4A3JG

Rna polymerase ii initial transcribing complex with a 2nt dna-rna hybrid and soaked with gmpcpp
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3jG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3jG01
1IL2A 4X64L 4GOPC 1QUQA 2KCMA 1VS0A 4POGA 1QZHA 4YY3L 4X64Q 1EIYB 1L0WA 4JC0A 1FJGQ 4A3DH 1UE6A 4XTCS 1G291 4OX9L 1E1TA 3AEVA 4LF4L 3CCRA 4JI8L 1AE2A 1JT8A 1A8VA 1B70B 2MQHA 4GOPB 1Z9FA 4JI3L 1HZCA 4LF6L 2Q2TA 3U58A 4R4IA 1N34L 1K0RA 4IJHA 4DKAC 2LXJA 1HZAA 4BY1H 4JI2L 4DV5L 2R7DA 1N9WA 3RNUA 2LSSA 1K9MC 1EYGA 4LF5Q 4KHPL 5GAGC 2WB1G 5C44H 1X65A 4DV4Q 2UXDQ 3PUZA 4BA1I 1ASYA 1LUZA 1W3SA 4C3IH 4OXPA 4JI4L 4R4CA 2NVQH 2ZTDA 1XPOA 1HNZL 4DUZQ 1VQOA 3H0GG 5GAEC 2HIXA 1Y1VG 3U50C 4APVA 2JA5H 4BA2I 2HHHL 4JI7L 2UXCL 1LM0A 4PMWA 2R7ZH 1HNWQ 3CD6A 2ZM6L 3HOUG 4HIDA 3I4OA 5JEAG 3DLLA 1X54A 2MFIA 4QGUA 2HQLA 2RHSB 3S2DH 4GLAC 4LUVA 2ZJRA 3HOZG 2N49A 3J80i 3KJPA 3HOXH 1GVPA 2R93H 3CCVA 4B3MQ 3H15A 1Q86C 2HHHQ 1A62A 3L7ZC 1PVOA 3PUVA 3S1RH 3EN2A 3JAMc 4LUZA 2VZAA 1JJGA 3KYHC 3LGJA 3CC7A 3SGIA 3NEMA 1PH1A 1XNQL 1C7YA 1YHAA 4PG3A 3G4SA 1VQCA 2UXBL 1TWAH 2D0PA 4PZ7A 4P72A 4BY1G 5FJ8G 4HIOA 4A75A 2YV5A 4B3RL 4JI6Q 2K5HA 3PCOB 1V1QA 2F52A 1YITA 2ZTCA 3GTJH 1VQNA 4OWXB 4HJAA 1VQ9A 1VQFA 4QL5A 4A3JH 2RF4A 2UU9Q 2JJQA 1TWGH 4BY7G 1FGUA 4LF9L 1CKOA 1EUJA 1N33Q 1H95A 1SE8A 5EAYA 1WOCA 5GADC 2ZM6Q 3PGZA 1QVFA 4BXXG 4X66L 3HOWH 5IE8A 3TS2A 4A3DG 4JV5Q 3K8AA 2YTYA 1K83H 4JV5L 2K14A 1KD1C 2ZJQA 4X66Q 4HJ5A 3PUXA 3J7A5 2Y0SG 2IT1A 3M4QA 4AYBG 1XTDA 1CKNA 1EQRA 1S40A 4JI4Q 1U0LA 5GROA 1QVGA 1I94L 2ZJPA 3OYYA 4TQUS 2UUBL 3ULLA 3S17H 2E2HH 2LXKA 3KF6B 1IZ6A 3T1HL 4R4QA 3GD7A 1X3GA 3PIOA 3PSIA 2ID0A 4DR1Q 1J5EL 5ELNA 4LF6Q 5LMNQ 1XNRQ 5C4XH 1N36Q 4LF7L 1NY4A 3CCQA 1VQBA 2BA0A 4YCWA 2Q2HA 1Z47A 3KF8B 4PZ8A 1NMGA 4X62Q 4LF7Q 3FP9A 1YJWA 1VQJA 3T1YL 4B3SQ 4DV0Q 3A74A 4ALPA 4EQ5A 3H0GH 1I3QH 2FXQA 1NBWA 5IP9G 5M5XH 5IYBH 2UUAL 3PF4A 3M7NA 4GNXA 2JA7H 4IFDG 2ZTEA 1E1OA 3E9HA 1V9PA 2XTIA 3CMAA 3VDYA 2IY5B 5M3MH 2AHOB 1I94Q 1D8LA 4YWLA 2VQEL 3S1MH 2K5VA 1PH4A 3CAMA 2Q2IA 1HNWL 4WJ3M 2JE6I 3KOJA 4HIMA 1SLJA 2OQKA 5ELOA 2JA9A 3BU2A 2JEAI 1W2BA 4L5QA 5C3EG 1PH7A 4DR4L 1P8LA 2PI2A 3L0OA 4A3BG 2KHJA 1N33L 2KENA 2RHQB 3FKIG 1OXVA 3WWVA 4DV7L 2UXDL 1Q12A 2ASBA 2JA8H 4A93H 2IHFA 4DV5Q 1VQDA 4IOAA 1KAWA 2XGTA 3CCLA 2D62A 3H3VI 3HOVH 5LMNW 4DV2L 3W1BA 1NJIC 4NPSA 4UP9A 2A19A 3J81i 4RMFA 4DR2Q 1Q7YC 2UUBQ 4JI3Q 1XPUA 4Y52H 4QIWE 1UE1A 4LF4Q 3F8TA 1Y1VH 2AWNA 3M4PA 1XMOL 3A0JA 1HR0Q 4L5SA 4DV1Q 1GD7A 4DR7Q 5GAHC 3GTOH 5IYDH 5FLXc 1YIJA 5M3MG 4LFBQ 2EQSA 4YY3Q 1OXSC 1PYBA 5C0XG 2GVAA 1KHIA 3UDXA 1FVIA 3HOZH 4IFDJ 5K36G 1D7QA 3G48A 1A63A 2WB1E 4WJ4A 1SROA 4QQBX 1KXLA 1VQHA 2ES2A 1HR0W 1IBKL 3S24A 1HZBA 4JG2A 1VQ5A 3FKIH 4JBKA 5IWAQ 3U4ZA 3S1QH 3KDFA 4LFAQ 2N8NA 4H02A 4IPHA 4OO1I 1VQ7A 1PHJA 1U5KA 2R92H 3A5ZB 2QA4A 4BBSH 1SMXA 5M5YH 3AQQA 4MTNA 2VS1A 4K0KL 2NVXH 4JBMA 1YI2A 1CKNB 2ATWA 4FDBA 3J80c 1T9HA 4A3GG 1X3EA 1TWCH 4NXNL 1K8AC 4DAMA 5AJ3L 2VQFL 4L5RC 2K52A 4DR3Q 1HZ9A 4B3ML 1Q1BA 4GKKL 1MIUA 1J5EQ 4A3LG 4DV3Q 1JE5A 5JJLA 4JOIC 4GKJQ 5M5WH 3PF5A 1YJ9A 4LFCQ 4YCVA 4DK3C 3J81c 3CP0A 4GN5A 1SFOH 2A8VA 2R6GA 4GNXC 4POFA 4IPCA 3CCMA 3BJUA 3CW2C 1VQPA 1YHBA 2EIFA 1IBMQ 2GN5A 1TXYA 1UE7A 2KCTA 3M4OH 1I6HH 3F2CA 4OWTB 1PFSA 1XJVA 3GTPH 4DR6Q 2WAQG 3EIVA 2PQAA 1KL9A 1X55A 4LF8L 5C44G 3S15H 5FJ8H 4HJ8A 4BBSG 4X65Q 4KLKA 5H1SE 4A4IA 2MO1A 4JI0L 3EBEA 4JI5Q 2I5HA 4IPDA 4A3GH 1XPRA 1M1KC 3I4MG 3MEFA 3DM3A 2E5LQ 2QEXA 4P73A 4A3FG 4B3RQ 3I2ZA 3PIPA 1XMQQ 3M3YH 2I5LX 4JYAQ 1Y1WG 1VQ8A 5JEAJ 4OX9Q 4IPGA 4BXXH 3GTLH 2CQOA 2B3GA 1PH2A 2K5NA 5C0XI 3I55A 4DPGA 1P16A 4KHZA 5IYCG 3CC4A 1VQKA 1I50H 2IX1A 2E5LL 4JCVE 3I4NG 1A0IA 3CCSA 1BVSA 1X56A 3GTKH 3NBHB 4ME3A 1RIPA 3PO3H 4OONA 5LMUL 2B29A 4DAYB 2BH2A 3MXNB 2OCEA 5BR8Q 3CF5A 4LWCA 2JQOA 1QVCA 1Q1EA 4YWMA 2KBNA 4A3MG 4A3EG 1PH6A 1VQAA 2HT1A 1PYSB 2Y0SE 4A3IG 3KFUA 2AMCB 1L1OB 3STBD 3G71A 4DUZL 1VQMA 3CPFA 2YU9H 1Y1WH 1L2FA 2B63G 3GTQH 4C3JH 3JC66 1N8RC 5LMUQ 4DK6C 5JJKA 3S2HH 3IRBA 2OTJA 3TREA 4UPAA 4AIMA 1JMCA 1YJNA 4LNQA 4HIKA 4LW1A 4BBRG 2NN6G 3KF6A 4GKKQ 5IYDG 4J15A 4AQYL 4DR5L 2NVTH 1TWHH 4YHHL 5M3FH 3CC2A 4A3LH 4IFDI 5IT9c 5AJ3Q 1YVCA 5C0XJ 2VQFQ 1X9NA 3CQZH 1K8GA 1TWFH 3HKZE 4P74A 1BBUA 2CKZB 5IP7G 4DV6Q 1GM5A 1YNXA 2I5MX 4Y7NH 1KQSA 1EFWA 4JYAL 3CXCA 3W5OA 3A5UA 1PH8A 2UUCL 3CPWA 2JA6G 1N32L 2JA8G 4A93G 3GDEA 2D0OA 3RLOA 3JAMi 1E24A 1HNXL 4A76A 4YCUA 1GO3E 3ULJA 3TQYA 1QZGA 3L2PA 1PV4A 2BA1A 4A3FH 4A3IH 1Y14B 2B63H 4DUYQ 5FLMG 3F2BA 1IBLL 2WFWA 5HY6A 5GQOA 3U4VA 4B3TL 2F4VQ 1OXXK 1SRUA 4JI1Q 4GOPA 4QJFA 1Q8KA 1YEZA 2JA5G 1KRTA 1HJPA 2K50A 4DV1L 4DR7L 3UDIA 3HOYH 2A1AA 1B7YB 3Q8DA 4YHHQ 3BZCA 3PO2G 2BH8A 3HOXG 3AYHB 1R9TH 2UU9L 4PZ6A 1G51A 2PMZE 4KI0A 4DUYL 2JA7G 1YZ6A 1B8AA 2MO0A 4GN3B 2AWOA 3PUWA 4DR3L 