4A3FG

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid and soaked with ampcpp
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 28
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3fG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3fG01
4DV0L 1I3QH 1HNZL 1SE8A 3RNUA 5GAEC 1JJCB 4JCVE 1YHBA 2HHHQ 4DK6C 4LUZA 3UE1A 1IZ6A 4P71A 4NPSA 2QEXA 4DV7Q 1PH9A 3CP0A 1YEZA 1NBWA 2JA7H 4DR7Q 1S40A 2UXDQ 3OYYA 1G6PA 4B3MQ 1GKHA 2NVQH 2ALYB 1MIUA 2JA6H 1SROA 1VQ4A 1EFWA 3AFQA 2JA5G 1K83H 2MO1A 4GN5A 3GTMH 1VQIA 4QIWE 1OXSC 3F2CA 4DV5L 5IP9G 4LFBL 2WB1E 4DV3Q 3I4MG 1SMXA 3CQZH 4KLKA 2EQSA 4LFAQ 5C0XJ 3STBC 4LF6L 1IYJB 5IYBH 1NMFA 1X54A 2NZOA 4DR6Q 3S2HH 5C4JH 4NXNL 1K9MC 1JB7A 5IE8A 3G6EA 3JAMc 4IO9A 3HOXG 5IYDH 4A3KG 1KHIA 3WWVA 3HOVG 2K50A 3J81j 4LF9Q 1QVFA 2AHOB 4A3DH 5AJ3Q 3FKIH 4JI2Q 1YNXA 4A3MH 4BY7H 4YHHL 2EXDA 4BBRG 1GO3E 1E1TA 1KRTA 4DUYQ 2AWNA 2Q2TA 4LNQA 4JI5L 4B3SL 3J80c 4YCVA 3I2ZA 3PO2H 2LSSA 4QGUA 2K5NA 1HNWQ 4HIDA 3T1YQ 1C7YA 3K0XA 4RG1A 1EIFA 1SLJA 1H95A 1I5FA 4JG2A 1E24A 3A0JA 1A8VA 3KJOA 1CKNB 1S3OA 4C3IH 1YITA 4X65Q 2D62A 1QZGA 2Z0SA 1Q81C 1I6HH 4B3TL 1VQCA 2R93G 2BA1A 1L1OC 1X55A 3TRZA 3T1HL 2RHSB 4OX9Q 4DR4L 2PQAB 1DGSA 3E0EA 2F52A 3CAMA 1NJIC 2NN6I 1VQBA 4JI6Q 4R4TA 3U50C 5JEAJ 1RIPA 4DUZQ 2N78A 2R7DA 1VQ5A 3AQQA 1VQAA 5C44G 1XPUA 1N32Q 1VQLA 1YVCA 1IBLL 5GAHC 4BBSH 1D7QA 2HHHL 1Z9FA 4AIMA 4MTNA 2ZTEA 4P74A 3H0GG 4JI0L 2K5VA 3D31A 1IBKQ 1O7IA 5HY6A 5C3EH 4A3EH 1N34Q 3ULPA 3NELA 1L1OA 1E7ZA 2L15A 2OQ0A 1VQHA 5LMUQ 4DR7L 2UXDL 1NMGA 3BZCA 1KRSA 1VQPA 4PMWA 1K8AC 1Y1VH 1EYGA 3CCVA 1XMQL 4Y7NH 2I0QA 4PZ6A 1VQKA 1L2FA 5M3MG 4LF4Q 1CSPA 4LUVA 3CCLA 4DV3L 1JMCA 2Y0SE 3TQYA 2UUAQ 4TVAB 4A4IA 1LTLA 1Q46A 2K14A 5C4XH 1VQOA 1J5EL 4GNXB 2Q2UA 2KCTA 2BH2A 4DR6L 1OXVA 2JK8A 1VS0A 3RR5A 4AYBG 1V9PA 3BU2A 4DPGA 5LMNW 2R92H 4B3RQ 4LF9L 2QA4A 1R9TH 3G48A 3ICEA 4JI2L 5GQOA 1KAWA 1Z47A 1PH1A 3UE0A 4QY7A 1XNQQ 4L5RC 2JA8G 4JI4L 1Y1WH 2WP8J 5FLXc 3S24A 4DUYL 1HR0W 1B8AA 1I94Q 3HOZH 1OXUA 2MO0A 4GOPC 4GN4B 4IPHA 3BJUA 2IHEA 3CCRA 3NBHB 1PH5A 4EX5A 4UP7A 3CCUA 2CFMA 4GLVB 4POGA 2A8VA 3S14H 2ID0A 4X65L 3I4NG 2CQOA 2E5LL 4DV2Q 4QQBX 1D8LA 4C3JH 3J81i 1XPRA 1N33Q 3ULLA 3H3VH 1UE5A 4H02A 4OX9L 2GVBA 2BH8A 3KF6A 4R4OA 4PZ7A 4JYAQ 2GN5A 2ZJRA 2OQKA 2UXCQ 2VL6A 1E3PA 5IP7H 1UE6A 3HFZB 4QL5A 4JI7L 1LM0A 1AE3A 3ZJYC 1VQ8A 3UDFA 4LF8Q 1XNRQ 2R7ZH 3S16H 1GD7A 2IX1A 5FJ8G 4JV5Q 1N32L 1FL0A 1V43A 2MNAA 1X56A 4POFA 3DM3A 3L2PA 4P72A 1HZAA 2VS1A 3K81C 1WCMG 5IYCG 3F2DA 3GDEA 4HJAA 1TWFH 4A3JH 3PF5A 3S1RH 4JI3Q 3S1NH 1JJGA 4OO1G 1WJJA 2OWOA 3MXNB 3NEMA 4DR2Q 1N9WA 2E8GA 4AYBE 5C0XI 3GTQH 3CCEA 2N3SA 3CC4A 4WJ3M 1W2BA 4JI1Q 4A75A 1NTGA 3UDIA 1UE7A 1KL9A 4A3CG 4BXXH 2H5XA 4X62Q 5JEAG 3GTJH 4LWCA 2HQLA 2N8NA 4YWMA 5FLMG 1QUQA 3CCMA 1QZHA 1YJ9A 4IFDI 4DV1L 1GVPA 1X6OA 4LF4L 2UUBQ 1PYBA 3KYHC 2ZJQA 4OWWB 4A3IG 2UUAL 3CMAA 4A3FG 4HIMA 2YYZA 3H3VI 4YY3L 1Q7YC 1ASYA 5DLQE 2NN6G 4GN3B 1L0WA 4UP9A 1X9NA 1K0RA 2AKWB 3L0OA 4IFDJ 2ATWA 1G51A 4C2MH 3M3YH 4O2DA 3A5UA 3HOWG 3STBD 2JA5H 1BBUA 1XPOA 3UDXA 1HNXL 1HZCA 5IP9H 2HT1A 1OTCA 3I4MH 1Q12A 4JBWA 4DAYB 3LGJA 2Y0SG 3PIPA 1W3SA 2A19A 1I94L 1YJNA 1XMOL 1SN8A 4OWXB 3W5OA 3KFUA 4WJ4A 2UUCQ 3AEVA 5HGQA 1YHAA 4JBKA 1PHJA 3EIVA 3HOXH 3PO3G 4YWKA 4A3KH 2WAQG 1RL2A 3PV0A 3HOVH 3M4OH 3PF4A 1C0AA 3W1GA 1YI2A 3HOUG 1FGUA 2CWPA 3HKSA 3BZKA 5IY0A 4A3LG 4A3BG 3CF5A 4GKKQ 3PUZA 3HKZG 4BBRH 5K36G 2ZTDA 1EUJA 2KENA 1PV4A 3GTKH 3KJPA 1N33L 1P16A 1IBML 4NB3A 1J6QA 2B63G 4LF7Q 3TREA 4JBMA 4A3GG 2UXCL 2UXBQ 1YHQA 1M1KC 3AFPA 1LUZA 4DV6L 1PH6A 4L5SA 5BR8Q 3RLOA 4DR1L 3AYHB 3I7FA 3J81c 3CC2A 4DR1Q 4JOIC 1VCIA 1PFSA 1UE1A 2D0OA 2R93H 1QVCA 1YZ6A 1X3FA 4DV7L 4L5QA 1JT8A 1FJGQ 1AH9A 4NXMQ 2F4VQ 3S17H 4JI1L 4B3ML 4YCUA 4OXPA 1VQ7A 4X62L 5C44H 1HZBA 1X65A 4J15A 3J7ZC 4O0AA 4DV0Q 1NE3A 3CD6A 1HNZQ 1PVOA 1WYDA 2MFIA 2K4KA 4P75A 3FP9A 4JOIA 4LFAL 3H0GH 3KOJA 5ELOA 1VQDA 2DGYA 1IL2A 5GADC 4MNOA 4FDBA 1M90C 1BKBA 3B6YA 1L1OB 1GM5A 2WAQE 3GTLH 3CW2C 1KD1C 4HJ8A 3J7A5 4A93G 5AJ3L 2D0PA 3HKZE 5M3MH 1SR3A 2KCMA 5M3FG 4TQUS 4GKJQ 1AE2A 4KHPQ 4DV5Q 4AQYQ 3F2BA 3F1ZA 1YBYA 2I5HA 5H1SE 5C0XG 4IJHA 1VQNA 1HNWL 5JJKA 3T1YL 1YIJA 3D0FA 4LF6Q 3GTGH 1KXLA 1UWVA 4R4IA 1IXRA 3PUYA 2A1AA 4JBJA 4DV4Q 4NXNQ 4PG3A 1MKHA 2WFWA 3CCQA 1Q86C 3E9HA 5M5WH 3A5ZB 2VQFQ 1EQRA 4OONA 1BVSA 3U4VA 3ERSX 5E7NA 4K0KQ 2JA8H 2RCNA 1XTDA 1X3GA 2B29A 4YHHQ 3S1QH 3OW2A 3F8TA 3HOYG 2AMCB 3KDFA 2KHJA 3U58A 4QJFA 2IHFA 4LF7L 2VQEQ 4JI6L 4PZ8A 4JI5Q 1V1QA 3GO5A 3TEHB 3DLLA 4DUZL 1JJ2A 2VUMG 3E9IA 4DR3Q 4GOPA 3ER0A 1MJCA 2K5HA 4BY1G 2UU9Q 3ULJA 3PUVA 5IWAQ 1KC8C 2FXQA 3I4NH 2NVTH 4Y52H 2CKZB 3KLWA 1PH8A 1OXXK 2YU9H 2F3IA 4B3TQ 1IBKL 2JJQA 1N34L 4ME3A 1FJGL 5LMUL 1VQGA 3SGIA 3KF6B 4IPGA 4DR4Q 4GS3A 4MZ9A 2GVAA 4JC0A 2JA7G 1VQEA 3IRBA 2HIXA 2IY5B 1B70B 2JA6G 5FJ8H 4GOPB 5M5YH 5GAGC 1TWCH 1K3RA 1CSQA 4X66Q 1BBWA 2CWAA 1WCMH 4XTCS 5IYCH 1K8GA 1IBLQ 1WI5A 4APVA 4UY8C 3M4PA 1MJEA 4LFCQ 4JI0Q 1A62A 1HJPA 5IYBG 1EIYB 3K8AA 1S72A 4B3RL 4A3CH 5IYDG 1HH2P 5FLMH 3K7AH 4UP8A 2ZM6Q 3RZDH 4A76A 3EN2A 1QUQB 3UDGA 1LYLA 3FKIG 1XNQL 4A3DG 1XMQQ 3M85A 4HIOA 4DR5Q 4YCWA 4L5TA 3CCJA 4P73A 4A3MG 4BY7G 4GKJL 4R4CA 4A3IH 1TWAH 4AQYL 4LF5Q 1Q82C 3S1MH 4KHPL 2JEAI 5LMNQ 5JJLA 1PA6A 2PI2A 1A0IA 4A3FH 2E2HH 1UEBA 2XTIA 3PUWA 1PYSB 4IOCA 1Q8KA 1J5EQ 3CPWA 3PO2G 3RLFA 2JA9A 3PGZA 5EAYA 4AH6A 4DV4L 5ELNA 1G291 5IT9c 4R4QA 2JE6I 3OTOQ 1CKNA 2LXKA 1HR0Q 3HOWH 1JE5A 1A63A 2VQFL 4DV2L 2PMZE 1N8RC 4K0KL 1X3EA 2JEBI 3K7UC 2E2JH 4KHZA 1N36Q 2VZAA 1E1OA 2R6GA 3CMEA 4JI4Q 4JYAL 2HIVA 2PQAA 4OO1I 2VQEL 2YTVA 2ZJPA 1YJWA 1VQJA 1VQ6A 2K52A 1XNRL 3NENA 4DR3L 4LF8L 3PO3H 2PI2E 2MQHA 2UU9L 4JV5L 2Q2IA 4LW1A 2OCEA 5IWAL 1PH4A 4HJ9A 3M4QA 3GTPH 1XJVA 3HOUH 4A3BH 4A3LH 4BBSG 2I5MX 1QVGA 4JI3L 4GNXC 4IOAA 1B7YB 3S2DH 2E5LQ 4KI0A 4DR2L 2B63H 2R7FA 2XGTA 5C3EG 2VY3A 4A3EG 2I5LX 3RZOH 4A3GH 3EBEA 1CKOA 2IT1A 4X64Q 4YWLA 3H15A 2EIFA 4JI8Q 1I50H 3I55A 4JI7Q 1HZ9A 3RN5A 1Y1VG 1CKMA 2UUBL 4LUOA 4HIKA 2VNUD 4X66L 2K75A 3M9BA 3CC7A 3JC66 2Z6KC 3L7ZC 3MEFA 4LFCL 1ASZA 4GNXA 4DK3C 1SFOH 5C4XG 1CUKA 4EQ5A 3U4ZA 1Y14B 4XIGS 2NVXH 1K73C 3GTOH 2ES2A 3G71A 3TS0A 1OXTA 2R92G 4C3HH 2ZM6L 3K80C 4RMFA 3CPFA 2BA0A 2Q2HA 1Q1EA 3JAMi 4DKAC 2ASBA 4DV1Q 4DR5L 4LFBQ 4X6AH 2KBNA 4LF5L 3I4OA 3M7NA 1Y1WG 5LMNL 1C9OA 4DAMA 2UUCL 2Z6KA 1TWGH 3HOZG 1EQQA 1WOCA 2YTXA 1U5KA 4YY3Q 2YTYA 2NVYH 3CCSA 2E2IH 2JQOA 4ALPA 1KIXA 1KQSA 4A93H 3PUXA 3J80i 4IFDG 2CCZA 3OTOL 4GKKL 1HR0L 1VQ9A 3G4SA 4GLXA 2OTLA 3RN2A 5M3FH 3S15H 2DUDA 4R1JA 1EOVA 1VQFA 1HNXQ 2NZHA 1N36L 1PH3A 3CXCA 3I56A 3W1BA 4DNIA 2ZTCA 2WB1G 4OWTB 1SRUA 3FHWA 1P8LA 4IPDA 3PIOA 3RLNA 4B3SQ 1WFQA 2UXBL 4HJ7A 1XMOQ 2C35B 4UPAA 1PH2A 2IX0A 2N49A 5BR8L 1PH7A 5IP7G 5GROA 4IPCA 1FVIA 4IJLA 2R7ZG 3PCOB 3TS2A 2B3GA 2KHIA 2PNHA 1TWHH 1E22A 5M5XH 1Q1BA 1VQMA 3GD7A 2YV5A 4A3JG 2V1CC 2RHQB 3PSIA 3Q8DA 3HOYH 4NXML 2F4VL 4HJ5A 2AWOA 2LXJA 2VW9A 5J3BA 3T1HQ 3KDFB 1IBMQ 1TXYA 2QGQA 2VUMH 2RF4A 4GLAC 4BA1I 5JJIA 3VDYA 4X64L 1U0LA 1EWIA 4BY1H 4DV6Q 1NY4A 4JI8L 4BA2I 4BXXG 3A74A 3KF8B 1T9HA 2OTJA
chains in the Genus database with same CATH superfamily
2FPGB 1B04A 1HNZL 1SE8A 3RNUA 3C2PA 4IRKA 2CQYA 1IZ6A 1PH9A 4DR2H 5JPMC 5KFPA 2RSNA 4FO2A 4JI1H 3V4SA 1YEZA 2OXPA 3A8JE 2UXDQ 1S40A 1KDCA 3MVVA 1G6PA 3DMUA 2NVQH 5M5XB 4R7RA 3GV7B 1TWFA 2EYOA 2EY1A 1VQ4A 5C8YF 3OHAA 1S5ED 4C3JB 4IUQA 1EL0A 2VA2A 3F2CA 2NZ1D 3CQZH 4LFCH 5C0XJ 3STBC 5LL6X 4LF6L 1IYJB 4DR6Q 1X54A 5C4JH 5EOYA 5IE8A 3HS0C 1JOOA 3JAMc 4K5XA 4XDXA 1KHIA 3D4RA 3WWVA 2PMZB 1EY5A 3J81j 2ZM6H 4JV1A 1NR2A 3RGZA 3TP6A 1YNXA 4DR5H 2A69C 3MR2A 1CI3M 4K8IA 4BBRG 1GO3E 1E1TA 1KRTA 4ED2A 3FVQA 4B3SL 3K57A 5CAEB 4QGUA 2JEJA 3HP3A 1HNWQ 3OHBA 1C7YA 3K0XA 4HCEA 4RG1A 5C5JA 1SLJA 5LHY1 3TZDA 4GKKH 1E24A 1S3OA 4ZRZA 4C3IH 1I6HH 2Z0SA 1L1OC 3OWEB 2KVMA 3TRZA 1SDFA 1EUCB 2UXBH 1DGSA 1WTPA 3E0EA 2F03A 1VQBA 4LH6A 3U50C 1CK1A 3FKIB 2I80A 1UEAB 2N78A 3KBGA 2BQUA 4BY7B 1HHVA 2L12A 4F50A 3I4MB 3N43B 4BBSH 3BQ2A 3H20A 2F4IA 4ECSA 3SHLA 4NXMH 1IBKQ 3M9OB 1O7IA 5HY6A 1N34Q 2TSSA 2K33A 1VQHA 2IPKD 1NMGA 2CW0C 1S5DD 1KRSA 4PMWA 3I73A 1AZPA 3CCVA 1F9PA 4ECRA 1XMQL 4Y7NH 1S9FA 2J9GA 3RV3A 2OT2A 3CCLA 1JMCA 1F2MA 4TVAB 3R5HA 1VMPA 2BH2A 1JIHA 4WJWA 3BQ0A 2JK8A 3RR5A 2AGOA 4AYBG 1V9PA 1LT5D 2NB0A 3BU2A 2BCOA 4I7AA 1I6UA 5JVG3 1STGA 2QCPX 3V05A 2EE1A 2R93B 1K1SA 4IZ8A 1KAWA 4A3EB 4QY7A 4DV5H 1H9RA 4DUYL 1B8AA 4LJZC 1I94Q 2L9HA 4Q43A 2MO0A 4GOPC 5C44B 4Q45A 4NXNH 1MD2D 2EYJA 4IFDH 3NBHB 4HNVA 4EQPA 4EX5A 3R3OA 4POGA 2CFMA 1JOKA 2XCLA 2A6HD 2VQFH 3RD4A 2F3WA 2ID0A 3I4NG 3N40P 2CQOA 3HBLA 1KBLA 5T14A 1AZQA 4AYBA 4EFEA 4LK1C 3EVQA 3J81i 1XPRA 1B6RA 5KFSA 3IFTA 4RGMA 2BH8A 3I91A 2W70A 2ZJRA 4L1KA 2OQKA 2VL6A 3EA6A 1E3PA 1R9TB 4YB8B 2YRWA 4KJOA 1EU3A 3ZJYC 1XNRQ 2VPQA 5M3MB 4U673 5FJ8G 1Y1WB 3ND8A 3URYA 1X56A 4RCOA 3DM3A 4POFA 2MNAA 4P72A 3L2PA 2XCPA 4IR9A 1RJPA 1CFMA 3F2DA 3GDEA 1TWFH 3MA2B 4OO1G 1WJJA 2F0UA 4QWBA 4AYBE 3T53B 1RTOA 3R2TA 5D3IB 3S14B 2FJ2A 4A3CG 4BXXH 3BA9A 2H5XA 1I7NA 4QIWB 1QZHA 2TMPA 1ICFB 2WB1B 3MFIA 2EJFC 4DV1L 1DOKA 3VYRA 1IBLH 1PRTB 4ECXA 1UC9A 2ZDGA 4RAUC 4B08A 1EYCA 1B3AA 4J9QA 2UUAL 5IT9L 4A3FG 1RODA 3H3VI 5GONF 1GUTA 1Q7YC 4EEQA 3NE5B 1T5EA 2PCFB 1BBXC 4UP9A 1X9NA 4DR7H 1K0RA 1D5ZC 5KFEA 3IKJA 2V59A 5KFDA 3Q8RB 4A3JB 5FD6A 3A5UA 3HOWG 2B2UC 1SYXB 3UDXA 4UCVA 3KALA 4YR3A 4C5CA 1I4GA 1OO9B 2F0SA 4LF5H 2XWJB 1Q12A 4DLKA 1IL8A 2Y0SG 3EFXD 3SVMA 3BVMA 4LSAA 2LMCB 4OWXB 1GHJA 3KFUA 4IUNA 3GTJB 2UUCQ 2VQDA 3TIIA 3AU7A 1YHAA 2WIIB 1LTAD 1S4ZA 4FXKC 1IOWA 4NW2A 4YWKA 2WAQG 1C0AA 1EQVA 3LWEA 3HKSA 4DL3A 4A3BG 4BBRH 5K36G 2ZJTA 5KFAA 4JV0A 1IBML 4A3GG 3M3YB 2UXCL 1GOZA 3AFPA 2CH4A 4ECWA 5BR8Q 4DR1L 1SJED 3CHBD 2Y0SA 4ECZA 2R8KA 1W6JA 1QVCA 1ET6A 1X3FA 3NP8A 2WAQA 2B39A 1FJGQ 1YNND 3M4OB 3GTPA 1S5BD 4JI1L 2YS7A 4JI7H 1I4XA 1VQ7A 5FLXE 4X62L 1WTQA 4KN7C 1HZBA 3VYTA 2EYHA 1NE3A 3J7AF 2K4KA 1JKJB 3IG0A 5DQGA 2P0AA 2EY5A 1VQDA 5IGCA 2DGYA 3GV3A 1I50A 1SNMA 4ZLTF 3B6YA 1PK8A 3RB0A 2WAQE 1TS2A 2R3ZA 3HOUB 1BNZA 3CW2C 1VKZA 2D0PA 4KN4C 3BAAA 3ZYYX 1TS4A 5C5MA 1SFOA 2FPIB 1S5FD 5KFXA 4FXDA 1HPCA 3PZPA 2Z4HA 4RNMA 1GXDC 2I5HA 5I2XA 4YY3H 1HNWL 3D0FA 2F0MA 4RB1A 1UWVA 4R4IA 1DYQA 1IXRA 4DV4Q 1WTRA 1Q86C 1NAPA 1Y8NB 4K6DA 4XT1B 3GV5B 4DL6A 1TWGA 2Z8LA 1HNXH 1EY6A 4YHHQ 2B2YC 3F8TA 3KDFA 1XMOH 3WDNA 2NTSA 2VQEQ 1D5MC 4MTKA 1PTOC 1V1QA 3GO5A 4JI5Q 3HRZC 4PDBA 1SYDA 4DR3Q 4GOPA 3ER0A 3OSPA 4JVZA 4BY1G 2UU9Q 3H3VC 2A6ED 3ULJA 3P1HA 3PUVA 3UQ8A 2I87A 1KEEA 3I4NH 1Y8OB 3TP8A 1TT2A 4Q44A 1QNKA 1A9XA 3RB3A 2A68D 4MV7A 5KFIA 1IBKL 2HGSA 4EGQA 1N34L 4DL7A 1JWMD 1PDQA 2I07B 4DR4Q 1TWHA 2GVAA 4JC0A 2JA7G 1A15A 4K14A 4CJ1B 5KNCA 5FO8B 4EBDA 4APMA 1B70B 4CDEC 5FJ8H 2JA6G 2QF7A 5GAGC 4DL5A 4IAJA 1K3RA 2L55A 2HHHH 1FNUA 2KEDA 4XTCS 2IP4A 1WI5A 4DV7H 4ZKBB 4UY8C 4OO1H 3M4PA 3ORQA 4JI0Q 2F0DA 3RB6A 3N42B 2YS6A 1EZ1A 5IIFA 1A3UA 4ED7A 4A3CH 1CQVA 3MC0B 2FKLA 2YU9B 2HDMA 1M6VA 5DLFA 3J80L 1ZKOA 3M9MB 1QUQB 1LYLA 2F0GA 3H6MA 2UVWA 1WTWA 4YP3A 5CBEE 2JA7A 4R4CA 4AQYL 4CKEA 2JEAI 5LMNQ 