  2D62 A;  2NZO A;  3J81 i;  2OEO A;  1XMQ H;  1PLF A;  2WFW A;  5D3I B;  2UVV A;  3PW7 A;  1V1P A;  5KYI A;  1K8O A;  5LMN L;  2MCT A;  1X54 A;  1EFI D;  3C0F B;  2E2H H;  5M3M H;  5HY6 A;  1SE2 A;  1X3P A;  1UE6 A;  2NN6 I;  4RUC A;  2C2D A;  4X64 Q;  3KF8 B;  1MHW C;  3Q8S B;  1EIG A;  3GTJ A;  2R92 G;  2R7Z B;  1L1O C;  4X62 L;  1WSC A;  3I4O A;  2SNM A;  4Q8E A;  3NBI A;  2N49 A;  4A3E B;  3UDF A;  3MXG A;  2EOT A;  3EPI A;  1HR0 L;  3HOV G;  4J6H A;  1B4O A;  4O3P A;  3H91 A;  4CGY B;  5J39 A;  2V58 A;  5KFM A;  1EIF A;  2YYZ A;  3GTM A;  4DNT B;  4XYL B;  3HOU H;  3M85 A;  1E4E A;  1WR2 A;  2Z0S A;  5C4H A;  3T56 B;  4A3B G;  1O7I A;  2VQE H;  4IOC A;  4MTD A;  3GTJ B;  2MGS A;  2OT2 A;  4HNT A;  1TWA B;  1MJE A;  2Y0S A;  4Y7N H;  2R7D A;  2JYO A;  2XN9 C;  1LAC A;  2NUC A;  3WOE A;  4A3G G;  3PO2 H;  5M5Y B;  4IZ8 A;  1S97 A;  1PHJ A;  1LTB D;  3J80 E;  4MHE A;  5ELF A;  4AYB E;  3S2D H;  4DUY H;  3OTO Q;  4O3N A;  2OXP A;  4DR4 L;  5C1O A;  5KFW A;  1Y1W A;  5DQH A;  4ME6 A;  2HHH L;  2ES2 A;  3M4P A;  5KFY A;  2ZTD A;  4QW9 A;  1HQR D;  1H9M A;  5M5W B;  4J15 A;  4IUR A;  1K83 A;  4DV3 H;  3VR5 A;  2E5L L;  3S15 B;  2VPS A;  3TIN A;  1XNR H;  4GN4 B;  4K6L A;  1IL8 A;  1GHK A;  4JI3 L;  3HOZ B;  5KRU A;  1EYZ A;  1LT6 D;  3PGZ A;  1EIY B;  1IW7 C;  3BJU A;  2R92 H;  1BO0 A;  4JV0 A;  3I4N G;  1UEA B;  4OEM B;  1ONL A;  1MKH A;  4A3E H;  1NY4 A;  2EYL A;  4AYB G;  4C3H B;  1PTO F;  3GID A;  2UXC H;  1UE7 A;  1VQD A;  3I73 A;  5CAE B;  4C1N I;  1LTI D;  4J1M A;  1H9S B;  1U4L A;  1ENF A;  3CC4 A;  1S5F D;  2HQE A;  5J1Z A;  2K5N A;  3H0G A;  1QWY A;  2R7N A;  2R7M A;  2PW7 A;  4RZQ A;  1D6E C;  4B3S H;  1TY2 A;  4GKJ L;  2KBN A;  4JI7 L;  1T36 A;  3JZI A;  5KT5 A;  1E7Z A;  5M3F H;  4A3L G;  4RU9 A;  3A8I E;  2XCL A;  3NE5 B;  2IT1 A;  3QR8 A;  5CV7 A;  4BXX H;  2XVS A;  4A93 G;  2M05 A;  2ZDG A;  1PA6 A;  4A3F G;  1I3Q H;  2WB1 E;  1SYX B;  4EGQ A;  2CHB D;  3HKZ E;  1AP0 A;  1C48 A;  5JJK A;  2W6P A;  4DV3 Q;  1EY7 A;  1UE5 A;  1LT3 D;  5LMU L;  2EY6 A;  3MR5 A;  4ECT A;  2FHT A;  3Q22 A;  4LF6 H;  2EXD A;  2UUB H;  1TAE A;  3L2P A;  4DR5 Q;  1NJI C;  2RHS B;  5GRO A;  1B6S A;  3R2I A;  4LFB H;  4JI0 L;  4ZRZ A;  2F0G A;  3T1Y Q;  4OO1 H;  1WTP A;  2FXQ A;  1S5B D;  2H4O A;  5LXT F;  4QGU A;  3BAA A;  3G6Y A;  1EY0 A;  4A3G B;  3Q8D A;  5M5X H;  2PVP A;  4EGJ A;  1FNW A;  3ULJ A;  1TKW B;  2IX1 A;  2YW2 A;  4IAJ A;  4C5C A;  3CU7 A;  4RGN A;  2LXK A;  1D1K A;  5IWA H;  1OWT A;  1I5F A;  1EEF D;  1SRO A;  3ERO A;  1TWC B;  3GQB A;  1ML0 D;  3NHH A;  3HKZ G;  1XMQ L;  4JI1 H;  2F3V A;  1X3G A;  1CKN B;  5C0X H;  4O3Q A;  2NVX H;  4JI4 H;  2JXM B;  2K04 A;  4BWG B;  1N33 H;  2K28 A;  5JPM C;  1TWG B;  3HKZ A;  4J9Q A;  1DYQ A;  3TN2 A;  5T1I A;  5C44 B;  1PVO A;  1EQV A;  3IG0 A;  4LF5 L;  3E3X A;  1VQL A;  2ASB A;  2OH2 A;  4DXF A;  4OL7 A;  4XYQ A;  4K0K L;  1CQJ B;  2KCT A;  4RCO A;  2JA7 B;  3DWP A;  3HKS A;  1SND A;  1M0W A;  1GO3 E;  3GV8 B;  3K59 A;  2JA7 A;  1SFO B;  3PVX A;  4JYA L;  4C2M B;  2CWP A;  4HIK A;  1UEB A;  2Y0S E;  3E5S A;  5ELC A;  4I4T F;  4AH6 A;  2PI2 E;  2RF4 A;  1EY5 A;  4LF8 H;  1RDP D;  5C3E G;  2W6O A;  4EFB A;  2B2T A;  3L3O C;  5KFZ A;  1BCP B;  1BF4 A;  5ISR A;  1VQ9 A;  1K28 A;  4C3J B;  2RA4 A;  1N36 L;  4L5R C;  4Y52 H;  1KD1 C;  1KJJ A;  2FKL A;  1E1O A;  2L1B A;  3UDX A;  5KT4 A;  3PW4 A;  2SDF A;  2OLS A;  1S10 A;  1RJR A;  1B8A A;  1RKN A;  4CHT B;  3A55 A;  4O0A A;  4NXM L;  1GKH A;  3E5N A;  2E2I B;  1IL2 A;  4CDC C;  3J80 c;  4B3S Q;  2UVR A;  4X66 L;  1R9T B;  3S1Q H;  2E2J B;  2Z6K C;  3K5H A;  3MFI A;  4RMF A;  2JE6 I;  1YNJ D;  3A0J A;  1WTV A;  4KY5 A;  1XWE A;  2H1E A;  5F9N A;  4DV6 Q;  2L9H A;  1UWV A;  2ID0 A;  1XJV A;  2R93 H;  3PV0 A;  4IUU A;  3OUZ A;  1UUP A;  1PH9 A;  1WTR A;  4X64 H;  4UDU C;  4UHV A;  4PMC A;  5BN4 A;  2QK4 A;  1JJ2 A;  2M00 A;  2NU9 B;  2BH2 A;  4IFD G;  3FKI H;  5JH7 F;  5L1I A;  1A0I A;  5KFE A;  3I90 A;  4GN5 A;  4BA1 I;  2C5C A;  2D0O A;  1Q82 C;  1LO5 D;  1RD9 D;  3HOX G;  1DIK A;  2N88 A;  1EHI A;  4O3O A;  3RUZ A;  1JOQ A;  4KHZ A;  2NU7 B;  3QG1 A;  1I7N A;  2W7O A;  2PNR C;  2EJF C;  1N36 Q;  3HOY B;  1G2S A;  1S72 A;  4LF6 Q;  1MD2 D;  4DUY Q;  2R7Z H;  2O03 A;  4ZQI A;  3I55 A;  4DV2 Q;  1ENC A;  5KG4 A;  1O7Y A;  2R93 G;  4JC0 A;  1LTR D;  1GOZ A;  4OX9 L;  3PUW A;  2SCU B;  4I65 A;  1WTQ A;  3GTK A;  1JR0 D;  2JA7 G;  3F2D A;  2BQU A;  1I6V C;  3F2C A;  1B9M A;  2F0H A;  5KG6 A;  4RH6 A;  5CV5 A;  1STB A;  5FLX E;  4LF5 Q;  4YHH H;  4A3K G;  5FPO A;  1N34 H;  3GTK H;  3GV6 A;  3ND9 A;  3BZC A;  4K8I A;  2YYA A;  2NVQ H;  3MWD A;  5JVH 3;  5C3E B;  1SNM A;  3DF7 A;  3SGI A;  3G6V A;  2UXC Q;  2HGS A;  4Q43 A;  3M7G A;  2K5W A;  4FF2 A;  3RGX A;  4N9P A;  1VQF A;  3GDE A;  1E4F T;  4DR6 L;  1A8V A;  4EGV A;  2PQE A;  2F0D A;  1FNU A;  2NZH A;  2WP8 J;  4RB0 A;  2C00 A;  2F0U A;  2JA7 H;  1QIL A;  3GTG B;  4ZK9 B;  3BDO A;  3K5L A;  1DGS A;  4J9O A;  4JI0 Q;  4NLG A;  2EJM A;  2EYO A;  5F2D A;  3K7A H;  3Q8P B;  4A3G H;  1R4P B;  3J7Z C;  4HMJ A;  1KAB A;  3MFG A;  1Q1B A;  4J9L A;  1NCV A;  3Q23 A;  1WTO A;  