3K7UC 4OWWB 3F1ZA 1YHQA 4NXNQ 3M9BA 4O2DA 1MKHA 1PH9A 3RLFA 3BZKA 3TEHB 4GLXA 4XIGS 1WJJA 2MNAA 4HJ9A 3I4MH 4X6AH 4L5TA 1WCMG 4B3TQ 2VUMH 1YBYA 2VNUD 1MJCA 4LFAL 1C0AA 1KIXA 4UP8A 4NXML 2NZHA 4YWKA 5IP9H 1CUKA 1VQLA 2N3SA 3TRZA 4A3CG 3HOWG 1OXTA 3W1GA 2UUAQ 1BBWA 3K0XA 1L1OA 1WFQA 4A3KG 2I0QA 5IYBG 1VQGA 1VQEA 1CSQA 2HIVA 2DGYA 4UY8C 1VQ6A 3NELA 4DV6L 1JJ2A 1JB7A 4X62L 1HNZQ 5C3EH 1VQ4A 4K0KQ 3GTMH 2RCNA 4HJ7A 3CCUA 2CWAA 4DR2L 3RN2A 4AQYQ 1RL2A 2E2JH 2K75A 4A3EH 4JBWA 4GKJL 1WI5A 3RR5A 2F3IA 1UWVA 4JI5L 1LYLA 2H5XA 2C35B 2IX0A 4NXMQ 1HNXQ 1K3RA 1S72A 5DLQE 4LF8Q 1WCMH 1FJGL 4DR6L 1BKBA 1IBML 1PH5A 2K4KA 1Q82C 4BBRH 4LFBL 1EWIA 3FHWA 3KDFB 5JJIA 3E9IA 2JK8A 1E22A 3ICEA 3GTGH 4LFCL 4JOIA 2CFMA 3S1NH 2PI2E 3GO5A 4DV2Q 1S3OA 2NN6I 3G6EA 1KC8C 1UEBA 1IYJB 4TVAB 1ASZA 4JI7Q 2JA6H 1GKHA 2E2IH 3T1YQ 2Z6KC 4R4TA 4DV0L 1VQIA 4B3SL 3ER0A 4AH6A 4A3MH 4MZ9A 1V43A 2VL6A 1PH3A 2Q2UA 1FL0A 4O0AA 4DV4L 3RZDH 1N36L 3B6YA 2IHEA 1X3FA 5J3BA 4GLVB 4R1JA 1QUQB 5LMNL 1IBLQ 4LF5L 2CWPA 5C4JH 1XNRL 2R92G 2WP8J 4IO9A 2CCZA 1K73C 3S16H 2YTVA 2R7FA 4R4OA 3HOVG 1LTLA 3J81j 1IBKQ 3UDFA 4QY7A 3UE1A 4AYBE 4JI8Q 3ULPA 4A3JG 2R7ZG 1G6PA 2OTLA 2GVBA 2OQ0A 2V1CC 2YYZA 3KJOA 1SR3A 4DV3L 3RN5A 2UXCQ 3I56A 3UDGA 3PO2H 2WAQE 4A3KH 1Q81C 5IP7H 3D0FA 4NB3A 1CKMA 5IY0A 1EQQA 5HGQA 3OW2A 4JI1L 4LF9Q 1E3PA 4C2MH 1XMQL 3K80C 3D31A 3HFZB 1X6OA 2NVYH 3STBC 4GNXB 2F4VL 3PO3G 3AFPA 1DGSA 4DR1L 3OTOQ 3CCJA 3OTOL 1N34Q 4MNOA 1C9OA 1M90C 2Z0SA 2VUMG 1EOVA 1OXUA 3H3VH 3M85A 4JI6L 1AH9A 3HKZG 4X65L 5FLMH 1AE3A 3RLNA 2NZOA 4DV7Q 4JI0Q 3S14H 2UXBQ 5C4XG 1NMFA 1IXRA 1EIFA 1UE5A 2EXDA 2L15A 3KLWA 1KRSA 4P75A 3K7AH 3CCEA 2UUCQ 4BY7H 1N32Q 1L1OC 1O7IA 1Q46A 3HOUH 3HKSA 2ALYB 1HH2P 3PUYA 3K81C 3NENA 4EX5A 1CSPA 2OWOA 5IWAL 2KHIA 3T1HQ 3TS0A 4IOCA 1XMOQ 1HR0L 4A3CH 3I7FA 5E7NA 4RG1A 2VW9A 1I5FA 2VY3A 4LUOA 3I4NH 2E8GA 4DR5Q 3HOYG 2QGQA 1NTGA 5IYCH 2PNHA 5M3FG 3CMEA 4GN4B 1NE3A 2N78A 2R93G 1XNQQ 1WYDA 3J7ZC 3AFQA 3PV0A 4IJLA 4DR4Q 3ZJYC 3UE0A 3RZOH 1PA6A 2Z6KA 4UP7A 1JJCB 2YTXA 4P71A 1VCIA 4KHPQ 4DNIA 4A3BH 3ERSX 1E7ZA 4JI2Q 1SN8A 4JBJA 1OTCA 2AKWB 2DUDA 2VQEQ 4OO1G 2JEBI 5BR8L 1MJEA 1J6QA 3F2DA 4GS3A 4C3HH 2PQAB 3E0EA
chains in the Genus database with same CATH superfamily
4X64L 1TKWB 3TP8A 1TY0A 3U9OA 5KFVA 1L0WA 2M05A 3W2DA 1Q3LA 1UE6A 1G291 4KKUA 5KFGA 2LFNA 4J8QA 1H9MA 1PTOF 3T13A 4LF4L 3CCRA 1O7YA 1B70B 2N88A 2L1BA 1TWFA 3MFIA 3U58A 3D6CA 4DKAC 4NLGA 4H7BA 1CQIB 4DV5L 4LF5Q 2LSSA 1K9MC 1JWMD 2A68C 2WB1G 2A74C 5GAGC 2YZNA 4ECYA 2UXDQ 2B2VA 1ASYA 1SE2A 5C8YF 1PZID 4OXPA 2FMMA 4HCSA 1JDBB 1DV1A 3VYRA 2HIXA 3U50C 4O4IF 3QO2A 4CHTB 4BA2I 2ZXOA 1WTXA 4JI7L 1PRTD 1LM0A 2EOTA 4PMWA 3Q0AA 1HNWQ 4MA0A 3CQZA 5JVDF 4CC6A 1TY2A 2F0QA 2WACA 1S5BD 5KNDA 4RKBA 2JEIA 5FD5A 4RAUC 4GLAC 1EQTA 3MR2A 4PV1C 3J7AF 1BJTA 5M3FB 3TZUA 4DR1H 1Q86C 1A62A 5K5PA 3PUVA 3OOCA 2RKSA 3EN2A 2IBKA 3LGJA 3SGIA 5DGBA 2QILA 4P72A 2PVPA 3K0YA 2YV5A 2K5HA 2ZTCA 5LP6F 2B2UC 4OWXB 2X6LA 3HXLA 5KFWA 1TWGH 4LF9L 1EUJA 2QF7A 2FHTA 4KTAA 2F0HA 3HOXB 1VAJA 1ILQA 4ZHQF 3J81L 3V4SA 5KFHA 2UU9H 4A3DG 4JV5Q 1SCUB 1KD1C 4C2MB 1J5EH 2ZJQA 3PUXA 2WAQB 1CKNA 2R92B 5C4ZA 4TQUS 3I4LA 2E2HH 1IZ6A 4CJ0B 1X3GA 1CHPD 5JJZA 2CH4W 4F88A 4K2LA 5LHY1 5J1ZA 4B9XA 2ENBA 5DNFA 3T5HA 5EGTA 4CDDC 1VF5C 3T5JA 4LF7L 1F2MA 1NY4A 4EG0A 5HV6A 2AQ1B 4JV1A 5KT3A 2Q2HA 1WVLA 4FO2A 4UCRA 1YJWA 3NBHA 2W7OA 4ALPA 2I80A 3H0GH 1UC8A 1NBWA 1BOSA 5IP9G 5M5XH 5IYBH 1JORA 1GUOA 4RUAA 4GNXA 4MV8A 4IFDG 4HQ6A 5LXTF 4ILWA 1PH4A 4WJ3M 4EYHB 5EJWA 1W2BA 4E4TA 5C3EG 3SE7A 1N33L 2RHQB 3CRKC 1OXVA 3WWVA 2YCHA 1KBLA 3BAAA 1DV2A 5C4HA 1VQDA 3CCLA 4DNTB 2W9CB 5LMNW 3GV8B 4N9PA 1TWAB 1VF7A 4NPSA 2E75C 4RMFA 4DR2Q 1Q7YC 2FK3A 1Z2OX 4LF4Q 4L5SA 1Y1VH 4NXMH 1GD7A 5IYDH 2K1BA 3A8JE 2W6MA 5C3WA 1MGSA 4JUZA 1KHIA 1FVIA 5K36G 2JYOA 5E4WC 1G6ZA 4ED2A 2WB1E 2VQDA 2ZDQA 1I4GA 2RSOA 4QQBX 3GTOA 4DR4H 3N43B 1QNUA 2J6TA 2WB1A 3GTJB 1HRJA 1W6JA 3NTIA 5J22A 2OLSA 1RODA 5I9PA 4H02A 4OO1I 4C2MA 3RFCA 2CQYA 1B3AA 1SYFA 1K1QA 4WBNF 3A5ZB 2AGPA 4C3IG 1EY0A 2NVXH 2ATWA 3J80W 4FDBA 5E3FA 5KRUA 4DAMA 5AJ3L 1Y69U 1ET6A 4DR3Q 1Q1BA 2R92A 4EBCA 4EQPA 4GKKL 1J5EQ 1B53A 1NNXA 4BWSC 4JOIC 2W9AA 1XTCD 1SNQA 2R61A 1PZKD 4EGVA 3J81c 5IT9W 2R6GA 3OSOA 4POFA 4FF4A 2EZVA 3SK5A 3CW2C 3CCMA 4C5AA 2F0DA 2EIFA 3RZOB 4O3SA 2GN5A 2KCTA 1PFSA 2B2UA 1XJVA 1QB5D 5KT2A 4LF8L 4YQWA 5FJ8H 5A2QW 2R93B 2FPIB 4IQZA 5H1SE 4CDFC 2MCTA 2I5HA 4UDUC 1M1KC 3I4MG 2AGOA 3GTPA 3GV7B 4V190 4RB3C 2QEXA 1JOQA 4P73A 1S5DD 1I6UA 3PIPA 3M3YH 4N8X1 2R84A 5IGCA 5H80A 4DK0A 2K33A 4IPGA 3GTLH 1SYXB 4C5CA 1C8CA 5C0XI 2YS7A 2NZ1D 4I55F 4KHZA 2F03A 4WJWA 1H9SA 3BG3A 3LMLA 2HJWA 2KVMA 1I50H 3EFXD 5BN5A 3VMMA 4ZUJA 2DPJA 4RZQA 4ME3A 2RGRA 4DAYB 1ESFA 2OCEA 5DG9A 3FDTA 2UXDH 1Y8OB 1Q1EA 2KJXA 4JK1C 1U9RA 1PYSB 2I87A 2AMCB 1B04A 2BDNA 