2VUMB 1PA6A 4A3FH 2SNMA 2JA6A 2XTIA 3PUWA 1J5EQ 1Q8KA 4KY5A 3CPWA 5KFLA 3J80W 1K83A 3GTMA 3RLFA 5LOVF 1S97A 1F2ZA 3HOWH 3OTOQ 3NBIA 2J7ZA 1HR0Q 4JI2H 4ME6A 2VQFL 1CQJB 2FK3A 1G8ZD 1DV2A 3FRPB 2E2JH 3K7UC 4Q8EA 1O7ZA 2VZAA 3QOLA 2L4NA 1FYCA 2ZJPA 4RZQA 4UCSA 3K7AB 1VQJA 3RZDB 1XNRL 3NHHA 4ZCKA 3WO0A 5F9NA 4RGOS 2WTFA 4R8UA 4IRDA 4G57A 4LW1A 3GTPH 4A3BH 2EDGA 4G4KA 3CQZB 5K36H 4UCRA 4B9WA 2E5LQ 2HUGA 5K2MA 4BWGB 3RZOH 5CC4A 5BN4A 5KFCA 4A3GH 4HNTA 4JI6H 4RNOA 2IL8A 1CKOA 3EBEA 5KFHA 4M9UA 5EWEA 2ATLA 1I4PA 4X64Q 3H91A 3H15A 1JC7A 2XWBB 1I50H 1N32H 1WTVA 2SCUB 3I90A 4LUOA 5CV7A 4X66L 3M9BA 1KAAA 5KGUA 5BPFA 4DU9A 3JC66 2C00A 4ETSA 3PW0A 1SYBA 2F0HA 3PO3B 4GNXA 2F0PA 1SFOH 5C4XG 1N56A 3MR6A 2O2LD 1ZYRC 4WRDA 3MWYW 3HKZB 5CORA 1I6HB 2WE6A 3KHRA 3TS0A 2R92G 5LP6F 4LF4H 4RMFA 2BA0A 2A73B 2V5AA 2KBNA 4LF5L 2K28A 3N8DA 2P5ZX 4JK1C 5A35A 2UUCL 2Z6KA 1TWGH 3HOZG 1DJRD 3GIDA 3MWEA 1WOCA 1U5KA 3CCSA 4B3RH 4FS1A 2ALZA 3BVGA 1KQSA 3V6KA 1VQ9A 4DXFA 3G4SA 4GLXA 2ZT9C 3NXWA 4R8NA 3S15H 2W6QA 3G8CA 2M00A 2NWGA 1XNQH 1N36L 5KFVA 1PH3A 5EDWA 2MP1A 4KHPH 2G5DA 4XYOA 2NVXB 3FHWA 4IPDA 2R92A 4B3SQ 4RZRA 2YW2A 2A5HA 5BR8L 3M9NB 5GROA 3V96A 3A55A 1TWHH 3A8IE 4YIJA 3J7YW 1VQMA 4F4XA 1RKNA 2YV5A 5LYJF 2RHQB 1G2TA 1SCUB 1TS5A 1SE2A 2B2YA 2W9CB 1CA5A 4A93B 1B1ZA 5I47A 2JEGA 5M3FB 4BY1H 1HQRD 1AFPA 4BA2I 3A74A 1V1PA 1T9HA 4XQNA 3J7ZC 4JCVE 3LP8A 4DK6C 3CRLC 2JEFA 5DG8A 2QEXA 4MIUA 5DGBA 2FLPA 4H7BA 3OOCA 2XIWA 2NYZD 2JA7H 1VAJA 1XDNA 1V8QA 2M9VA 1BCPC 1MIUA 2JA6H 3TIGA 3AFQA 1K83H 2UUBH 3GTMH 1VQIA 1GUGA 2E76C 4DAYA 5IP9G 2EQSA 3J81E 4FM9A 1TR5A 2K5QA 4XYMB 4PWQA 3S2HH 1DOMA 2J0TD 1G91A 1TY2A 3HXLA 1I3QB 2KEEA 4ZQ3A 1VF7A 3HOVG 2K50A 2AHOB 2XIGA 1TWFB 1BF4A 3KBXA 4YHHL 3RJ0A 4DUYQ 4QW8A 2SDFA 1EU4A 4JI5L 3BDCA 4YCVA 3I2ZA 3KHHA 3NWTA 2LSSA 1QE6A 1SE4A 3T1YQ 1GJXA 1VMCA 1EIFA 2XGPA 4HSPA 3A0JA 1A8VA 1CKNB 4J9NA 1G2SA 2QEJC 2FMAA 2BA1A 4I7HA 4MV8A 1X55A 1B6SA 1UC8A 2XN9C 1SYGA 3T1HL 3V6JA 5AFWA 4DR4L 2VB2X 2OF1A 2F52A 3J7AK 3UFXB 3LWBA 1WVLA 5JEAJ 1RIPA 4A3DB 1TKWB 4MV6A 5DEHA 1ML0D 2R7DA 5J22A 3BDLA 1VQAA 1XPUA 2AU0A 2BQ3A 1YVCA 1CZWA 1HA6A 2HHHL 3VR2A 1Z9FA 4PMBA 4AIMA 3PO2B 4P74A 3RV4A 1LT6D 2K5VA 4IQZA 4JI0L 2YZNA 5FK9C 2F4VH 2O5JC 3NELA 3RB4A 4KKTA 1O75A 4H44C 3BZCA 5KFNA 1I4QA 5CV5A 4ED6A 4DV0H 4K2KA 3Q8QB 1SMYC 2I0QA 3DXJC 4PZ6A 1VQKA 4UCTA 3TP7A 3GIKA 1DIKA 3NSWA 4LUVA 4U68A 1X3QA 3TQYA 2UUAQ 2F0LA 2K14A 5C4XH 1J5EL 2KCTA 5DAUA 5KG2A 3VR4A 3V4ZA 1IYUA 4DPGA 1ZQ7A 4O4HF 5LMNW 2R92H 3A54A 2A74C 4LF9L 2QA4A 5EPKA 2KQ3A 4JI2L 1PH1A 1Z47A 4LFBH 3W3AA 3OUUA 4L5RC 2JA8G 1FNVA 4MA0A 3GTLA 1RF2D 3S24A 1HR0W 1CHPD 3HOZH 1HQMC 1SNDA 2HDLA 3GV6A 4GN4B 4IWYA 2EJMA 3L3OC 4L8JA 5KG0A 2BR0A 1W6KA 3DWPA 1S0OA 2WKCA 2PZUA 3GIMA 4X65L 2F3VA 1O80A 2E5LL 4QQBX 1XX8A 3MXNA 3IAYA 3H3VH 1LLRD 4H02A 4OX9L 3KF6A 4R4OA 3VR3A 4JYAQ 3U9SA 2GN5A 1FNWA 2UXCQ 1AN8A 3HFZB 3OUZA 1LM0A 1VQ8A 4LF8Q 5IWAH 2R7NA 1GD7A 3ERQA 1N32L 4JV5Q 4F8MA 3R2IA 2L5TA 4FF2A 4B3TH 1XTCD 3H40A 2VS1A 3PF5A 1WCMG 4HJAA 3S1RH 3S1NH 2OWOA 3QZ8A 4DR2Q 5C4ZA 2N3SA 1SYEA 2LY7A 3CC4A 4JI1Q 1NTGA 2ZXOA 1UE7A 5DLGA 4X62Q 4FP5D 4LWCA 3PR5B 3CCMA 1YJ9A 4LF4L 5FOBB 1Q3LA 2X6GA 4O3NA 1WTOA 1O78A 4A3IG 2EYPA 1GHKA 4IUUA 4HIMA 1KJIA 2R7ZB 1S68A 2O03A 2NN6G 1L0WA 2UXDH 4IFDJ 3S9WA 1WCMA 2C2RA 2F1MA 3VMMA 4I65A 2QDBA 1XPOA 3NGDA 1F2LA 2K7VA 2YRXA 5IP9H 3HZXA 1LTSD 4FF3A 2HT1A 3GTQB 4ZOLF 2KJXA 2IA6A 1QWYA 4DR6H 4UDUC 4ECUA 1M8AA 4X3TA 5EKLA 1IW7C 4JBKA 3T5KA 3EIVA 1B9NA 5KG1A 3HOVH 1CS0A 2L1BA 4F88A 3I72A 3ND9A 1EYDA 1FGUA 4GKKQ 5DGAA 1D6EC 3A56A 1MBYA 2W8KA 3PUZA 4RKLA 5EKKA 4TQRA 2ZTDA 2L11A 4JI4H 4EYHB 3KJPA 1N33L 1B33N 1JWUD 3HEJA 4NB3A 2B63G 1WR2A 4C2MB 1PRTF 4RWSC 2UXBQ 2JA5B 1M1KC 3DEPA 1NR4A 5IODA 4IHJF 4WBNF 4DF7A 3AYHB 2F0IA 3J81c 5A2QL 4DA2A 4F7XA 4O2BF 2YYAA 2AQ4A 3U9TA 3QZ7A 3HOXB 4NXMQ 1KDBA 2H1EA 5A2QW 3S17H 3HOWB 1AUVA 5ISRA 4LMQD 3K58A 4J9SA 3C46A 3AMUA 3GTKB 1KJJA 3R23A 3R8BA 2B63A 4J15A 5KFJA 3Q24A 3ETJA 2FINB 1PVOA 3F2UA 1RCVD 2FK2A 2MCTA 5ELOA 3CRKC 3SEBA 1M0TA 4J0MA 2FFKB 5GADC 1M90C 3TBIB 1L1OB 1QJOA 2R8JA 4TV9F 3RFCA 3GTLH 5KG6A 2W7OA 3GTPB 4MTEA 1KD1C 4HJ8A 3J7A5 2Z9HA 1PFNA 4UHVA 1IKLA 1CQFA 1SR3A 4TQUS 2WKDA 3Q0AA 4A3GB 4DV5Q 4AQYQ 2PBZA 3PVXA 3F2BA 3GTOA 2B2WA 1BO0A 2K1BA 5H1SE 1KXLA 3EJIA 1LTID 3T1YL 2R85A 1I50B 5IGDA 2A1AA 4NXNQ 2BE5D 1MKHA 2WFWA 1VBGA 5DQIA 1NNXA 2V9WA 3ITPA 3H0GB 2VQFQ 3U4VA 5E7NA 4CHTB 2JA8H 5BN3A 3JRXA 5KEEA 2NVYA 1IHZA 5C3XA 2AMCB 3U58A 4JUZA 1ET9A 1I94H 3LNNA 4PZ8A 5EPJA 4FYDA 1EY8A 5KFFA 2QW7A 2RDHA 1SYFA 3E9IA 4C5BA 1YNJD 4KJNA 1EHIA 4HCSA 2GPSA 3T16A 3K59A 3L4KA 2Z1CA 2FXQA 3K5IA 4ZHQF 4Y52H 3KLWA 3X3NA 1PH8A 3GLKA 1PTOD 3PN1A 1JX4A 3GTGB 2DPJA 5FPOA 4IPGA 4GS3A 4MZ9A 3G6YA 4DV6H 2HIXA 3PW5A 5JQWA 3MHBA 2IY5B 4GOPB 3RGXA 5EZYF 3H4BA 3S1QB 4X66Q 1IBLQ 1WCMH 1H9SA 3JAML 1JOQA 2FK1A 2PQEA 1A6XA 1PZJD 5IYBG 3KLSA 4EG0A 1HCZA 4KKSA 1EIYB 1CQIB 1S72A 4B3MH 2NVTB 2K32A 2AUKA 5KRUA 5IYDG 2PMZA 1TWHB 3JAMW 1KC7A 5IT9W 4UP8A 4HR7B 3D3RA 4JPBW 1SBBB 4A76A 3UDGA 3C3LA 3FKIG 3K5LA 3KHLA 4HYKA 1ZETA 1TA8A 3M85A 4HIOA 4DV3H 5L1IA 2PNRC 4BY7G 1S5CD 4MA5A 1Y8PB 4LFAH 4A3IH 4LF5Q 4DK0A 1Q82C 3S1MH 2RGRA 1UUPA 2PI2A 4FS2A 2EVBA 4EGJA 3DM1A 2NN6H 4BY1B 4IZOA 5M5YB 1TWCB 1WD1A 2YZMA 5EAYA 3E5SA 2C2DA 4N8X1 4R4QA 5CGKA 1A63A 1V1OA 2X0SA 2PMZE 4K0KL 2JEBI 5T1IA 4MTDA 1N36Q 1KJ9A 4JYAL 5CBAE 1YJWA 5KFKA 4DAPA 3FKIA 2JA6B 2K52A 1PFBA 3NENA 5FKAC 4LF8L 2PI2E 1Y69U 2W6ZA 2HCCA 3V6HA 3R93A 1AEXA 4JV5L 1FKAH 5IWAL 1PH4A 1TWAB 4HJ9A 3GP7A 1STNA 2I5MX 2E2HB 4GNXC 4XQJA 5BMVF 1O7LA 3S2HB 4KI0A 3P75A 4NP5A 4YR0A 4DR2L 4K5WA 2B63H 5C1PA 4YAJB 5C3EG 1K28A 4A3EG 1M0WA 1A3TA 4DUZH 3A8KE 4RB2C 2MGSA 5L1LA 3VR5A 4DFAA 4JI7Q 3I55A 3RN5A 4R8UB 5DG7A 2XRQD 1F9QA 4XQQA 3Q6SA 4CKBA 2Z6KC 2E75C 3L7ZC 4EBEA 4LFCL 4G3IA 1FJGH 2AUJD 5LMUH 1ILPA 2MPMA 3PIP3 1E4EB 4ECVA 1SE3A 4MV9A 4CC5A 3CU7A 5EQ0A 4RH6A 1K73C 3GTOH 3MFHA 5CYUA 1A2UA 2ZM6L 3QJYA 5IGGA 2Q2HA 1Q1EA 3QWNA 4J1MA 4DR5L 1ZYRD 2C28A 3OSOA 1E4FT 3BVZA 3M7NA 1Y1WG 2ZXRA 1HFNA 2LS01 1JORA 2YZGA 4DAMA 4CC6A 2B2VA 4EEYA 1EQQA 4DL2A 4YY3Q 2NVYH 3NBHA 5I6WA 2JQOA 4QUCA 4ALPA 4UFZA 3PUXA 3J80i 1WD0A 4GKKL 1XYIA 1HXYD 3RN2A 4N9TA 2DUDA 1HNXQ 3CXCA 2JN4A 2AGPA 4DNIA 2ZTCA 2WB1G 1SRUA 5G3LD 2XCAA 2A6HC 2CHBD 5EBCA 2UXBL 4ZQIA 4BWSC 4ODGA 4HJ7A 1XMOQ 2C35B 1R9TA 2J6TA 2RDJA 4J9LA 4C3HB 2N49A 4OIJA 4DV4H 1FVIA 1U4MA 4I50F 2FHTA 3PCOB 1Y1WA 1STYA 3TS2A 1I7LA 2B3GA 2KHIA 2PNHA 1W93A 1JR0D 5K5PA 1NSNS 1EIHA 5M5XH 4DV2H 3GD7A 5C4XB 1GLVA 1TAEA 4HQ6A 4A3JG 2M2LA 4YR2A 4NXML 4EGVA 1MSGA 2AWOA 3T1HQ 2E2IB 3L4JA 2VQEH 3K3PA 4XXEA 4O3RA 2RF4A 2IJ0A 3VDYA 4DR3H 4KY6A 1DV1A 2UU9H 1PMRA 3KF8B 3U9OA 2WB1A 5E3FA 1GSOA 2ASDA 3NPPA 1JJCB 3SE7A 4JI3H 1RD9D 2PZWA 2HHHQ 4LUZA 3I4LA 4DV7Q 1D1IA 2DN8A 2K5DA 3NUCA 5T1GA 1NBWA 4KKUA 3OYYA 4C1NK 5I9PA 2NBFA 5D1OB 4O42A 2JSOA 2ALYB 1EUDB 1SROA 1PTOB 1EFWA 1Q8IA 5KIXA 2MO1A 2K05A 3HOYB 4K6LA 5M9OA 1FR3A 4QIWE 4DV5L 2WB1E 5KT3A 4G7HC 3D4WA 3PR4A 3GTJA 5IYBH 1NMFA 2NZOA 2YL2A 5D1PA 2VUGA 2R8IA 4NXNL 3G6EA 5IYDH 4TUYF 4A3KG 2EJGC 4LF9Q 4HTHA 1QVFA 1M7JA 5AJ3Q 3FKIH 4JI2Q 3S1RB 2R86A 2FPPB 3K5OA 3E6ZX 4BY7H 2EXDA 4ZK9B 4IRCA 3H94A 5LMNH 5IGFA 2W71A 2AWNA 4LAAA 5CV8A 5TSSA 4LNQA 2NVQB 1EWCA 5FO7B 5ELDA 2K5NA 5G3LF 1DONA 1RTNA 4HIDA 1DZ1A 4ZUIA 4RA8A 4Z9CB 2EY2A 3OTOH 4CDCC 1I4RA 1Z6HA 4JG2A 1QZGA 4U6PA 4X65Q 3VYUA 2CW7A 1VQCA 1EY9A 2K01A 3OSNA 3GIJA 5C4JB 3I12A 4LF7H 2RHSB 4OX9Q 1KJ8A 2PQAB 2W6MA 1LTBD 5ELBA 1NJIC 3PW4A 2NN6I 2DY7A 1RJTA 4JI6Q 4R4TA 1XXGA 2RSOA 4L6TB 4B9XA 4DK1A 3E5NA 3Q22A 4YQWA 1N48A 3SI8A 1VQ5A 3VPDA 2SEBD 1YNNC 1N32Q 5LA6F 4F4ZA 4OL7A 3L9AX 1IBLL 5GAHC 1C8CA 4HMIA 2XVSA 1D7QA 1QILA 4MTNA 1LTTD 3RBDA 3D31A 5C3EH 2KSWA 4A3EH 3CKIB 4DNTB 1E7ZA 1WTXA 5C3WA 4DR7L 1GSAA 1HTLD 4X64H 4C3IB 1BNCA 1K8AC 4A2BA 3RIZA 2SNSA 3QO2A 5EBDA 1HNZH 4LF4Q 1QNUA 4CJ2C 4DV3L 2DJFC 4P2CB 1LTLA 4A4IA 2I46A 1AP0A 1VS0A 4KV6A 2JYOA 4BBSB 1CE8A 5IOCA 1E2VA 4J9MA 5J2UF 4B3RQ 1L0XB 5D3DA 1R9TH 3G48A 4FXGC 2HJWA 4F87A 4GKJH 3UE0A 1BDOA 1XNQQ 3K5NA 5BPHA 4PMCA 1Y1WH 2WP8J 5FLXc 1E2ZA 3S17B 5L9XA 1SEIA 1F9RA 5CR3A 4LF6H 2V58A 1TVXA 2W57A 2H4OA 4K5VA 4FNFA 1AUXA 1Q90A 4Y7NB 4O4LF 4RUAA 3BJUA 3P20A 4GC7A 2ASLA 1JLLB 4RU9A 4F4WA 4UP7A 4GLVB 2A8VA 3QR8A 1KNAA 1HRJA 4J9KA 3S14H 1NCVA 5J1ZA 3VPCA 5I6YA 1N33Q 4RKBA 3FMAA 5H80A 4JW0A 2GVBA 3GTLB 2WACA 4B3SH 1GUNA 3GIPA 3I3CA 2XSCA 2J4XA 4JI7L 3S16H 1JT8A 4RAZA 3UDFA 2DWCA 1FL0A 1V43A 2PO4A 4N8FA 1EQTA 2I8CA 4WD3A 1HZAA 4A3JH 4ME5A 4CDFC 5IT9E 4G7OC 1PXUA 2BDOA 4FF1A 5KFYA 3MXNB 1CTMA 2RKSA 2YU9A 1STBA 5JEAG 3GTJH 5FLMG 4RNNA 2NU9B 1QUQA 5JH7F 1VDZA 1GVPA 4N9PA 2CW8A 1HUMA 2UUBQ 2RGVA 5COYA 3KYHC 2ZJQA 4OWWB 1WSCA 5DM63 3GIIA 4I4TF 3CMAA 2YYZA 1WTHA 4YY3L 2D9UA 5KFWA 5DLQE 4GN3B 3TN2A 1GUWA 1VBHA 4IUPA 2W6PA 2ATWA 1G51A 3O13A 3M3YH 3STBD 1BBUA 1ONLA 3MEHA 4OELB 5FO9B 1XMQH 1HNXL 3BG5A 2DNEA 4M8AA 1OTCA 1UAPA 4H0LC 2A19A 1ULZA 1YJNA 1XMOL 4QWEA 1L2ZA 1JDEA 3AEVA 1DOLA 5HGQA 4J9PA 2A69D 2G9HD 4HNUA 4DN4M 1PHJA 3PO3G 3JSNA 3KHGA 4A3KH 1B44D 1RL2A 3M4OH 2DNCA 3PF4A 2CWPA 4KD3A 3M7GA 3BZKA 4A3LG 5KFGA 3CF5A 2HVRA 3HKZG 1K3BC 1BCPB 1EYZA 3T5HA 2V4QA 2KENA 1IW7D 2HVSA 2ICIA 1P16A 3GV8B 2W9AA 2W9BA 3TREA 4ED3A 4FVMA 1YHQA 4X3UA 1CT1D 1LUZA 1PH6A 5KX5F 3RLOA 3OHXC 3BYTB 2PW7A 4Q0FA 5KT2A 3CC2A 1B53A 1VCIA 4A3IB 4RB3C 1YZ6A 4DAVA 4RHRA 1ENCA 2RA4A 4DV7L 1IOVA 1Z2NX 4L5QA 1AH9A 5E4WC 3R5XA 2F4VQ 2RQXA 3QG1A 1MZBA 2KCNA 3HKZA 4OXPA 4JI8H 2KHSA 4BBRB 2O4XA 5EKIA 4O0AA 4XT3B 5I4DA 3Q23A 4DV0Q 4R9WA 2B2WC 2MFIA 4P75A 3P7JA 3SR1A 3QFFA 4JOIA 2CW0D 3MXUA 1BXTA 3WNZA 4OHJA 5KFBA 1BKBA 3DEOA 1GM5A 3KLSX 3MXGA 3NQTA 1V51A 3Q8SB 4A93G 5AJ3L 3LMLA 3OPOA 1TS3A 3HKZE 2PW5A 3SK6A 4DV1H 1R4PB 5M3FG 2KCMA 1PLFA 1X3PA 2B63B 1BUVT 3HGBA 3M4YA 2NVXA 2UUAH 5KYIA 3DHQA 3F1ZA 1YBYA 5ELFA 4LH7A 3OWFA 5C0XG 2J6UA 1MSHA 5JJKA 2CH4W 5EWFA 3NTHA 5LL6b 4NKLA 1CHQD 1B9MA 3CCQA 2WINB 3E9HA 5M5WH 1VF5C 2KA7A 4U7CA 3EQLC 5HGTA 4K0KQ 2ZDQA 3IFDA 3SXHA 1XTDA 1MHWC 4IURA 1DM0B 4ZAIA 3OW2A 1EYAA 2W9CA 2RVLA 4MV4A 2IHFA 4LF7L 4JI6L 3TEHB 3DLLA 1JJ2A 4RB0A 3FDTA 3T4AC 1A2TA 1Z2OX 1MJCA 2K5HA 1TY0A 1C30A 5IWAQ 4KY7A 3G7LA 1EFID 5EJWA 1EY7A 2CKZB 1OXXK 2YU9H 4C1NI 5KNDA 4B3TQ 4YJ3F 2JJQA 4AYBB 4RAYA 1LTGD 3WO1A 1IBMH 4TQSA 4HEDA 4OIKA 3OMGA 2UXCH 5L37A 1A3VA 3NWSA 4DR1H 3TMEA 3OMCA 3N52A 4OEMB 3J80E 1AN7A 5IGBA 1C3OA 3QOJA 1GUSA 2CWAA 2B8FA 4G7ZC 4APVA 3N41B 3RBEA 4LFCQ 2NTTA 3N6XA 1ZHSA 1BGWA 1HJPA 2GA4B 1I3QA 3K8AA 3IL8A 3I4NB 2DZDA 4B3RL 5JEAH 4X62H 3T5JA 1HH2P 4ULLA 5FLMH 3K7AH 3K6OA 4OGQC 2F0JA 2ZM6Q 1ILQA 3RZDH 5JOBA 4A3DG 3JRWA 5KFZA 4IR1A 1M4VA 1XNQL 2JXMB 4DR5Q 2XD4A 2L0CA 4A3MG 1EEID 4P73A 4GKJL 4KHPL 3MWDA 5JJLA 3MAQA 1H9SB 5KKNB 1RJRA 4WFN3 1UEBA 4O3QA 2HQEA 4IOCA 1C4QA 5KNBA 3FEWX 3PO2G 2OH2A 2JA9A 3PGZA 2F0WA 3FDSA 5ELNA 5IT9c 1S0NA 2R87A 1CKNA 2LXKA 5CB4F 1JE5A 1O7YA 2NU8B 1S10A 5HBRB 2RDGA 1X3EA 1E1OA 2R6GA 1TQOA 4JI4Q 2HIVA 2F0EA 3QIAA 4IN3A 1HNWH 4Y8VB 2CZGA 5J2TF 3PO3H 4J9RA 2V4RA 1EZ8A 1RK5A 2J6SA 4I55F 2OCEA 3M4QA 