3L4K A;  5LHY 1;  3X3N A;  2ZM6 L;  4H13 C;  1GUG A;  4JV5 H;  1Z2N X;  2RCF A;  1WFQ A;  1TWF H;  4G7O C;  5GQO A;  1O80 A;  2C35 B;  1UNS A;  4CDE C;  4POG A;  4DR4 H;  4YCV A;  1DON A;  3SE7 A;  5EBC A;  1VQN A;  3CVZ A;  4ME3 A;  4KN7 C;  1EY4 A;  1SNC A;  2EZV A;  1O7Z A;  5A2Q E;  1IBK H;  2B29 A;  4LW1 A;  3R3O A;  3HOX B;  2R8I A;  4ECS A;  2ATL A;  4C56 C;  4L63 B;  5JJI A;  4X64 L;  3OHA A;  4FS2 A;  2X6G A;  3J81 W;  3PIO A;  3NPP A;  5IGF A;  4A3I B;  4JV5 Q;  3ND8 A;  5DLQ E;  2VR1 A;  4F4Y A;  3SI8 A;  2V9W A;  3Q8R B;  3MEH A;  4G7H C;  1EYA A;  1Z47 A;  4A3M G;  2QCP X;  3LWU A;  1G8Z D;  3X3M A;  4JI5 L;  3N42 B;  3WNZ A;  2DN8 A;  2ZT9 C;  4LFC L;  4HR7 A;  3NBH A;  5KFS A;  1MSG A;  2QF7 A;  2NUA B;  2NTS A;  2EY1 A;  3S2H B;  2PZW A;  3M7N A;  1SEI A;  4ABN A;  4JI5 H;  1L0X B;  4DV4 H;  3NP8 A;  4UAI A;  4JI8 L;  2JEF A;  3VR3 A;  3KK7 A;  2F0W A;  4IN3 A;  3BVM A;  4DK0 A;  3RUP A;  5E4X A;  2UUC L;  2AQ4 A;  1YBY A;  3FHW A;  1KRS A;  5IIF A;  5JPN C;  2NVY B;  4HIO A;  1UE1 A;  1CKO A;  3W5O A;  3K6O A;  1R9T A;  3HOZ G;  3GTO A;  3GTQ A;  1JKJ B;  2J6U A;  4QWA A;  2RVL A;  1I50 B;  3KLW A;  5LYJ F;  3VYR A;  2VQF H;  4LSX A;  1A6X A;  3MWM A;  1SNO A;  4FYD A;  1I94 L;  3ONA B;  4OWT B;  4JI5 Q;  1GUW A;  1TR5 A;  3RN5 A;  2W9C B;  3GIQ A;  4HMI A;  3K5O A;  4BY1 H;  3BQ0 A;  4LF9 H;  2R8K A;  3R8B A;  2AGQ A;  2Y0S G;  2V4Q A;  4JV5 L;  4IZO A;  3TEH B;  1S40 A;  2R6G A;  1KNA A;  4GLA C;  3K5M A;  2RGR A;  1F2Y A;  4RNO A;  2NN6 H;  1CQF A;  2I0Q A;  2A69 D;  5KT6 A;  4DR7 Q;  2EY5 A;  4EEQ A;  4RAZ A;  4FXG C;  2DY7 A;  4B3R Q;  3R93 A;  4PZ8 A;  4RB1 A;  2IX0 A;  4FU0 A;  1V1Q A;  4WRD A;  4YCW A;  4L6T B;  1GYF A;  3QJY A;  2OTL A;  3BYY B;  4FBU A;  4O3S A;  3BVZ A;  1GJX A;  2HVS A;  2IA6 A;  2F0Q A;  3I72 A;  4DAP A;  4DAY B;  1K0S A;  3JRX A;  3RB4 A;  4DL2 A;  4UCU A;  1MI2 A;  1ZYR D;  2VA2 A;  3VPB A;  1A3V A;  1H9R A;  4NKL A;  4BS9 A;  2HCI A;  5KFJ A;  4B3T H;  3CME A;  2XCP A;  2WII B;  4DGZ A;  3MHB A;  3HOW B;  1NUC A;  2XRS D;  4BBR G;  5J22 A;  4YY3 L;  2HDM A;  4R8U A;  4BBS B;  1PZK D;  2G9H D;  2QEJ C;  1D5Z C;  5LMU Q;  1G6P A;  2IP4 A;  1MGS A;  4F87 A;  1TWH H;  5CV9 A;  1VQJ A;  4E4T A;  4C3H H;  3KBX A;  1KNE A;  1PTO H;  4C3H G;  3KXY T;  2Q2U A;  4C3J G;  2FB9 A;  2K32 A;  3HFZ B;  4YR3 A;  3RNU A;  4A75 A;  3PO3 H;  1SE3 A;  4GOP C;  2ASJ A;  4X3T A;  5BPH A;  3FKI B;  4X6A H;  2Z9H A;  3JAM E;  2UXC L;  2Z4H A;  2V5A A;  2VQE Q;  4K8J A;  1TWA H;  1CT1 D;  5DM7 3;  3V6J A;  2F0T A;  4A3F B;  3FPU B;  3CQZ B;  4EG0 A;  3CW2 C;  1V9P A;  4H02 A;  1AUV A;  1J5E H;  2XIW A;  2N8N A;  4RCN A;  1OXU A;  3U9O A;  2RHQ B;  3AFP A;  4DV1 Q;  1ZXT A;  1XDN A;  3D8G A;  3S2D B;  3OHX C;  4MA0 A;  1B44 D;  1BR9 A;  3QOJ A;  1I6H B;  3AEV A;  1JOO A;  3H6M A;  1JXL A;  3KUP A;  1GSO A;  5ELO A;  2XWJ B;  1AH9 A;  4DV5 Q;  1EU3 A;  4CBV A;  1LTG D;  3NK9 A;  1GXD C;  3HOV B;  3VR6 A;  1B1Z A;  2RKS A;  1TA8 A;  4IWX A;  4EYH B;  1TWH A;  4DUY L;  3K80 C;  4JI8 H;  4N8X 1;  1RIP A;  4TVA B;  4IRD A;  1DOK A;  4R4I A;  3HP3 A;  4IHJ F;  3KHG A;  3V96 A;  4DAM A;  2MP1 A;  2NN6 G;  4AQY Q;  1H95 A;  1QZH A;  1M0T A;  3PF4 A;  1X65 A;  3FDS A;  2TSS A;  4IUN A;  3R5F A;  1LTA D;  4ID6 A;  5M9O A;  4HIM A;  1PH1 A;  1QOH A;  1GLV A;  4R7R A;  4UY8 C;  1UC8 A;  2LMC B;  4FNF A;  4HR7 B;  4J9R A;  4DR7 H;  1EU4 A;  1CHQ D;  2XNA C;  1I4R A;  2MQH A;  4BBR H;  2NVX B;  1SYB A;  2JN4 A;  1DJR D;  2I5M X;  1IBM H;  2UUC H;  3C1F A;  3HB9 A;  4P74 A;  2D2C C;  1VQP A;  1SYG A;  4R8N A;  4DR2 L;  1KLG D;  3NEN A;  5CYU A;  3V6K A;  4JPB W;  5FO7 B;  1FJG L;  5LOV F;  1I7L A;  4C5A A;  1B9N A;  5D3D A;  4K0K H;  1IBL Q;  1PFB A;  4N8F A;  4QIW E;  1JOK A;  2JK8 A;  5KFV A;  3LNN A;  2WE6 A;  2I46 A;  4EEY A;  2PQA B;  5M5W H;  2IW3 A;  1I50 H;  3BVG A;  4A2A A;  1Y1V H;  1SYC A;  4DR6 H;  2J6S A;  2UUA H;  3EJI A;  4KLK A;  3ORQ A;  3GTP A;  2YS6 A;  4ODG A;  4Y8V B;  1ROD A;  3A5Z B;  2W8L A;  2EYF A;  2DPJ A;  1HCZ A;  2Z1C A;  2ASL A;  2YRW A;  4J9K A;  4LK1 C;  2PN1 A;  2R92 B;  3FKI G;  2DPI A;  4OXP A;  2WIN B;  4IUV A;  3I4N B;  1B3A A;  4BWS C;  3MFH A;  4K0K Q;  1M90 C;  4A4I A;  4HNV A;  1SYF A;  5HUR A;  2JEI A;  2C22 A;  4JI3 Q;  1BOS A;  5DQG A;  2K6A A;  1EY6 A;  3KHH A;  1HUM A;  2VQF Q;  4KJO A;  2KSW A;  3RLO A;  4A3M H;  1PH7 A;  2PNH A;  1OXT A;  2LXJ A;  3RB6 A;  2K5Q A;  4JI6 Q;  1WTH A;  3J80 L;  3BQ2 A;  1EOV A;  4ZYS A;  3GTQ H;  1Z6H A;  5NUC A;  1BBW A;  1N32 Q;  4A3B B;  3FPP A;  4P73 A;  3B6Y A;  1VMC A;  2EY2 A;  4C2M A;  4MZ9 A;  3I4L A;  3R5H A;  3MTS A;  2RDI A;  3H3V C;  5KFC A;  4DLK A;  5M3F B;  5BR8 H;  3PN1 A;  5KFK A;  1BJT A;  1O7L A;  4P2C B;  4B08 A;  4DR3 Q;  3S16 B;  4YHH L;  2DGY A;  1L0W A;  2ZJP A;  3BU2 A;  3I7F A;  4DAY A;  5J2U F;  1PDQ A;  4XDX A;  1TS4 A;  2KUM A;  1YVC A;  4KMU C;  1R4Q B;  1QNU A;  4GNX B;  2WAQ A;  2H5X A;  1HR0 W;  5M5X B;  4DF7 A;  5A35 A;  4KN4 C;  4QWB A;  1SE8 A;  4XTC S;  5G3L F;  2B2U C;  2C28 A;  1IBK Q;  5K2M A;  3WWV A;  1NE3 A;  3N43 B;  4JBJ A;  5IGD A;  1AEX A;  1II3 A;  2E76 C;  4QUC A;  