1O78A 1Y1WH 1BUVT 1ML0D 1N8RC 2F1MA 2OTJA 5C6AA 3TQTA 2F0FA 1EFID 4UPAA 1YJNA 1IYUA 4LNQA 4HIKA 4BBRG 2B2TA 1STNA 4YHHL 3T5LA 2UVVA 3N44B 2ASDA 5C0XH 5C0XJ 1TS5A 1EYDA 1TWFH 1BBUA 1CA5A 2K04A 1EY5A 1D1KA 1J8IA 2KQ3A 3CXCA 3A5UA 1N32L 4TV8F 3KBGA 2DN8A 3RLOA 1STBA 4O3QA 2IP4A 4A76A 5L1JA 4K0KH 3ULJA 2HVSA 2E2IB 1PV4A 4OX9H 4O3NA 2BA1A 2UVUA 2NTSA 2QDBA 1D5ZC 2FPGB 1PTOD 5CBEE 1DZ1A 3F2BA 2XCLA 1TWHB 2TMPA 5HY6A 4B3TL 2F4VQ 5COYA 3MR3A 1PRTB 5I6YA 2EJGC 3RF2A 1OXXK 1SRUA 3BQ2A 4QJFA 3T4AC 4JVZA 4DR5H 2JA5G 4DV1L 4IWXA 1E4FT 3PO2G 3S17B 1TT2A 2KOLA 3MFYA 2PMZE 4CKEA 4DUYL 2R8KA 4GN3B 1GUNA 2F0UA 2K32A 4DR3L 2V59A 3EPGA 4C56C 1C48A 3H20A 4LK1C 3RLFA 1KJ8A 1STEA 4GLXA 1FR3A 2L55A 4XIGS 5JOBA 1F9QA 3P1HA 3I4MH 3V2TA 4H0LC 2VNUD 4RCOA 4ID6A 4LF9H 2CQAA 1U4RA 4DLKA 5KFSA 4DAPA 3C3LA 4YWKA 1LTGD 2NN6H 1VQLA 1CUKA 4A3DB 2N3SA 1JXLA 3OWEB 1FYCA 2VUMA 4A3CG 3W1GA 4ECZA 3K0XA 1L1OA 1NAPA 1I4PA 2I0QA 3I90A 1O75A 4WORA 1HTPA 4ECVA 2HIVA 3WNZA 1PMRA 5ELEA 3AMUA 3Q23A 5IOCA 4DV6L 1JB7A 2W6ZA 3GTMH 2V58A 5J2UF 5DM63 2RCNA 1KJ9A 4ED1A 3MVVA 4HJ7A 2CWAA 1IOWA 4AQYQ 1RL2A 2JA8B 4A93B 2PYKA 5DG8A 3H09A 3R93A 3VA7A 3N41B 3ETHA 2W70A 3RR5A 2F3IA 4ED0A 2VUGA 2W8KA 4JV2A 1HNXQ 4LF8Q 2CW7A 1BCPC 4LF5H 3N42B 1EL0A 4X3UA 3G6VA 3RBDA 4LMYA 1PH5A 4DL7A 2V9WA 4X3TA 1U4MA 1Q82C 4YR0A 4DL5A 4LMQD 5JJIA 1I50B 2JA5B 1AZQA 4PDBA 5I6WA 4LFCL 3MXUA 4FF3A 3A8KE 3G6EA 1KC8C 5KG1A 1SJHD 3PN1A 4WRDA 2G9HD 2Z6KC 3VPCA 1OO9B 2F0GA 2L9HA 2EY1A 2K01A 1V43A 5FK9C 3HGBA 3T16A 4DNRB 1PH3A 2A69D 2WKCA 2O03A 3LX0A 2EY5A 1IW7D 1TWCB 3AB9A 4FNFA 1ONLA 1IBLQ 3EPIA 2CWPA 4DV0H 1SSOA 2F3WA 1QJOA 5D3IB 4LF7H 1RK5A 3UE1A 3ULPA 4JI8Q 4A3JG 2R7ZG 2GVBA 2V1CC 1SR3A 3DWQA 3OIQA 3RN5A 4MTEA 2UXCQ 3PO2H 3N6RA 5HURA 4FVMA 4NB3A 1FNWA 2ZXPA 1JICA 3GTPB 5JPNC 5KFBA 2WINB 1EWCA 1PTOH 3HFZB 4GNXB 2F4VL 2NVTB 3L4KA 1X3PA 5TSSA 3MXPA 3OTOL 4MNOA 5D65A 1M90C 4JW0A 1OXUA 3H3VH 1AH9A 3HKZG 1AE3A 2UXBQ 3MA2B 4DV7Q 2SOBA 5JH7F 1N33H 3OMCA 3KLWA 2C22A 1I3QB 4K5WA 4Q44A 4P75A 3L3OC 3K7AH 1N32Q 5EDWA 1CE8A 4DV3H 3HKSA 2W6PA 3MJFA 2RDFA 1H9RA 4DR3H 4RCNA 2KSWA 1XMOQ 5E7NA 2E2DC 2VW9A 4LUOA 2VY3A 5J39A 1JE4A 4DK1A 3HOYG 1NTGA 1HXYD 1JB3A 1VMCA 5JQWA 4LH6A 1BNCA 4C3HB 4Y8VB 4J9PA 1PZJD 3OWFA 2C28A 1X3QA 2R93G 1WYDA 2EYMA 3J7ZC 4O3PA 5KFTA 1JJCB 4P71A 2PO4A 3V6KA 1E7ZA 4M9UA 2HUGA 4JI2Q 1RTNA 2FK2A 1SN8A 4YJ3F 4JBJA 3RB6A 1ILPA 2VQEQ 1M8AA 4XQNA 1SE3A 4S3SA 4GS3A 2Z6BA 4GN5A 1IL2A 5BN3A 2OEOA 4FXKC 2KCMA 2C00A 1VS0A 3CKIB 4F4YA 4MTKA 4XQJA 1YNND 1EIYB 2R82A 5KFCA 4XTCS 2J0TD 3RJ0A 3AEVA 3A54A 3FDSA 1HZCA 4LF6L 1RTOA 1Y8NB 4F50A 5LOVF 4IJHA 1EZ6A 2LXJA 1HZAA 4BY1H 3S2DB 5KFPA 4JI2L 4RH6A 5ELDA 2W6OA 5BR8H 4FXDA 1LUZA 1W3SA 4C3IH 1EEFD 3NBIA 1II3A 2NVQH 2ZTDA 4YIJA 1XPOA 4DUZQ 1HA5A 3NUCA 4XT3B 2JA5H 1Y1VG 4EEQA 5DM73 1SNMA 3VR4A 1KEEA 3CD6A 3HOUG 3RUZA 1DYQA 1HNZH 4C1NI 1SNCA 4KV6A 3Q22A 4XQQA 1KDAA 4RB2C 3S2DH 2ZJRA 1STGA 1PFBA 3J80i 4IUNA 1RYSA 2R93H 3KUPA 4B3RH 2FK1A 4YAKB 3HG9A 4ED6A 3S14B 1R9TA 3Q6SA 4IZ8A 3GTGB 3S1RH 3LWUA 3DWPA 1GSHA 3JAMc 5IGFA 3R5FA 4CGYB 1S5ED 3NPPA 2F0NA 3HKZA 2VA2A 2MHVA 4BY1G 1D5XC 3GTOB 1AW7A 4MTDA 1G91A 2F52A 1GUSA 1VQNA 3IN5A 3DEPA 2UU9Q 3Q8PB 1M6VA 2JJQA 3RZDB 3QZ7A 3AU7A 3FPUB 1N33Q 4K5XA 4QWEA 2YYAA 1SE8A 1TR5A 5EAYA 5GADC 2ZM6Q 5K36H 3DMUA 1MI2A 4JV5L 3TS2A 2K14A 1SYBA 4KJNA 1HPCA 3M4QA 4AYBG 4JI4Q 1C3OA 2W57A 4YHHH 5KFXA 4Q8EA 4E6IA 1UEAB 2UUBL 1S4ZA 4EYIB 3KF6B 3TZDA 4ED7A 3T1HL 3KAKA 4R4QA 3GD7A 4LSXA 2EY6A 1F9PA 1GJXA 1B1ZA 2MUYA 5C4XH 2J4XA 5IGBA 1N36Q 4A2AA 1G2SA 1S03G 4Q8FA 2I07B 4YCWA 3K5IA 1FKAH 1DIKA 1VQJA 3H94A 4RGNA 1F2YA 4DV0Q 4RU9A 3RGXA 3BABA 3IFDA 1EU4A 1I3QH 2DLNA 1DOMA 1TQOA 3PF4A 3DXJC 3V96A 2JA7H 4FS2A 1V9PA 4TUYF 2FLLA 5M3MH 1I94Q 5CV9A 4EVOA 4IUUA 2VQEL 1T94A 3J81W 2K5VA 2Q2IA 4I7ZC 3KOJA 2E74C 1L0YB 2OQKA 3OPOA 1GHKA 2KEEA 3KLSA 1ZKOA 2JEAI 1K3BC 4ZKCB 4EGJA 1P8LA 2OT2A 5LMUH 2KHJA 1VDZA 3FKIG 4DV7L 3RUPA 2ASBA 2ZDHA 2FMAA 4MV1A 2IHFA 2MGSA 3H0GB 4DV5Q 4IOAA 1KAWA 2XGTA 3H3VI 5G3LF 2AQ3B 2KUMA 3V4ZA 1XMOL 1LT4D 3BVGA 2EJMA 1SEIA 4DR7Q 4K5VA 5FLXW 2UVWA 1KJIA 2EQSA 1CZWA 2NU9B 1K1SA 3G48A 3DEOA 3L4JA 5KEEA 1SROA 1QG7A 5BPFA 4KY6A 4HCEA 1AFPA 2XVSA 2ES2A 1HR0W 5C1OA 1HZBA 4JG2A 2NVXA 4I7HA 4JYAH 3U4ZA 3KDFA 4LFAQ 4L63B 2IWHA 4CJ1B 1VQ7A 2R8HA 1U5KA 2M9VA 1SEBD 2R92H 4X3SA 4R9WA 1HFGA 5KFRA 4B9WA 1SMXA 4IRDA 4ETSA 2A68D 1EYAA 4A3GG 1X3EA 4NXNL 1PX2A 1JX4A 2K52A 4Q5VA 1JDEA 4B3ML 4A3LG 1I4QA 2F3VA 1AN8A 3PF5A 1TWFB 3T53B 1YJ9A 1TWCA 2YRXA 4YCVA 2B2YC 1AP0A 2L4NA 2A8VA 1RF2D 1CT1D 3WOFA 3T51B 3TIIA 2RQXA 3JSLA 1UUPA 3M4OH 1I6HH 3F2CA 2VA3A 4DR6Q 1T3NA 3E6ZX 2PQAA 3K57A 4OEMB 3FEWX 1KAAA 5DEHA 3KBXA 1IHZA 4OHJA 1CA6A 4ZI7F 2DWCA 4IPDA 3J7AK 1AEXA 1U4LA 4A3GH 4HNTA 4FBUA 1XXGA 1B6RA 3C0FB 4IWYA 2A6ED 2QDLA 4QCLA 1TVXA 1VQ8A 1D2BA 4ECQA 