4A3LH 4FU0A 2B2TA 4A3FB 2VXWA 1D1KA 3S2DH 3T51B 1ZXTA 2EYLA 1RK6A 2DIKA 4O1NA 3BA8A 1SSOA 2C2EA 2IT1A 3MFYA 5KFOA 2DJGC 4ED1A 2EIFA 2E2JB 2R7LA 4MV3A 3EPGA 4ED0A 1HZ9A 1Y1VG 1CKMA 2K5WA 2Y0SB 3F8NA 2UUBL 1GYFA 2VNUD 3G6VA 3BQ1A 3OIQA 2K75A 2F0TA 4I7ZC 2B2VC 3TINA 1IBKH 1N34H 3MEFA 5D14A 3EPIA 1ASZA 1J8IA 4DK3C 2WAQB 3U4ZA 1Y14B 4XIGS 4GZYC 2NVXH 4RCNA 4A3BB 1EWHA 1WH2A 4J9OA 2ES2A 2ASJA 1ZEQX 3G71A 1OXTA 3HG9A 3VA7A 3BS1A 3RZOB 2KCCA 3JAMi 2FP4B 3I4OA 2FB9A 1C9OA 3BJYA 2PYKA 4TV8F 4ECQA 2PN1A 1Y1VA 2YTXA 3NTKA 2YTYA 2DY8A 4CGYB 5JPNC 2F0VA 4ZYSA 2C22A 4A93H 2RBMA 2CCZA 5CV6A 2RDIA 3I8ZA 3BABA 5M3FH 2B8GA 1SFOB 5C3EB 4C3JG 2Q8RE 3UI2A 4AQYH 1EEFD 4OWTB 2FLNA 3D4DA 5C0XH 4EQOA 1DCZA 5C1OA 1PH2A 4UPAA 2IX0A 2LFNA 5D65A 5IP7G 2E2DC 1I6VC 4IPCA 1PRTC 2BOSA 2R7ZG 4EBCA 1E22A 3K5HA 1FD7D 1Q1BA 2F0QA 2V4DA 5D8DA 1TWGB 5F9LA 4NDXA 2V1CC 5KT7A 2X69A 3PSIA 2VA3A 2F4VL 3K5MA 1JQYD 2VW9A 3N6RA 3KDFB 3GILA 4E4TA 1XNRH 1BR9A 4ILWA 3S15B 3Q2OA 4DV6Q 4JI8L 3KLRA 2HCIA 1UNNC 1V4YA 2OTJA 4DV0L 1I3QH 2ENBA 4IUVA 5GAEC 1YHBA 4Q5VA 2AQ2B 1PX2A 4RGTA 1SNCA 2ICEC 3UE1A 4P71A 4NPSA 5KT6A 2R7ZA 3T56B 1EOTA 2F0KA 2WYOA 3CP0A 2DLNA 3KAJA 4DR7Q 1H9KA 1J9OA 2OEOA 2EOTA 4V0BA 4B3MQ 1GKHA 2G9DA 5CV9A 4HN7A 1U9RA 4TSSA 4ECYA 1STHA 2DPIA 2JA5G 3D8GA 4GN5A 1OWTA 2BDNA 3DF7A 4LFBL 4X66H 1OXSC 1GUOA 3GTQA 2D2CC 3Q1KA 2JEIA 4DV3Q 3I4MG 1Z7TA 1SMXA 4KLKA 4EQNA 1U4RA 4LFAQ 2PPBC 1MGSA 5EGTA 1QCBD 4IALA 3S16B 2QK4A 3A7AB 1K9MC 1JB7A 1EY0A 4O3PA 4IO9A 3HOXG 4KTAA 1Z2PX 1K8OA 4QW9A 3H4DA 4A3DH 2W8LA 3VYSA 4A3MH 4J6HA 1JDBB 1EIGA 1R4QB 2JA7B 1STAA 2Q2TA 4C2MA 3G6JB 3J81L 2UUCH 3J80c 2O5IC 2JA5A 3PO2H 3T13A 1K83B 3GTMB 4BS9A 1H95A 1I5FA 2SOBA 5JVLA 3SK8A 3KJOA 1GSHA 1YITA 3J81W 2D62A 2MHVA 1Q81C 4B3TL 1MI2A 2R93G 1N36H 3A7LA 4CDDC 1PTOF 2K04A 4YAKB 3HB9A 2EY6A 3CAMA 3DWQA 4L63B 5BR8H 4UCUA 1ZHQA 3BYYB 1SYCA 4DUZQ 5JVDF 2IW3A 3AQQA 5C44G 3GTKA 1VQLA 2Z6BA 5JVH3 2RCFA 3MXPA 2NU7B 5KFMA 4MAMA 1JICA 2ZTEA 3H0GG 1IKMA 3TSSA 3ULPA 2K03A 1L1OA 1C48A 4ID6A 3WOEA 4A3KB 2OQ0A 2L15A 5LMUQ 2UXDL 4QF4A 3BG3A 1SAPA 3T5LA 2R93A 4O4IF 1CM9A 1K8MA 1VQPA 4IUTA 1Y1VH 1EYGA 2IMWP 5CMDA 1L2FA 5M3MG 3SK5A 2UVVA 1CSPA 2Y0SE 5C5LA 1Q46A 1VQOA 3LX0A 1E2WA 4ABNA 4GNXB 4HSVA 2Q2UA 4DR6L 1D2BA 1OXVA 3PW2A 1RJQA 4J8QA 4DL4A 5JUMA 3H0GA 3ICEA 5E4XA 3ORRA 3SE0A 4S3SA 5GQOA 2AQ3B 2N55A 4PV1C 4JI4L 4K2LA 2BE5C 3PMFA 1JCKB 1OXUA 1HUNA 3SDZA 4IPHA 1T36A 1QOHA 2IHEA 3CCRA 1TIID 3OW7A 1PH5A 3CCUA 4QWCA 3FPPA 1RYRA 1SJHD 4DV2Q 4YHHH 2EYMA 1D8LA 4C3JH 1YNJC 3GTGA 5NUCA 3ULLA 1UE5A 2EXZA 4JI5H 4PZ7A 5IGEA 2R92B 4MV1A 2F0OA 5IP7H 1UE6A 4QL5A 3KAKA 5KFUA 4QIWA 1AE3A 4FBUA 2R7ZH 5IYZF 2IX1A 1T94A 3PQIA 1W96A 3Q8PB 3HOZB 3K81C 5IYCG 4JI3Q 2R82A 3V2TA 1JJGA 1H9MA 3T1HH 4RUCA 4DR4H 3NEMA 1N9WA 2E8GA 5C0XI 3GTQH 4C5AA 3CCEA 4WJ3M 3PW7A 2AGQA 3X3MA 1W2BA 4A75A 3UDIA 5M5WB 4YBZB 1KL9A 3BDOA 3ONAB 4HR7A 2HQLA 2N8NA 1PFMA 2NUCA 4YWMA 4TKOB 1V1PB 2IWHA 4IFDI 5FPRA 1X6OA 5DM73 5JAVA 1PYBA 1D5XC 2C9OA 4HMJA 3I70A 2K6AA 3TZUA 1BCPD 5E1FA 1IYVA 4JI0H 4M7EA 1RHPA 2R8GA 5EWGA 4KMUC 1ASYA 1TWCA 1TU2B 2AKWB 1SNQA 3L0OA 3NQIA 5CV4A 3VA5A 2MJ8A 4C2MH 4O2DA 4O3SA 3MTSA 1HFGA 4XYQA 2JA5H 5CA1F 5JJZA 2D5DA 3S1NB 3CVZA 4ECTA 2KECA 1HZCA 4QWDA 3I4MH 1L0YB 4DAYB 4JBWA 3LGJA 3PIPA 1W3SA 1I94L 1J5EH 2Q8IB 1SN8A 3W5OA 4GC6A 4WJ4A 3MZ5A 4NMZA 3HOXH 3PV0A 1HR0H 2VPSA 3W1GA 4MHEA 5A2QE 1TWAA 4LF9H 1YI2A 3HOUG 5KG4A 5IY0A 2LKVA 4C56C 2E2HA 2F0NA 3TP5A 1EUJA 2B2UA 1PV4A 1QG7A 3GTKH 5KT5A 1U4LA 1B4OA 1U4PA 5L1KA 1J6QA 4LF7Q 4JBMA 2VOBA 1DXMA 1ENAA 4L5SA 4DV6L 1KJQA 3DWAA 1AW7A 1GGOA 1EY4A 4YJ2F 2R84A 3I7FA 5HURA 2QKIC 3LWUA 4JOIC 4X65H 1PFSA 1UE1A 2E5LH 1PZKD 2D0OA 2R93H 2R61A 5HV6A 4NLGA 3RTXA 4PQXA 1QB5D 1E4EA 4FBTA 4OX9H 4DNRB 3HOVB 4HAEA 3MR5A 2EYFA 4B3ML 4K8JA 2W9BB 4YCUA 2BQRA 5LL6S 1LABA 1PZID 3KK7A 5C44H 1LO5D 4C3HG 1X65A 4XYLB 1LACA 3CD6A 1HNZQ 1WYDA 2M05A 3FP9A 2KUMA 4LFAL 3H0GH 3KOJA 2W7PA 3FPUB 4EVOA 2X6LA 1KABA 1IL2A 4EYIB 4MNOA 4FDBA 1SMYD 2MUYA 2PZTA 3D6WA 4JV2A 1BCPF 2ZDHA 5LXTF 3C1FA 4CBVA 3W2DA 3EROA 3ETHA 3AB9A 5KYLA 3S2DB 4Q8FA 4ZUJA 5M3MH 5ELCA 4GKJQ 1AE2A 4KHPQ 2W6NA 5KG5A 4KD4A 2CVRA 4IJHA 1VQNA 1YIJA 4LF6Q 3GTGH 3VPBA 3PUYA 4JBJA 2NU6B 1CZGA 3JZIA 4PG3A 1S0MA 1RYSA 1K0SA 1S03G 3A5ZB 1EQRA 4OONA 4CKCA 1BVSA 3ERSX 5KFQA 2RCNA 1X3GA 2A6EC 2B29A 3S1QH 2E2IA 3HOYG 5KT4A 2KHJA 1B3QA 4QJFA 1JWSD 2VR1A 2OLSA 2A68C 1B2TA 2KOLA 4DUZL 3GIQA 2VUMG 2AQ1B 3KF8A 1BQQT 1KLGD 2FJZA 1KC8C 4MN3A 4TRDA 1HTPA 2RDFA 2NVTH 5L1JA 3JAME 2UVRA 1KTKA 2F3IA 1PYWD 1N33H 4ED8A 5ELEA 3TDQA 4ME3A 1SNOA 1FJGL 5LMUL 1VQGA 1E0BA 1LT3D 3SGIA 2CQAA 3KF6B 2XRSD 2W6OA 4DGZA 3KXYT 3G6XA 4QMGA 5D1OA 1VQEA 3IRBA 1BOSA 3OIPA 2JA8B 4QB4A 3NTIA 5M5YH 1TWCH 2FMCA 3K0YA 3NK9A 1F77A 1CSQA 2IX3A 4ZI7F 1BBWA 5IYCH 1I4HA 1K8GA 2VUMA 1SXTA 4V190 2R7KA 1JXLA 4XZ3B 1MJEA 4UAIA 3PIO3 1A62A 1T3NA 2IBKA 1NUCA 3TQTA 5DNFA 1KNEA 3JSLA 3MWMA 4X3KA 4X3SA 3EN2A 3D6CA 1EZ6A 2FLLA 1XMQQ 1T5XD 3KUPA 4L5TA 4YCWA 4PNYA 3CCJA 3FMCA 2R7MA 4E6IA 3N44B 1TWAH 1UNSA 3RUZA 5KFRA 4RHSA 3VR6A 1A0IA 2EPBA 4M1UB 2E2HH 5DG9A 1PYSB 1LTRD 3K3VA 2Z4IA 4AH6A 1KLUD 4DV4L 3QB3A 1G291 2B2TC 1WCMB 2JE6I 1BJTA 3CQZA 4LMYA 4DV2L 1STEA 4C3IG 1N8RC 3R5FA 3RAQA 3DUZA 4KHZA 4DUYH 1LV9A 3CMEA 1JE4A 2PQAA 1K1QA 2HVQA 2R8HA 4OO1I 2VQEL 2YTVA 2XNAC 1G6ZA 3T1YH 1VQ6A 3IN5A 4O2AF 4O3OA 2EZVA 4DR3L 2GPWA 2E74C 2MQHA 2ZXPA 2R6FA 3MFGA 2UU9L 2C5CA 1E4GT 2Q2IA 3HOUH 1XWEA 1XJVA 5J39A 3S1MB 2GLTA 4UCOA 3M4IA 3GQCA 4BBSG 1QVGA 4JI3L 4IOAA 3WOFA 1B7YB 2JP1A 4QWAA 2F0FA 2R7FA 2XGTA 2VY3A 5CA0F 2I5LX 5EPLA 5C6AA 2QILA 4YWLA 1ENFA 1ESRA 3RAXA 4JI8Q 4A3MB 5I2YA 4KK7A 4HIKA 4EFBA 3MJFA 3CC7A 2NUAB 3MR3A 4LSXA 5F2DA 5KG3A 3J7AV 1DD2A 2XC9A 1CUKA 3GQBA 4EQ5A 4RGNA 1SNPA 1B50A 4Q0YA 3BZDB 2FMMA 3RUPA 3E3XA 4KHVA 5FLXL 3TQ1A 2PVPA 4C3HH 3K80C 1ICWA 3CPFA 1FGBD 4DXGA 4DKAC 2ASBA 4DV1Q 3C1EA 4LFBQ 1F2YA 1II3A 4X6AH 1KDAA 3SK4A 5LMNL 5FLXW 3KTMA 2YCHA 4WORA 1SEBD 5C4HA 5KG7A 2E2IH 1KIXA 4IFDG 3OTOL 1HR0L 3EYYA 1F9SA 2N88A 2OTLA 5KFTA 1ESFA 1RDPD 4R1JA 2HD3A 1EOVA 1VQFA 4ZKCB 4QUFA 2NZHA 4F4YA 3I56A 3W1BA 2VB3X 3PIOA 3GTOB 1P8LA 3RLNA 1WFQA 1LT4D 4IWXA 3RMHA 1PH7A 2FE3A 3RF2A 1Y1VB 5FD5A 4A2AA 3H09A 1BXRA 4RFBA 4IJLA 5DQHA 5I9OA 1H9JA 3C0FB 1HA5A 2XGQA 4K0KH 4R8IA 1PTOH 3E0JA 1X32A 2UVUA 4H13C 3Q8DA 3HOYH 2WV6D 4FF4A 1PRTD 2NVYB 2QDLA 4HJ5A 2LXJA 2WDTA 5J3BA 4JYAH 1CA6A 1IBMQ 5BN5A 1TXYA 2QGQA 1JB3A 2VUMH 4GLAC 4BA1I 5JJIA 4X64L 4LF8H 1U0LA 4QCLA 1EWIA 4CJ0B 2QYZA 1NY4A 4BXXG 2Q8TA 4DR1Q 4JV5H 4XX0B
chains in the Genus database with same CATH topology
4DV0L 1I3QH 1HNZL 1SE8A 3RNUA 5GAEC 1JJCB 4JCVE 1YHBA 2HHHQ 4DK6C 4LUZA 3UE1A 1IZ6A 4P71A 4NPSA 2QEXA 4DV7Q 1PH9A 3CP0A 1YEZA 1NBWA 2JA7H 4DR7Q 1S40A 2UXDQ 3OYYA 1G6PA 4B3MQ 1GKHA 2NVQH 2ALYB 1MIUA 2JA6H 1SROA 1VQ4A 1EFWA 3AFQA 2JA5G 1K83H 2MO1A 4GN5A 3GTMH 1VQIA 4QIWE 1OXSC 3F2CA 4DV5L 5IP9G 4LFBL 2WB1E 4DV3Q 3I4MG 1SMXA 3CQZH 4KLKA 2EQSA 4LFAQ 5C0XJ 3STBC 4LF6L 1IYJB 5IYBH 1NMFA 1X54A 2NZOA 4DR6Q 3S2HH 5C4JH 4NXNL 1K9MC 1JB7A 5IE8A 3G6EA 3JAMc 4IO9A 3HOXG 5IYDH 4A3KG 1KHIA 3WWVA 3HOVG 2K50A 3J81j 4LF9Q 1QVFA 2AHOB 4A3DH 5AJ3Q 3FKIH 4JI2Q 1YNXA 4A3MH 4BY7H 4YHHL 2EXDA 4BBRG 1GO3E 1E1TA 1KRTA 4DUYQ 2AWNA 2Q2TA 4LNQA 4JI5L 4B3SL 3J80c 4YCVA 3I2ZA 3PO2H 2LSSA 4QGUA 2K5NA 1HNWQ 4HIDA 3T1YQ 1C7YA 3K0XA 4RG1A 1EIFA 1SLJA 1H95A 1I5FA 4JG2A 1E24A 3A0JA 1A8VA 3KJOA 1CKNB 1S3OA 4C3IH 1YITA 4X65Q 2D62A 1QZGA 2Z0SA 1Q81C 1I6HH 4B3TL 1VQCA 2R93G 2BA1A 1L1OC 1X55A 3TRZA 3T1HL 2RHSB 4OX9Q 4DR4L 2PQAB 1DGSA 3E0EA 2F52A 3CAMA 1NJIC 2NN6I 1VQBA 4JI6Q 4R4TA 3U50C 5JEAJ 1RIPA 4DUZQ 2N78A 2R7DA 1VQ5A 3AQQA 1VQAA 5C44G 1XPUA 1N32Q 1VQLA 1YVCA 1IBLL 5GAHC 4BBSH 1D7QA 2HHHL 1Z9FA 4AIMA 4MTNA 2ZTEA 4P74A 3H0GG 4JI0L 2K5VA 3D31A 1IBKQ 1O7IA 5HY6A 5C3EH 4A3EH 1N34Q 3ULPA 3NELA 1L1OA 1E7ZA 2L15A 2OQ0A 1VQHA 5LMUQ 4DR7L 2UXDL 1NMGA 3BZCA 1KRSA 1VQPA 4PMWA 1K8AC 1Y1VH 1EYGA 3CCVA 1XMQL 4Y7NH 2I0QA 4PZ6A 1VQKA 1L2FA 5M3MG 4LF4Q 1CSPA 4LUVA 3CCLA 4DV3L 1JMCA 2Y0SE 3TQYA 2UUAQ 4TVAB 4A4IA 1LTLA 1Q46A 2K14A 5C4XH 1VQOA 1J5EL 4GNXB 2Q2UA 2KCTA 2BH2A 4DR6L 1OXVA 2JK8A 1VS0A 3RR5A 4AYBG 1V9PA 3BU2A 4DPGA 5LMNW 2R92H 4B3RQ 4LF9L 2QA4A 1R9TH 3G48A 3ICEA 4JI2L 5GQOA 1KAWA 1Z47A 1PH1A 3UE0A 4QY7A 1XNQQ 4L5RC 2JA8G 4JI4L 1Y1WH 2WP8J 5FLXc 3S24A 4DUYL 1HR0W 1B8AA 1I94Q 3HOZH 1OXUA 2MO0A 4GOPC 4GN4B 4IPHA 3BJUA 2IHEA 3CCRA 3NBHB 1PH5A 4EX5A 4UP7A 3CCUA 2CFMA 4GLVB 4POGA 2A8VA 3S14H 2ID0A 4X65L 3I4NG 2CQOA 2E5LL 4DV2Q 4QQBX 1D8LA 4C3JH 3J81i 1XPRA 1N33Q 3ULLA 3H3VH 1UE5A 4H02A 4OX9L 2GVBA 2BH8A 3KF6A 4R4OA 4PZ7A 4JYAQ 2GN5A 2ZJRA 2OQKA 2UXCQ 2VL6A 1E3PA 5IP7H 1UE6A 3HFZB 4QL5A 4JI7L 1LM0A 1AE3A 3ZJYC 1VQ8A 3UDFA 4LF8Q 1XNRQ 2R7ZH 3S16H 1GD7A 2IX1A 5FJ8G 4JV5Q 1N32L 1FL0A 1V43A 2MNAA 1X56A 4POFA 3DM3A 3L2PA 4P72A 1HZAA 2VS1A 3K81C 1WCMG 5IYCG 3F2DA 3GDEA 4HJAA 1TWFH 4A3JH 3PF5A 3S1RH 4JI3Q 3S1NH 1JJGA 4OO1G 1WJJA 2OWOA 3MXNB 3NEMA 4DR2Q 1N9WA 2E8GA 4AYBE 5C0XI 3GTQH 3CCEA 2N3SA 3CC4A 4WJ3M 1W2BA 4JI1Q 4A75A 1NTGA 3UDIA 1UE7A 1KL9A 4A3CG 4BXXH 2H5XA 4X62Q 5JEAG 3GTJH 4LWCA 2HQLA 2N8NA 4YWMA 5FLMG 1QUQA 3CCMA 1QZHA 1YJ9A 4IFDI 4DV1L 1GVPA 1X6OA 4LF4L 2UUBQ 1PYBA 3KYHC 2ZJQA 4OWWB 4A3IG 2UUAL 3CMAA 4A3FG 4HIMA 2YYZA 3H3VI 4YY3L 1Q7YC 1ASYA 5DLQE 2NN6G 4GN3B 1L0WA 4UP9A 1X9NA 1K0RA 2AKWB 3L0OA 4IFDJ 2ATWA 1G51A 4C2MH 3M3YH 4O2DA 3A5UA 3HOWG 3STBD 2JA5H 1BBUA 1XPOA 3UDXA 1HNXL 1HZCA 5IP9H 2HT1A 1OTCA 3I4MH 1Q12A 4JBWA 4DAYB 3LGJA 2Y0SG 3PIPA 1W3SA 2A19A 1I94L 1YJNA 1XMOL 1SN8A 4OWXB 3W5OA 3KFUA 4WJ4A 2UUCQ 3AEVA 5HGQA 1YHAA 4JBKA 1PHJA 3EIVA 3HOXH 3PO3G 4YWKA 4A3KH 2WAQG 1RL2A 3PV0A 3HOVH 3M4OH 3PF4A 1C0AA 3W1GA 1YI2A 3HOUG 1FGUA 2CWPA 3HKSA 3BZKA 5IY0A 4A3LG 4A3BG 3CF5A 4GKKQ 3PUZA 3HKZG 4BBRH 5K36G 2ZTDA 1EUJA 2KENA 1PV4A 3GTKH 3KJPA 1N33L 1P16A 1IBML 4NB3A 1J6QA 2B63G 4LF7Q 3TREA 4JBMA 4A3GG 2UXCL 2UXBQ 1YHQA 1M1KC 3AFPA 1LUZA 4DV6L 1PH6A 4L5SA 5BR8Q 3RLOA 4DR1L 3AYHB 3I7FA 3J81c 3CC2A 4DR1Q 4JOIC 1VCIA 1PFSA 1UE1A 2D0OA 2R93H 1QVCA 1YZ6A 1X3FA 4DV7L 4L5QA 1JT8A 1FJGQ 1AH9A 4NXMQ 2F4VQ 3S17H 4JI1L 4B3ML 4YCUA 4OXPA 1VQ7A 4X62L 5C44H 1HZBA 1X65A 4J15A 3J7ZC 4O0AA 4DV0Q 1NE3A 3CD6A 1HNZQ 1PVOA 1WYDA 2MFIA 2K4KA 4P75A 3FP9A 4JOIA 4LFAL 3H0GH 3KOJA 5ELOA 1VQDA 2DGYA 1IL2A 5GADC 4MNOA 4FDBA 1M90C 1BKBA 3B6YA 1L1OB 1GM5A 2WAQE 3GTLH 3CW2C 1KD1C 4HJ8A 3J7A5 4A93G 5AJ3L 2D0PA 3HKZE 5M3MH 1SR3A 2KCMA 5M3FG 4TQUS 4GKJQ 1AE2A 4KHPQ 4DV5Q 4AQYQ 3F2BA 3F1ZA 1YBYA 2I5HA 5H1SE 5C0XG 4IJHA 1VQNA 1HNWL 5JJKA 3T1YL 1YIJA 3D0FA 4LF6Q 3GTGH 1KXLA 1UWVA 4R4IA 1IXRA 3PUYA 2A1AA 4JBJA 4DV4Q 4NXNQ 4PG3A 1MKHA 2WFWA 3CCQA 1Q86C 3E9HA 5M5WH 3A5ZB 2VQFQ 1EQRA 4OONA 1BVSA 3U4VA 3ERSX 5E7NA 4K0KQ 2JA8H 2RCNA 1XTDA 1X3GA 2B29A 4YHHQ 3S1QH 3OW2A 3F8TA 3HOYG 2AMCB 3KDFA 2KHJA 3U58A 4QJFA 2IHFA 4LF7L 2VQEQ 4JI6L 4PZ8A 4JI5Q 1V1QA 3GO5A 3TEHB 3DLLA 4DUZL 1JJ2A 2VUMG 3E9IA 4DR3Q 4GOPA 3ER0A 1MJCA 2K5HA 4BY1G 2UU9Q 3ULJA 3PUVA 5IWAQ 1KC8C 2FXQA 3I4NH 2NVTH 4Y52H 2CKZB 3KLWA 1PH8A 1OXXK 2YU9H 2F3IA 4B3TQ 1IBKL 2JJQA 1N34L 4ME3A 1FJGL 