3EN2 A;  5JEA G;  2VNU D;  1JWM D;  1TWH B;  2ALY B;  1EYC A;  4UFZ A;  4JI8 Q;  1BCP D;  3I2Z A;  2PZU A;  1HJP A;  4J9S A;  2QYZ A;  5EGT A;  3KAK A;  1EQR A;  5EKI A;  1I4X A;  2FMA A;  4OHJ A;  3LGJ A;  3VR2 A;  3HOW H;  1PH3 A;  3A56 A;  5KFR A;  2WB1 G;  5EBD A;  5I2Y A;  3SR1 A;  2QKI C;  2E5L H;  1KHI A;  2K1B A;  4LWC A;  2JJQ A;  1PZJ D;  3DMU A;  1SMX A;  2B63 A;  2NBF A;  2W9C A;  1S3O A;  5IGC A;  4A3M B;  2RCN A;  5ELD A;  1KC8 C;  3SE0 A;  4B3R L;  4O4I F;  4IOA A;  4JYA Q;  5M5Y H;  2VOB A;  4ECR A;  4X65 H;  3Q8Q B;  4WJ3 M;  2L12 A;  2UVU A;  1CE8 A;  2PZT A;  3GP7 A;  4UP8 A;  1PH2 A;  1XNR Q;  3J81 j;  4EBD A;  3J81 E;  4DV4 L;  3PZP A;  1Y8O B;  1C8C A;  3RFC A;  1S0O A;  2W6Q A;  2VUG A;  1ILP A;  4JI7 Q;  2BH8 A;  1EWH A;  4JV1 A;  1STE A;  1J6Q A;  1PFS A;  2VQE L;  3S1M B;  2MO0 A;  1H9K A;  4ME5 A;  4RKB A;  2W6M A;  2LY7 A;  3N52 A;  4YR0 A;  5KT3 A;  3S1N B;  1KBL A;  4HCS A;  3A54 A;  5C4X H;  1N36 H;  2F0I A;  1CA6 A;  4KY7 A;  4Q44 A;  1C4Q A;  4DV6 L;  1A3U A;  1VDZ A;  4G3I A;  3TDQ A;  2Y0S B;  2Q8I B;  3CD6 A;  1XX8 A;  5I6W A;  4NXM H;  5T1G A;  4HJ7 A;  3OPO A;  4ULL A;  1CA5 A;  2UUA Q;  1VF7 A;  1BCP C;  4P71 A;  3EYY A;  5L1J A;  4ZKB B;  1ZET A;  4X65 Q;  4YY3 Q;  2IL8 A;  4IWY A;  3CP0 A;  3GIL A;  2GVB A;  4C3I G;  4RHS A;  5I9P A;  4DR2 Q;  1FYC A;  2R93 B;  1XTC D;  2WAC A;  2K75 A;  3OSN A;  4OIK A;  4IFD H;  3PR5 B;  3OWF A;  2FJ2 A;  2NB0 A;  2JA6 H;  3TIG A;  1M6V A;  3IKJ A;  1HR0 Q;  1JWU D;  1HQM C;  1UNN C;  1L2Z A;  2AUK A;  2C9O A;  1YZ6 A;  5LMU H;  3MR3 A;  4CDF C;  4E6I A;  3TP5 A;  4OGQ C;  2MJ8 A;  2KEE A;  4K2K A;  1TWA A;  2BDN A;  2SNS A;  4PZ7 A;  4GKK Q;  4KHP Q;  4DR3 H;  4LF5 H;  3SK4 A;  2LFN A;  1HNX H;  4EBE A;  1KJQ A;  3CRK C;  1Q8K A;  2JA5 G;  3CCQ A;  5I9O A;  3CMA A;  1HFG A;  2R6F A;  3CCS A;  2A8V A;  2N55 A;  3P1H A;  4QF4 A;  2HVQ A;  4HJA A;  2Z6K A;  3M4I A;  4U67 3;  4ECX A;  3GTM B;  3A5U A;  4DV2 L;  1VQI A;  3CPF A;  4TQS A;  1B2T A;  1GGO A;  2W9A A;  4LF7 L;  4QWC A;  4EQN A;  5EAY A;  4K2L A;  4LF4 L;  4F4Z A;  3GV5 B;  2R7F A;  4TUY F;  3RGZ A;  4BBS G;  3SXH A;  1CTM A;  5GON F;  4R4T A;  2VA3 A;  4XYO A;  1JLL B;  3AFQ A;  4RAU C;  3RR5 A;  2W8K A;  2D5D A;  2IBK A;  3N8D A;  4J9P A;  1VMP A;  4JI2 Q;  3OUU A;  4Z9C B;  2F0L A;  2KCN A;  3GTQ B;  1DZ1 A;  2FIN B;  4I50 F;  4YJ2 F;  2XD4 A;  2HUG A;  3CRL C;  5COY A;  2IPK D;  1ESR A;  4IO9 A;  3K57 A;  4FS1 A;  5EPL A;  4JI0 H;  1G91 A;  4IRC A;  1Q1E A;  3ER0 A;  4GLX A;  1AFP A;  4JI7 H;  3R23 A;  5CC4 A;  3QFF A;  3PUX A;  1G51 A;  1VBH A;  1ZHS A;  2K33 A;  2ZDH A;  2HCC A;  2DNC A;  2P5Z X;  2FP4 B;  1NMF A;  4C2M H;  4JI2 H;  4HN7 A;  4WBN F;  4QMG A;  2N3S A;  4JI2 L;  5JUM A;  1RJP A;  3E0E A;  4GN3 B;  2A74 C;  1X56 A;  1FJG Q;  4DUZ Q;  1QB5 D;  5FLM G;  4YWK A;  1EYD A;  1TWC A;  4MV1 A;  4OX9 Q;  1TII D;  4JBW A;  1XPR A;  1SN8 A;  2A6E C;  1JDE A;  3QIA A;  4PNY A;  4LH6 A;  1Y8N B;  4YHH Q;  3F2U A;  5C44 G;  5J2T F;  1XMO Q;  5IGE A;  1TWF B;  1OXX K;  3G8C A;  2BA1 A;  2HHH H;  2NVQ B;  2F1M A;  4LF8 Q;  4TV8 F;  2UXB H;  5EWE A;  1ICF B;  1D5M C;  3BYT B;  4UCV A;  3RLN A;  1Y1W B;  4A3K B;  4F7X A;  3R5X A;  2RDG A;  2L55 A;  2F52 A;  4WJW A;  5KFX A;  1LUZ A;  3PIP 3;  2G9D A;  2HQL A;  5JJZ A;  3PW2 A;  5LMN W;  1X6O A;  4O4L F;  3LX0 A;  4TKO B;  3HOU B;  2ASD A;  2CQY A;  4R9W A;  2FLN A;  3Q6S A;  1ILQ A;  3NXW A;  3RMH A;  4ED3 A;  2JP1 A;  3GO5 A;  2PI2 A;  3I4M B;  2CW0 C;  1A2U A;  2ZXO A;  1ZEQ X;  2WYO A;  1D1I A;  1MIU A;  3F8N A;  3KBG A;  5JJL A;  2K14 A;  2GLT A;  2SOB A;  4ECQ A;  1D5X C;  1XMQ Q;  4NMZ A;  3T5L A;  4QCL A;  4L5Q A;  1HNX Q;  5KG2 A;  3JAM i;  4GKK H;  4R4O A;  3V2T A;  4KHP H;  4FO2 A;  4EQ5 A;  3PR4 A;  2R8H A;  1IYU A;  2J0T D;  4JBM A;  2ZM6 Q;  3M9M B;  2NVY H;  1YIT A;  3S1N H;  4DL6 A;  4A3J H;  3E9I A;  1DV1 A;  1RYS A;  5C0X J;  1I94 Q;  1FR3 A;  2TMP A;  4B9X A;  1SBB B;  4DV0 L;  2C2E A;  2EVB A;  1SJE D;  1QE6 A;  3S24 A;  3FKI A;  3HEJ A;  2EDG A;  1GUO A;  2A68 C;  5LL6 S;  2KEC A;  4DKA C;  5C4X G;  4DR3 L;  4DL7 A;  4YCU A;  2B2W A;  3I56 A;  1C7Y A;  3S15 H;  4YIJ A;  5K36 H;  4V19 0;  1B6R A;  1RK5 A;  5FO9 B;  1BKB A;  5KGU A;  1K1Q A;  2RDJ A;  1VQ5 A;  1BDO A;  1N9W A;  4B3M L;  1W93 A;  4AQY H;  4JG2 A;  3KJP A;  4DV2 H;  4S3S A;  4EFE A;  1N56 A;  1LTL A;  2VUM A;  3NBH B;  1QG7 A;  3F1Z A;  4U68 A;  1SFO A;  3PSI A;  4LFA Q;  4A3J G;  2KHI A;  3TQT A;  4DV0 H;  4I7A A;  1B3Q A;  5C0X G;  3CCJ A;  1ZYR C;  5IP7 H;  2R84 A;  4KKU A;  3RD4 A;  4V0B A;  2YU9 A;  3W3A A;  2OQ0 A;  5CGK A;  1YHA A;  3CCV A;  2DY8 A;  3IL8 A;  4DR5 H;  5C5L A;  2JEB I;  3BQ1 A;  4ZLT F;  5K36 G;  2XC9 A;  5CV8 A;  2Q2T A;  5HGQ A;  1A63 A;  1EFW A;  3N40 P;  4G57 A;  2A5H A;  4JI4 Q;  4HQ6 A;  2CWA A;  3RZD B;  3RAX A;  5KEE A;  3S9W A;  4XXE A;  3PO3 G;  4DUZ L;  1GUT A;  2F0M A;  2B2Y C;  4O1N A;  1JMC A;  4LMY A;  4DR6 Q;  1Y69 U;  4LNQ A;  5FJ8 H;  5IYC G;  3VA5 A;  4B3R H;  5I4D A;  1SYE A;  4HED A;  1XNQ Q;  1PMR A;  2B2V A;  2CH4 A;  1SLJ A;  2QIL A;  1HNZ H;  2KED A;  1YNJ C;  4GKK L;  4KHP L;  4ZOL F;  