4BXXH 1SYGA 1IBKH 4H44C 4I7AA 4HSVA 2K5NA 1H9KA 4DPGA 1P16A 3EVQA 4FYDA 2VOBA 2E2HB 3OHAA 5GONF 3HP3A 2G9DA 4JCVE 4ZRZA 3I4NG 1A0IA 3GTLA 1X56A 4DUZH 4K8IA 2B29A 4DV1H 4HMIA 5BR8Q 3I4MB 3A55A 3CQZB 4EFBA 2P0AA 1B33N 2FLPA 4JI7H 5KT6A 3D3RA 4J9SA 3KFUA 2JEFA 2NUCA 4V0BA 1L1OB 4NDXA 2YU9H 3BG5A 5CA1F 2HDMA 2P5ZX 2EE1A 3FKIB 1G8ZD 4O3OA 4C3JH 2J7ZA 1JKJB 5KX5F 3NGDA 3V6JA 4DU9A 1S9FA 4LW1A 1LTTD 4GKKQ 3BA8A 5IYDG 4AQYL 2NVTH 3CC2A 5M3FH 5DLGA 3J81E 2VQFQ 1CQFA 1X9NA 1IKMA 1S0NA 2R7ZA 3CQZH 1YNNC 5M5WB 1K8GA 4DV6Q 5IP7G 1TS2A 3ERQA 3P20A 2AUKA 1QWYA 1KTKA 3W5OA 4JI2H 1ZYRC 1MSGA 1PH8A 1GUWA 4KD3A 3RD4A 4CDCC 4B3SH 4TSSA 1CTMA 3GQCA 4YCUA 4TQSA 4P2CB 4TQRA 5KGUA 4TKOB 3DM1A 1IOVA 4A3IH 4AYBA 2RDGA 4CKBA 3Q24A 1I4XA 4BBRB 4DUYQ 1EY7A 2WFWA 1SNPA 4GZYC 4C3HG 4KKSA 4HYKA 3GTJA 4RB1A 3IKJA 3GIPA 3UDIA 3VR6A 2A1AA 3GQBA 2R93A 1BCPB 4JI4H 1F2LA 2F0KA 3BZCA 4ECRA 3HOXG 1R9TH 2AQ2B 3RIZA 1G51A 2PBZA 1YZ6A 2MO0A 1N32H 3PUWA 3QZ8A 5ELCA 4XDXA 2ZM6H 3RBEA 3F1ZA 1YHQA 1LTAD 3X3NA 4NXNQ 3WO0A 4F8MA 3S16B 4EEYA 2ATLA 3HOZB 4XXEA 3NQTA 4LFCH 3TEHB 2C9OA 5CGKA 3M7GA 3PIO3 4N8FA 1WCMG 2VUMH 4LFAL 1Z7TA 1GLVA 2FP4B 1GUTA 4KKTA 2EYOA 1C0AA 2L11A 1BF4A 3A8IE 4DAYA 3VPBA 2XN9C 5CR3A 2NUAB 1OXTA 5M5YB 2AU0A 3S2HB 3I91A 1VQEA 4DUYH 3NSWA 4KD4A 3C46A 4BY7B 2DGYA 4UY8C 1TU2B 1VQ6A 3GTQB 3NELA 1B6SA 5FD6A 3SK6A 2KCCA 4X62L 3KHLA 2ALZA 5BN4A 5EBCA 4APMA 1K8MA 4IR9A 3GV6A 2E2JH 1VBHA 2F0VA 5KFZA 1B44D 3OHXC 4JBWA 4KY7A 4DGZA 3PIP3 1SFOB 3HOUB 3NHHA 4DL3A 3M9NB 3PZPA 3MFGA 2IX0A 2RSNA 2F0PA 3A56A 2VQFH 1ZYRD 5DLQE 3Q2OA 4DV4H 5FO7B 4JI3H 1FJGL 2HD3A 2BQUA 4DR6L 1BKBA 5LA6F 1IBML 1EY9A 4LFBL 4CKCA 2PW7A 2XRQD 3KDFB 3BYTB 2F0WA 3D4WA 2FJZA 4ECSA 1NR4A 5FLXL 1E22A 3OIPA 5EKLA 5KT7A 3KALA 5EKKA 3GTGH 3SI8A 4X64H 2DY8A 1ICWA 1UEBA 1IYJB 2WV6D 4I65A 3F8NA 4O3RA 3N8DA 3ER0A 2JSOA 1HNXH 2EYJA 4A3MH 4FF2A 1WH2A 5CB4F 4EBEA 2XD4A 3JAMW 2IL8A 1AUVA 1B2TA 1TWGB 4MHEA 1N36L 4LF5L 1QUQB 1XNRL 2GLTA 4UCVA 1TAEA 4AQYH 2R92G 2WP8J 2CCZA 1S0OA 1BCPF 1A3TA 1K73C 2R7FA 4R4OA 4Q43A 1IBKQ 1BR9A 1G6PA 2OTLA 2YYZA 2OQ0A 1A15A 2EXZA 3MTSA 3VR5A 2VPQA 3C2PA 3R5XA 3VR2A 3I56A 4DL4A 2WAQE 4IUQA 2E5LH 1Q81C 1V4YA 2R87A 3D0FA 1JOKA 1CKMA 5IY0A 4WD3A 1WTVA 3TDQA 1L2ZA 1KABA 3OW2A 3FKIA 4J0MA 4KMUC 3R2IA 3TSSA 5C44B 1XMQL 3K3VA 3H6MA 4FF1A 3P7JA 3QOLA 4DR1L 1E2ZA 1O7LA 3OTOQ 4O42A 3E5NA 2IX3A 3PW0A 2VUMG 2Z0SA 1EOVA 3M85A 4JI6L 5KFEA 1QILA 4IUTA 1FD7D 3JRXA 2A5HA 2XWJB 1M4VA 2D2CC 2Z4IA 3K3PA 4DV7H 1NMFA 4FXGC 4RWSC 1BBXC 1UE5A 2EXDA 2L15A 3Q8SB 3CCEA 3QFFA 2R6FA 1L1OC 1HUNA 2ALYB 3PUYA 4EX5A 3NENA 2FJ2A 3NWSA 4IOCA 1K28A 5JVG3 2XGPA 4RG1A 2D5DA 4J9MA 1I5FA 3TINA 4DR5Q 2C2EA 1STHA 2PNHA 5M3FG 4ECTA 2F4VH 2C2RA 4QUCA 2CW8A 2YL2A 3CMEA 4FU0A 4QMGA 4GN4B 2R8JA 1NE3A 2SEBD 5BPHA 1XNQQ 2HVQA 4MV7A 4JI8H 4FS1A 1ZXTA 3AFQA 1IW7C 2YTXA 1VCIA 4XYOA 1HNWH 4A3BH 3ERSX 3C1FA 2RVLA 2NYZD 5A2QE 1OTCA 2ZXRA 2AKWB 3GP7A 4IAJA 3JAME 2JEBI 2V4DA 3I12A 4ME6A 4J9OA 1LLRD 1HA6A 4RFBA 3ND9A 1SMYC 4C3HH 4MV3A 5D3DA 5CMDA 4POGA 4PWQA 2J6SA 1EIHA 2EPBA 1F77A 1I4HA 4JC0A 5T1GA 3Q8RB 4OX9L 4EQNA 1JT8A 1XDNA 1AE2A 1A8VA 3MEHA 2AGQA 1Z9FA 4JI3L 2GPWA 2Q2TA 1N34L 2MJ8A 2BR0A 2PN1A 5CV7A 2V4RA 3T5KA 3PUZA 1V1OA 1FGBD 4R8NA 3K59A 3PO2B 4R4CA 4XYLB 1VKZA 5D8DA 1VQOA 4UAIA 2O5JC 1B4OA 5CAEB 2BOSA 1WTQA 3G6YA 2R7ZH 4C3JG 1Y1WB 1UNNC 4HIDA 3I4OA 5CA0F 1RK6A 5IODA 3DLLA 1X54A 2MFIA 4QGUA 3PW4A 2HDLA 2HQLA 1HQRD 2RHSB 1N36H 1CK1A 2N49A 4LSAA 4LF6H 4B3MQ 5J2TF 3RAXA 3H15A 5EQ0A 1SJED 2HHHQ 3L7ZC 1PVOA 3ORRA 2NVQB 4LUZA 1JJGA 4X65H 3KYHC 1JWSD 3NEMA 4PG3A 2UXBL 1BXTA 3WO1A 1TWAH 2D0PA 3D6WA 5JPMC 1BGWA 3VYSA 4A75A 4JI6Q 3PCOB 1YITA 2JP1A 2L0CA 1Y1VB 3GTJH 1KNEA 1VQ9A 1VQFA 4QL5A 1SNOA 2RF4A 5KFDA 3URYA 3MXGA 2RDJA 3H4BA 4JI0H 5E4XA 2IPKD 3G6XA 3SR1A 2OF1A 3K8AA 2YTYA 2O5IC 4HJ5A 3J7A5 2IT1A 3FPPA 3SVMA 1XTDA 1S40A 1I94L 1PTOC 3EQLC 3OYYA 4BS9A 5JVH3 2R8IA 1XX8A 1BDOA 1V51A 3U9TA 3GTMA 1J5EL 3PIOA 3PSIA 2ID0A 1MZBA 5IT9E 4RZRA 3H3VC 1XNRQ 4U68A 1DONA 2M2LA 3SHLA 2BA0A 2DNCA 2X6GA 2A73B 3KF8B 4X62Q 2K28A 1LABA 1WSCA 4TV9F 3FP9A 3BQ1A 4IURA 3IG0A 3T1YL 3BVZA 1TA8A 1CZGA 3A74A 3SE0A 4EQ5A 2W9BA 4O1NA 4NW2A 2ICIA 2UUAL 3M7NA 2CH4A 3PMFA 3E0JA 3MFHA 1SNDA 3E9HA 2XTIA 2AHOB 5DQHA 2FLNA 1D8LA 4YWLA 3KLSX 1I6HB 2ZJTA 1BXRA 1LV9A 3CAMA 3OSPA 1HNWL 2JE6I 2W9CA 1SLJA 1G2TA 4J9NA 2JA9A 4RNMA 3BU2A 4L5QA 1A3VA 3SXHA 3BYYB 1ZQ7A 2PI2A 2EDGA 4GC6A 4F4ZA 5C4JB 3MZ5A 4A3BG 5EOYA 2KENA 2B63B 3PQIA 2UXDL 1SAPA 3GTLB 3M3YB 4QIWA 2D62A 3HOVH 1K8OA 3VYTA 3ORQA 3W3AA 5IGEA 3W1BA 1PDQA 4UP9A 1NJIC 4A3BB 2A19A 4JI3Q 2EYPA 2K5DA 5JVLA 2UUBQ 4A3FB 5CC4A 2AWNA 2E76C 3UQ8A 3A0JA 4RGTA 5IGDA 3V05A 1JLLB 2XC9A 5FLXc 5M3MG 2VQEH 1E2WA 1OXSC 3GILA 3K6OA 2GVAA 3UDXA 3HOZH 5KFNA 1D7QA 1A63A 3SK8A 5KKNB 3IAYA 4L6TB 2VB2X 3SDZA 2DJGC 1IBKL 2HQEA 