5LMUL 1VQGA 3SGIA 3KF6B 4IPGA 4DR4Q 4GS3A 4MZ9A 2GVAA 4JC0A 2JA7G 1VQEA 3IRBA 2HIXA 2IY5B 1B70B 2JA6G 5FJ8H 4GOPB 5M5YH 5GAGC 1TWCH 1K3RA 1CSQA 4X66Q 1BBWA 2CWAA 1WCMH 4XTCS 5IYCH 1K8GA 1IBLQ 1WI5A 4APVA 4UY8C 3M4PA 1MJEA 4LFCQ 4JI0Q 1A62A 1HJPA 5IYBG 1EIYB 3K8AA 1S72A 4B3RL 4A3CH 5IYDG 1HH2P 5FLMH 3K7AH 4UP8A 2ZM6Q 3RZDH 4A76A 3EN2A 1QUQB 3UDGA 1LYLA 3FKIG 1XNQL 4A3DG 1XMQQ 3M85A 4HIOA 4DR5Q 4YCWA 4L5TA 3CCJA 4P73A 4A3MG 4BY7G 4GKJL 4R4CA 4A3IH 1TWAH 4AQYL 4LF5Q 1Q82C 3S1MH 4KHPL 2JEAI 5LMNQ 5JJLA 1PA6A 2PI2A 1A0IA 4A3FH 2E2HH 1UEBA 2XTIA 3PUWA 1PYSB 4IOCA 1Q8KA 1J5EQ 3CPWA 3PO2G 3RLFA 2JA9A 3PGZA 5EAYA 4AH6A 4DV4L 5ELNA 1G291 5IT9c 4R4QA 2JE6I 3OTOQ 1CKNA 2LXKA 1HR0Q 3HOWH 1JE5A 1A63A 2VQFL 4DV2L 2PMZE 1N8RC 4K0KL 1X3EA 2JEBI 3K7UC 2E2JH 4KHZA 1N36Q 2VZAA 1E1OA 2R6GA 3CMEA 4JI4Q 4JYAL 2HIVA 2PQAA 4OO1I 2VQEL 2YTVA 2ZJPA 1YJWA 1VQJA 1VQ6A 2K52A 1XNRL 3NENA 4DR3L 4LF8L 3PO3H 2PI2E 2MQHA 2UU9L 4JV5L 2Q2IA 4LW1A 2OCEA 5IWAL 1PH4A 4HJ9A 3M4QA 3GTPH 1XJVA 3HOUH 4A3BH 4A3LH 4BBSG 2I5MX 1QVGA 4JI3L 4GNXC 4IOAA 1B7YB 3S2DH 2E5LQ 4KI0A 4DR2L 2B63H 2R7FA 2XGTA 5C3EG 2VY3A 4A3EG 2I5LX 3RZOH 4A3GH 3EBEA 1CKOA 2IT1A 4X64Q 4YWLA 3H15A 2EIFA 4JI8Q 1I50H 3I55A 4JI7Q 1HZ9A 3RN5A 1Y1VG 1CKMA 2UUBL 4LUOA 4HIKA 2VNUD 4X66L 2K75A 3M9BA 3CC7A 3JC66 2Z6KC 3L7ZC 3MEFA 4LFCL 1ASZA 4GNXA 4DK3C 1SFOH 5C4XG 1CUKA 4EQ5A 3U4ZA 1Y14B 4XIGS 2NVXH 1K73C 3GTOH 2ES2A 3G71A 3TS0A 1OXTA 2R92G 4C3HH 2ZM6L 3K80C 4RMFA 3CPFA 2BA0A 2Q2HA 1Q1EA 3JAMi 4DKAC 2ASBA 4DV1Q 4DR5L 4LFBQ 4X6AH 2KBNA 4LF5L 3I4OA 3M7NA 1Y1WG 5LMNL 1C9OA 4DAMA 2UUCL 2Z6KA 1TWGH 3HOZG 1EQQA 1WOCA 2YTXA 1U5KA 4YY3Q 2YTYA 2NVYH 3CCSA 2E2IH 2JQOA 4ALPA 1KIXA 1KQSA 4A93H 3PUXA 3J80i 4IFDG 2CCZA 3OTOL 4GKKL 1HR0L 1VQ9A 3G4SA 4GLXA 2OTLA 3RN2A 5M3FH 3S15H 2DUDA 4R1JA 1EOVA 1VQFA 1HNXQ 2NZHA 1N36L 1PH3A 3CXCA 3I56A 3W1BA 4DNIA 2ZTCA 2WB1G 4OWTB 1SRUA 3FHWA 1P8LA 4IPDA 3PIOA 3RLNA 4B3SQ 1WFQA 2UXBL 4HJ7A 1XMOQ 2C35B 4UPAA 1PH2A 2IX0A 2N49A 5BR8L 1PH7A 5IP7G 5GROA 4IPCA 1FVIA 4IJLA 2R7ZG 3PCOB 3TS2A 2B3GA 2KHIA 2PNHA 1TWHH 1E22A 5M5XH 1Q1BA 1VQMA 3GD7A 2YV5A 4A3JG 2V1CC 2RHQB 3PSIA 3Q8DA 3HOYH 4NXML 2F4VL 4HJ5A 2AWOA 2LXJA 2VW9A 5J3BA 3T1HQ 3KDFB 1IBMQ 1TXYA 2QGQA 2VUMH 2RF4A 4GLAC 4BA1I 5JJIA 3VDYA 4X64L 1U0LA 1EWIA 4BY1H 4DV6Q 1NY4A 4JI8L 4BA2I 4BXXG 3A74A 3KF8B 1T9HA 2OTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 L;  1I3Q H;  1HNZ L;  1SE8 A;  3RNU A;  5GAE C;  1JJC B;  4JCV E;  1YHB A;  2HHH Q;  4DK6 C;  4LUZ A;  3UE1 A;  1IZ6 A;  4P71 A;  4NPS A;  2QEX A;  4DV7 Q;  1PH9 A;  3CP0 A;  1YEZ A;  1NBW A;  2JA7 H;  4DR7 Q;  1S40 A;  2UXD Q;  3OYY A;  1G6P A;  4B3M Q;  1GKH A;  2NVQ H;  2ALY B;  1MIU A;  2JA6 H;  1SRO A;  1VQ4 A;  1EFW A;  3AFQ A;  2JA5 G;  1K83 H;  2MO1 A;  4GN5 A;  3GTM H;  1VQI A;  4QIW E;  1OXS C;  3F2C A;  4DV5 L;  5IP9 G;  4LFB L;  2WB1 E;  4DV3 Q;  3I4M G;  1SMX A;  3CQZ H;  4KLK A;  2EQS A;  4LFA Q;  5C0X J;  3STB C;  4LF6 L;  1IYJ B;  5IYB H;  1NMF A;  1X54 A;  2NZO A;  4DR6 Q;  3S2H H;  5C4J H;  4NXN L;  1K9M C;  1JB7 A;  5IE8 A;  3G6E A;  3JAM c;  4IO9 A;  3HOX G;  5IYD H;  4A3K G;  1KHI A;  3WWV A;  3HOV G;  2K50 A;  3J81 j;  4LF9 Q;  1QVF A;  2AHO B;  4A3D H;  5AJ3 Q;  3FKI H;  4JI2 Q;  1YNX A;  4A3M H;  4BY7 H;  4YHH L;  2EXD A;  4BBR G;  1GO3 E;  1E1T A;  1KRT A;  4DUY Q;  2AWN A;  2Q2T A;  4LNQ A;  4JI5 L;  4B3S L;  3J80 c;  4YCV A;  3I2Z A;  3PO2 H;  2LSS A;  4QGU A;  2K5N A;  1HNW Q;  4HID A;  3T1Y Q;  1C7Y A;  3K0X A;  4RG1 A;  1EIF A;  1SLJ A;  1H95 A;  1I5F A;  4JG2 A;  1E24 A;  3A0J A;  1A8V A;  3KJO A;  1CKN B;  1S3O A;  4C3I H;  1YIT A;  4X65 Q;  2D62 A;  1QZG A;  2Z0S A;  1Q81 C;  1I6H H;  4B3T L;  1VQC A;  2R93 G;  2BA1 A;  1L1O C;  1X55 A;  3TRZ A;  3T1H L;  2RHS B;  4OX9 Q;  4DR4 L;  2PQA B;  1DGS A;  3E0E A;  2F52 A;  3CAM A;  1NJI C;  2NN6 I;  1VQB A;  4JI6 Q;  4R4T A;  3U50 C;  5JEA J;  1RIP A;  4DUZ Q;  2N78 A;  2R7D A;  1VQ5 A;  3AQQ A;  1VQA A;  5C44 G;  1XPU A;  1N32 Q;  1VQL A;  1YVC A;  1IBL L;  5GAH C;  4BBS H;  1D7Q A;  2HHH L;  1Z9F A;  4AIM A;  4MTN A;  2ZTE A;  4P74 A;  3H0G G;  4JI0 L;  2K5V A;  3D31 A;  1IBK Q;  1O7I A;  5HY6 A;  5C3E H;  4A3E H;  1N34 Q;  3ULP A;  3NEL A;  1L1O A;  1E7Z A;  2L15 A;  2OQ0 A;  1VQH A;  5LMU Q;  4DR7 L;  2UXD L;  1NMG A;  3BZC A;  1KRS A;  1VQP A;  4PMW A;  1K8A C;  1Y1V H;  1EYG A;  3CCV A;  1XMQ L;  4Y7N H;  2I0Q A;  4PZ6 A;  1VQK A;  1L2F A;  5M3M G;  4LF4 Q;  1CSP A;  4LUV A;  3CCL A;  4DV3 L;  1JMC A;  2Y0S E;  3TQY A;  2UUA Q;  4TVA B;  4A4I A;  1LTL A;  1Q46 A;  2K14 A;  5C4X H;  1VQO A;  1J5E L;  4GNX B;  2Q2U A;  2KCT A;  2BH2 A;  4DR6 L;  1OXV A;  2JK8 A;  1VS0 A;  3RR5 A;  4AYB G;  1V9P A;  3BU2 A;  4DPG A;  5LMN W;  2R92 H;  4B3R Q;  4LF9 L;  2QA4 A;  1R9T H;  3G48 A;  3ICE A;  4JI2 L;  5GQO A;  1KAW A;  1Z47 A;  1PH1 A;  3UE0 A;  4QY7 A;  1XNQ Q;  4L5R C;  2JA8 G;  4JI4 L;  1Y1W H;  2WP8 J;  5FLX c;  3S24 A;  4DUY L;  1HR0 W;  1B8A A;  1I94 Q;  3HOZ H;  1OXU A;  2MO0 A;  4GOP C;  4GN4 B;  4IPH A;  3BJU A;  2IHE A;  3CCR A;  3NBH B;  1PH5 A;  4EX5 A;  4UP7 A;  3CCU A;  2CFM A;  4GLV B;  4POG A;  2A8V A;  3S14 H;  2ID0 A;  4X65 L;  3I4N G;  2CQO A;  2E5L L;  4DV2 Q;  4QQB X;  1D8L A;  4C3J H;  3J81 i;  1XPR A;  1N33 Q;  3ULL A;  3H3V H;  1UE5 A;  4H02 A;  4OX9 L;  2GVB A;  2BH8 A;  3KF6 A;  4R4O A;  4PZ7 A;  4JYA Q;  2GN5 A;  2ZJR A;  2OQK A;  2UXC Q;  2VL6 A;  1E3P A;  5IP7 H;  1UE6 A;  3HFZ B;  4QL5 A;  4JI7 L;  1LM0 A;  1AE3 A;  3ZJY C;  1VQ8 A;  3UDF A;  4LF8 Q;  1XNR Q;  2R7Z H;  3S16 H;  1GD7 A;  2IX1 A;  5FJ8 G;  4JV5 Q;  1N32 L;  1FL0 A;  1V43 A;  2MNA A;  1X56 A;  4POF A;  3DM3 A;  3L2P A;  4P72 A;  1HZA A;  2VS1 A;  3K81 C;  1WCM G;  5IYC G;  3F2D A;  3GDE A;  4HJA A;  1TWF H;  4A3J H;  3PF5 A;  3S1R H;  4JI3 Q;  3S1N H;  1JJG A;  4OO1 G;  1WJJ A;  2OWO A;  3MXN B;  3NEM A;  4DR2 Q;  1N9W A;  2E8G A;  4AYB E;  5C0X I;  3GTQ H;  3CCE A;  2N3S A;  3CC4 A;  4WJ3 M;  1W2B A;  4JI1 Q;  4A75 A;  1NTG A;  3UDI A;  1UE7 A;  1KL9 A;  4A3C G;  4BXX H;  2H5X A;  4X62 Q;  5JEA G;  3GTJ H;  4LWC A;  2HQL A;  2N8N A;  4YWM A;  5FLM G;  1QUQ A;  3CCM A;  1QZH A;  1YJ9 A;  4IFD I;  4DV1 L;  1GVP A;  1X6O A;  4LF4 L;  2UUB Q;  1PYB A;  3KYH C;  2ZJQ A;  4OWW B;  4A3I G;  2UUA L;  3CMA A;  4A3F G;  4HIM A;  2YYZ A;  3H3V I;  4YY3 L;  1Q7Y C;  1ASY A;  5DLQ E;  2NN6 G;  4GN3 B;  1L0W A;  4UP9 A;  1X9N A;  1K0R A;  2AKW B;  3L0O A;  4IFD J;  2ATW A;  1G51 A;  4C2M H;  3M3Y H;  4O2D A;  3A5U A;  3HOW G;  3STB D;  2JA5 H;  1BBU A;  1XPO A;  3UDX A;  1HNX L;  1HZC A;  5IP9 H;  2HT1 A;  1OTC A;  3I4M H;  1Q12 A;  4JBW A;  4DAY B;  3LGJ A;  2Y0S G;  3PIP A;  1W3S A;  2A19 A;  1I94 L;  1YJN A;  1XMO L;  1SN8 A;  4OWX B;  3W5O A;  3KFU A;  4WJ4 A;  2UUC Q;  3AEV A;  5HGQ A;  1YHA A;  4JBK A;  1PHJ A;  3EIV A;  3HOX H;  3PO3 G;  4YWK A;  4A3K H;  2WAQ G;  1RL2 A;  3PV0 A;  3HOV H;  3M4O H;  3PF4 A;  1C0A A;  3W1G A;  1YI2 A;  3HOU G;  1FGU A;  2CWP A;  3HKS A;  3BZK A;  5IY0 A;  4A3L G;  4A3B G;  3CF5 A;  4GKK Q;  3PUZ A;  3HKZ G;  4BBR H;  5K36 G;  2ZTD A;  1EUJ A;  2KEN A;  1PV4 A;  3GTK H;  3KJP A;  1N33 L;  1P16 A;  1IBM L;  4NB3 A;  1J6Q A;  2B63 G;  4LF7 Q;  3TRE A;  4JBM A;  4A3G G;  2UXC L;  2UXB Q;  1YHQ A;  1M1K C;  3AFP A;  1LUZ A;  4DV6 L;  1PH6 A;  4L5S A;  5BR8 Q;  3RLO A;  4DR1 L;  3AYH B;  3I7F A;  3J81 c;  3CC2 A;  4DR1 Q;  4JOI C;  1VCI A;  1PFS A;  1UE1 A;  2D0O A;  2R93 H;  1QVC A;  1YZ6 A;  1X3F A;  4DV7 L;  4L5Q A;  1JT8 A;  1FJG Q;  1AH9 A;  4NXM Q;  2F4V Q;  3S17 H;  4JI1 L;  4B3M L;  4YCU A;  4OXP A;  1VQ7 A;  4X62 L;  5C44 H;  1HZB A;  1X65 A;  4J15 A;  3J7Z C;  4O0A A;  4DV0 Q;  1NE3 A;  3CD6 A;  1HNZ Q;  1PVO A;  1WYD A;  2MFI A;  2K4K A;  4P75 A;  3FP9 A;  4JOI A;  4LFA L;  3H0G H;  3KOJ A;  5ELO A;  1VQD A;  2DGY A;  1IL2 A;  5GAD C;  4MNO A;  4FDB A;  1M90 C;  1BKB A;  3B6Y A;  1L1O B;  1GM5 A;  2WAQ E;  3GTL H;  3CW2 C;  1KD1 C;  4HJ8 A;  3J7A 5;  4A93 G;  5AJ3 L;  2D0P A;  3HKZ E;  5M3M H;  1SR3 A;  2KCM A;  5M3F G;  4TQU S;  4GKJ Q;  1AE2 A;  4KHP Q;  4DV5 Q;  4AQY Q;  3F2B A;  3F1Z A;  1YBY A;  2I5H A;  5H1S E;  5C0X G;  4IJH A;  1VQN A;  1HNW L;  5JJK A;  3T1Y L;  1YIJ A;  3D0F A;  4LF6 Q;  3GTG H;  1KXL A;  1UWV A;  4R4I A;  1IXR A;  3PUY A;  2A1A A;  4JBJ A;  4DV4 Q;  4NXN Q;  4PG3 A;  1MKH A;  2WFW A;  3CCQ A;  1Q86 C;  3E9H A;  5M5W H;  3A5Z B;  2VQF Q;  1EQR A;  4OON A;  1BVS A;  3U4V A;  3ERS X;  5E7N A;  4K0K Q;  2JA8 H;  2RCN A;  1XTD A;  1X3G A;  2B29 A;  4YHH Q;  3S1Q H;  3OW2 A;  3F8T A;  3HOY G;  2AMC B;  3KDF A;  2KHJ A;  3U58 A;  4QJF A;  2IHF A;  4LF7 L;  2VQE Q;  4JI6 L;  4PZ8 A;  4JI5 Q;  1V1Q A;  3GO5 A;  3TEH B;  3DLL A;  4DUZ L;  1JJ2 A;  2VUM G;  3E9I A;  4DR3 Q;  4GOP A;  3ER0 A;  1MJC A;  2K5H A;  4BY1 G;  2UU9 Q;  3ULJ A;  3PUV A;  5IWA Q;  1KC8 C;  2FXQ A;  3I4N H;  2NVT H;  4Y52 H;  2CKZ B;  3KLW A;  1PH8 A;  1OXX K;  2YU9 H;  2F3I A;  4B3T Q;  1IBK L;  2JJQ A;  1N34 L;  4ME3 A;  1FJG L;  5LMU L;  1VQG A;  3SGI A;  3KF6 B;  4IPG A;  4DR4 Q;  4GS3 A;  4MZ9 A;  2GVA A;  4JC0 A;  2JA7 G;  1VQE A;  3IRB A;  2HIX A;  2IY5 B;  1B70 B;  2JA6 G;  5FJ8 H;  4GOP B;  5M5Y H;  5GAG C;  1TWC H;  1K3R A;  1CSQ A;  4X66 Q;  1BBW A;  2CWA A;  1WCM H;  4XTC S;  5IYC H;  1K8G A;  1IBL Q;  1WI5 A;  4APV A;  4UY8 C;  3M4P A;  1MJE A;  4LFC Q;  4JI0 Q;  1A62 A;  1HJP A;  5IYB G;  1EIY B;  3K8A A;  1S72 A;  4B3R L;  4A3C H;  5IYD G;  1HH2 P;  5FLM H;  3K7A H;  4UP8 A;  2ZM6 Q;  3RZD H;  4A76 A;  3EN2 A;  1QUQ B;  3UDG A;  1LYL A;  3FKI G;  1XNQ L;  4A3D G;  1XMQ Q;  3M85 A;  4HIO A;  4DR5 Q;  4YCW A;  4L5T A;  3CCJ A;  4P73 A;  4A3M G;  4BY7 G;  4GKJ L;  4R4C A;  4A3I H;  1TWA H;  4AQY L;  4LF5 Q;  1Q82 C;  3S1M H;  4KHP L;  2JEA I;  5LMN Q;  5JJL A;  1PA6 A;  2PI2 A;  1A0I A;  4A3F H;  2E2H H;  1UEB A;  2XTI A;  3PUW A;  1PYS B;  4IOC A;  1Q8K A;  1J5E Q;  3CPW A;  3PO2 G;  3RLF A;  2JA9 A;  3PGZ A;  5EAY A;  4AH6 A;  4DV4 L;  5ELN A;  1G29 1;  5IT9 c;  4R4Q A;  2JE6 I;  3OTO Q;  1CKN A;  2LXK A;  1HR0 Q;  3HOW H;  1JE5 A;  1A63 A;  2VQF L;  4DV2 L;  2PMZ E;  1N8R C;  4K0K L;  1X3E A;  2JEB I;  3K7U C;  2E2J H;  4KHZ A;  1N36 Q;  2VZA A;  1E1O A;  2R6G A;  3CME A;  4JI4 Q;  4JYA L;  2HIV A;  2PQA A;  4OO1 I;  2VQE L;  2YTV A;  2ZJP A;  1YJW A;  1VQJ A;  1VQ6 A;  2K52 A;  1XNR L;  3NEN A;  4DR3 L;  4LF8 L;  3PO3 H;  2PI2 E;  2MQH A;  2UU9 L;  4JV5 L;  2Q2I A;  4LW1 A;  2OCE A;  5IWA L;  1PH4 A;  4HJ9 A;  3M4Q A;  3GTP H;  1XJV A;  3HOU H;  4A3B H;  4A3L H;  4BBS G;  2I5M X;  1QVG A;  4JI3 L;  4GNX C;  4IOA A;  1B7Y B;  3S2D H;  2E5L Q;  4KI0 A;  4DR2 L;  2B63 H;  2R7F A;  2XGT A;  5C3E G;  2VY3 A;  4A3E G;  2I5L X;  3RZO H;  4A3G H;  3EBE A;  1CKO A;  2IT1 A;  4X64 Q;  4YWL A;  3H15 A;  2EIF A;  4JI8 Q;  1I50 H;  3I55 A;  4JI7 Q;  1HZ9 A;  3RN5 A;  1Y1V G;  1CKM A;  2UUB L;  4LUO A;  4HIK A;  2VNU D;  4X66 L;  2K75 A;  3M9B A;  3CC7 A;  3JC6 6;  2Z6K C;  3L7Z C;  3MEF A;  4LFC L;  1ASZ A;  4GNX A;  4DK3 C;  1SFO H;  5C4X G;  1CUK A;  4EQ5 A;  3U4Z A;  1Y14 B;  4XIG S;  2NVX H;  1K73 C;  3GTO H;  2ES2 A;  3G71 A;  3TS0 A;  1OXT A;  2R92 G;  4C3H H;  2ZM6 L;  3K80 C;  4RMF A;  3CPF A;  2BA0 A;  2Q2H A;  1Q1E A;  3JAM i;  4DKA C;  2ASB A;  4DV1 Q;  4DR5 L;  4LFB Q;  4X6A H;  2KBN A;  4LF5 L;  3I4O A;  3M7N A;  1Y1W G;  5LMN L;  1C9O A;  4DAM A;  2UUC L;  2Z6K A;  1TWG H;  3HOZ G;  1EQQ A;  1WOC A;  2YTX A;  1U5K A;  4YY3 Q;  2YTY A;  2NVY H;  3CCS A;  2E2I H;  2JQO A;  4ALP A;  1KIX A;  1KQS A;  4A93 H;  3PUX A;  3J80 i;  4IFD G;  2CCZ A;  3OTO L;  4GKK L;  1HR0 L;  1VQ9 A;  3G4S A;  4GLX A;  2OTL A;  3RN2 A;  5M3F H;  3S15 H;  2DUD A;  4R1J A;  1EOV A;  1VQF A;  1HNX Q;  2NZH A;  1N36 L;  1PH3 A;  3CXC A;  3I56 A;  3W1B A;  4DNI A;  2ZTC A;  2WB1 G;  4OWT B;  1SRU A;  3FHW A;  1P8L A;  4IPD A;  3PIO A;  3RLN A;  4B3S Q;  1WFQ A;  2UXB L;  4HJ7 A;  1XMO Q;  2C35 B;  4UPA A;  1PH2 A;  2IX0 A;  2N49 A;  5BR8 L;  1PH7 A;  5IP7 G;  5GRO A;  4IPC A;  1FVI A;  4IJL A;  2R7Z G;  3PCO B;  3TS2 A;  2B3G A;  2KHI A;  2PNH A;  1TWH H;  1E22 A;  5M5X H;  1Q1B A;  1VQM A;  3GD7 A;  2YV5 A;  4A3J G;  2V1C C;  2RHQ B;  3PSI A;  3Q8D A;  3HOY H;  4NXM L;  2F4V L;  4HJ5 A;  2AWO A;  2LXJ A;  2VW9 A;  5J3B A;  3T1H Q;  3KDF B;  1IBM Q;  1TXY A;  2QGQ A;  2VUM H;  2RF4 A;  4GLA C;  4BA1 I;  5JJI A;  3VDY A;  4X64 L;  1U0L A;  1EWI A;  4BY1 H;  4DV6 Q;  1NY4 A;  4JI8 L;  4BA2 I;  4BXX G;  3A74 A;  3KF8 B;  1T9H A;  2OTJ A; 