3RB3 A;  2A69 C;  1XMO H;  4FXK C;  2B2T C;  2XWB B;  3EFX D;  1PFM A;  3GIP A;  1IYJ B;  3MEF A;  3K3V A;  1B7Y B;  1B33 N;  4C3I H;  4HTH A;  2F0E A;  3HBL A;  2R8J A;  1PRT C;  4EVO A;  5KT2 A;  2XSC A;  2PPB C;  2ZJQ A;  3AU7 A;  1CQI B;  3GII A;  3STB D;  1VQ7 A;  2GA4 B;  4IJL A;  4OO1 I;  4IR9 A;  2YZN A;  2BE5 D;  5KT7 A;  4DR1 Q;  4ZUI A;  3EPG A;  1HZC A;  1K8A C;  2EXZ A;  4QB4 A;  3HZX A;  2NYZ D;  3RV3 A;  2KCC A;  2ZTC A;  3VYU A;  3M3Y B;  3KFU A;  1QNK A;  4RB2 C;  2PMZ E;  1VQB A;  3TZD A;  5BMV F;  3TSS A;  4MTK A;  2GN5 A;  2K52 A;  3U58 A;  4QJF A;  1VF5 C;  4A3F H;  5BR8 L;  1O78 A;  1LM0 A;  3RIZ A;  3H94 A;  3U50 C;  4NXN Q;  3DM3 A;  3DEO A;  2MPM A;  3STB C;  1WD0 A;  3HOY H;  1PTO C;  4A3J B;  3O13 A;  4A3C G;  5I6Y A;  2OTJ A;  2WKC A;  3WO0 A;  4DL4 A;  4YBZ B;  2L5T A;  1Q90 A;  1X32 A;  4BY7 B;  4RGO S;  3E9H A;  2R8G A;  5D8D A;  3ETJ A;  4DV4 Q;  3D4W A;  2KEN A;  1GHJ A;  3CPW A;  1UAP A;  1S9F A;  2YZG A;  2I8C A;  5C4J B;  1VCI A;  2ZJT A;  1SJH D;  4DK1 A;  4TV9 F;  5CA1 F;  2RSN A;  3S1Q B;  3A7A B;  3MFY A;  5LP6 F;  2QEX A;  1ICW A;  2B8F A;  4X62 H;  2R61 A;  3A7L A;  4IFD I;  1BVS A;  1VKZ A;  2NU6 B;  3A8K E;  2JA8 H;  3RAQ A;  4PMB A;  1YIJ A;  2KJX A;  1DM0 B;  3MZ5 A;  1HTL D;  3OSP A;  3MAQ A;  3CCM A;  5KNC A;  4IPH A;  1WCM A;  2R87 A;  1T9H A;  1NTG A;  4B3M H;  2NVY A;  2YL2 A;  4B9W A;  5C8Y F;  3M4Y A;  2KHS A;  1TVX A;  1EY8 A;  3QOL A;  3S14 B;  1E4E B;  3U9T A;  3LWE A;  2D0P A;  1H9S A;  1S68 A;  1MZB A;  4MV8 A;  1IZ6 A;  5TSS A;  3BG5 A;  4O2B F;  4O4H F;  1KTK A;  5EPJ A;  2HIV A;  3DWQ A;  1XNQ L;  1QUQ A;  1VQO A;  4F88 A;  3OHB A;  1DOL A;  5ELB A;  1HHV A;  3TQY A;  3MXU A;  1T5X D;  1YJN A;  2QDL A;  4LFC Q;  1YNN C;  2XRQ D;  4Q0F A;  4JCV E;  1JX4 A;  4APM A;  2K4K A;  2K5V A;  2LSS A;  4CKE A;  1F9Q A;  5H1S E;  5FD5 A;  2VQF L;  4YR2 A;  2K50 A;  4QUF A;  3G4S A;  4DV6 H;  3BJY A;  3TQ1 A;  3EVQ A;  4HSV A;  4RWS C;  5D14 A;  2VUM G;  3G6J B;  2B8G A;  1KQS A;  1GUS A;  4DNR B;  4R8U B;  1ESF A;  4A2B A;  1V43 A;  1CZG A;  4KK7 A;  4LF7 Q;  4DR4 Q;  1JB7 A;  5C5M A;  3T53 B;  4IR1 A;  3RB0 A;  5KIX A;  3RV4 A;  3GTJ H;  4ED0 A;  3DHQ A;  3ZJY C;  4UCR A;  3L4J A;  1J5E L;  1E24 A;  4KD4 A;  4A3D G;  3H20 A;  2HD3 A;  2ENB A;  3GIM A;  2YZM A;  3ERS X;  2O5I C;  4C3J H;  1HNW L;  2YU9 H;  2AMC B;  1E3P A;  1PV4 A;  3S2H H;  4YQW A;  3TP8 A;  4IPC A;  1Y8P B;  1KEE A;  1KL9 A;  5IYB H;  1PH8 A;  2IHE A;  2FLP A;  3NTK A;  1IBM L;  1I6U A;  1M7J A;  3MXP A;  2QA4 A;  2E74 C;  1N34 Q;  2RGV A;  4X65 L;  3K5N A;  4X3S A;  1VQH A;  3J80 W;  1KC7 A;  5DAU A;  2KVM A;  4QWD A;  4EQO A;  2NVX A;  3H40 A;  3UDG A;  3HOV H;  3Q1K A;  2MUY A;  4CJ0 B;  1WYD A;  1BQQ T;  2VY3 A;  4X3U A;  1WCM G;  5DGB A;  4L5T A;  1V1O A;  1NBW A;  3ETH A;  2AWN A;  3ERQ A;  4IUP A;  1AE3 A;  1U4P A;  3HOZ H;  3KLS X;  3KF6 A;  3NTI A;  2R7Z A;  2CZG A;  2O4X A;  3K3P A;  3VPC A;  1HZA A;  2A6E D;  3JAM W;  1TS3 A;  4K6D A;  5IT9 W;  1XTD A;  4RFB A;  3GTO H;  2JEJ A;  2AKW B;  1KRT A;  1RF2 D;  4RGT A;  4RG1 A;  1N8R C;  5DQI A;  1JE4 A;  4A93 B;  2EYP A;  4TRD A;  5KFD A;  4HSP A;  4DN4 M;  3IFT A;  3NGD A;  5ELE A;  1EZ8 A;  4H44 C;  3G6E A;  3CC2 A;  5DGA A;  3QO2 A;  1U0L A;  3PO2 B;  1ASY A;  4M1U B;  4LFB Q;  1WCM H;  2V4D A;  1FKA H;  1A3T A;  4DV5 L;  4MV3 A;  1CUK A;  2E5L Q;  1KAA A;  2BE5 C;  3DLL A;  4LFA L;  2F3I A;  2W6Z A;  3G71 A;  1YJ9 A;  3C2P A;  1SCU B;  4GC6 A;  4ED8 A;  3HOY G;  4POF A;  4I7H A;  3VPD A;  3MWY W;  4DV7 L;  1W6J A;  1L2F A;  4APV A;  5M3M B;  2E2H B;  5C4X B;  4ETS A;  4FM9 A;  1PRT D;  2VL6 A;  4P72 A;  5C3W A;  1SYD A;  3SVM A;  5EDW A;  4ZQ3 A;  2GPW A;  2BQR A;  2A19 A;  1S4Z A;  2HJW A;  3GIK A;  4MIU A;  1AE2 A;  2L11 A;  1F2M A;  2V1C C;  4YJ3 F;  3D4D A;  1L0Y B;  2F4V Q;  1LAB A;  4O2A F;  2KQ3 A;  4F50 A;  4JOI A;  5IE8 A;  3CF5 A;  1TWF A;  1Z7T A;  3S17 H;  1JIC A;  5BN5 A;  2UU9 L;  1Z2P X;  4RHR A;  2NVT H;  1K3B C;  5LA6 F;  3KHL A;  4GKJ Q;  2ICE C;  3S1R B;  5L9X A;  3ULP A;  2EYJ A;  3C3L A;  4JW0 A;  3I12 A;  4J9N A;  5JVG 3;  3H4D A;  1VQG A;  2JA6 B;  1WI5 A;  1STN A;  4TSS A;  1U4R A;  1KJI A;  4PG3 A;  2EYH A;  1IBM Q;  2F4V H;  4ECZ A;  3K58 A;  3KOJ A;  2JA5 B;  3MXN A;  1Q8I A;  3PW0 A;  2VS1 A;  5I47 A;  3OSO A;  1I4H A;  1CKN A;  3V05 A;  3M4O B;  1S5E D;  3CCU A;  4Q8F A;  1N32 L;  2YU9 B;  4GZY C;  5HV6 A;  1VQ8 A;  1ET6 A;  4NXN L;  3J7Y W;  4QQB X;  3NSW A;  2CFM A;  4U6P A;  3VR4 A;  4TQU S;  1Y14 B;  1SSO A;  4KY6 A;  3J81 L;  3BZD B;  5LMN Q;  4WD3 A;  3PF5 A;  1XYI A;  1SAP A;  1JDB B;  4RGM A;  3PMF A;  4OWW B;  4BBS H;  1RJT A;  5EKL A;  2FPP B;  1JB3 A;  4ED7 A;  3T1H H;  5EWF A;  1STH A;  1JIH A;  2B63 B;  1E22 A;  2FFK B;  2GPS A;  4ZHQ F;  1IKL A;  4JBK A;  3BDL A;  3K8A A;  4A3C H;  3BA8 A;  1DD2 A;  4DR2 H;  5GAE C;  4JI1 Q;  3CQZ A;  2UXD L;  3H09 A;  1XPU A;  2IWH A;  1YNN D;  4FDB A;  5CV4 A;  3TP7 A;  3MR6 A;  4Y7N B;  3FP9 A;  3OOC A;  1Y1W H;  1EUD B;  1EUC B;  3GTO B;  5DLF A;  1STA A;  3WOF A;  2UXD H;  5ELN A;  1CKM A;  1SMY C;  4MTN A;  5AJ3 L;  2DIK A;  2ZJR A;  2NZ1 D;  