3GV5B 3MAQA 4JBKA 5IWAQ 4XX0B 2W8LA 2N8NA 1XNRH 1ESRA 4XYQA 1XYIA 1PHJA 3K5OA 1JIHA 3V6HA 2BDOA 4BBSH 3AQQA 4MTNA 2VS1A 1LT5D 3BVMA 4JBMA 4K0KL 1WR2A 1CKNB 3ONAB 3J80c 1TWCH 2VQFL 5JUMA 1MIUA 4B3TH 1HCZA 4DV3Q 1JE5A 4HNUA 1IBMH 2NTTA 2Z9HA 4LFCQ 1QNKA 1A6XA 5T14A 5DQGA 2JEGA 1SFOH 3IFTA 2UXBH 2CVRA 4GNXC 3KF8A 1HQMC 3BJUA 2EYHA 1YHBA 1IBMQ 4M7EA 1EYZA 1TXYA 4ZAIA 2JA7B 4O4HF 2EYFA 4OWTB 5C3EB 2WAQG 4R8UA 2ICEC 2Z4HA 2YW2A 1X55A 1ZHSA 5C44G 3S15H 4QF4A 4HJ8A 4PQXA 1IL8A 3RV4A 4X65Q 4KLKA 4A3EB 4A4IA 3O13A 4JI0L 1N56A 3U9SA 1XPRA 3QR8A 5I2YA 3DM3A 3E5SA 5EPLA 4B3MH 3P75A 3PR4A 4A3FG 2UXCH 3I2ZA 3I72A 1VBGA 1KC7A 3LP8A 1E2VA 5I47A 1EOTA 2N55A 2VB3X 1S5FD 2X0SA 1CHQD 1JCKB 2B3GA 1GGOA 3R3OA 4UHVA 5IYCG 4F7XA 3PW5A 1VQKA 3FVQA 5KFJA 1PK8A 3BS1A 2M00A 2E5LL 2B8FA 3S15B 4MA5A 2A6EC 4U7CA 1K83B 2DIKA 3GTKH 3NBHB 1RIPA 3PO3H 4DV6H 3BJYA 2BH2A 2WKDA 2YU9A 3MXNB 2VPSA 3J80E 4LWCA 1QVCA 4K6DA 4YWMA 2KBNA 4A3MG 3T1YH 3GTQA 2HT1A 3NK9A 3K5NA 4EBDA 4OL7A 1VQMA 2EY2A 3G71A 3CPFA 5EPJA 4KY5A 3BDLA 4Q0YA 2RGVA 2HGSA 3JC66 1HTLD 4DK6C 5LL6S 3MWYW 5F2DA 3TBIB 1EQVA 2EJFC 4O2AF 2J6UA 1ET9A 4AIMA 1JMCA 3GTMB 5EWEA 1ENCA 1WCMB 2NN6G 4YR3A 2NVXB 5KFFA 2XCAA 4A3LH 2JN4A 4U6PA 3WDNA 4IFDI 5IT9c 2F4IA 4F4WA 4IALA 4CC5A 2WDTA 4YR2A 3HKZE 3QJYA 4P74A 2CKZB 3S9WA 2O4XA 1GM5A 1YNXA 2I5MX 4Y7NH 1KQSA 1WD1A 1TWHA 2UUCL 2JA6G 2F0JA 2JA8G 4A93G 3GDEA 2D0OA 2PMZB 3HOVB 3QB3A 4LAAA 4X62H 1GO3E 4M1UB 5EBDA 4A3FH 1B9NA 2FINB 2XNAC 2YRWA 2B63H 4EGQA 4HMJA 1IBLL 5I4DA 3PR5B 1GHJA 4YBZB 4JI1Q 1Q8KA 4R8UB 1HJPA 4DR7L 1EZ1A 3HOYH 3Q8DA 1B7YB 3T1HH 5KFKA 1LT3D 1ZEQX 2FFKB 2BH8A 3SK4A 4DR6H 3D8GA 2JA7G 4KI0A 1EEID 3T56B 5KFMA 1A3UA 3H4DA 3RV3A 2ASJA 3E3XA 3D4DA 4OWWB 3GIJA 1ZETA 4I4TF 3QG1A 5C4XB 4O2DA 1MKHA 2MP1A 1WD0A 3BZKA 1SE4A 3KLRA 1AN7A 2W7PA 4GKJH 1E4EA 1WJJA 2HCIA 2MNAA 4X6AH 4L5TA 2WYOA 1YBYA 1MJCA 1EIGA 2CHBD 4BBSB 3GIIA 3MR6A 5IP9H 1X32A 1V1PB 3TRZA 4CJ2C 2F0LA 3HOWG 5KG0A 2WE6A 1WFQA 4ME5A 1CSQA 2NU7B 1PRTC 1I3QA 4RAYA 1LTRD 3OUUA 4K0KQ 5KNCA 2FPPB 2FMCA 3FMCA 3CRLC 4DR2L 1F9RA 5KG2A 2K75A 1WCMA 1T5XD 4YB8B 3K7AB 4YY3H 2JEJA 1KJQA 5CV6A 5CYUA 1HFNA 4J9KA 1J9OA 4MIUA 2R85A 4Z9CB 1LYLA 3MWDA 2C35B 1EWHA 3A7AB 4ZKBB 2PQEA 1Z6HA 2RDIA 5LL6b 5DGAA 2Q8RE 2IW3A 3GTGA 3IL8A 5T1IA 2I8CA 4RGMA 1D6EC 1CQVA 1S68A 1LT6D 3LNNA 2K4KA 3VYUA 1EWIA 4HSPA 3FHWA 5FPRA 3G7LA 4FBTA 2O2LD 1JC7A 2PZUA 4K2KA 4OELB 3S1NH 2PI2E 3GO5A 2YZGA 1S3OA 2NN6I 5C5LA 4TVAB 1QCBD 3TP6A 1ASZA 2JA6H 2E2IH 3DUZA 3T1YQ 3G8CA 4DV0L 4AH6A 3OMGA 1I94H 4QWBA 2VL6A 4HR7B 5CORA 4ECXA 2Q2UA 4KK7A 3RTXA 4HN7A 4QWAA 2BQRA 4O0AA 4DV4L 1SYDA 3RZDH 2K5WA 5AFWA 4ZQ3A 1X3FA 4GLVB 1SYCA 5LMNL 1O7ZA 4IO9A 3DWAA 3S16H 2YTVA 1JQYD 1S0MA 1LTLA 2B2VC 4QY7A 4AYBE 4OIKA 1XNQH 3HOWB 4A3KH 2NVYA 1EQQA 4EFEA 5HGQA 2A6HD 5KFYA 5L9XA 3G6JB 3BA9A 3MR5A 4JI1L 2CW0C 2NWGA 1E3PA 4C2MH 2NU8B 4ED8A 4G3IA 3K80C 3D31A 1X6OA 3PO3G 4X66H 3AFPA 5E1FA 2W9BB 1CFMA 2ZT9C 3CCJA 4A3IB 1BQQT 2FB9A 1UC9A 2YZMA 2PZWA 1JR0D 4IRCA 3N52A 5CBAE 1I7NA 3R23A 3RLNA 2NZOA 3S14H 5C5JA 1NR2A 5CV8A 1E4GT 4QW9A 4RAZA 3LWEA 2LMCB 2UUCQ 4BY7H 1N34H 3HOYB 3OTOH 1O7IA 1YNJC 2RCFA 5L37A 1HH2P 3K81C 3HKZB 2AQ4A 1DM0B 3I73A 4JV0A 1HR0L 2BCOA 3I7FA 1RJPA 5DQIA 2AUJD 2E8GA 2QGQA 3OW7A 2JXMB 5IYCH 3GIQA 4RHSA 3I8ZA 2B2WC 2RBMA 2VUMB 1LTID 3M4YA 5CV4A 1O80A 1PFNA 3PV0A 4DR4Q 3RZOH 3UE0A 4DAVA 3ETJA 3KTMA 1PA6A 2Z6KA 4UP7A 4DNIA 3UFXB 3RB4A 4CBVA 1DOLA 2F0SA 4K6LA 2V5AA 1CQJB 2GPSA 1J6QA 1I6VC 3JRWA 4G7HC 3OSNA 2DZDA 4A3KG 5F9NA 3M9OB 2GA4B 1PRTF 1Z2NX 4DR2H 1D1IA 2WIIB 4FM9A 3HS0C 4GOPC 1QUQA 5KFQA 4DV2H 1QZHA 1EUDB 1SBBB 4YY3L 4X64Q 1FJGQ 4A3DH 4GC7A 3GLKA 5M5XB 3K5LA 1E1TA 2Q8IB 4JI8L 4NKLA 2MQHA 2VR1A 4GOPB 5LYJF 1MSHA 4PNYA 4R4IA 1K0RA 3VR3A 4R7RA 1WTPA 2EYLA 2KHSA 2R7DA 1N9WA 2QKIC 3RNUA 1AZPA 1EYGA 4KHPL 2R7MA 4HEDA 5C44H 1X65A 2SDFA 4DV4Q 4BA1I 3S1QB 4MV9A 2QW7A 4JI4L 4ZOLF 1HNZL 3H0GG 5GAEC 4APVA 4NMZA 1GSAA 2HHHL 2RA4A 2UXCL 2ZM6L 1GSOA 5D1OA 5JEAG 2W71A 3ZYYX 1ENAA 4LJZC 2J9GA 2A6HC 4LUVA 3HOZG 3KJPA 1KDCA 3HOXH 1GVPA 5I2XA 1TWAA 3L9AX 3CCVA 4Q0FA 4R8IA 2UUAH 3NE5B 4B08A 1C4QA 2BQ3A 4YP3A 4JI5H 1YNJD 2VZAA 3CC7A 5KNBA 1PH1A 2NU6B 1XNQL 1C7YA 1YHAA 3G4SA 1VQCA 3NTHA 4PZ7A 2R7NA 5F9LA 4QWCA 5FJ8G 4HIOA 4B3RL 3KHHA 2R7LA 4ZK9B 2R3ZA 1V1QA 1GUGA 4G4KA 4JV5H 3TP7A 4HJAA 4A3JH 1ENFA 5IGGA 4RUCA 1F9SA 4BY7G 2ZDGA 1E0BA 1FGUA 3NP8A 4A3KB 1CKOA 1H95A 4NXNH 4UCTA 3GTKB 1WOCA 3CVZA 3PGZA 1QVFA 4BXXG 4X66L 1SYEA 3VA5A 5IE8A 3CU7A 3HOWH 1B3QA 1RJTA 1K83H 2IA6A 1HUMA 2E2JB 4X66Q 1KJJA 1TWGA 3H40A 2Y0SG 1TIID 4IN3A 1EQRA 1U0LA 5GROA 1QVGA 2ZJPA 5IWAH 3ULLA 3S17H 5DLFA 2LXKA 1EY8A 1XWEA 1CM9A 4H13C 4DR1Q 4O2BF 5ELNA 4LF6Q 4RA8A 5KFLA 5LMNQ 2NVYB 5A35A 4PMBA 5I9OA 3CCQA 1VQBA 2BE5D 3Q8QB 1JOOA 1Z47A 4PZ8A 5KFUA 1NMGA 1EY6A 2XRSD 3MHBA 4RKLA 3R8BA 4LF7Q 2Y0SA 