#chains in the Genus database with same CATH topology
 2FPG B;  1B04 A;  1HNZ L;  1SE8 A;  3RNU A;  3C2P A;  4IRK A;  2CQY A;  1IZ6 A;  1PH9 A;  4DR2 H;  5JPM C;  5KFP A;  2RSN A;  4FO2 A;  4JI1 H;  3V4S A;  1YEZ A;  2OXP A;  3A8J E;  2UXD Q;  1S40 A;  1KDC A;  3MVV A;  1G6P A;  3DMU A;  2NVQ H;  5M5X B;  4R7R A;  3GV7 B;  1TWF A;  2EYO A;  2EY1 A;  1VQ4 A;  5C8Y F;  3OHA A;  1S5E D;  4C3J B;  4IUQ A;  1EL0 A;  2VA2 A;  3F2C A;  2NZ1 D;  3CQZ H;  4LFC H;  5C0X J;  3STB C;  5LL6 X;  4LF6 L;  1IYJ B;  4DR6 Q;  1X54 A;  5C4J H;  5EOY A;  5IE8 A;  3HS0 C;  1JOO A;  3JAM c;  4K5X A;  4XDX A;  1KHI A;  3D4R A;  3WWV A;  2PMZ B;  1EY5 A;  3J81 j;  2ZM6 H;  4JV1 A;  1NR2 A;  3RGZ A;  3TP6 A;  1YNX A;  4DR5 H;  2A69 C;  3MR2 A;  1CI3 M;  4K8I A;  4BBR G;  1GO3 E;  1E1T A;  1KRT A;  4ED2 A;  3FVQ A;  4B3S L;  3K57 A;  5CAE B;  4QGU A;  2JEJ A;  3HP3 A;  1HNW Q;  3OHB A;  1C7Y A;  3K0X A;  4HCE A;  4RG1 A;  5C5J A;  1SLJ A;  5LHY 1;  3TZD A;  4GKK H;  1E24 A;  1S3O A;  4ZRZ A;  4C3I H;  1I6H H;  2Z0S A;  1L1O C;  3OWE B;  2KVM A;  3TRZ A;  1SDF A;  1EUC B;  2UXB H;  1DGS A;  1WTP A;  3E0E A;  2F03 A;  1VQB A;  4LH6 A;  3U50 C;  1CK1 A;  3FKI B;  2I80 A;  1UEA B;  2N78 A;  3KBG A;  2BQU A;  4BY7 B;  1HHV A;  2L12 A;  4F50 A;  3I4M B;  3N43 B;  4BBS H;  3BQ2 A;  3H20 A;  2F4I A;  4ECS A;  3SHL A;  4NXM H;  1IBK Q;  3M9O B;  1O7I A;  5HY6 A;  1N34 Q;  2TSS A;  2K33 A;  1VQH A;  2IPK D;  1NMG A;  2CW0 C;  1S5D D;  1KRS A;  4PMW A;  3I73 A;  1AZP A;  3CCV A;  1F9P A;  4ECR A;  1XMQ L;  4Y7N H;  1S9F A;  2J9G A;  3RV3 A;  2OT2 A;  3CCL A;  1JMC A;  1F2M A;  4TVA B;  3R5H A;  1VMP A;  2BH2 A;  1JIH A;  4WJW A;  3BQ0 A;  2JK8 A;  3RR5 A;  2AGO A;  4AYB G;  1V9P A;  1LT5 D;  2NB0 A;  3BU2 A;  2BCO A;  4I7A A;  1I6U A;  5JVG 3;  1STG A;  2QCP X;  3V05 A;  2EE1 A;  2R93 B;  1K1S A;  4IZ8 A;  1KAW A;  4A3E B;  4QY7 A;  4DV5 H;  1H9R A;  4DUY L;  1B8A A;  4LJZ C;  1I94 Q;  2L9H A;  4Q43 A;  2MO0 A;  4GOP C;  5C44 B;  4Q45 A;  4NXN H;  1MD2 D;  2EYJ A;  4IFD H;  3NBH B;  4HNV A;  4EQP A;  4EX5 A;  3R3O A;  4POG A;  2CFM A;  1JOK A;  2XCL A;  2A6H D;  2VQF H;  3RD4 A;  2F3W A;  2ID0 A;  3I4N G;  3N40 P;  2CQO A;  3HBL A;  1KBL A;  5T14 A;  1AZQ A;  4AYB A;  4EFE A;  4LK1 C;  3EVQ A;  3J81 i;  1XPR A;  1B6R A;  5KFS A;  3IFT A;  4RGM A;  2BH8 A;  3I91 A;  2W70 A;  2ZJR A;  4L1K A;  2OQK A;  2VL6 A;  3EA6 A;  1E3P A;  1R9T B;  4YB8 B;  2YRW A;  4KJO A;  1EU3 A;  3ZJY C;  1XNR Q;  2VPQ A;  5M3M B;  4U67 3;  5FJ8 G;  1Y1W B;  3ND8 A;  3URY A;  1X56 A;  4RCO A;  3DM3 A;  4POF A;  2MNA A;  4P72 A;  3L2P A;  2XCP A;  4IR9 A;  1RJP A;  1CFM A;  3F2D A;  3GDE A;  1TWF H;  3MA2 B;  4OO1 G;  1WJJ A;  2F0U A;  4QWB A;  4AYB E;  3T53 B;  1RTO A;  3R2T A;  5D3I B;  3S14 B;  2FJ2 A;  4A3C G;  4BXX H;  3BA9 A;  2H5X A;  1I7N A;  4QIW B;  1QZH A;  2TMP A;  1ICF B;  2WB1 B;  3MFI A;  2EJF C;  4DV1 L;  1DOK A;  3VYR A;  1IBL H;  1PRT B;  4ECX A;  1UC9 A;  2ZDG A;  4RAU C;  4B08 A;  1EYC A;  1B3A A;  4J9Q A;  2UUA L;  5IT9 L;  4A3F G;  1ROD A;  3H3V I;  5GON F;  1GUT A;  1Q7Y C;  4EEQ A;  3NE5 B;  1T5E A;  2PCF B;  1BBX C;  4UP9 A;  1X9N A;  4DR7 H;  1K0R A;  1D5Z C;  5KFE A;  3IKJ A;  2V59 A;  5KFD A;  3Q8R B;  4A3J B;  5FD6 A;  3A5U A;  3HOW G;  2B2U C;  1SYX B;  3UDX A;  4UCV A;  3KAL A;  4YR3 A;  4C5C A;  1I4G A;  1OO9 B;  2F0S A;  4LF5 H;  2XWJ B;  1Q12 A;  4DLK A;  1IL8 A;  2Y0S G;  3EFX D;  3SVM A;  3BVM A;  4LSA A;  2LMC B;  4OWX B;  1GHJ A;  3KFU A;  4IUN A;  3GTJ B;  2UUC Q;  2VQD A;  3TII A;  3AU7 A;  1YHA A;  2WII B;  1LTA D;  1S4Z A;  4FXK C;  1IOW A;  4NW2 A;  4YWK A;  2WAQ G;  1C0A A;  1EQV A;  3LWE A;  3HKS A;  4DL3 A;  4A3B G;  4BBR H;  5K36 G;  2ZJT A;  5KFA A;  4JV0 A;  1IBM L;  4A3G G;  3M3Y B;  2UXC L;  1GOZ A;  3AFP A;  2CH4 A;  4ECW A;  5BR8 Q;  4DR1 L;  1SJE D;  3CHB D;  2Y0S A;  4ECZ A;  2R8K A;  1W6J A;  1QVC A;  1ET6 A;  1X3F A;  3NP8 A;  2WAQ A;  2B39 A;  1FJG Q;  1YNN D;  3M4O B;  3GTP A;  1S5B D;  4JI1 L;  2YS7 A;  4JI7 H;  1I4X A;  1VQ7 A;  5FLX E;  4X62 L;  1WTQ A;  4KN7 C;  1HZB A;  3VYT A;  2EYH A;  1NE3 A;  3J7A F;  2K4K A;  1JKJ B;  3IG0 A;  5DQG A;  2P0A A;  2EY5 A;  1VQD A;  5IGC A;  2DGY A;  3GV3 A;  1I50 A;  1SNM A;  4ZLT F;  3B6Y A;  1PK8 A;  3RB0 A;  2WAQ E;  1TS2 A;  2R3Z A;  3HOU B;  1BNZ A;  3CW2 C;  1VKZ A;  2D0P A;  4KN4 C;  3BAA A;  3ZYY X;  1TS4 A;  5C5M A;  1SFO A;  2FPI B;  1S5F D;  5KFX A;  4FXD A;  1HPC A;  3PZP A;  2Z4H A;  4RNM A;  1GXD C;  2I5H A;  5I2X A;  4YY3 H;  1HNW L;  3D0F A;  2F0M A;  4RB1 A;  1UWV A;  4R4I A;  1DYQ A;  1IXR A;  4DV4 Q;  1WTR A;  1Q86 C;  1NAP A;  1Y8N B;  4K6D A;  4XT1 B;  3GV5 B;  4DL6 A;  1TWG A;  2Z8L A;  1HNX H;  1EY6 A;  4YHH Q;  2B2Y C;  3F8T A;  3KDF A;  1XMO H;  3WDN A;  2NTS A;  2VQE Q;  1D5M C;  4MTK A;  1PTO C;  1V1Q A;  3GO5 A;  4JI5 Q;  3HRZ C;  4PDB A;  1SYD A;  4DR3 Q;  4GOP A;  3ER0 A;  3OSP A;  4JVZ A;  4BY1 G;  2UU9 Q;  3H3V C;  2A6E D;  3ULJ A;  3P1H A;  3PUV A;  3UQ8 A;  2I87 A;  1KEE A;  3I4N H;  1Y8O B;  3TP8 A;  1TT2 A;  4Q44 A;  1QNK A;  1A9X A;  3RB3 A;  2A68 D;  4MV7 A;  5KFI A;  1IBK L;  2HGS A;  4EGQ A;  1N34 L;  4DL7 A;  1JWM D;  1PDQ A;  2I07 B;  4DR4 Q;  1TWH A;  2GVA A;  4JC0 A;  2JA7 G;  1A15 A;  4K14 A;  4CJ1 B;  5KNC A;  5FO8 B;  4EBD A;  4APM A;  1B70 B;  4CDE C;  5FJ8 H;  2JA6 G;  2QF7 A;  5GAG C;  4DL5 A;  4IAJ A;  1K3R A;  2L55 A;  2HHH H;  1FNU A;  2KED A;  4XTC S;  2IP4 A;  1WI5 A;  4DV7 H;  4ZKB B;  4UY8 C;  4OO1 H;  3M4P A;  3ORQ A;  4JI0 Q;  2F0D A;  3RB6 A;  3N42 B;  2YS6 A;  1EZ1 A;  5IIF A;  1A3U A;  4ED7 A;  4A3C H;  1CQV A;  3MC0 B;  2FKL A;  2YU9 B;  2HDM A;  1M6V A;  5DLF A;  3J80 L;  1ZKO A;  3M9M B;  1QUQ B;  1LYL A;  2F0G A;  3H6M A;  2UVW A;  1WTW A;  4YP3 A;  5CBE E;  2JA7 A;  4R4C A;  4AQY L;  4CKE A;  2JEA I;  5LMN Q;  2VUM B;  1PA6 A;  4A3F H;  2SNM A;  2JA6 A;  2XTI A;  3PUW A;  1J5E Q;  1Q8K A;  4KY5 A;  3CPW A;  5KFL A;  3J80 W;  1K83 A;  3GTM A;  3RLF A;  5LOV F;  1S97 A;  1F2Z A;  3HOW H;  3OTO Q;  3NBI A;  2J7Z A;  1HR0 Q;  4JI2 H;  4ME6 A;  2VQF L;  1CQJ B;  2FK3 A;  1G8Z D;  1DV2 A;  3FRP B;  2E2J H;  3K7U C;  4Q8E A;  1O7Z A;  2VZA A;  3QOL A;  2L4N A;  1FYC A;  2ZJP A;  4RZQ A;  4UCS A;  3K7A B;  1VQJ A;  3RZD B;  1XNR L;  3NHH A;  4ZCK A;  3WO0 A;  5F9N A;  4RGO S;  2WTF A;  4R8U A;  4IRD A;  4G57 A;  4LW1 A;  3GTP H;  4A3B H;  2EDG A;  4G4K A;  3CQZ B;  5K36 H;  4UCR A;  4B9W A;  2E5L Q;  2HUG A;  5K2M A;  4BWG B;  3RZO H;  5CC4 A;  5BN4 A;  5KFC A;  4A3G H;  4HNT A;  4JI6 H;  4RNO A;  2IL8 A;  1CKO A;  3EBE A;  5KFH A;  4M9U A;  5EWE A;  2ATL A;  1I4P A;  4X64 Q;  3H91 A;  3H15 A;  1JC7 A;  2XWB B;  1I50 H;  1N32 H;  1WTV A;  2SCU B;  3I90 A;  4LUO A;  5CV7 A;  4X66 L;  3M9B A;  1KAA A;  5KGU A;  5BPF A;  4DU9 A;  3JC6 6;  2C00 A;  4ETS A;  3PW0 A;  1SYB A;  2F0H A;  3PO3 B;  4GNX A;  2F0P A;  1SFO H;  5C4X G;  1N56 A;  3MR6 A;  2O2L D;  1ZYR C;  4WRD A;  3MWY W;  3HKZ B;  5COR A;  1I6H B;  2WE6 A;  3KHR A;  3TS0 A;  2R92 G;  5LP6 F;  4LF4 H;  4RMF A;  2BA0 A;  2A73 B;  2V5A A;  2KBN A;  4LF5 L;  2K28 A;  3N8D A;  2P5Z X;  4JK1 C;  5A35 A;  2UUC L;  2Z6K A;  1TWG H;  3HOZ G;  1DJR D;  3GID A;  3MWE A;  1WOC A;  1U5K A;  3CCS A;  4B3R H;  4FS1 A;  2ALZ A;  3BVG A;  1KQS A;  3V6K A;  1VQ9 A;  4DXF A;  3G4S A;  4GLX A;  2ZT9 C;  3NXW A;  4R8N A;  3S15 H;  2W6Q A;  3G8C A;  2M00 A;  2NWG A;  1XNQ H;  1N36 L;  5KFV A;  1PH3 A;  5EDW A;  2MP1 A;  4KHP H;  2G5D A;  4XYO A;  2NVX B;  3FHW A;  4IPD A;  2R92 A;  4B3S Q;  4RZR A;  2YW2 A;  2A5H A;  5BR8 L;  3M9N B;  5GRO A;  3V96 A;  3A55 A;  1TWH H;  3A8I E;  4YIJ A;  3J7Y W;  1VQM A;  4F4X A;  1RKN A;  2YV5 A;  5LYJ F;  2RHQ B;  1G2T A;  1SCU B;  1TS5 A;  1SE2 A;  2B2Y A;  2W9C B;  1CA5 A;  4A93 B;  1B1Z A;  5I47 A;  2JEG A;  5M3F B;  4BY1 H;  1HQR D;  1AFP A;  4BA2 I;  3A74 A;  1V1P A;  1T9H A;  4XQN A;  3J7Z C;  4JCV E;  3LP8 A;  4DK6 C;  3CRL C;  2JEF A;  5DG8 A;  2QEX A;  4MIU A;  5DGB A;  2FLP A;  4H7B A;  3OOC A;  2XIW A;  2NYZ D;  2JA7 H;  1VAJ A;  1XDN A;  1V8Q A;  2M9V A;  1BCP C;  1MIU A;  2JA6 H;  3TIG A;  3AFQ A;  1K83 H;  2UUB H;  3GTM H;  1VQI A;  1GUG A;  2E76 C;  4DAY A;  5IP9 G;  2EQS A;  3J81 E;  4FM9 A;  1TR5 A;  2K5Q A;  4XYM B;  4PWQ A;  3S2H H;  1DOM A;  2J0T D;  1G91 A;  1TY2 A;  3HXL A;  1I3Q B;  2KEE A;  4ZQ3 A;  1VF7 A;  3HOV G;  2K50 A;  2AHO B;  2XIG A;  1TWF B;  1BF4 A;  3KBX A;  4YHH L;  3RJ0 A;  4DUY Q;  4QW8 A;  2SDF A;  1EU4 A;  4JI5 L;  3BDC A;  4YCV A;  3I2Z A;  3KHH A;  3NWT A;  2LSS A;  1QE6 A;  1SE4 A;  3T1Y Q;  1GJX A;  1VMC A;  1EIF A;  2XGP A;  4HSP A;  3A0J A;  1A8V A;  1CKN B;  4J9N A;  1G2S A;  2QEJ C;  2FMA A;  2BA1 A;  4I7H A;  4MV8 A;  1X55 A;  1B6S A;  1UC8 A;  2XN9 C;  1SYG A;  3T1H L;  3V6J A;  5AFW A;  4DR4 L;  2VB2 X;  2OF1 A;  2F52 A;  3J7A K;  3UFX B;  3LWB A;  1WVL A;  5JEA J;  1RIP A;  4A3D B;  1TKW B;  4MV6 A;  5DEH A;  1ML0 D;  2R7D A;  5J22 A;  3BDL A;  1VQA A;  1XPU A;  2AU0 A;  2BQ3 A;  1YVC A;  1CZW A;  1HA6 A;  2HHH L;  3VR2 A;  1Z9F A;  4PMB A;  4AIM A;  3PO2 B;  4P74 A;  3RV4 A;  1LT6 D;  2K5V A;  4IQZ A;  4JI0 L;  2YZN A;  5FK9 C;  2F4V H;  2O5J C;  3NEL A;  3RB4 A;  4KKT A;  1O75 A;  4H44 C;  3BZC A;  5KFN A;  1I4Q A;  5CV5 A;  4ED6 A;  4DV0 H;  4K2K A;  3Q8Q B;  1SMY C;  2I0Q A;  3DXJ C;  4PZ6 A;  1VQK A;  4UCT