1WOC A;  3S1R H;  2W6N A;  5JAV A;  2V4R A;  2J4X A;  4HCE A;  3KAL A;  5HGT A;  5BN3 A;  1QCB D;  5KFQ A;  1CSQ A;  1GUN A;  5IYD G;  1N33 Q;  2HDL A;  1X3E A;  1YI2 A;  1XXG A;  1IOV A;  1PH4 A;  1SDF A;  3OIQ A;  4DV0 Q;  3L0O A;  2JA8 G;  5FLX L;  4NXM Q;  1FGU A;  1EZ6 A;  4ED6 A;  1B53 A;  5FPR A;  1Q46 A;  4ECU A;  1ASZ A;  4LUZ A;  4XT3 B;  4DV7 Q;  2OWO A;  1HNW Q;  2E8G A;  1N32 H;  3T4A C;  3FMA A;  1BNZ A;  4BY1 B;  4DPG A;  1T3N A;  1OO9 B;  5FD6 A;  2W7P A;  3OMG A;  4QY7 A;  4NW2 A;  5IGG A;  4RAY A;  1ZKO A;  1TU2 B;  1X3F A;  2FMC A;  1E2Z A;  4AYB B;  4DA2 A;  4ZI7 F;  4ILW A;  4EQP A;  3OW7 A;  4I7Z C;  1NNX A;  5IGB A;  1LLR D;  3KDF B;  4X62 Q;  3GTP H;  3GQC A;  2G5D A;  1A9X A;  1U4M A;  3RZO H;  1F9P A;  1MJC A;  1G2T A;  4A93 H;  5KG3 A;  4B3T L;  2BDO A;  4XIG S;  1KAW A;  3F2B A;  2RDF A;  2MHV A;  1HFN A;  4EYI B;  3AMU A;  2QGQ A;  2XCA A;  3LWB A;  2F0N A;  2YTV A;  2EIF A;  1J8I A;  2ZTE A;  1SFO H;  3W1B A;  3C46 A;  2QW7 A;  5IYB G;  5E3F A;  2F0O A;  4LUO A;  3AQQ A;  5FKA C;  4R8I A;  1PZI D;  4RNM A;  1IHZ A;  1K83 B;  5KFL A;  3MR2 A;  3GTG A;  3IN5 A;  1SRU A;  4OX9 H;  3U4Z A;  1KXL A;  2CKZ B;  1VAJ A;  1VQC A;  4X3K A;  1CQV A;  3SK8 A;  4GKJ H;  1JC7 A;  4ECY A;  1STG A;  4ECV A;  3P7J A;  1VQE A;  4FXD A;  4LF7 H;  4IJH A;  1KJ9 A;  2DUD A;  5FOB B;  3SK5 A;  5JVL A;  2B39 A;  2UXB Q;  2Q2I A;  2UUA L;  1V4Y A;  4CJ2 C;  1IYV A;  4DR1 L;  4UCT A;  5KFT A;  1LYL A;  3H4B A;  2FMM A;  2Q8R E;  4K5X A;  4IUT A;  3D3R A;  1N34 L;  1X9N A;  5IOC A;  1YEZ A;  2F0S A;  3TRE A;  4HNU A;  2WAQ E;  3K81 C;  2RDH A;  4KHV A;  1UC9 A;  4LF9 L;  2YTX A;  2E2I H;  3TII A;  2N78 A;  4X66 H;  3UDI A;  4O42 A;  1VQ4 A;  3FEW X;  3RLF A;  2BCO A;  4KKS A;  4PV1 C;  3PO3 B;  1A15 A;  2JEG A;  4C3I B;  4KV6 A;  3QZ8 A;  5D1O A;  2WB1 B;  1EOT A;  5KFI A;  5KG7 A;  2PBZ A;  4ALP A;  3T1H Q;  4DK3 C;  2A1A A;  4C5B A;  1AUX A;  4UCS A;  1E0B A;  2RBM A;  4I55 F;  3KHR A;  5BPF A;  3M4O H;  2JA6 A;  1G6Z A;  1TS5 A;  3IAY A;  3UFX B;  1JT8 A;  1NAP A;  5KFP A;  1I94 H;  4YAK B;  1CM9 A;  2R3Z A;  3KJO A;  3PUZ A;  1QJO A;  3GD7 A;  4XT1 B;  3W1G A;  4CKC A;  2IX3 A;  3J7A F;  3M3Y H;  1CSP A;  1HNZ L;  4BA2 I;  1K83 H;  1HXY D;  4L8J A;  1RJQ A;  2B2W C;  3NQI A;  1W2B A;  1BBX C;  4PMW A;  2WB1 A;  3K7A B;  4XYM B;  1A62 A;  3PCO B;  5IOD A;  1I4Q A;  3MC0 B;  2W57 A;  4FBT A;  5I2X A;  2OCE A;  4PDB A;  4QL5 A;  2XGT A;  5F9L A;  4R4C A;  3MJF A;  4NXN H;  4FF4 A;  1NR2 A;  4O2D A;  4M9U A;  4DR5 L;  3U4V A;  3KAJ A;  2VB2 X;  4WJ4 A;  3H3V H;  4JI1 L;  4F4W A;  4RB3 C;  4J9M A;  3H0G G;  3UI2 A;  2F0V A;  2F4V L;  4HYK A;  5JEA J;  5FLM H;  2CQA A;  1VQA A;  3T5H A;  2K5D A;  2ALZ A;  2JEA I;  4RNN A;  1JOR A;  5DG9 A;  2E2I A;  1IW7 D;  2FPI B;  2WKD A;  5EZY F;  2NVT B;  1VS0 A;  1E1T A;  3RBE A;  4NP5 A;  3J7A V;  3DWA A;  5L1K A;  2A68 D;  4BY7 G;  1K0R A;  1SNQ A;  3AB9 A;  5DEH A;  4WOR A;  5CBA E;  1I50 A;  1RTO A;  4MNO A;  4AQY L;  4UPA A;  1I3Q A;  1K9M C;  2CH4 W;  2ZXP A;  1HRJ A;  4MA5 A;  3GV7 B;  5IYZ F;  3M9N B;  2OQK A;  3T51 B;  5HBR B;  5CA0 F;  1QVF A;  3J80 i;  2W70 A;  1IKM A;  2UUC Q;  5IWA L;  3D0F A;  1JE5 A;  2EE1 A;  2F0J A;  1SE4 A;  4M8A A;  5KG5 A;  4YY3 H;  1JCK B;  1LTT D;  4HAE A;  2BOS A;  4OON A;  1PYB A;  2ZM6 H;  2I5H A;  3GTG H;  1JQY D;  2W71 A;  4DR1 H;  2WTF A;  1EIH A;  4JI4 L;  3I4N H;  2CVR A;  4ED2 A;  3V4Z A;  2XGQ A;  5BR8 Q;  2JA5 A;  3KF6 B;  1EY9 A;  3D6W A;  4UP7 A;  2XIG A;  5KKN B;  3KYH C;  3N6X A;  4ZCK A;  2M9V A;  2RSO A;  4K14 A;  2BQ3 A;  1YHQ A;  4XQJ A;  4DNI A;  4H7B A;  4XQQ A;  2B63 H;  3IFD A;  3I3C A;  5E1F A;  4GOP B;  5IYC H;  5FJ8 G;  3M9O B;  1U5K A;  1I4P A;  1Y1W G;  5D1P A;  4YWL A;  1C3O A;  4LF9 Q;  4NPS A;  3JAM L;  3U9S A;  4DK6 C;  1TWC H;  3DUZ A;  4FP5 D;  1S5C D;  5C3E H;  3I91 A;  1Q86 C;  3J7A 5;  4A3B H;  1C30 A;  1BUV T;  5JOB A;  4AIM A;  2MO1 A;  1ZQ7 A;  2K03 A;  3VA7 A;  5C5J A;  3URY A;  4JI3 H;  4CKB A;  4MV9 A;  1QVC A;  4OEL B;  3ORR A;  4GC7 A;  4DV3 L;  4TQR A;  4LFA H;  1IOW A;  3GTL A;  1PTO D;  4OIJ A;  2YS7 A;  4RKL A;  1J5E Q;  3PUY A;  1DV2 A;  1FNV A;  1B70 B;  1HA5 A;  3UE0 A;  5C1P A;  4RUA A;  4RZR A;  1ENA A;  5A2Q W;  1ZHQ A;  3GTL H;  1EZ1 A;  3CXC A;  5IP9 G;  4OO1 G;  4EBC A;  5IY0 A;  1H9J A;  3OW2 A;  2B63 G;  3T16 A;  3RZD H;  2ZDQ A;  1B04 A;  2F0F A;  2M2L A;  2IMW P;  3TS0 A;  1CFM A;  2A6H D;  1XNR L;  3D4R A;  1EQQ A;  1KDB A;  2KHJ A;  3PIP A;  1SEB D;  3ULL A;  3LP8 A;  1TXY A;  2J7Z A;  2AGO A;  2O2L D;  2X0S A;  3I8Z A;  4IRK A;  1O75 A;  1F2Z A;  5LL6 b;  2E75 C;  3OYY A;  4P75 A;  5EQ0 A;  4MAM A;  3QB3 A;  1Z2O X;  5C4J H;  2SEB D;  5M3M G;  1PH5 A;  2AGP A;  2CW8 A;  5H80 A;  2X6L A;  1SR3 A;  2R7K A;  1JJC B;  3KLR A;  1JWS D;  5C3X A;  4LF4 Q;  2AU0 A;  4F4X A;  5KFB A;  2GVA A;  3HOX H;  2R82 A;  5COR A;  3ICE A;  5JVD F;  3JAM c;  3K7U C;  1KLU D;  3RBD A;  1WVL A;  1FJG H;  3BG3 A;  2O5J C;  2Q2H A;  2OF1 A;  4DU9 A;  1U9R A;  2ICI A;  2I87 A;  3SDZ A;  5DNF A;  2JA8 B;  1ULZ A;  2L15 A;  3NQT A;  5KG1 A;  2AQ2 B;  2FK2 A;  2L4N A;  4H0L C;  4YP3 A;  