2QYZA 3EYYA 4B3SQ 1IBLH 2NBFA 2SNSA 2FXQA 5HGTA 4C3IB 3F2UA 2ZTEA 1E1OA 1EYCA 3CMAA 2IY5B 1E4EB 5L1LA 3PVXA 1S97A 4IZOA 3S1MH 4A3MB 4G57A 3JZIA 4HIMA 5ELOA 3TN2A 1PH7A 3I4NB 5M9OA 4DR4L 3L0OA 3RB0A 2ASLA 1V8QA 1Q12A 2JA8H 4A93H 4QWDA 1NCVA 4DV2L 1H9SB 3JSNA 3J81i 4Y52H 1WTRA 1XPUA 2F0TA 1S10A 1K0SA 4QIWE 1UE1A 3F8TA 3M4PA 2B39A 1T36A 1HR0Q 4DV1Q 1GXDC 5GAHC 3GTOH 4DFAA 2IMWP 1LACA 4HAEA 5EKIA 1YIJA 1B9MA 4LFBQ 4YY3Q 5C0XG 1CS0A 1PYBA 1EZ8A 4IFDH 4IFDJ 4U673 4MV6A 3EA6A 1Y1VA 4WJ4A 4KHPH 3J80L 1CI3M 1KXLA 1A9XA 1VQHA 3S24A 5KFAA 1VQ5A 5ISRA 1L0XB 5LL6X 4KJOA 3FKIH 1GOZA 3S1QH 4IPHA 5LMNH 1LO5D 3KK7A 3HB9A 2XSCA 3GV3A 3UI2A 4ECWA 2QA4A 5EZYF 2BE5C 5M5YH 4ZQIA 1YI2A 4I50F 1T9HA 2PCFB 1K8AC 4BY1B 1S5CD 4L5RC 2B8GA 2PMZA 1HZ9A 1SFOA 1W6KA 4UFZA 3KHRA 3R5HA 4KN4C 5JJLA 1U4PA 3RMHA 4GKJQ 5M5WH 4QB4A 4AYBB 2TSSA 4M8AA 4DK3C 5JAVA 4Y7NB 3EROA 4K14A 3CP0A 3HEJA 4F87A 1IYVA 1HHVA 2H1EA 3QOJA 3R2TA 4IPCA 3I3CA 4RGOS 1WTHA 3HRZC 1VQPA 1UE7A 3RAQA 1SMYD 5FO8B 3GTPH 3RGZA 2Y0SB 3EIVA 1KL9A 1DCZA 3KAJA 1WTOA 4MV4A 5BMVF 1MD2D 4BBSG 4G7ZC 2MO1A 3NXWA 3EBEA 4JI5Q 2R8GA 3RB3A 5G3LD 4DXGA 5FLXE 2SNMA 4RB0A 1FNUA 3MEFA 2E5LQ 5HBRB 3PW7A 3LWBA 2KECA 4B3RQ 1R9TB 4LFAH 1XMQQ 4PMCA 2I5LX 3FRPB 5ELBA 1Y1WG 1D5MC 4JYAQ 3VPDA 5JEAJ 5JEAH 4OX9Q 3GIKA 4A3JB 3FMAA 2CQOA 4OIJA 4RHRA 2PZTA 2WTFA 1PH2A 3J7AV 2EVBA 3NQIA 4CDEC 1LTBD 4LH7A 3I55A 5EPKA 2HCCA 3CC4A 4Q45A 4QUFA 2LY7A 3C1EA 2IX1A 1AUXA 3CCSA 1BVSA 1V1PA 5KG7A 4F4XA 4ECUA 4OONA 5DG7A 5LMUL 4DR7H 4XYMB 3ITPA 3CF5A 1QE6A 2JQOA 2Z8LA 1Y1WA 1NSNS 1PH6A 4A3EG 4RNNA 1PLFA 1Q90A 4L8JA 1VQAA 2F0IA 4IUPA 3OHBA 2Y0SE 4A3IG 4YAJB 4DXFA 4XZ3B 3HZXA 4DUZL 3STBD 5KFOA 3N40P 3NWTA 4ULLA 4DV5H 3TP5A 2XGQA 1L2FA 3MXNA 2B63G 3GTQH 5LMUQ 5JJKA 3S2HH 5CV5A 3IRBA 3TREA 4KHVA 4X3KA 2FKLA 3KF6A 1STAA 4J15A 1KLUD 4DR5L 1TWHH 3KHGA 2IJ0A 4BWGB 5AJ3Q 3BDCA 1RCVD 1H9JA 1YVCA 1RYRA 2K6AA 4K8JA 1EU3A 4IR1A 2QCPX 3K5HA 5KG6A 1R4QB 4JYAL 1EFWA 1M7JA 5C3XA 3A7LA 3J7YW 3N6XA 3CPWA 2OH2A 4FP5D 2VXWA 4RNOA 1GYFA 2L12A 4HNVA 3JAMi 2HVRA 3WOEA 3TQ1A 1E24A 1PTOB 5IIFA 1HNXL 3TQYA 1STYA 5KYIA 1MBYA 1QZGA 3L2PA 2R86A 5KG3A 2JA5A 5L1KA 1NUCA 1Y14B 2WAQA 5FLMG 2B2TC 5ELFA 5GQOA 3U4VA 4KN7C 3K58A 2F0OA 4GOPA 1YEZA 4ED3A 1KRTA 3S1NB 4A3GB 2K50A 2B63A 1EHIA 3BZDB 2FE3A 1KLGD 4YHHQ 1BNZA 2XIGA 2PW5A 4DL6A 2JA6B 3AYHB 2UU9L 4PZ6A 4WFN3 5C1PA 5L1IA 1B8AA 2UUCH 2AWOA 1OWTA 1KNAA 3K7UC 4UCSA 1T5EA 2H4OA 1PXUA 3M9BA 1DD2A 3JAML 1PH9A 4G7OC 2LS01 5KFIA 4HJ9A 2E2HA 2LKVA 4O4LF 4B3TQ 2OXPA 3X3MA 4EQOA 1QOHA 2MPMA 3SEBA 1KIXA 4DL2A 4UP8A 2PPBC 4NXML 4MAMA 3D4RA 4OO1H 1RHPA 2NZHA 2YU9B 3DF7A 2NB0A 2QEJC 4XT1B 5M3MB 1K83A 3ND8A 1DOKA 2UUAQ 1BBWA 1VMPA 3DHQA 3M4IA 4YJ2F 1Z2PX 2WB1B 5IYBG 1VQGA 2F0EA 3H0GA 2KA7A 4IRKA 5EWGA 1JJ2A 3BDOA 1HNZQ 2RDHA 1M0WA 5C3EH 1VQ4A 5FPOA 1RJQA 1Y8PB 1ICFB 3CCUA 3QWNA 3RN2A 1SXTA 1RDPD 5D1OB 4A3EH 4GKJL 4A2BA 4C1NK 1WI5A 1MHWC 1PYWD 2QK4A 2C2DA 2V4QA 4IHJF 1UWVA 2K5QA 4JI5L 1N48A 2H5XA 4NXMQ 4C5BA 5KT5A 3TIGA 3NTKA 1K3RA 2KEDA 1S72A 1RJRA 4UCUA 4LF4H 1WCMH 2K03A 2UUBH 1UAPA 3H91A 4GKKH 4TRDA 2L5TA 2SCUB 2JA7A 3MC0B 4ZCKA 4BBRH 4DF7A 1I7LA 4L1KA 2CW0D 1I4RA 2X69A 1EY4A 2E2IA 3E9IA 5KT4A 2F0MA 4DN4M 2JK8A 2UVRA 3ICEA 2D9UA 1FJGH 2DJFC 3M9MB 4JOIA 2CFMA 3I70A 2W6QA 4J9QA 4J9LA 4DV2Q 1FNVA 1W96A 1BCPD 4JI7Q 1GKHA 2DY7A 4B3SL 4R4TA 5FKAC 1VQIA 4LF8H 4QW8A 4MZ9A 5NUCA 3MWMA 1FL0A 2K7VA 3B6YA 3MWEA 2JA6A 2IHEA 3S1RB 5J3BA 4R1JA 5C4JH 2G5DA 2PNRC 4J1MA 3HOVG 3J81j 4MN3A 5KG5A 1LTSD 3UDFA 1WTWA 3PW2A 2B2YA 2CZGA 3KJOA 4J9RA 1W93A 1TS4A 1EUCB 2R7KA 4DV3L 3TMEA 5KG4A 1XMQH 3UDGA 5IP7H 4C3JB 4ZLTF 4DA2A 2KCNA 2W6NA 1XMOH 4LF9Q 5D1PA 2Q8TA 3STBC 4IUVA 2NVYH 3BQ0A 4OGQC 1B50A 1DGSA 5D14A 1N34Q 1A2UA 1C9OA 1SDFA 2XWBB 4NP5A 3K5MA 4HTHA 5C5MA 5FLMH 4X65L 4ODGA 4JI0Q 4J6HA 1BO0A 4N9TA 5C4XG 2B2WA 2Z1CA 1IXRA 1EIFA 4ABNA 2R7ZB 1KRSA 4UCOA 3HOUH 1Q46A 4JI6H 1CSPA 2OWOA 5IWAL 1DJRD 3QIAA 2KHIA 3T1HQ 1TS3A 3TS0A 3S1MB 4QIWB 4A3CH 5FOBB 1RKNA 3I4NH 5K2MA 3PO3B 5IT9L 3HBLA 2DPIA 1JWUD 5EWFA 4JPBW 3KXYT 4JI1H 2HHHH 2C5CA 3GIDA 2YS6A 1RD9D 4ZYSA 1ULZA 3Q1KA 2N78A 1F2ZA 1IKLA 1ZHQA 1I50A 1PFMA 3GIMA 2XCPA 5FO9B 5KIXA 2K05A 4IJLA 3GTKA 5DAUA 3ZJYC 1KDBA 5KYLA 5A2QL 1M0TA 1DXMA 3M4OB 4KHPQ 2I46A 3OUZA 1Q8IA 3EJIA 2DUDA 4OO1G 1UNSA 1C30A 5BR8L 3CHBD 4LFBH 1MJEA 4ZUIA 2A69C 1HR0H 2XIWA 1A2TA 3F2DA 1R4PB 4HR7A 5IYZF 3VDYA 2PQAB 2DNEA 3E0EA
chains in the Genus database with same CATH topology