A;  3TP7 A;  3GIK A;  1DIK A;  3NSW A;  4LUV A;  4U68 A;  1X3Q A;  3TQY A;  2UUA Q;  2F0L A;  2K14 A;  5C4X H;  1J5E L;  2KCT A;  5DAU A;  5KG2 A;  3VR4 A;  3V4Z A;  1IYU A;  4DPG A;  1ZQ7 A;  4O4H F;  5LMN W;  2R92 H;  3A54 A;  2A74 C;  4LF9 L;  2QA4 A;  5EPK A;  2KQ3 A;  4JI2 L;  1PH1 A;  1Z47 A;  4LFB H;  3W3A A;  3OUU A;  4L5R C;  2JA8 G;  1FNV A;  4MA0 A;  3GTL A;  1RF2 D;  3S24 A;  1HR0 W;  1CHP D;  3HOZ H;  1HQM C;  1SND A;  2HDL A;  3GV6 A;  4GN4 B;  4IWY A;  2EJM A;  3L3O C;  4L8J A;  5KG0 A;  2BR0 A;  1W6K A;  3DWP A;  1S0O A;  2WKC A;  2PZU A;  3GIM A;  4X65 L;  2F3V A;  1O80 A;  2E5L L;  4QQB X;  1XX8 A;  3MXN A;  3IAY A;  3H3V H;  1LLR D;  4H02 A;  4OX9 L;  3KF6 A;  4R4O A;  3VR3 A;  4JYA Q;  3U9S A;  2GN5 A;  1FNW A;  2UXC Q;  1AN8 A;  3HFZ B;  3OUZ A;  1LM0 A;  1VQ8 A;  4LF8 Q;  5IWA H;  2R7N A;  1GD7 A;  3ERQ A;  1N32 L;  4JV5 Q;  4F8M A;  3R2I A;  2L5T A;  4FF2 A;  4B3T H;  1XTC D;  3H40 A;  2VS1 A;  3PF5 A;  1WCM G;  4HJA A;  3S1R H;  3S1N H;  2OWO A;  3QZ8 A;  4DR2 Q;  5C4Z A;  2N3S A;  1SYE A;  2LY7 A;  3CC4 A;  4JI1 Q;  1NTG A;  2ZXO A;  1UE7 A;  5DLG A;  4X62 Q;  4FP5 D;  4LWC A;  3PR5 B;  3CCM A;  1YJ9 A;  4LF4 L;  5FOB B;  1Q3L A;  2X6G A;  4O3N A;  1WTO A;  1O78 A;  4A3I G;  2EYP A;  1GHK A;  4IUU A;  4HIM A;  1KJI A;  2R7Z B;  1S68 A;  2O03 A;  2NN6 G;  1L0W A;  2UXD H;  4IFD J;  3S9W A;  1WCM A;  2C2R A;  2F1M A;  3VMM A;  4I65 A;  2QDB A;  1XPO A;  3NGD A;  1F2L A;  2K7V A;  2YRX A;  5IP9 H;  3HZX A;  1LTS D;  4FF3 A;  2HT1 A;  3GTQ B;  4ZOL F;  2KJX A;  2IA6 A;  1QWY A;  4DR6 H;  4UDU C;  4ECU A;  1M8A A;  4X3T A;  5EKL A;  1IW7 C;  4JBK A;  3T5K A;  3EIV A;  1B9N A;  5KG1 A;  3HOV H;  1CS0 A;  2L1B A;  4F88 A;  3I72 A;  3ND9 A;  1EYD A;  1FGU A;  4GKK Q;  5DGA A;  1D6E C;  3A56 A;  1MBY A;  2W8K A;  3PUZ A;  4RKL A;  5EKK A;  4TQR A;  2ZTD A;  2L11 A;  4JI4 H;  4EYH B;  3KJP A;  1N33 L;  1B33 N;  1JWU D;  3HEJ A;  4NB3 A;  2B63 G;  1WR2 A;  4C2M B;  1PRT F;  4RWS C;  2UXB Q;  2JA5 B;  1M1K C;  3DEP A;  1NR4 A;  5IOD A;  4IHJ F;  4WBN F;  4DF7 A;  3AYH B;  2F0I A;  3J81 c;  5A2Q L;  4DA2 A;  4F7X A;  4O2B F;  2YYA A;  2AQ4 A;  3U9T A;  3QZ7 A;  3HOX B;  4NXM Q;  1KDB A;  2H1E A;  5A2Q W;  3S17 H;  3HOW B;  1AUV A;  5ISR A;  4LMQ D;  3K58 A;  4J9S A;  3C46 A;  3AMU A;  3GTK B;  1KJJ A;  3R23 A;  3R8B A;  2B63 A;  4J15 A;  5KFJ A;  3Q24 A;  3ETJ A;  2FIN B;  1PVO A;  3F2U A;  1RCV D;  2FK2 A;  2MCT A;  5ELO A;  3CRK C;  3SEB A;  1M0T A;  4J0M A;  2FFK B;  5GAD C;  1M90 C;  3TBI B;  1L1O B;  1QJO A;  2R8J A;  4TV9 F;  3RFC A;  3GTL H;  5KG6 A;  2W7O A;  3GTP B;  4MTE A;  1KD1 C;  4HJ8 A;  3J7A 5;  2Z9H A;  1PFN A;  4UHV A;  1IKL A;  1CQF A;  1SR3 A;  4TQU S;  2WKD A;  3Q0A A;  4A3G B;  4DV5 Q;  4AQY Q;  2PBZ A;  3PVX A;  3F2B A;  3GTO A;  2B2W A;  1BO0 A;  2K1B A;  5H1S E;  1KXL A;  3EJI A;  1LTI D;  3T1Y L;  2R85 A;  1I50 B;  5IGD A;  2A1A A;  4NXN Q;  2BE5 D;  1MKH A;  2WFW A;  1VBG A;  5DQI A;  1NNX A;  2V9W A;  3ITP A;  3H0G B;  2VQF Q;  3U4V A;  5E7N A;  4CHT B;  2JA8 H;  5BN3 A;  3JRX A;  5KEE A;  2NVY A;  1IHZ A;  5C3X A;  2AMC B;  3U58 A;  4JUZ A;  1ET9 A;  1I94 H;  3LNN A;  4PZ8 A;  5EPJ A;  4FYD A;  1EY8 A;  5KFF A;  2QW7 A;  2RDH A;  1SYF A;  3E9I A;  4C5B A;  1YNJ D;  4KJN A;  1EHI A;  4HCS A;  2GPS A;  3T16 A;  3K59 A;  3L4K A;  2Z1C A;  2FXQ A;  3K5I A;  4ZHQ F;  4Y52 H;  3KLW A;  3X3N A;  1PH8 A;  3GLK A;  1PTO D;  3PN1 A;  1JX4 A;  3GTG B;  2DPJ A;  5FPO A;  4IPG A;  4GS3 A;  4MZ9 A;  3G6Y A;  4DV6 H;  2HIX A;  3PW5 A;  5JQW A;  3MHB A;  2IY5 B;  4GOP B;  3RGX A;  5EZY F;  3H4B A;  3S1Q B;  4X66 Q;  1IBL Q;  1WCM H;  1H9S A;  3JAM L;  1JOQ A;  2FK1 A;  2PQE A;  1A6X A;  1PZJ D;  5IYB G;  3KLS A;  4EG0 A;  1HCZ A;  4KKS A;  1EIY B;  1CQI B;  1S72 A;  4B3M H;  2NVT B;  2K32 A;  2AUK A;  5KRU A;  5IYD G;  2PMZ A;  1TWH B;  3JAM W;  1KC7 A;  5IT9 W;  4UP8 A;  4HR7 B;  3D3R A;  4JPB W;  1SBB B;  4A76 A;  3UDG A;  3C3L A;  3FKI G;  3K5L A;  3KHL A;  4HYK A;  1ZET A;  1TA8 A;  3M85 A;  4HIO A;  4DV3 H;  5L1I A;  2PNR C;  4BY7 G;  1S5C D;  4MA5 A;  1Y8P B;  4LFA H;  4A3I H;  4LF5 Q;  4DK0 A;  1Q82 C;  3S1M H;  2RGR A;  1UUP A;  2PI2 A;  4FS2 A;  2EVB A;  4EGJ A;  3DM1 A;  2NN6 H;  4BY1 B;  4IZO A;  5M5Y B;  1TWC B;  1WD1 A;  2YZM A;  5EAY A;  3E5S A;  2C2D A;  4N8X 1;  4R4Q A;  5CGK A;  1A63 A;  1V1O A;  2X0S A;  2PMZ E;  4K0K L;  2JEB I;  5T1I A;  4MTD A;  1N36 Q;  1KJ9 A;  4JYA L;  5CBA E;  1YJW A;  5KFK A;  4DAP A;  3FKI A;  2JA6 B;  2K52 A;  1PFB A;  3NEN A;  5FKA C;  4LF8 L;  2PI2 E;  1Y69 U;  2W6Z A;  2HCC A;  3V6H A;  3R93 A;  1AEX A;  4JV5 L;  1FKA H;  5IWA L;  1PH4 A;  1TWA B;  4HJ9 A;  3GP7 A;  1STN A;  2I5M X;  2E2H B;  4GNX C;  4XQJ A;  5BMV F;  1O7L A;  3S2H B;  4KI0 A;  3P75 A;  4NP5 A;  4YR0 A;  4DR2 L;  4K5W A;  2B63 H;  5C1P A;  4YAJ B;  5C3E G;  1K28 A;  4A3E G;  1M0W A;  1A3T A;  4DUZ H;  3A8K E;  4RB2 C;  2MGS A;  5L1L A;  3VR5 A;  4DFA A;  4JI7 Q;  3I55 A;  3RN5 A;  4R8U B;  5DG7 A;  2XRQ D;  1F9Q A;  4XQQ A;  3Q6S A;  4CKB A;  2Z6K C;  2E75 C;  3L7Z C;  4EBE A;  4LFC L;  4G3I A;  1FJG H;  2AUJ D;  5LMU H;  1ILP A;  2MPM A;  3PIP 3;  1E4E B;  4ECV A;  1SE3 A;  4MV9 A;  4CC5 A;  3CU7 A;  5EQ0 A;  4RH6 A;  1K73 C;  3GTO H;  3MFH A;  5CYU A;  1A2U A;  2ZM6 L;  3QJY A;  5IGG A;  2Q2H A;  1Q1E A;  3QWN A;  4J1M A;  4DR5 L;  1ZYR D;  2C28 A;  3OSO A;  1E4F T;  3BVZ A;  3M7N A;  1Y1W G;  2ZXR A;  1HFN A;  2LS0 1;  1JOR A;  2YZG A;  4DAM A;  4CC6 A;  2B2V A;  4EEY A;  1EQQ A;  4DL2 A;  4YY3 Q;  2NVY H;  3NBH A;  5I6W A;  2JQO A;  4QUC A;  4ALP A;  4UFZ A;  3PUX A;  3J80 i;  1WD0 A;  4GKK L;  1XYI A;  1HXY D;  3RN2 A;  4N9T A;  2DUD A;  1HNX Q;  3CXC A;  2JN4 A;  2AGP A;  4DNI A;  2ZTC A;  2WB1 G;  1SRU A;  5G3L D;  2XCA A;  2A6H C;  2CHB D;  5EBC A;  2UXB L;  4ZQI A;  4BWS C;  4ODG A;  4HJ7 A;  1XMO Q;  2C35 B;  1R9T A;  2J6T A;  2RDJ A;  4J9L A;  4C3H B;  2N49 A;  4OIJ A;  4DV4 H;  1FVI A;  1U4M A;  4I50 F;  2FHT A;  3PCO B;  1Y1W A;  1STY A;  3TS2 A;  1I7L A;  2B3G A;  2KHI A;  2PNH A;  1W93 A;  1JR0 D;  5K5P A;  1NSN S;  1EIH A;  5M5X H;  4DV2 H;  3GD7 A;  5C4X B;  1GLV A;  1TAE A;  4HQ6 A;  4A3J G;  2M2L A;  4YR2 A;  4NXM L;  4EGV A;  1MSG A;  2AWO A;  3T1H Q;  2E2I B;  3L4J A;  2VQE H;  3K3P A;  4XXE A;  4O3R A;  2RF4 A;  2IJ0 A;  3VDY A;  4DR3 H;  4KY6 A;  1DV1 A;  2UU9 H;  1PMR A;  3KF8 B;  3U9O A;  2WB1 A;  5E3F A;  1GSO A;  2ASD A;  3NPP A;  1JJC B;  3SE7 A;  4JI3 H;  1RD9 D;  2PZW A;  2HHH Q;  4LUZ A;  3I4L A;  4DV7 Q;  1D1I A;  2DN8 A;  2K5D A;  3NUC A;  5T1G A;  1NBW A;  4KKU A;  3OYY A;  4C1N K;  5I9P A;  2NBF A;  5D1O B;  4O42 A;  2JSO A;  2ALY B;  1EUD B;  1SRO A;  1PTO B;  1EFW A;  1Q8I A;  5KIX A;  2MO1 A;  2K05 A;  3HOY B;  4K6L A;  5M9O A;  1FR3 A;  4QIW E;  4DV5 L;  2WB1 E;  5KT3 A;  4G7H C;  3D4W A;  3PR4 A;  3GTJ A;  5IYB H;  1NMF A;  2NZO A;  2YL2 A;  5D1P A;  2VUG A;  2R8I A;  4NXN L;  3G6E A;  5IYD H;  4TUY F;  4A3K G;  2EJG C;  4LF9 Q;  4HTH A;  1QVF A;  1M7J A;  5AJ3 Q;  3FKI H;  4JI2 Q;  3S1R B;  2R86 A;  2FPP B;  3K5O A;  3E6Z X;  4BY7 H;  2EXD A;  4ZK9 B;  4IRC A;  3H94 A;  5LMN H;  5IGF A;  2W71 A;  2AWN A;  4LAA A;  5CV8 A;  5TSS A;  4LNQ A;  2NVQ B;  1EWC A;  5FO7 B;  5ELD A;  2K5N A;  5G3L F;  1DON A;  1RTN A;  4HID A;  1DZ1 A;  4ZUI A;  4RA8 A;  4Z9C B;  2EY2 A;  3OTO H;  4CDC C;  1I4R A;  1Z6H A;  4JG2 A;  1QZG A;  4U6P A;  4X65 Q;  3VYU A;  2CW7 A;  1VQC A;  1EY9 A;  2K01 A;  3OSN A;  3GIJ A;  5C4J B;  3I12 A;  4LF7 H;  2RHS B;  4OX9 Q;  1KJ8 A;  2PQA B;  2W6M A;  1LTB D;  5ELB A;  1NJI C;  3PW4 A;  2NN6 I;  2DY7 A;  1RJT A;  4JI6 Q;  4R4T A;  1XXG A;  2RSO A;  4L6T B;  4B9X A;  4DK1 A;  3E5N A;  3Q22 A;  4YQW A;  1N48 A;  3SI8 A;  1VQ5 A;  3VPD A;  2SEB D;  1YNN C;  1N32 Q;  5LA6 F;  4F4Z A;  4OL7 A;  3L9A X;  1IBL L;  5GAH C;  1C8C A;  4HMI A;  2XVS A;  1D7Q A;  1QIL A;  4MTN A;  1LTT D;  3RBD A;  3D31 A;  5C3E H;  2KSW A;  4A3E H;  3CKI B;  4DNT B;  1E7Z A;  1WTX A;  5C3W A;  4DR7 L;  1GSA A;  1HTL D;  4X64 H;  4C3I B;  1BNC A;  1K8A C;  4A2B A;  3RIZ A;  2SNS A;  3QO2 A;  5EBD A;  1HNZ H;  4LF4 Q;  1QNU A;  4CJ2 C;  4DV3 L;  2DJF C;  4P2C B;  1LTL A;  4A4I A;  2I46 A;  1AP0 A;  1VS0 A;  4KV6 A;  2JYO A;  4BBS B;  1CE8 A;  5IOC A;  1E2V A;  4J9M A;  5J2U F;  4B3R Q;  1L0X B;  5D3D A;  1R9T H;  3G48 A;  4FXG C;  2HJW A;  4F87 A;  4GKJ H;  3UE0 A;  1BDO A;  1XNQ Q;  3K5N A;  5BPH A;  4PMC A;  1Y1W H;  2WP8 J;  5FLX c;  1E2Z A;  3S17 B;  5L9X A;  1SEI A;  1F9R A;  5CR3 A;  4LF6 H;  2V58 A;  1TVX A;  2W57 A;  2H4O A;  4K5V A;  4FNF A;  1AUX A;  1Q90 A;  4Y7N B;  4O4L F;  4RUA A;  3BJU A;  3P20 A;  4GC7 A;  2ASL A;  1JLL B;  4RU9 A;  4F4W A;  4UP7 A;  4GLV B;  2A8V A;  3QR8 A;  1KNA A;  1HRJ A;  4J9K A;  3S14 H;  1NCV A;  5J1Z A;  3VPC A;  5I6Y A;  1N33 Q;  4RKB A;  3FMA A;  5H80 A;  4JW0 A;  2GVB A;  3GTL B;  2WAC A;  4B3S H;  1GUN A;  3GIP A;  3I3C A;  2XSC A;  2J4X A;  4JI7 L;  3S16 H;  1JT8 A;  4RAZ A;  3UDF A;  2DWC A;  1FL0 A;  1V43 A;  2PO4 A;  4N8F A;  1EQT A;  2I8C A;  4WD3 A;  1HZA A;  4A3J H;  4ME5 A;  4CDF C;  5IT9 E;  4G7O C;  1PXU A;  2BDO A;  4FF1 A;  5KFY A;  3MXN B;  1CTM A;  2RKS A;  2YU9 A;  1STB A;  5JEA G;  3GTJ H;  5FLM G;  4RNN A;  2NU9 B;  1QUQ A;  5JH7 F;  1VDZ A;  1GVP A;  4N9P A;  2CW8 A;  1HUM A;  2UUB Q;  2RGV A;  5COY A;  3KYH C;  2ZJQ A;  4OWW B;  1WSC A;  5DM6 3;  3GII A;  4I4T F;  3CMA A;  2YYZ A;  1WTH A;  4YY3 L;  2D9U A;  5KFW A;  5DLQ E;  4GN3 B;  3TN2 A;  1GUW A;  1VBH A;  4IUP A;  2W6P A;  2ATW A;  1G51 A;  3O13 A;  3M3Y H;  3STB D;  1BBU A;  1ONL A;  3MEH A;  4OEL B;  5FO9 B;  1XMQ H;  1HNX L;  3BG5 A;  2DNE A;  4M8A A;  1OTC A;  1UAP A;  4H0L C;  2A19 A;  1ULZ A;  1YJN A;  1XMO L;  4QWE A;  1L2Z A;  1JDE A;  3AEV A;  1DOL A;  5HGQ A;  4J9P A;  2A69 D;  2G9H D;  4HNU A;  4DN4 M;  1PHJ A;  3PO3 G;  3JSN A;  3KHG A;  4A3K H;  1B44 D;  1RL2 A;  3M4O H;  2DNC A;  3PF4 A;  2CWP A;  4KD3 A;  3M7G A;  3BZK A;  4A3L G;  5KFG A;  3CF5 A;  2HVR A;  3HKZ G;  1K3B C;  1BCP B;  1EYZ A;  3T5H A;  2V4Q A;  2KEN A;  1IW7 D;  2HVS A;  2ICI A;  1P16 A;  3GV8 B;  2W9A A;  2W9B A;  3TRE A;  4ED3 A;  4FVM A;  1YHQ A;  4X3U A;  1CT1 D;  1LUZ A;  1PH6 A;  5KX5 F;  3RLO A;  3OHX C;  3BYT B;  2PW7 A;  4Q0F A;  5KT2 A;  3CC2 A;  1B53 A;  1VCI A;  4A3I B;  4RB3 C;  1YZ6 A;  4DAV A;  4RHR A;  1ENC A;  2RA4 A;  4DV7 L;  1IOV A;  1Z2N X;  4L5Q A;  1AH9 A;  5E4W C;  3R5X A;  2F4V Q;  2RQX A;  3QG1 A;  1MZB A;  2KCN A;  3HKZ A;  4OXP A;  4JI8 H;  2KHS A;  4BBR B;  2O4X A;  5EKI A;  4O0A A;  4XT3 B;  5I4D A;  3Q23 A;  4DV0 Q;  4R9W A;  2B2W C;  2MFI A;  4P75 A;  3P7J A;  3SR1 A;  3QFF A;  4JOI A;  2CW0 D;  3MXU A;  1BXT A;  3WNZ A;  4OHJ A;  5KFB A;  1BKB A;  3DEO A;  1GM5 A;  3KLS X;  3MXG A;  3NQT A;  1V51 A;  3Q8S B;  4A93 G;  5AJ3 L;  3LML A;  3OPO A;  1TS3 A;  3HKZ E;  2PW5 A;  3SK6 A;  4DV1 H;  1R4P