1Q81 C;  5FLX W;  2DLN A;  4DR7 L;  3UQ8 A;  1I3Q B;  1DCZ A;  2I5L X;  1LV9 A;  4BBR B;  2KCM A;  1GSH A;  4LH7 A;  2B2Y A;  1OXS C;  1IBK L;  2EYM A;  2C2R A;  1M1K C;  2FPG B;  1LT4 D;  4Q5V A;  4ZKC B;  3FRP B;  5FK9 C;  3QZ7 A;  1YHB A;  3G48 A;  5C4Z A;  1C0A A;  3T5J A;  2YV5 A;  4LUV A;  3CAM A;  2MNA A;  3VMM A;  3OMC A;  1K3R A;  1F77 A;  5EJW A;  1QZG A;  4BY7 H;  4BY1 G;  2MFI A;  2BR0 A;  1CI3 M;  1Y1V G;  3NWT A;  5L37 A;  2UU9 H;  3DEP A;  2R85 A;  4JYA H;  3FVQ A;  2UXD Q;  1HZ9 A;  5KFN A;  2K01 A;  2IY5 B;  5L1L A;  4DV1 H;  5GAH C;  2F0K A;  1X55 A;  3H15 A;  5KFO A;  2VZA A;  1EEI D;  4DL3 A;  2KA7 A;  3EQL C;  4UP9 A;  5FO8 B;  4MV6 A;  5CV6 A;  5KNB A;  3EBE A;  3D31 A;  2E2J H;  2NTT A;  4MV4 A;  4JK1 C;  1YJW A;  1E4G T;  2F0P A;  2V59 A;  2RQX A;  2J9G A;  3MVV A;  4CJ1 B;  3VYS A;  4LFB L;  1L1O B;  1HPC A;  5C44 H;  5IWA Q;  2W9B B;  1Z9F A;  4LF6 L;  3VYT A;  2R7L A;  5EPK A;  3UE1 A;  2K05 A;  1PK8 A;  1WH2 A;  1PFN A;  1EWI A;  1CK1 A;  3E0J A;  4ECW A;  4FVM A;  3S14 H;  3OTO H;  4F8M A;  3T1Y H;  1LT5 D;  4A3D B;  1I6H H;  3P20 A;  3PQI A;  3Q0A A;  4DFA A;  1VQK A;  2FK1 A;  2JA9 A;  2AQ3 B;  2F4I A;  1FGB D;  4XZ3 B;  2DWC A;  4XQN A;  4OWX B;  4A3I G;  4L5S A;  3IRB A;  3S16 H;  3I70 A;  1RK6 A;  4MV7 A;  5CB4 F;  3VDY A;  2CW0 D;  4Q0Y A;  4R1J A;  3H0G H;  2UUB L;  4DV7 H;  3L9A X;  4FF1 A;  4MTE A;  5KFF A;  1NMG A;  4RA8 A;  4ED1 A;  4YB8 B;  1E2V A;  3EIV A;  2LS0 1;  4KKT A;  4KD3 A;  1AZP A;  1AN8 A;  3W2D A;  3NWS A;  2VW9 A;  4IQZ A;  3D6C A;  2I80 A;  1RTN A;  4R4Q A;  5E7N A;  5LL6 X;  2NWG A;  1K73 C;  1QUQ B;  2A73 B;  4NDX A;  1R9T H;  2HVR A;  3C1E A;  1WTX A;  2CQO A;  4FF3 A;  1HA6 A;  1W6K A;  1GD7 A;  3NEL A;  3TP6 A;  4QWE A;  4B3S L;  3HOU G;  3GIJ A;  1OTC A;  4KTA A;  1CHP D;  5JQW A;  2WAQ B;  4GNX A;  1EWC A;  1QVG A;  3I4M G;  4AYB A;  3I4M H;  4A3I H;  1Y1V A;  2CW7 A;  2K7V A;  2UUB Q;  2DJG C;  3GTL B;  1FVI A;  1T5E A;  1PH6 A;  2JA6 G;  5IT9 E;  2EQS A;  4A3E G;  2PO4 A;  3KLS A;  5C6A A;  4PZ6 A;  1CZW A;  3CQZ H;  4UCO A;  4JI6 H;  3K0X A;  3JRW A;  5EWG A;  5GAG C;  1V1P B;  5CBE E;  4LSA A;  4EX5 A;  2JA5 H;  3RTX A;  2CCZ A;  2VQD A;  1D2B A;  2VUM B;  3ZYY X;  1BXR A;  5DLG A;  1FL0 A;  3NTH A;  3SEB A;  1F9S A;  2VB3 X;  2FLL A;  4M7E A;  2PMZ A;  2PYK A;  3RF2 A;  4QW8 A;  4K5W A;  4A76 A;  4G7Z C;  2DNE A;  3BAB A;  3E6Z X;  2W9B A;  2I07 B;  5M3F G;  3CHB D;  4IUQ A;  5IT9 L;  3EA6 A;  3H0G B;  5EKK A;  2AUJ D;  4A3K H;  5IYD H;  4HJ5 A;  3HKZ B;  1TWG A;  1BBU A;  1DXM A;  2B2V C;  1HNW H;  1PYW D;  2KOL A;  1TT2 A;  3BDC A;  2Z6B A;  1ET9 A;  4B3M Q;  3SK6 A;  4LFC H;  1YNX A;  3J7A K;  3T1H L;  1IBL H;  3GTK B;  5KX5 F;  3PUV A;  5DM6 3;  1STY A;  2Z4I A;  2YRX A;  1Q7Y C;  1TQO A;  3GTP B;  2WV6 D;  4L1K A;  4DUZ H;  2XGP A;  1AN7 A;  3BA9 A;  3P75 A;  4U7C A;  4Q45 A;  1NSN S;  2ZXR A;  3DXJ C;  5JEA H;  4J8Q A;  1L1O A;  3TME A;  5K5P A;  4A3L H;  4X66 Q;  2AWO A;  1HNZ Q;  1K1S A;  1WCM B;  2A6H C;  3HS0 C;  5CMD A;  4ZUJ A;  1HTP A;  3HRZ C;  5AJ3 Q;  2HT1 A;  4J0M A;  4LF4 H;  4KJN A;  1HZB A;  5KFG A;  1WJJ A;  1EYG A;  3V6H A;  4IFD J;  1T94 A;  5CR3 A;  1JJG A;  2WAQ G;  2K5H A;  4DL5 A;  3BZK A;  4NB3 A;  3T13 A;  3PIO 3;  4LAA A;  1KDC A;  1G29 1;  2R93 A;  4N9T A;  3QWN A;  1PYS B;  3KDF A;  5GAD C;  1AW7 A;  3WO1 A;  1F9R A;  2E2D C;  2VUM H;  3A74 A;  1HNX L;  2Q8T A;  1V51 A;  3DM1 A;  3FMC A;  1V8Q A;  4DV1 L;  3JSN A;  1FD7 D;  1RCV D;  3MWE A;  3F8T A;  2DZD A;  1C9O A;  4YAJ B;  4XX0 B;  3NUC A;  5KFU A;  1DOM A;  3G7L A;  1EQT A;  1B50 A;  1F2L A;  2PCF B;  3M9B A;  4GS3 A;  3S17 B;  5C0X I;  1XPO A;  1XNQ H;  1SXT A;  2D9U A;  2EPB A;  1P16 A;  1D7Q A;  2FE3 A;  5J3B A;  1D8L A;  1E2W A;  4CDD C;  3CCE A;  4HJ8 A;  2IJ0 A;  1IXR A;  3TRZ A;  4C1N K;  1GSA A;  4QIW B;  3Q2O A;  3PO2 G;  3CCL A;  3BS1 A;  4CC6 A;  2DJF C;  2QDB A;  1RHP A;  3KF8 A;  4IPD A;  4DV5 H;  2AHO B;  1GM5 A;  4DAV A;  1WD1 A;  3AYH B;  1SMY D;  5A2Q L;  2UXB L;  2L0C A;  1BNC A;  3TZU A;  3Q24 A;  2VPQ A;  2VXW A;  1KJ8 A;  2HIX A;  4A3D H;  2HHH Q;  3HG9 A;  3RJ0 A;  4LJZ C;  2AQ1 B;  3FDT A;  3MXN B;  4HID A;  1PX2 A;  5DG8 A;  4JV2 A;  1TS2 A;  1IBL L;  3OWE B;  4QIW A;  4GLV B;  3G6X A;  2PW5 A;  3WDN A;  3CCR A;  3HOW G;  3NEM A;  3S1M H;  2R86 A;  2J6T A;  1M8A A;  1HUN A;  3CC7 A;  4GNX C;  2UVW A;  5EOY A;  4JVZ A;  1HH2 P;  1WTW A;  2R92 A;  4MN3 A;  1TY0 A;  4DXG A;  2WDT A;  1PRT F;  3N41 B;  1BXT A;  4HJ9 A;  5KFH A;  2FJZ A;  1Q3L A;  4KI0 A;  2R7Z G;  4GOP A;  3ITP A;  2PMZ B;  3MA2 B;  5DG7 A;  3SHL A;  3JSL A;  1BGW A;  5IP7 G;  5T14 A;  1N48 A;  4G4K A;  4BXX G;  4WFN 3;  3PW5 A;  3GV3 A;  2JSO A;  4JI6 L;  4B3T Q;  1VQ6 A;  3GLK A;  2P0A A;  3K0Y A;  3A8J E;  3TBI B;  2E2H A;  1MBY A;  1A2T A;  1OXV A;  1HR0 H;  2B3G A;  4PWQ A;  4IPG A;  1M4V A;  2UU9 Q;  3N44 B;  4JOI C;  1S5D D;  3R2T A;  2JQO A;  5D65 A;  1KIX A;  2YTY A;  1PRT B;  2X69 A;  2B2U A;  2Z8L A;  5KFA A;  1J9O A;  1Y1V B;  3K5I A;  2FK3 A;  3HGB A;  2IHF A;  2EJG C;  3TS2 A;  5KYL A;  3T1Y L;  3RN2 A;  3OTO L;  5E4W C;  3T5K A;  3JC6 6;  5G3L D;  2XTI A;  5D1O B;  4LF8 L;  3GTM H;  3H3V I;  5LMN H;  1RYR A;  1S0M A;  1K8M A;  1NR4 A;  2BA0 A;  5IT9 c;  1W3S A;  3RZO B;  1RL2 A;  1CS0 A;  1W96 A;  1XMO L;  1I4G A;  1GVP A; 