1IL2A 4X64L 4GOPC 1QUQA 2KCMA 1VS0A 4POGA 1QZHA 4YY3L 4X64Q 1EIYB 1L0WA 4JC0A 1FJGQ 4A3DH 1UE6A 4XTCS 1G291 4OX9L 1E1TA 3AEVA 4LF4L 3CCRA 4JI8L 1AE2A 1JT8A 1A8VA 1B70B 2MQHA 4GOPB 1Z9FA 4JI3L 1HZCA 4LF6L 2Q2TA 3U58A 4R4IA 1N34L 1K0RA 4IJHA 4DKAC 2LXJA 1HZAA 4BY1H 4JI2L 4DV5L 2R7DA 1N9WA 3RNUA 2LSSA 1K9MC 1EYGA 4LF5Q 4KHPL 5GAGC 2WB1G 5C44H 1X65A 4DV4Q 2UXDQ 3PUZA 4BA1I 1ASYA 1LUZA 1W3SA 4C3IH 4OXPA 4JI4L 4R4CA 2NVQH 2ZTDA 1XPOA 1HNZL 4DUZQ 1VQOA 3H0GG 5GAEC 2HIXA 1Y1VG 3U50C 4APVA 2JA5H 4BA2I 2HHHL 4JI7L 2UXCL 1LM0A 4PMWA 2R7ZH 1HNWQ 3CD6A 2ZM6L 3HOUG 4HIDA 3I4OA 5JEAG 3DLLA 1X54A 2MFIA 4QGUA 2HQLA 2RHSB 3S2DH 4GLAC 4LUVA 2ZJRA 3HOZG 2N49A 3J80i 3KJPA 3HOXH 1GVPA 2R93H 3CCVA 4B3MQ 3H15A 1Q86C 2HHHQ 1A62A 3L7ZC 1PVOA 3PUVA 3S1RH 3EN2A 3JAMc 4LUZA 2VZAA 1JJGA 3KYHC 3LGJA 3CC7A 3SGIA 3NEMA 1PH1A 1XNQL 1C7YA 1YHAA 4PG3A 3G4SA 1VQCA 2UXBL 1TWAH 2D0PA 4PZ7A 4P72A 4BY1G 5FJ8G 4HIOA 4A75A 2YV5A 4B3RL 4JI6Q 2K5HA 3PCOB 1V1QA 2F52A 1YITA 2ZTCA 3GTJH 1VQNA 4OWXB 4HJAA 1VQ9A 1VQFA 4QL5A 4A3JH 2RF4A 2UU9Q 2JJQA 1TWGH 4BY7G 1FGUA 4LF9L 1CKOA 1EUJA 1N33Q 1H95A 1SE8A 5EAYA 1WOCA 5GADC 2ZM6Q 3PGZA 1QVFA 4BXXG 4X66L 3HOWH 5IE8A 3TS2A 4A3DG 4JV5Q 3K8AA 2YTYA 1K83H 4JV5L 2K14A 1KD1C 2ZJQA 4X66Q 4HJ5A 3PUXA 3J7A5 2Y0SG 2IT1A 3M4QA 4AYBG 1XTDA 1CKNA 1EQRA 1S40A 4JI4Q 1U0LA 5GROA 1QVGA 1I94L 2ZJPA 3OYYA 4TQUS 2UUBL 3ULLA 3S17H 2E2HH 2LXKA 3KF6B 1IZ6A 3T1HL 4R4QA 3GD7A 1X3GA 3PIOA 3PSIA 2ID0A 4DR1Q 1J5EL 5ELNA 4LF6Q 5LMNQ 1XNRQ 5C4XH 1N36Q 4LF7L 1NY4A 3CCQA 1VQBA 2BA0A 4YCWA 2Q2HA 1Z47A 3KF8B 4PZ8A 1NMGA 4X62Q 4LF7Q 3FP9A 1YJWA 1VQJA 3T1YL 4B3SQ 4DV0Q 3A74A 4ALPA 4EQ5A 3H0GH 1I3QH 2FXQA 1NBWA 5IP9G 5M5XH 5IYBH 2UUAL 3PF4A 3M7NA 4GNXA 2JA7H 4IFDG 2ZTEA 1E1OA 3E9HA 1V9PA 2XTIA 3CMAA 3VDYA 2IY5B 5M3MH 2AHOB 1I94Q 1D8LA 4YWLA 2VQEL 3S1MH 2K5VA 1PH4A 3CAMA 2Q2IA 1HNWL 4WJ3M 2JE6I 3KOJA 4HIMA 1SLJA 2OQKA 5ELOA 2JA9A 3BU2A 2JEAI 1W2BA 4L5QA 5C3EG 1PH7A 4DR4L 1P8LA 2PI2A 3L0OA 4A3BG 2KHJA 1N33L 2KENA 2RHQB 3FKIG 1OXVA 3WWVA 4DV7L 2UXDL 1Q12A 2ASBA 2JA8H 4A93H 2IHFA 4DV5Q 1VQDA 4IOAA 1KAWA 2XGTA 3CCLA 2D62A 3H3VI 3HOVH 5LMNW 4DV2L 3W1BA 1NJIC 4NPSA 4UP9A 2A19A 3J81i 4RMFA 4DR2Q 1Q7YC 2UUBQ 4JI3Q 1XPUA 4Y52H 4QIWE 1UE1A 4LF4Q 3F8TA 1Y1VH 2AWNA 3M4PA 1XMOL 3A0JA 1HR0Q 4L5SA 4DV1Q 1GD7A 4DR7Q 5GAHC 3GTOH 5IYDH 5FLXc 1YIJA 5M3MG 4LFBQ 2EQSA 4YY3Q 1OXSC 1PYBA 5C0XG 2GVAA 1KHIA 3UDXA 1FVIA 3HOZH 4IFDJ 5K36G 1D7QA 3G48A 1A63A 2WB1E 4WJ4A 1SROA 4QQBX 1KXLA 1VQHA 2ES2A 1HR0W 1IBKL 3S24A 1HZBA 4JG2A 1VQ5A 3FKIH 4JBKA 5IWAQ 3U4ZA 3S1QH 3KDFA 4LFAQ 2N8NA 4H02A 4IPHA 4OO1I 1VQ7A 1PHJA 1U5KA 2R92H 3A5ZB 2QA4A 4BBSH 1SMXA 5M5YH 3AQQA 4MTNA 2VS1A 4K0KL 2NVXH 4JBMA 1YI2A 1CKNB 2ATWA 4FDBA 3J80c 1T9HA 4A3GG 1X3EA 1TWCH 4NXNL 1K8AC 4DAMA 5AJ3L 2VQFL 4L5RC 2K52A 4DR3Q 1HZ9A 4B3ML 1Q1BA 4GKKL 1MIUA 1J5EQ 4A3LG 4DV3Q 1JE5A 5JJLA 4JOIC 4GKJQ 5M5WH 3PF5A 1YJ9A 4LFCQ 4YCVA 4DK3C 3J81c 3CP0A 4GN5A 1SFOH 2A8VA 2R6GA 4GNXC 4POFA 4IPCA 3CCMA 3BJUA 3CW2C 1VQPA 1YHBA 2EIFA 1IBMQ 2GN5A 1TXYA 1UE7A 2KCTA 3M4OH 1I6HH 3F2CA 4OWTB 1PFSA 1XJVA 3GTPH 4DR6Q 2WAQG 3EIVA 2PQAA 1KL9A 1X55A 4LF8L 5C44G 3S15H 5FJ8H 4HJ8A 4BBSG 4X65Q 4KLKA 5H1SE 4A4IA 2MO1A 4JI0L 3EBEA 4JI5Q 2I5HA 4IPDA 4A3GH 1XPRA 1M1KC 3I4MG 3MEFA 3DM3A 2E5LQ 2QEXA 4P73A 4A3FG 4B3RQ 3I2ZA 3PIPA 1XMQQ 3M3YH 2I5LX 4JYAQ 1Y1WG 1VQ8A 5JEAJ 4OX9Q 4IPGA 4BXXH 3GTLH 2CQOA 2B3GA 1PH2A 2K5NA 5C0XI 3I55A 4DPGA 1P16A 4KHZA 5IYCG 3CC4A 1VQKA 1I50H 2IX1A 2E5LL 4JCVE 3I4NG 1A0IA 3CCSA 1BVSA 1X56A 3GTKH 3NBHB 4ME3A 1RIPA 3PO3H 4OONA 5LMUL 2B29A 4DAYB 2BH2A 3MXNB 2OCEA 5BR8Q 3CF5A 4LWCA 2JQOA 1QVCA 1Q1EA 4YWMA 2KBNA 4A3MG 4A3EG 1PH6A 1VQAA 2HT1A 1PYSB 2Y0SE 4A3IG 3KFUA 2AMCB 1L1OB 3STBD 3G71A 4DUZL 1VQMA 3CPFA 2YU9H 1Y1WH 1L2FA 2B63G 3GTQH 4C3JH 3JC66 1N8RC 5LMUQ 4DK6C 5JJKA 3S2HH 3IRBA 2OTJA 3TREA 4UPAA 4AIMA 1JMCA 1YJNA 4LNQA 4HIKA 4LW1A 4BBRG 2NN6G 3KF6A 4GKKQ 5IYDG 4J15A 4AQYL 4DR5L 2NVTH 1TWHH 4YHHL 5M3FH 3CC2A 4A3LH 4IFDI 5IT9c 5AJ3Q 1YVCA 5C0XJ 2VQFQ 1X9NA 3CQZH 1K8GA 1TWFH 3HKZE 4P74A 1BBUA 2CKZB 5IP7G 4DV6Q 1GM5A 1YNXA 2I5MX 4Y7NH 1KQSA 1EFWA 4JYAL 3CXCA 3W5OA 3A5UA 1PH8A 2UUCL 3CPWA 2JA6G 1N32L 2JA8G 4A93G 3GDEA 2D0OA 3RLOA 3JAMi 1E24A 1HNXL 4A76A 4YCUA 1GO3E 3ULJA 3TQYA 1QZGA 3L2PA 1PV4A 2BA1A 4A3FH 4A3IH 1Y14B 2B63H 4DUYQ 5FLMG 3F2BA 1IBLL 2WFWA 5HY6A 5GQOA 3U4VA 4B3TL 2F4VQ 1OXXK 1SRUA 4JI1Q 4GOPA 4QJFA 1Q8KA 1YEZA 2JA5G 1KRTA 1HJPA 2K50A 4DV1L 4DR7L 3UDIA 3HOYH 2A1AA 1B7YB 3Q8DA 4YHHQ 3BZCA 3PO2G 2BH8A 3HOXG 3AYHB 1R9TH 2UU9L 4PZ6A 1G51A 2PMZE 4KI0A 4DUYL 2JA7G 1YZ6A 1B8AA 2MO0A 4GN3B 2AWOA 3PUWA 4DR3L 3K7UC 4OWWB 3F1ZA 1YHQA 4NXNQ 3M9BA 4O2DA 1MKHA 1PH9A 3RLFA 3BZKA 3TEHB 4GLXA 4XIGS 1WJJA 2MNAA 4HJ9A 3I4MH 4X6AH 4L5TA 1WCMG 4B3TQ 2VUMH 1YBYA 2VNUD 1MJCA 4LFAL 1C0AA 1KIXA 4UP8A 4NXML 2NZHA 4YWKA 5IP9H 1CUKA 1VQLA 2N3SA 3TRZA 4A3CG 3HOWG 1OXTA 3W1GA 2UUAQ 1BBWA 3K0XA 1L1OA 1WFQA 4A3KG 2I0QA 5IYBG 1VQGA 1VQEA 1CSQA 2HIVA 2DGYA 4UY8C 1VQ6A 3NELA 4DV6L 1JJ2A 1JB7A 4X62L 1HNZQ 5C3EH 1VQ4A 4K0KQ 3GTMH 2RCNA 4HJ7A 3CCUA 2CWAA 4DR2L 3RN2A 4AQYQ 1RL2A 2E2JH 2K75A 4A3EH 4JBWA 4GKJL 1WI5A 3RR5A 2F3IA 1UWVA 4JI5L 1LYLA 2H5XA 2C35B 2IX0A 4NXMQ 1HNXQ 1K3RA 1S72A 5DLQE 4LF8Q 