B;  5M3F G;  2KCM A;  1PLF A;  1X3P A;  2B63 B;  1BUV T;  3HGB A;  3M4Y A;  2NVX A;  2UUA H;  5KYI A;  3DHQ A;  3F1Z A;  1YBY A;  5ELF A;  4LH7 A;  3OWF A;  5C0X G;  2J6U A;  1MSH A;  5JJK A;  2CH4 W;  5EWF A;  3NTH A;  5LL6 b;  4NKL A;  1CHQ D;  1B9M A;  3CCQ A;  2WIN B;  3E9H A;  5M5W H;  1VF5 C;  2KA7 A;  4U7C A;  3EQL C;  5HGT A;  4K0K Q;  2ZDQ A;  3IFD A;  3SXH A;  1XTD A;  1MHW C;  4IUR A;  1DM0 B;  4ZAI A;  3OW2 A;  1EYA A;  2W9C A;  2RVL A;  4MV4 A;  2IHF A;  4LF7 L;  4JI6 L;  3TEH B;  3DLL A;  1JJ2 A;  4RB0 A;  3FDT A;  3T4A C;  1A2T A;  1Z2O X;  1MJC A;  2K5H A;  1TY0 A;  1C30 A;  5IWA Q;  4KY7 A;  3G7L A;  1EFI D;  5EJW A;  1EY7 A;  2CKZ B;  1OXX K;  2YU9 H;  4C1N I;  5KND A;  4B3T Q;  4YJ3 F;  2JJQ A;  4AYB B;  4RAY A;  1LTG D;  3WO1 A;  1IBM H;  4TQS A;  4HED A;  4OIK A;  3OMG A;  2UXC H;  5L37 A;  1A3V A;  3NWS A;  4DR1 H;  3TME A;  3OMC A;  3N52 A;  4OEM B;  3J80 E;  1AN7 A;  5IGB A;  1C3O A;  3QOJ A;  1GUS A;  2CWA A;  2B8F A;  4G7Z C;  4APV A;  3N41 B;  3RBE A;  4LFC Q;  2NTT A;  3N6X A;  1ZHS A;  1BGW A;  1HJP A;  2GA4 B;  1I3Q A;  3K8A A;  3IL8 A;  3I4N B;  2DZD A;  4B3R L;  5JEA H;  4X62 H;  3T5J A;  1HH2 P;  4ULL A;  5FLM H;  3K7A H;  3K6O A;  4OGQ C;  2F0J A;  2ZM6 Q;  1ILQ A;  3RZD H;  5JOB A;  4A3D G;  3JRW A;  5KFZ A;  4IR1 A;  1M4V A;  1XNQ L;  2JXM B;  4DR5 Q;  2XD4 A;  2L0C A;  4A3M G;  1EEI D;  4P73 A;  4GKJ L;  4KHP L;  3MWD A;  5JJL A;  3MAQ A;  1H9S B;  5KKN B;  1RJR A;  4WFN 3;  1UEB A;  4O3Q A;  2HQE A;  4IOC A;  1C4Q A;  5KNB A;  3FEW X;  3PO2 G;  2OH2 A;  2JA9 A;  3PGZ A;  2F0W A;  3FDS A;  5ELN A;  5IT9 c;  1S0N A;  2R87 A;  1CKN A;  2LXK A;  5CB4 F;  1JE5 A;  1O7Y A;  2NU8 B;  1S10 A;  5HBR B;  2RDG A;  1X3E A;  1E1O A;  2R6G A;  1TQO A;  4JI4 Q;  2HIV A;  2F0E A;  3QIA A;  4IN3 A;  1HNW H;  4Y8V B;  2CZG A;  5J2T F;  3PO3 H;  4J9R A;  2V4R A;  1EZ8 A;  1RK5 A;  2J6S A;  4I55 F;  2OCE A;  3M4Q A;  4A3L H;  4FU0 A;  2B2T A;  4A3F B;  2VXW A;  1D1K A;  3S2D H;  3T51 B;  1ZXT A;  2EYL A;  1RK6 A;  2DIK A;  4O1N A;  3BA8 A;  1SSO A;  2C2E A;  2IT1 A;  3MFY A;  5KFO A;  2DJG C;  4ED1 A;  2EIF A;  2E2J B;  2R7L A;  4MV3 A;  3EPG A;  4ED0 A;  1HZ9 A;  1Y1V G;  1CKM A;  2K5W A;  2Y0S B;  3F8N A;  2UUB L;  1GYF A;  2VNU D;  3G6V A;  3BQ1 A;  3OIQ A;  2K75 A;  2F0T A;  4I7Z C;  2B2V C;  3TIN A;  1IBK H;  1N34 H;  3MEF A;  5D14 A;  3EPI A;  1ASZ A;  1J8I A;  4DK3 C;  2WAQ B;  3U4Z A;  1Y14 B;  4XIG S;  4GZY C;  2NVX H;  4RCN A;  4A3B B;  1EWH A;  1WH2 A;  4J9O A;  2ES2 A;  2ASJ A;  1ZEQ X;  3G71 A;  1OXT A;  3HG9 A;  3VA7 A;  3BS1 A;  3RZO B;  2KCC A;  3JAM i;  2FP4 B;  3I4O A;  2FB9 A;  1C9O A;  3BJY A;  2PYK A;  4TV8 F;  4ECQ A;  2PN1 A;  1Y1V A;  2YTX A;  3NTK A;  2YTY A;  2DY8 A;  4CGY B;  5JPN C;  2F0V A;  4ZYS A;  2C22 A;  4A93 H;  2RBM A;  2CCZ A;  5CV6 A;  2RDI A;  3I8Z A;  3BAB A;  5M3F H;  2B8G A;  1SFO B;  5C3E B;  4C3J G;  2Q8R E;  3UI2 A;  4AQY H;  1EEF D;  4OWT B;  2FLN A;  3D4D A;  5C0X H;  4EQO A;  1DCZ A;  5C1O A;  1PH2 A;  4UPA A;  2IX0 A;  2LFN A;  5D65 A;  5IP7 G;  2E2D C;  1I6V C;  4IPC A;  1PRT C;  2BOS A;  2R7Z G;  4EBC A;  1E22 A;  3K5H A;  1FD7 D;  1Q1B A;  2F0Q A;  2V4D A;  5D8D A;  1TWG B;  5F9L A;  4NDX A;  2V1C C;  5KT7 A;  2X69 A;  3PSI A;  2VA3 A;  2F4V L;  3K5M A;  1JQY D;  2VW9 A;  3N6R A;  3KDF B;  3GIL A;  4E4T A;  1XNR H;  1BR9 A;  4ILW A;  3S15 B;  3Q2O A;  4DV6 Q;  4JI8 L;  3KLR A;  2HCI A;  1UNN C;  1V4Y A;  2OTJ A;  4DV0 L;  1I3Q H;  2ENB A;  4IUV A;  5GAE C;  1YHB A;  4Q5V A;  2AQ2 B;  1PX2 A;  4RGT A;  1SNC A;  2ICE C;  3UE1 A;  4P71 A;  4NPS A;  5KT6 A;  2R7Z A;  3T56 B;  1EOT A;  2F0K A;  2WYO A;  3CP0 A;  2DLN A;  3KAJ A;  4DR7 Q;  1H9K A;  1J9O A;  2OEO A;  2EOT A;  4V0B A;  4B3M Q;  1GKH A;  2G9D A;  5CV9 A;  4HN7 A;  1U9R A;  4TSS A;  4ECY A;  1STH A;  2DPI A;  2JA5 G;  3D8G A;  4GN5 A;  1OWT A;  2BDN A;  3DF7 A;  4LFB L;  4X66 H;  1OXS C;  1GUO A;  3GTQ A;  2D2C C;  3Q1K A;  2JEI A;  4DV3 Q;  3I4M G;  1Z7T A;  1SMX A;  4KLK A;  4EQN A;  1U4R A;  4LFA Q;  2PPB C;  1MGS A;  5EGT A;  1QCB D;  4IAL A;  3S16 B;  2QK4 A;  3A7A B;  1K9M C;  1JB7 A;  1EY0 A;  4O3P A;  4IO9 A;  3HOX G;  4KTA A;  1Z2P X;  1K8O A;  4QW9 A;  3H4D A;  4A3D H;  2W8L A;  3VYS A;  4A3M H;  4J6H A;  1JDB B;  1EIG A;  1R4Q B;  2JA7 B;  1STA A;  2Q2T A;  4C2M A;  3G6J B;  3J81 L;  2UUC H;  3J80 c;  2O5I C;  2JA5 A;  3PO2 H;  3T13 A;  1K83 B;  3GTM B;  4BS9 A;  1H95 A;  1I5F A;  2SOB A;  5JVL A;  3SK8 A;  3KJO A;  1GSH A;  1YIT A;  3J81 W;  2D62 A;  2MHV A;  1Q81 C;  4B3T L;  1MI2 A;  2R93 G;  1N36 H;  3A7L A;  4CDD C;  1PTO F;  2K04 A;  4YAK B;  3HB9 A;  2EY6 A;  3CAM A;  3DWQ A;  4L63 B;  5BR8 H;  4UCU A;  1ZHQ A;  3BYY B;  1SYC A;  4DUZ Q;  5JVD F;  2IW3 A;  3AQQ A;  5C44 G;  3GTK A;  1VQL A;  2Z6B A;  5JVH 3;  2RCF A;  3MXP A;  2NU7 B;  5KFM A;  4MAM A;  1JIC A;  2ZTE A;  3H0G G;  1IKM A;  3TSS A;  3ULP A;  2K03 A;  1L1O A;  1C48 A;  4ID6 A;  3WOE A;  4A3K B;  2OQ0 A;  2L15 A;  5LMU Q;  2UXD L;  4QF4 A;  3BG3 A;  1SAP A;  3T5L A;  2R93 A;  4O4I F;  1CM9 A;  1K8M A;  1VQP A;  4IUT A;  1Y1V H;  1EYG A;  2IMW P;  5CMD A;  1L2F A;  5M3M G;  3SK5 A;  2UVV A;  1CSP A;  2Y0S E;  5C5L A;  1Q46 A;  1VQO A;  3LX0 A;  1E2W A;  4ABN A;  4GNX B;  4HSV A;  2Q2U A;  4DR6 L;  1D2B A;  1OXV A;  3PW2 A;  1RJQ A;  4J8Q A;  4DL4 A;  5JUM A;  3H0G A;  3ICE A;  5E4X A;  3ORR A;  3SE0 A;  4S3S A;  5GQO A;  2AQ3 B;  2N55 A;  4PV1 C;  4JI4 L;  4K2L A;  2BE5 C;  3PMF A;  1JCK B;  1OXU A;  1HUN A;  3SDZ A;  4IPH A;  1T36 A;  1QOH A;  2IHE A;  3CCR A;  1TII D;  3OW7 A;  1PH5 A;  3CCU A;  4QWC A;  3FPP A;  1RYR A;  1SJH D;  4DV2 Q;  4YHH H;  2EYM A;  1D8L A;  4C3J H;  1YNJ C;  3GTG A;  5NUC A;  3ULL A;  1UE5 A;  2EXZ A;  4JI5 H;  4PZ7 A;  5IGE A;  2R92 B;  4MV1 A;  2F0O A;  5IP7 H;  1UE6 A;  4QL5 A;  3KAK A;  5KFU A;  4QIW A;  1AE3 A;  4FBU A;  2R7Z H;  5IYZ F;  2IX1 A;  1T94 A;  3PQI A;  1W96 A;  3Q8P B;  3HOZ B;  3K81 C;  5IYC G;  4JI3 Q;  2R82 A;  3V2T A;  1JJG A;  1H9M A;  3T1H H;  4RUC A;  4DR4 H;  3NEM A;  1N9W A;  2E8G A;  5C0X I;  3GTQ H;  4C5A A;  3CCE A;  4WJ3 M;  3PW7 A;  2AGQ A;  3X3M A;  1W2B A;  4A75 A;  3UDI A;  5M5W B;  4YBZ B;  1KL9 A;  3BDO A;  3ONA B;  4HR7 A;  2HQL A;  2N8N A;  1PFM A;  2NUC A;  4YWM A;  4TKO B;  1V1P B;  2IWH A;  4IFD I;  5FPR A;  1X6O A;  5DM7 3;  5JAV A;  1PYB A;  1D5X C;  2C9O A;  4HMJ A;  3I70 A;  2K6A A;  3TZU A;  1BCP D;  5E1F A;  1IYV A;  4JI0 H;  4M7E A;  1RHP A;  2R8G A;  5EWG A;  4KMU C;  1ASY A;  1TWC A;  1TU2 B;  2AKW B;  1SNQ A;  3L0O A;  3NQI A;  5CV4 A;  3VA5 A;  2MJ8 A;  4C2M H;  4O2D A;  4O3S A;  3MTS A;  1HFG A;  4XYQ A;  2JA5 H;  5CA1 F;  5JJZ A;  2D5D A;  3S1N B;  3CVZ A;  4ECT A;  2KEC A;  1HZC A;  4QWD A;  3I4M H;  1L0Y B;  4DAY B;  4JBW A;  3LGJ A;  3PIP A;  1W3S A;  1I94 L;  1J5E H;  2Q8I B;  1SN8 A;  3W5O A;  4GC6 A;  4WJ4 A;  3MZ5 A;  4NMZ A;  3HOX H;  3PV0 A;  1HR0 H;  2VPS A;  3W1G A;  4MHE A;  5A2Q E;  1TWA A;  4LF9 H;  1YI2 A;  3HOU G;  5KG4 A;  5IY0 A;  2LKV A;  4C56 C;  2E2H A;  2F0N A;  3TP5 A;  1EUJ A;  2B2U A;  1PV4 A;  1QG7 A;  3GTK H;  5KT5 A;  1U4L A;  1B4O A;  1U4P A;  5L1K A;  1J6Q A;  4LF7 Q;  4JBM A;  2VOB A;  1DXM A;  1ENA A;  4L5S A;  4DV6 L;  1KJQ A;  3DWA A;  1AW7 A;  1GGO A;  1EY4 A;  4YJ2 F;  2R84 A;  3I7F A;  5HUR A;  2QKI C;  3LWU A;  4JOI C;  4X65 H;  1PFS A;  1UE1 A;  2E5L H;  1PZK D;  2D0O A;  2R93 H;  2R61 A;  5HV6 A;  4NLG A;  3RTX A;  4PQX A;  1QB5 D;  1E4E A;  4FBT A;  4OX9 H;  4DNR B;  3HOV B;  4HAE A;  3MR5 A;  2EYF A;  4B3M L;  4K8J A;  2W9B B;  4YCU A;  2BQR A;  5LL6 S;  1LAB A;  1PZI D;  3KK7 A;  5C44 H;  1LO5 D;  4C3H G;  1X65 A;  4XYL B;  1LAC A;  3CD6 A;  1HNZ Q;  1WYD A;  2M05 A;  3FP9 A;  2KUM A;  4LFA L;  3H0G H;  3KOJ A;  2W7P A;  3FPU B;  4EVO A;  2X6L A;  1KAB A;  1IL2 A;  4EYI B;  4MNO A;  4FDB A;  1SMY D;  2MUY A;  2PZT A;  3D6W A;  4JV2 A;  1BCP F;  2ZDH A;  5LXT F;  3C1F A;  4CBV A;  3W2D A;  3ERO A;  3ETH A;  3AB9 A;  5KYL A;  3S2D B;  4Q8F A;  4ZUJ A;  5M3M H;  5ELC A;  4GKJ Q;  1AE2 A;  4KHP Q;  2W6N A;  5KG5 A;  4KD4 A;  2CVR A;  4IJH A;  1VQN A;  1YIJ A;  4LF6 Q;  3GTG H;  3VPB A;  3PUY A;  4JBJ A;  2NU6 B;  1CZG A;  3JZI A;  4PG3 A;  1S0M A;  1RYS A;  1K0S A;  1S03 G;  3A5Z B;  1EQR A;  4OON A;  4CKC A;  1BVS A;  3ERS X;  5KFQ A;  2RCN A;  1X3G A;  2A6E C;  2B29 A;  3S1Q H;  2E2I A;  3HOY G;  5KT4 A;  2KHJ A;  1B3Q A;  4QJF A;  1JWS D;  2VR1 A;  2OLS A;  2A68 C;  1B2T A;  2KOL A;  4DUZ L;  3GIQ A;  2VUM G;  2AQ1 B;  3KF8 A;  1BQQ T;  1KLG D;  2FJZ A;  1KC8 C;  4MN3 A;  4TRD A;  1HTP A;  2RDF A;  2NVT H;  5L1J A;  3JAM E;  2UVR A;  1KTK A;  2F3I A;  1PYW D;  1N33 H;  4ED8 A;  5ELE A;  3TDQ A;  4ME3 A;  1SNO A;  1FJG L;  5LMU L;  1VQG A;  1E0B A;  1LT3 D;  3SGI A;  2CQA A;  3KF6 B;  2XRS D;  2W6O A;  4DGZ A;  3KXY T;  3G6X A;  4QMG A;  5D1O A;  1VQE A;  3IRB A;  1BOS A;  3OIP A;  2JA8 B;  4QB4 A;  3NTI A;  5M5Y H;  1TWC H;  2FMC A;  3K0Y A;  3NK9 A;  1F77 A;  1CSQ A;  2IX3 A;  4ZI7 F;  1BBW A;  5IYC H;  1I4H A;  1K8G A;  2VUM A;  1SXT A;  4V19 0;  2R7K A;  1JXL A;  4XZ3 B;  1MJE A;  4UAI A;  3PIO 3;  1A62 A;  1T3N A;  2IBK A;  1NUC A;  3TQT A;  5DNF A;  1KNE A;  3JSL A;  3MWM A;  4X3K A;  4X3S A;  3EN2 A;  3D6C A;  1EZ6 A;  2FLL A;  1XMQ Q;  1T5X D;  3KUP A;  4L5T A;  4YCW A;  4PNY A;  3CCJ A;  3FMC A;  2R7M A;  4E6I A;  3N44 B;  1TWA H;  1UNS A;  3RUZ A;  5KFR A;  4RHS A;  3VR6 A;  1A0I A;  2EPB A;  4M1U B;  2E2H H;  5DG9 A;  1PYS B;  1LTR D;  3K3V A;  2Z4I A;  4AH6 A;  1KLU D;  4DV4 L;  3QB3 A;  1G29 1;  2B2T C;  1WCM B;  2JE6 I;  1BJT A;  3CQZ A;  4LMY A;  4DV2 L;  1STE A;  4C3I G;  1N8R C;  3R5F A;  3RAQ A;  3DUZ A;  4KHZ A;  4DUY H;  1LV9 A;  3CME A;  1JE4 A;  2PQA A;  1K1Q A;  2HVQ A;  2R8H A;  4OO1 I;  2VQE L;  2YTV A;  2XNA C;  1G6Z A;  3T1Y H;  1VQ6 A;  3IN5 A;  4O2A F;  4O3O A;  2EZV A;  4DR3 L;  2GPW A;  2E74 C;  2MQH A;  2ZXP A;  2R6F A;  3MFG A;  2UU9 L;  2C5C A;  1E4G T;  2Q2I A;  3HOU H;  1XWE A;  1XJV A;  5J39 A;  3S1M B;  2GLT A;  4UCO A;  3M4I A;  3GQC A;  4BBS G;  1QVG A;  4JI3 L;  4IOA A;  3WOF A;  1B7Y B;  2JP1 A;  4QWA A;  2F0F A;  2R7F A;  2XGT A;  2VY3 A;  5CA0 F;  2I5L X;  5EPL A;  5C6A A;  2QIL A;  4YWL A;  1ENF A;  1ESR A;  3RAX A;  4JI8 Q;  4A3M B;  5I2Y A;  4KK7 A;  4HIK A;  4EFB A;  3MJF A;  3CC7 A;  2NUA B;  3MR3 A;  4LSX A;  5F2D A;  5KG3 A;  3J7A V;  1DD2 A;  2XC9 A;  1CUK A;  3GQB A;  4EQ5 A;  4RGN A;  1SNP A;  1B50 A;  4Q0Y A;  3BZD B;  2FMM A;  3RUP A;  3E3X A;  4KHV A;  5FLX L;  3TQ1 A;  2PVP A;  4C3H H;  3K80 C;  1ICW A;  3CPF A;  1FGB D;  4DXG A;  4DKA C;  2ASB A;  4DV1 Q;  3C1E A;  4LFB Q;  1F2Y A;  1II3 A;  4X6A H;  1KDA A;  3SK4 A;  5LMN L;  5FLX W;  3KTM A;  2YCH A;  4WOR A;  1SEB D;  5C4H A;  5KG7 A;  2E2I H;  1KIX A;  4IFD G;  3OTO L;  1HR0 L;  3EYY A;  1F9S A;  2N88 A;  2OTL A;  5KFT A;  1ESF A;  1RDP D;  4R1J A;  2HD3 A;  1EOV A;  1VQF A;  4ZKC B;  4QUF A;  2NZH A;  4F4Y A;  3I56 A;  3W1B A;  2VB3 X;  3PIO A;  3GTO B;  1P8L A;  3RLN A;  1WFQ A;  1LT4 D;  4IWX A;  3RMH A;  1PH7 A;  2FE3 A;  3RF2 A;  1Y1V B;  5FD5 A;  4A2A A;  3H09 A;  1BXR A;  4RFB A;  4IJL A;  5DQH A;  5I9O A;  1H9J A;  3C0F B;  1HA5 A;  2XGQ A;  4K0K H;  4R8I A;  1PTO H;  3E0J A;  1X32 A;  2UVU A;  4H13 C;  3Q8D A;  3HOY H;  2WV6 D;  4FF4 A;  1PRT D;  2NVY B;  2QDL A;  4HJ5 A;  2LXJ A;  2WDT A;  5J3B A;  4JYA H;  1CA6 A;  1IBM Q;  5BN5 A;  1TXY A;  2QGQ A;  1JB3 A;  2VUM H;  4GLA C;  4BA1 I;  5JJI A;  4X64 L;  4LF8 H;  1U0L A;  4QCL A;  1EWI A;  4CJ0 B;  2QYZ A;  1NY4 A;  4BXX G;  2Q8T A;  4DR1 Q;  4JV5 H;  4XX0 B; 