#chains in the Genus database with same CATH homology
 5FLM H;  1VQA A;  1P8L A;  1TWH H;  1K8G A;  1VQJ A;  2JEA I;  4C3H H;  1EUJ A;  3J81 c;  2ZJQ A;  2Q2U A;  1Q12 A;  3STB D;  1VQ7 A;  1VS0 A;  1E1T A;  4IJL A;  3L7Z C;  3M4Q A;  4OO1 I;  3HFZ B;  5IP9 H;  3RNU A;  4BY7 G;  4A75 A;  1K0R A;  4DR1 Q;  3PO3 H;  4GOP C;  1N33 L;  1HZC A;  4MNO A;  4AQY L;  4YWM A;  4X6A H;  4UPA A;  1K9M C;  2UXC L;  1K8A C;  5FLX c;  2PQA A;  1TWG H;  2OQK A;  2VQE Q;  1VQM A;  2ZTC A;  1QVF A;  1TWA H;  2ATW A;  3J80 i;  3KFU A;  2D62 A;  2NZO A;  2UUC Q;  5IWA L;  3J81 i;  3D0F A;  2WFW A;  2PMZ E;  1JE5 A;  1VQB A;  3CW2 C;  1V9P A;  2GN5 A;  2K52 A;  4H02 A;  4QJF A;  5LMN L;  2N8N A;  1X54 A;  1OXU A;  5BR8 L;  3U58 A;  1LM0 A;  2E2H H;  5M3M H;  2RHQ B;  5HY6 A;  3AFP A;  4DV1 Q;  4OON A;  1PYB A;  3U50 C;  1UE6 A;  2I5H A;  4NXN Q;  2NN6 I;  3GTG H;  4X64 Q;  3DM3 A;  3KF8 B;  3HOY H;  3STB C;  4JI4 L;  3I4N H;  4A3C G;  3AEV A;  2OTJ A;  2R92 G;  5BR8 Q;  1L1O C;  4X62 L;  3KF6 B;  3I4O A;  4UP7 A;  5ELO A;  3E9H A;  4DV5 Q;  1AH9 A;  3KYH C;  2N49 A;  1YHQ A;  3UDF A;  4DNI A;  4DUY L;  4DV4 Q;  2B63 H;  3K80 C;  1HR0 L;  2KEN A;  1RIP A;  4TVA B;  3HOV G;  4GOP B;  5IYC H;  4R4I A;  5FJ8 G;  3CPW A;  1U5K A;  1Y1W G;  1EIF A;  2YYZ A;  1VCI A;  4YWL A;  4NPS A;  4DAM A;  2NN6 G;  4LF9 Q;  4AQY Q;  3HOU H;  4DK6 C;  1QZH A;  1TWC H;  5C3E H;  1X65 A;  1Q86 C;  3J7A 5;  3PF4 A;  4A3B H;  1H95 A;  3M85 A;  4HIM A;  1PH1 A;  4AIM A;  2Z0S A;  4A3B G;  2MO1 A;  4UY8 C;  1O7I A;  1G6P A;  2QEX A;  2MQH A;  1QVC A;  4BBR H;  4IOC A;  2I5M X;  4DV3 L;  1BVS A;  1MJE A;  4Y7N H;  2R7D A;  4IFD I;  4P74 A;  1VQP A;  2JA8 H;  4A3G G;  4DR2 L;  1YIJ A;  1J5E Q;  3NEN A;  3PUY A;  3PO2 H;  1B70 B;  3UE0 A;  3CCM A;  1PHJ A;  1FJG L;  4IPH A;  3GTL H;  1T9H A;  1NTG A;  4AYB E;  5IP9 G;  3CXC A;  3S2D H;  3OTO Q;  4OO1 G;  5IY0 A;  3OW2 A;  2B63 G;  1IBL Q;  4QIW E;  4DR4 L;  2JK8 A;  3RZD H;  3TS0 A;  2HHH L;  2ES2 A;  1XNR L;  2PQA B;  3M4P A;  5M5W H;  1EQQ A;  2KHJ A;  1I50 H;  3PIP A;  2ZTD A;  3ULL A;  2D0P A;  1TXY A;  1Y1V H;  4J15 A;  1IZ6 A;  4KLK A;  2E5L L;  2HIV A;  1XNQ L;  1QUQ A;  3A5Z B;  4GN4 B;  1VQO A;  3OYY A;  4P75 A;  4JI3 L;  3TQY A;  3FKI G;  4OXP A;  5M3M G;  5C4J H;  3PGZ A;  1YJN A;  1PH5 A;  4LFC Q;  1EIY B;  1SR3 A;  3BJU A;  4JCV E;  2R92 H;  1JJC B;  4K0K Q;  1M90 C;  2K4K A;  4A4I A;  4LF4 Q;  3I4N G;  2GVA A;  2K5V A;  2LSS A;  3HOX H;  4JI3 Q;  3ICE A;  5H1S E;  3JAM c;  1MKH A;  3K7U C;  1NY4 A;  4A3E H;  4AYB G;  2VQF Q;  2VQF L;  1UE7 A;  1VQD A;  2K50 A;  3RLO A;  3G4S A;  4A3M H;  1PH7 A;  2PNH A;  2VUM G;  2Q2H A;  1OXT A;  2LXJ A;  4JI6 Q;  1KQS A;  3CC4 A;  2K5N A;  2L15 A;  1EOV A;  3GTQ H;  1N32 Q;  1BBW A;  1V43 A;  4P73 A;  3B6Y A;  4LF7 Q;  1Q81 C;  1JB7 A;  4DR4 Q;  4GKJ L;  2KBN A;  4JI7 L;  4MZ9 A;  4DR7 L;  1E7Z A;  5M3F H;  4A3L G;  4A93 G;  2IT1 A;  4BXX H;  2I5L X;  1PA6 A;  3GTJ H;  4A3F G;  2KCM A;  3ZJY C;  1I3Q H;  2WB1 E;  1E24 A;  1J5E L;  4A3D G;  1OXS C;  1IBK L;  3HKZ E;  4DR3 Q;  1M1K C;  5JJK A;  3ERS X;  4C3J H;  4YHH L;  1HNW L;  4DV3 Q;  2YU9 H;  2AMC B;  1E3P A;  1UE5 A;  2DGY A;  1L0W A;  2ZJP A;  3BU2 A;  3I7F A;  5LMU L;  1PV4 A;  1YHB A;  3G48 A;  4IPC A;  3S2H H;  1C0A A;  1KL9 A;  5IYB H;  1PH8 A;  2IHE A;  2EXD A;  2YV5 A;  1IBM L;  3L2P A;  4DR5 Q;  2QA4 A;  1NJI C;  2RHS B;  1YVC A;  4X65 L;  1N34 Q;  5GRO A;  4LUV A;  3CAM A;  2MNA A;  4GNX B;  4JI0 L;  1VQH A;  1K3R A;  1QZG A;  4BY7 H;  2H5X A;  3T1Y Q;  4BY1 G;  2MFI A;  1HR0 W;  2FXQ A;  4QGU A;  3UDG A;  1SE8 A;  3HOV H;  4XTC S;  3Q8D A;  1Y1V G;  5M5X H;  1WYD A;  3ULJ A;  1IBK Q;  3WWV A;  2IX1 A;  1NE3 A;  4JBJ A;  5JEA G;  2VNU D;  2VY3 A;  2LXK A;  3EN2 A;  1WCM G;  4L5T A;  2ALY B;  1NBW A;  1HZ9 A;  2UXD Q;  4JI8 Q;  1I5F A;  2AWN A;  3I2Z A;  1HJP A;  2IY5 B;  1SRO A;  1AE3 A;  3HOZ H;  1EQR A;  3KF6 A;  3LGJ A;  5GAH C;  3HKZ G;  1XMQ L;  1X55 A;  3H15 A;  1X3G A;  1CKN B;  2VZA A;  4UP9 A;  1HZA A;  3HOW H;  1PH3 A;  2WB1 G;  3EBE A;  1XTD A;  1KHI A;  3D31 A;  4A3F H;  2E2J H;  2NVX H;  4LWC A;  2JJQ A;  1YJW A;  3GTO H;  2AKW B;  1KRT A;  1SMX A;  1S3O A;  4RG1 A;  1N8R C;  2RCN A;  1PVO A;  1KC8 C;  4B3R L;  4IOA A;  4JYA Q;  5M5Y H;  4LFB L;  4LF5 L;  1L1O B;  5C44 H;  5IWA Q;  1VQL A;  2ASB A;  1Z9F A;  4WJ3 M;  4K0K L;  4LF6 L;  2KCT A;  4UP8 A;  3G6E A;  1PH2 A;  3CC2 A;  1U0L A;  3J81 j;  1XNR Q;  3HKS A;  4DV4 L;  1GO3 E;  3UE1 A;  1ASY A;  4JYA L;  1EWI A;  1WCM H;  2CWP A;  4HIK A;  1UEB A;  2Y0S E;  3S14 H;  4LFB Q;  4DV5 L;  1I6H H;  1CUK A;  2PI2 E;  2RF4 A;  2BH8 A;  4AH6 A;  2E5L Q;  4JI7 Q;  1VQK A;  5C3E G;  2JA9 A;  3DLL A;  4LFA L;  1J6Q A;  2F3I A;  4A3I G;  4OWX B;  3G71 A;  1YJ9 A;  3IRB A;  1PFS A;  2VQE L;  1VQ9 A;  4L5S A;  3S16 H;  1N36 L;  4L5R C;  3VDY A;  4Y52 H;  1KD1 C;  4R1J A;  1E1O A;  3HOY G;  2MO0 A;  4POF A;  3H0G H;  2UUB L;  4DV7 L;  1L2F A;  3UDX A;  4APV A;  