#chains in the Genus database with same CATH homology
 4DV0 L;  1I3Q H;  1HNZ L;  1SE8 A;  3RNU A;  5GAE C;  1JJC B;  4JCV E;  1YHB A;  2HHH Q;  4DK6 C;  4LUZ A;  3UE1 A;  1IZ6 A;  4P71 A;  4NPS A;  2QEX A;  4DV7 Q;  1PH9 A;  3CP0 A;  1YEZ A;  1NBW A;  2JA7 H;  4DR7 Q;  1S40 A;  2UXD Q;  3OYY A;  1G6P A;  4B3M Q;  1GKH A;  2NVQ H;  2ALY B;  1MIU A;  2JA6 H;  1SRO A;  1VQ4 A;  1EFW A;  3AFQ A;  2JA5 G;  1K83 H;  2MO1 A;  4GN5 A;  3GTM H;  1VQI A;  4QIW E;  1OXS C;  3F2C A;  4DV5 L;  5IP9 G;  4LFB L;  2WB1 E;  4DV3 Q;  3I4M G;  1SMX A;  3CQZ H;  4KLK A;  2EQS A;  4LFA Q;  5C0X J;  3STB C;  4LF6 L;  1IYJ B;  5IYB H;  1NMF A;  1X54 A;  2NZO A;  4DR6 Q;  3S2H H;  5C4J H;  4NXN L;  1K9M C;  1JB7 A;  5IE8 A;  3G6E A;  3JAM c;  4IO9 A;  3HOX G;  5IYD H;  4A3K G;  1KHI A;  3WWV A;  3HOV G;  2K50 A;  3J81 j;  4LF9 Q;  1QVF A;  2AHO B;  4A3D H;  5AJ3 Q;  3FKI H;  4JI2 Q;  1YNX A;  4A3M H;  4BY7 H;  4YHH L;  2EXD A;  4BBR G;  1GO3 E;  1E1T A;  1KRT A;  4DUY Q;  2AWN A;  2Q2T A;  4LNQ A;  4JI5 L;  4B3S L;  3J80 c;  4YCV A;  3I2Z A;  3PO2 H;  2LSS A;  4QGU A;  2K5N A;  1HNW Q;  4HID A;  3T1Y Q;  1C7Y A;  3K0X A;  4RG1 A;  1EIF A;  1SLJ A;  1H95 A;  1I5F A;  4JG2 A;  1E24 A;  3A0J A;  1A8V A;  3KJO A;  1CKN B;  1S3O A;  4C3I H;  1YIT A;  4X65 Q;  2D62 A;  1QZG A;  2Z0S A;  1Q81 C;  1I6H H;  4B3T L;  1VQC A;  2R93 G;  2BA1 A;  1L1O C;  1X55 A;  3TRZ A;  3T1H L;  2RHS B;  4OX9 Q;  4DR4 L;  2PQA B;  1DGS A;  3E0E A;  2F52 A;  3CAM A;  1NJI C;  2NN6 I;  1VQB A;  4JI6 Q;  4R4T A;  3U50 C;  5JEA J;  1RIP A;  4DUZ Q;  2N78 A;  2R7D A;  1VQ5 A;  3AQQ A;  1VQA A;  5C44 G;  1XPU A;  1N32 Q;  1VQL A;  1YVC A;  1IBL L;  5GAH C;  4BBS H;  1D7Q A;  2HHH L;  1Z9F A;  4AIM A;  4MTN A;  2ZTE A;  4P74 A;  3H0G G;  4JI0 L;  2K5V A;  3D31 A;  1IBK Q;  1O7I A;  5HY6 A;  5C3E H;  4A3E H;  1N34 Q;  3ULP A;  3NEL A;  1L1O A;  1E7Z A;  2L15 A;  2OQ0 A;  1VQH A;  5LMU Q;  4DR7 L;  2UXD L;  1NMG A;  3BZC A;  1KRS A;  1VQP A;  4PMW A;  1K8A C;  1Y1V H;  1EYG A;  3CCV A;  1XMQ L;  4Y7N H;  2I0Q A;  4PZ6 A;  1VQK A;  1L2F A;  5M3M G;  4LF4 Q;  1CSP A;  4LUV A;  3CCL A;  4DV3 L;  1JMC A;  2Y0S E;  3TQY A;  2UUA Q;  4TVA B;  4A4I A;  1LTL A;  1Q46 A;  2K14 A;  5C4X H;  1VQO A;  1J5E L;  4GNX B;  2Q2U A;  2KCT A;  2BH2 A;  4DR6 L;  1OXV A;  2JK8 A;  1VS0 A;  3RR5 A;  4AYB G;  1V9P A;  3BU2 A;  4DPG A;  5LMN W;  2R92 H;  4B3R Q;  4LF9 L;  2QA4 A;  1R9T H;  3G48 A;  3ICE A;  4JI2 L;  5GQO A;  1KAW A;  1Z47 A;  1PH1 A;  3UE0 A;  4QY7 A;  1XNQ Q;  4L5R C;  2JA8 G;  4JI4 L;  1Y1W H;  2WP8 J;  5FLX c;  3S24 A;  4DUY L;  1HR0 W;  1B8A A;  1I94 Q;  3HOZ H;  1OXU A;  2MO0 A;  4GOP C;  4GN4 B;  4IPH A;  3BJU A;  2IHE A;  3CCR A;  3NBH B;  1PH5 A;  4EX5 A;  4UP7 A;  3CCU A;  2CFM A;  4GLV B;  4POG A;  2A8V A;  3S14 H;  2ID0 A;  4X65 L;  3I4N G;  2CQO A;  2E5L L;  4DV2 Q;  4QQB X;  1D8L A;  4C3J H;  3J81 i;  1XPR A;  1N33 Q;  3ULL A;  3H3V H;  1UE5 A;  4H02 A;  4OX9 L;  2GVB A;  2BH8 A;  3KF6 A;  4R4O A;  4PZ7 A;  4JYA Q;  2GN5 A;  2ZJR A;  2OQK A;  2UXC Q;  2VL6 A;  1E3P A;  5IP7 H;  1UE6 A;  3HFZ B;  4QL5 A;  4JI7 L;  1LM0 A;  1AE3 A;  3ZJY C;  1VQ8 A;  3UDF A;  4LF8 Q;  1XNR Q;  2R7Z H;  3S16 H;  1GD7 A;  2IX1 A;  5FJ8 G;  4JV5 Q;  1N32 L;  1FL0 A;  1V43 A;  2MNA A;  1X56 A;  4POF A;  3DM3 A;  3L2P A;  4P72 A;  1HZA A;  2VS1 A;  3K81 C;  1WCM G;  5IYC G;  3F2D A;  3GDE A;  4HJA A;  1TWF H;  4A3J H;  3PF5 A;  3S1R H;  4JI3 Q;  3S1N H;  1JJG A;  4OO1 G;  1WJJ A;  2OWO A;  3MXN B;  3NEM A;  4DR2 Q;  1N9W A;  2E8G A;  4AYB E;  5C0X I;  3GTQ H;  3CCE A;  2N3S A;  3CC4 A;  4WJ3 M;  1W2B A;  4JI1 Q;  4A75 A;  1NTG A;  3UDI A;  1UE7 A;  1KL9 A;  4A3C G;  4BXX H;  2H5X A;  4X62 Q;  5JEA G;  3GTJ H;  4LWC A;  2HQL A;  2N8N A;  4YWM A;  5FLM G;  1QUQ A;  3CCM A;  1QZH A;  1YJ9 A;  4IFD I;  4DV1 L;  1GVP A;  1X6O A;  4LF4 L;  2UUB Q;  1PYB A;  3KYH C;  2ZJQ A;  4OWW B;  4A3I G;  2UUA L;  3CMA A;  4A3F G;  4HIM A;  2YYZ A;  3H3V I;  4YY3 L;  1Q7Y C;  1ASY A;  5DLQ E;  2NN6 G;  4GN3 B;  1L0W A;  4UP9 A;  1X9N A;  1K0R A;  2AKW B;  3L0O A;  4IFD J;  2ATW A;  1G51 A;  4C2M H;  3M3Y H;  4O2D A;  3A5U A;  3HOW G;  3STB D;  2JA5 H;  1BBU A;  1XPO A;  3UDX A;  1HNX L;  1HZC A;  5IP9 H;  2HT1 A;  1OTC A;  3I4M H;  1Q12 A;  4JBW A;  4DAY B;  3LGJ A;  2Y0S G;  3PIP A;  1W3S A;  2A19 A;  1I94 L;  1YJN A;  1XMO L;  1SN8 A;  4OWX B;  3W5O A;  3KFU A;  4WJ4 A;  2UUC Q;  3AEV A;  5HGQ A;  1YHA A;  4JBK A;  1PHJ A;  3EIV A;  3HOX H;  3PO3 G;  4YWK A;  4A3K H;  2WAQ G;  1RL2 A;  3PV0 A;  3HOV H;  3M4O H;  3PF4 A;  1C0A A;  3W1G A;  1YI2 A;  3HOU G;  1FGU A;  2CWP A;  3HKS A;  3BZK A;  5IY0 A;  4A3L G;  4A3B G;  3CF5 A;  4GKK Q;  3PUZ A;  3HKZ G;  4BBR H;  5K36 G;  2ZTD A;  1EUJ A;  2KEN A;  1PV4 A;  3GTK H;  3KJP A;  1N33 L;  1P16 A;  1IBM L;  4NB3 A;  1J6Q A;  2B63 G;  4LF7 Q;  3TRE A;  4JBM A;  4A3G G;  2UXC L;  2UXB Q;  1YHQ A;  1M1K C;  3AFP A;  1LUZ A;  4DV6 L;  1PH6 A;  4L5S A;  5BR8 Q;  3RLO A;  4DR1 L;  3AYH B;  3I7F A;  3J81 c;  3CC2 A;  4DR1 Q;  4JOI C;  1VCI A;  1PFS A;  1UE1 A;  2D0O A;  2R93 H;  1QVC A;  1YZ6 A;  1X3F A;  4DV7 L;  4L5Q A;  1JT8 A;  1FJG Q;  1AH9 A;  4NXM Q;  2F4V Q;  3S17 H;  4JI1 L;  4B3M L;  4YCU A;  4OXP A;  1VQ7 A;  4X62 L;  5C44 H;  1HZB A;  1X65 A;  4J15 A;  3J7Z C;  4O0A A;  4DV0 Q;  1NE3 A;  3CD6 A;  1HNZ Q;  1PVO A;  1WYD A;  2MFI A;  2K4K A;  4P75 A;  3FP9 A;  4JOI A;  4LFA L;  3H0G H;  3KOJ A;  5ELO A;  1VQD A;  2DGY A;  1IL2 A;  5GAD C;  4MNO A;  4FDB A;  1M90 C;  1BKB A;  3B6Y A;  1L1O B;  1GM5 A;  2WAQ E;  3GTL H;  3CW2 C;  1KD1 C;  4HJ8 A;  3J7A 5;  4A93 G;  5AJ3 L;  2D0P A;  3HKZ E;  5M3M H;  1SR3 A;  2KCM A;  5M3F G;  4TQU S;  4GKJ Q;  1AE2 A;  4KHP Q;  4DV5 Q;  4AQY Q;  3F2B A;  3F1Z A;  1YBY A;  2I5H A;  5H1S E;  5C0X G;  4IJH A;  1VQN A;  1HNW L;  5JJK A;  3T1Y L;  1YIJ A;  3D0F A;  4LF6 Q;  3GTG H;  1KXL A;  1UWV A;  4R4I A;  1IXR A;  3PUY A;  2A1A A;  4JBJ A;  4DV4 Q;  4NXN Q;  4PG3 A;  1MKH A;  2WFW A;  3CCQ A;  1Q86 C;  3E9H A;  5M5W H;  3A5Z B;  2VQF Q;  1EQR A;  4OON A;  1BVS A;  3U4V A;  3ERS X;  5E7N A;  4K0K Q;  2JA8 H;  2RCN A;  1XTD A;  1X3G A;  2B29 A;  4YHH Q;  3S1Q H;  3OW2 A;  3F8T A;  3HOY G;  2AMC B;  3KDF A;  2KHJ A;  3U58 A;  4QJF A;  2IHF A;  4LF7 L;  2VQE Q;  4JI6 L;  4PZ8 A;  4JI5 Q;  1V1Q A;  3GO5 A;  3TEH B;  3DLL A;  4DUZ L;  1JJ2 A;  2VUM G;  3E9I A;  4DR3 Q;  4GOP A;  3ER0 A;  1MJC A;  2K5H A;  4BY1 G;  2UU9 Q;  3ULJ A;  3PUV A;  5IWA Q;  1KC8 C;  2FXQ A;  3I4N H;  2NVT H;  4Y52 H;  2CKZ B;  3KLW A;  1PH8 A;  1OXX K;  2YU9 H;  2F3I A;  4B3T Q;  1IBK L;  2JJQ A;  1N34 L;  4ME3 A;  1FJG L;  5LMU L;  1VQG A;  3SGI A;  3KF6 B;  4IPG A;  4DR4 Q;  4GS3 A;  4MZ9 A;  2GVA A;  4JC0 A;  2JA7 G;  1VQE A;  3IRB A;  2HIX A;  2IY5 B;  1B70 B;  2JA6 G;  5FJ8 H;  4GOP B;  5M5Y H;  5GAG C;  1TWC H;  1K3R A;  1CSQ A;  4X66 Q;  1BBW A;  2CWA A;  1WCM H;  4XTC S;  5IYC H;  1K8G A;  1IBL Q;  1WI5 A;  4APV A;  4UY8 C;  3M4P A;  1MJE A;  4LFC Q;  4JI0 Q;  1A62 A;  1HJP A;  5IYB G;  1EIY B;  3K8A A;  1S72 A;  4B3R L;  4A3C H;  5IYD G;  1HH2 P;  5FLM H;  3K7A H;  4UP8 A;  2ZM6 Q;  3RZD H;  4A76 A;  3EN2 A;  1QUQ B;  3UDG A;  1LYL A;  3FKI G;  1XNQ L;  4A3D G;  1XMQ Q;  3M85 A;  4HIO A;  4DR5 Q;  4YCW A;  4L5T A;  3CCJ A;  4P73 A;  4A3M G;  4BY7 G;  4GKJ L;  4R4C A;  4A3I H;  1TWA H;  4AQY L;  4LF5 Q;  1Q82 C;  3S1M H;  4KHP L;  2JEA I;  5LMN Q;  5JJL A;  1PA6 A;  2PI2 A;  1A0I A;  4A3F H;  2E2H H;  1UEB A;  2XTI A;  3PUW A;  1PYS B;  4IOC A;  1Q8K A;  1J5E Q;  3CPW A;  3PO2 G;  3RLF A;  2JA9 A;  3PGZ A;  5EAY A;  4AH6 A;  4DV4 L;  5ELN A;  1G29 1;  5IT9 c;  4R4Q A;  2JE6 I;  3OTO Q;  1CKN A;  2LXK A;  1HR0 Q;  3HOW H;  1JE5 A;  1A63 A;  2VQF L;  4DV2 L;  2PMZ E;  1N8R C;  4K0K L;  1X3E A;  2JEB I;  3K7U C;  2E2J H;  4KHZ A;  1N36 Q;  2VZA A;  1E1O A;  2R6G A;  3CME A;  4JI4 Q;  4JYA L;  2HIV A;  2PQA A;  4OO1 I;  2VQE L;  2YTV A;  2ZJP A;  1YJW A;  1VQJ A;  1VQ6 A;  2K52 A;  1XNR L;  3NEN A;  4DR3 L;  4LF8 L;  3PO3 H;  2PI2 E;  2MQH A;  2UU9 L;  4JV5 L;  2Q2I A;  4LW1 A;  2OCE A;  5IWA L;  1PH4 A;  4HJ9 A;  3M4Q A;  3GTP H;  1XJV A;  3HOU H;  4A3B H;  4A3L H;  4BBS G;  2I5M X;  1QVG A;  4JI3 L;  4GNX C;  4IOA A;  1B7Y B;  3S2D H;  2E5L Q;  4KI0 A;  4DR2 L;  2B63 H;  2R7F A;  2XGT A;  5C3E G;  2VY3 A;  4A3E G;  2I5L X;  3RZO H;  4A3G H;  3EBE A;  1CKO A;  2IT1 A;  4X64 Q;  4YWL A;  3H15 A;  2EIF A;  4JI8 Q;  1I50 H;  3I55 A;  4JI7 Q;  1HZ9 A;  3RN5 A;  1Y1V G;  1CKM A;  2UUB L;  4LUO A;  4HIK A;  2VNU D;  4X66 L;  2K75 A;  3M9B A;  3CC7 A;  3JC6 6;  2Z6K C;  3L7Z C;  3MEF A;  4LFC L;  1ASZ A;  4GNX A;  4DK3 C;  1SFO H;  5C4X G;  1CUK A;  4EQ5 A;  3U4Z A;  1Y14 B;  4XIG S;  2NVX H;  1K73 C;  3GTO H;  2ES2 A;  3G71 A;  3TS0 A;  1OXT A;  2R92 G;  4C3H H;  2ZM6 L;  3K80 C;  4RMF A;  3CPF A;  2BA0 A;  2Q2H A;  1Q1E A;  3JAM i;  4DKA C;  2ASB A;  4DV1 Q;  4DR5 L;  4LFB Q;  4X6A H;  2KBN A;  4LF5 L;  3I4O A;  3M7N A;  1Y1W G;  5LMN L;  1C9O A;  4DAM A;  2UUC L;  2Z6K A;  1TWG H;  3HOZ G;  1EQQ A;  1WOC A;  2YTX A;  1U5K A;  4YY3 Q;  2YTY A;  2NVY H;  3CCS A;  2E2I H;  2JQO A;  4ALP A;  1KIX A;  1KQS A;  4A93 H;  3PUX A;  3J80 i;  4IFD G;  2CCZ A;  3OTO L;  4GKK L;  1HR0 L;  1VQ9 A;  3G4S A;  4GLX A;  2OTL A;  3RN2 A;  5M3F H;  3S15 H;  2DUD A;  4R1J A;  1EOV A;  1VQF A;  1HNX Q;  2NZH A;  1N36 L;  1PH3 A;  3CXC A;  3I56 A;  3W1B A;  4DNI A;  2ZTC A;  2WB1 G;  4OWT B;  1SRU A;  3FHW A;  1P8L A;  4IPD A;  3PIO A;  3RLN A;  4B3S Q;  1WFQ A;  2UXB L;  4HJ7 A;  1XMO Q;  2C35 B;  4UPA A;  1PH2 A;  2IX0 A;  2N49 A;  5BR8 L;  1PH7 A;  5IP7 G;  5GRO A;  4IPC A;  1FVI A;  4IJL A;  2R7Z G;  3PCO B;  3TS2 A;  2B3G A;  2KHI A;  2PNH A;  1TWH H;  1E22 A;  5M5X H;  1Q1B A;  1VQM A;  3GD7 A;  2YV5 A;  4A3J G;  2V1C C;  2RHQ B;  3PSI A;  3Q8D A;  3HOY H;  4NXM L;  2F4V L;  4HJ5 A;  2AWO A;  2LXJ A;  2VW9 A;  5J3B A;  3T1H Q;  3KDF B;  1IBM Q;  1TXY A;  2QGQ A;  2VUM H;  2RF4 A;  4GLA C;  4BA1 I;  5JJI A;  3VDY A;  4X64 L;  1U0L A;  1EWI A;  4BY1 H;  4DV6 Q;  1NY4 A;  4JI8 L;  4BA2 I;  4BXX G;  3A74 A;  3KF8 B;  1T9H A;  2OTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...