1NMG A;  5C4X H;  1B8A A;  2VL6 A;  4P72 A;  3EIV A;  4O0A A;  4NXM L;  1GKH A;  1IL2 A;  3J80 c;  2A19 A;  2VW9 A;  4DV6 L;  4B3S Q;  4X66 L;  4R4Q A;  5E7N A;  1AE2 A;  3S1Q H;  2Z6K C;  1K73 C;  2V1C C;  4RMF A;  1QUQ B;  3CD6 A;  2JE6 I;  4HJ7 A;  1R9T H;  2F4V Q;  3A0J A;  2UUA Q;  2CQO A;  4P71 A;  1GD7 A;  3NEL A;  4JOI A;  5IE8 A;  3CF5 A;  4DV6 Q;  4B3S L;  4X65 Q;  3HOU G;  1OTC A;  4YY3 Q;  1UWV A;  2ID0 A;  3S17 H;  1XJV A;  2UU9 L;  2R93 H;  4GNX A;  3PV0 A;  3CP0 A;  2GVB A;  1QVG A;  2NVT H;  1PH9 A;  4DR2 Q;  3I4M G;  3I4M H;  4A3I H;  4GKJ Q;  2K75 A;  3ULP A;  2UUB Q;  1JJ2 A;  1FVI A;  1PH6 A;  2JA6 G;  2JA6 H;  2BH2 A;  4IFD G;  2EQS A;  3FKI H;  1HR0 Q;  1VQG A;  4A3E G;  1A0I A;  1WI5 A;  1YZ6 A;  4PZ6 A;  4PG3 A;  1IBM Q;  4GN5 A;  4BA1 I;  3CQZ H;  2D0O A;  3K0X A;  1Q82 C;  3HOX G;  3KOJ A;  2VS1 A;  5GAG C;  4PZ7 A;  4GKK Q;  4KHP Q;  1CKN A;  4EX5 A;  3CCU A;  2JA5 H;  1N32 L;  4KHZ A;  1Q8K A;  2CCZ A;  3CCQ A;  2JA5 G;  3CMA A;  1N36 Q;  1VQ8 A;  1S72 A;  4NXN L;  4LF6 Q;  4QQB X;  2CFM A;  3CCS A;  4DUY Q;  1FL0 A;  2A8V A;  4TQU S;  1Y14 B;  2R7Z H;  5LMN Q;  3I55 A;  4HJA A;  2Z6K A;  4DV2 Q;  3PF5 A;  3A5U A;  4DV2 L;  1VQI A;  3CPF A;  4A76 A;  2R93 G;  4JC0 A;  4LF7 L;  4BBS H;  4OWW B;  5EAY A;  5M3F G;  4OX9 L;  3PUW A;  4LF4 L;  2R7F A;  4BBS G;  2JA7 G;  3F2D A;  4A3K H;  4R4T A;  5IYD H;  3F2C A;  4HJ5 A;  3AFQ A;  1BBU A;  3RR5 A;  4LF5 Q;  1JJG A;  1E22 A;  4A3K G;  4JBK A;  4A3C H;  3K8A A;  4JI2 Q;  3GTK H;  3BZC A;  4B3M Q;  5GAE C;  4JI1 Q;  2NVQ H;  1YNX A;  3T1H L;  2UXD L;  1XPU A;  3PUV A;  4FDB A;  4IO9 A;  1Q7Y C;  1Q1E A;  3ER0 A;  3SGI A;  4GLX A;  3FP9 A;  1Y1W H;  2UXC Q;  3PUX A;  1VQF A;  1G51 A;  1CKM A;  3GDE A;  5ELN A;  4MTN A;  4DR6 L;  5AJ3 L;  1A8V A;  1L1O A;  2ZJR A;  4A3L H;  4X66 Q;  2NZH A;  1WOC A;  2AWO A;  1NMF A;  2WP8 J;  4C2M H;  3S1R H;  1HNZ Q;  2JA7 H;  5AJ3 Q;  2HT1 A;  2N3S A;  1HZB A;  1CSQ A;  5IYD G;  1N33 Q;  4JI2 L;  1WJJ A;  1EYG A;  1DGS A;  1X3E A;  1YI2 A;  4JI0 Q;  4IFD J;  3E0E A;  4GN3 B;  1PH4 A;  1X56 A;  3K7A H;  4DV0 Q;  1FJG Q;  3L0O A;  4DUZ Q;  2WAQ G;  3J7Z C;  2K5H A;  2JA8 G;  4A3G H;  3BZK A;  4NB3 A;  5FLM G;  4NXM Q;  1Q1B A;  4YWK A;  1FGU A;  1G29 1;  2ZM6 L;  4OX9 Q;  4JBW A;  1XPR A;  1Q46 A;  1PYS B;  1SN8 A;  1ASZ A;  4LUZ A;  3KDF A;  5GAD C;  4DV7 Q;  1WFQ A;  1TWF H;  2E8G A;  4YHH Q;  2OWO A;  1HNW Q;  2VUM H;  3A74 A;  1HNX L;  5C44 G;  5GQO A;  4DPG A;  1XMO Q;  2C35 B;  4POG A;  1OXX K;  4YCV A;  4QY7 A;  4DV1 L;  1X3F A;  2BA1 A;  1VQN A;  4LF8 Q;  4ME3 A;  3F8T A;  1C9O A;  3GTP H;  3KDF B;  3RLN A;  2B29 A;  4LW1 A;  4X62 Q;  3RZO H;  3M9B A;  4GS3 A;  1MJC A;  5C0X I;  1XPO A;  4A93 H;  2F52 A;  5JJI A;  4X64 L;  1P16 A;  1LUZ A;  1D7Q A;  4B3T L;  5J3B A;  1D8L A;  2HQL A;  1KAW A;  4XIG S;  3PIO A;  3F2B A;  5LMN W;  1X6O A;  3CCE A;  4JV5 Q;  4HJ8 A;  5DLQ E;  1IXR A;  3TRZ A;  2QGQ A;  2YTV A;  2EIF A;  3GO5 A;  2PI2 A;  1Z47 A;  2ZTE A;  1SFO H;  4A3M G;  3W1B A;  3PO2 G;  5IYB G;  1MIU A;  3CCL A;  4JI5 L;  4LUO A;  3AQQ A;  5JJL A;  4LFC L;  2K14 A;  4IPD A;  2AHO B;  1GM5 A;  1XMQ Q;  1SRU A;  3M7N A;  3AYH B;  4L5Q A;  3U4Z A;  2CKZ B;  1HNX Q;  2UXB L;  1KXL A;  3JAM i;  1VQC A;  4R4O A;  4JI8 L;  4EQ5 A;  4JBM A;  2ZM6 Q;  2UUC L;  2NVY H;  1YIT A;  3S1N H;  4A3J H;  3E9I A;  1YBY A;  3FHW A;  1VQE A;  1KRS A;  5C0X J;  2HIX A;  4IJH A;  4HIO A;  1I94 Q;  1UE1 A;  2HHH Q;  4DV0 L;  2DUD A;  1CKO A;  3W5O A;  4A3D H;  3HOZ G;  3MXN B;  3S24 A;  4HID A;  2UXB Q;  2Q2I A;  1IBL L;  3KLW A;  2UUA L;  4GLV B;  4DR1 L;  4DKA C;  3CCR A;  3HOW G;  1LYL A;  5C4X G;  4DR3 L;  3NEM A;  3S1M H;  1N34 L;  4YCU A;  3I56 A;  1X9N A;  1I94 L;  1C7Y A;  4OWT B;  3S15 H;  1YEZ A;  3TRE A;  3CC7 A;  4JI5 Q;  3RN5 A;  4GNX C;  2WAQ E;  3K81 C;  4BY1 H;  1BKB A;  1HH2 P;  4LF9 L;  1VQ5 A;  2YTX A;  2E2I H;  4B3M L;  1N9W A;  2N78 A;  3UDI A;  2Y0S G;  4JG2 A;  3KJP A;  1VQ4 A;  3RLF A;  4JV5 L;  3TEH B;  4HJ9 A;  1S40 A;  1LTL A;  2R6G A;  4GLA C;  3NBH B;  3F1Z A;  2I0Q A;  4KI0 A;  2R7Z G;  4DR7 Q;  4GOP A;  4ALP A;  3PSI A;  4LFA Q;  4A3J G;  3T1H Q;  4DK3 C;  2KHI A;  2A1A A;  4B3R Q;  4PZ8 A;  5IP7 G;  2IX0 A;  5C0X G;  3CCJ A;  5IP7 H;  4BXX G;  1V1Q A;  3M4O H;  2OQ0 A;  4JI6 L;  4B3T Q;  1YHA A;  4YCW A;  3CCV A;  1VQ6 A;  2OTL A;  1JT8 A;  2JEB I;  5K36 G;  2Q2T A;  5HGQ A;  3KJO A;  1A63 A;  3PUZ A;  3GD7 A;  1EFW A;  1OXV A;  3W1G A;  3M3Y H;  2B3G A;  4DAY B;  4IPG A;  1CSP A;  2CWA A;  1HNZ L;  4JI4 Q;  1K83 H;  4BA2 I;  2UU9 Q;  4JOI C;  1W2B A;  1KIX A;  3PO3 G;  2JQO A;  4DUZ L;  2YTY A;  1JMC A;  4PMW A;  4DR6 Q;  4LNQ A;  5FJ8 H;  5IYC G;  1A62 A;  3PCO B;  1XNQ Q;  2OCE A;  2IHF A;  1SLJ A;  4QL5 A;  2XGT A;  4GKK L;  4KHP L;  3TS2 A;  3T1Y L;  4R4C A;  3CME A;  3OTO L;  3RN2 A;  3JC6 6;  2XTI A;  4O2D A;  4LF8 L;  4DR5 L;  3U4V A;  1IYJ B;  4BBR G;  4YY3 L;  3GTM H;  3H3V I;  3MEF A;  3H3V H;  1B7Y B;  4JI1 L;  4WJ4 A;  2BA0 A;  3H0G G;  4C3I H;  5IT9 c;  1W3S A;  1RL2 A;  5LMU Q;  1XMO L;  2F4V L;  1GVP A;  5JEA J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...