1WCMH 1FJGL 4DR6L 1BKBA 1IBML 1PH5A 2K4KA 1Q82C 4BBRH 4LFBL 1EWIA 3FHWA 3KDFB 5JJIA 3E9IA 2JK8A 1E22A 3ICEA 3GTGH 4LFCL 4JOIA 2CFMA 3S1NH 2PI2E 3GO5A 4DV2Q 1S3OA 2NN6I 3G6EA 1KC8C 1UEBA 1IYJB 4TVAB 1ASZA 4JI7Q 2JA6H 1GKHA 2E2IH 3T1YQ 2Z6KC 4R4TA 4DV0L 1VQIA 4B3SL 3ER0A 4AH6A 4A3MH 4MZ9A 1V43A 2VL6A 1PH3A 2Q2UA 1FL0A 4O0AA 4DV4L 3RZDH 1N36L 3B6YA 2IHEA 1X3FA 5J3BA 4GLVB 4R1JA 1QUQB 5LMNL 1IBLQ 4LF5L 2CWPA 5C4JH 1XNRL 2R92G 2WP8J 4IO9A 2CCZA 1K73C 3S16H 2YTVA 2R7FA 4R4OA 3HOVG 1LTLA 3J81j 1IBKQ 3UDFA 4QY7A 3UE1A 4AYBE 4JI8Q 3ULPA 4A3JG 2R7ZG 1G6PA 2OTLA 2GVBA 2OQ0A 2V1CC 2YYZA 3KJOA 1SR3A 4DV3L 3RN5A 2UXCQ 3I56A 3UDGA 3PO2H 2WAQE 4A3KH 1Q81C 5IP7H 3D0FA 4NB3A 1CKMA 5IY0A 1EQQA 5HGQA 3OW2A 4JI1L 4LF9Q 1E3PA 4C2MH 1XMQL 3K80C 3D31A 3HFZB 1X6OA 2NVYH 3STBC 4GNXB 2F4VL 3PO3G 3AFPA 1DGSA 4DR1L 3OTOQ 3CCJA 3OTOL 1N34Q 4MNOA 1C9OA 1M90C 2Z0SA 2VUMG 1EOVA 1OXUA 3H3VH 3M85A 4JI6L 1AH9A 3HKZG 4X65L 5FLMH 1AE3A 3RLNA 2NZOA 4DV7Q 4JI0Q 3S14H 2UXBQ 5C4XG 1NMFA 1IXRA 1EIFA 1UE5A 2EXDA 2L15A 3KLWA 1KRSA 4P75A 3K7AH 3CCEA 2UUCQ 4BY7H 1N32Q 1L1OC 1O7IA 1Q46A 3HOUH 3HKSA 2ALYB 1HH2P 3PUYA 3K81C 3NENA 4EX5A 1CSPA 2OWOA 5IWAL 2KHIA 3T1HQ 3TS0A 4IOCA 1XMOQ 1HR0L 4A3CH 3I7FA 5E7NA 4RG1A 2VW9A 1I5FA 2VY3A 4LUOA 3I4NH 2E8GA 4DR5Q 3HOYG 2QGQA 1NTGA 5IYCH 2PNHA 5M3FG 3CMEA 4GN4B 1NE3A 2N78A 2R93G 1XNQQ 1WYDA 3J7ZC 3AFQA 3PV0A 4IJLA 4DR4Q 3ZJYC 3UE0A 3RZOH 1PA6A 2Z6KA 4UP7A 1JJCB 2YTXA 4P71A 1VCIA 4KHPQ 4DNIA 4A3BH 3ERSX 1E7ZA 4JI2Q 1SN8A 4JBJA 1OTCA 2AKWB 2DUDA 2VQEQ 4OO1G 2JEBI 5BR8L 1MJEA 1J6QA 3F2DA 4GS3A 4C3HH 2PQAB 3E0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IL2 A;  4X64 L;  4GOP C;  1QUQ A;  2KCM A;  1VS0 A;  4POG A;  1QZH A;  4YY3 L;  4X64 Q;  1EIY B;  1L0W A;  4JC0 A;  1FJG Q;  4A3D H;  1UE6 A;  4XTC S;  1G29 1;  4OX9 L;  1E1T A;  3AEV A;  4LF4 L;  3CCR A;  4JI8 L;  1AE2 A;  1JT8 A;  1A8V A;  1B70 B;  2MQH A;  4GOP B;  1Z9F A;  4JI3 L;  1HZC A;  4LF6 L;  2Q2T A;  3U58 A;  4R4I A;  1N34 L;  1K0R A;  4IJH A;  4DKA C;  2LXJ A;  1HZA A;  4BY1 H;  4JI2 L;  4DV5 L;  2R7D A;  1N9W A;  3RNU A;  2LSS A;  1K9M C;  1EYG A;  4LF5 Q;  4KHP L;  5GAG C;  2WB1 G;  5C44 H;  1X65 A;  4DV4 Q;  2UXD Q;  3PUZ A;  4BA1 I;  1ASY A;  1LUZ A;  1W3S A;  4C3I H;  4OXP A;  4JI4 L;  4R4C A;  2NVQ H;  2ZTD A;  1XPO A;  1HNZ L;  4DUZ Q;  1VQO A;  3H0G G;  5GAE C;  2HIX A;  1Y1V G;  3U50 C;  4APV A;  2JA5 H;  4BA2 I;  2HHH L;  4JI7 L;  2UXC L;  1LM0 A;  4PMW A;  2R7Z H;  1HNW Q;  3CD6 A;  2ZM6 L;  3HOU G;  4HID A;  3I4O A;  5JEA G;  3DLL A;  1X54 A;  2MFI A;  4QGU A;  2HQL A;  2RHS B;  3S2D H;  4GLA C;  4LUV A;  2ZJR A;  3HOZ G;  2N49 A;  3J80 i;  3KJP A;  3HOX H;  1GVP A;  2R93 H;  3CCV A;  4B3M Q;  3H15 A;  1Q86 C;  2HHH Q;  1A62 A;  3L7Z C;  1PVO A;  3PUV A;  3S1R H;  3EN2 A;  3JAM c;  4LUZ A;  2VZA A;  1JJG A;  3KYH C;  3LGJ A;  3CC7 A;  3SGI A;  3NEM A;  1PH1 A;  1XNQ L;  1C7Y A;  1YHA A;  4PG3 A;  3G4S A;  1VQC A;  2UXB L;  1TWA H;  2D0P A;  4PZ7 A;  4P72 A;  4BY1 G;  5FJ8 G;  4HIO A;  4A75 A;  2YV5 A;  4B3R L;  4JI6 Q;  2K5H A;  3PCO B;  1V1Q A;  2F52 A;  1YIT A;  2ZTC A;  3GTJ H;  1VQN A;  4OWX B;  4HJA A;  1VQ9 A;  1VQF A;  4QL5 A;  4A3J H;  2RF4 A;  2UU9 Q;  2JJQ A;  1TWG H;  4BY7 G;  1FGU A;  4LF9 L;  1CKO A;  1EUJ A;  1N33 Q;  1H95 A;  1SE8 A;  5EAY A;  1WOC A;  5GAD C;  2ZM6 Q;  3PGZ A;  1QVF A;  4BXX G;  4X66 L;  3HOW H;  5IE8 A;  3TS2 A;  4A3D G;  4JV5 Q;  3K8A A;  2YTY A;  1K83 H;  4JV5 L;  2K14 A;  1KD1 C;  2ZJQ A;  4X66 Q;  4HJ5 A;  3PUX A;  3J7A 5;  2Y0S G;  2IT1 A;  3M4Q A;  4AYB G;  1XTD A;  1CKN A;  1EQR A;  1S40 A;  4JI4 Q;  1U0L A;  5GRO A;  1QVG A;  1I94 L;  2ZJP A;  3OYY A;  4TQU S;  2UUB L;  3ULL A;  3S17 H;  2E2H H;  2LXK A;  3KF6 B;  1IZ6 A;  3T1H L;  4R4Q A;  3GD7 A;  1X3G A;  3PIO A;  3PSI A;  2ID0 A;  4DR1 Q;  1J5E L;  5ELN A;  4LF6 Q;  5LMN Q;  1XNR Q;  5C4X H;  1N36 Q;  4LF7 L;  1NY4 A;  3CCQ A;  1VQB A;  2BA0 A;  4YCW A;  2Q2H A;  1Z47 A;  3KF8 B;  4PZ8 A;  1NMG A;  4X62 Q;  4LF7 Q;  3FP9 A;  1YJW A;  1VQJ A;  3T1Y L;  4B3S Q;  4DV0 Q;  3A74 A;  4ALP A;  4EQ5 A;  3H0G H;  1I3Q H;  2FXQ A;  1NBW A;  5IP9 G;  5M5X H;  5IYB H;  2UUA L;  3PF4 A;  3M7N A;  4GNX A;  2JA7 H;  4IFD G;  2ZTE A;  1E1O A;  3E9H A;  1V9P A;  2XTI A;  3CMA A;  3VDY A;  2IY5 B;  5M3M H;  2AHO B;  1I94 Q;  1D8L A;  4YWL A;  2VQE L;  3S1M H;  2K5V A;  1PH4 A;  3CAM A;  2Q2I A;  1HNW L;  4WJ3 M;  2JE6 I;  3KOJ A;  4HIM A;  1SLJ A;  2OQK A;  5ELO A;  2JA9 A;  3BU2 A;  2JEA I;  1W2B A;  4L5Q A;  5C3E G;  1PH7 A;  4DR4 L;  1P8L A;  2PI2 A;  3L0O A;  4A3B G;  2KHJ A;  1N33 L;  2KEN A;  2RHQ B;  3FKI G;  1OXV A;  3WWV A;  4DV7 L;  2UXD L;  1Q12 A;  2ASB A;  2JA8 H;  4A93 H;  2IHF A;  4DV5 Q;  1VQD A;  4IOA A;  1KAW A;  2XGT A;  3CCL A;  2D62 A;  3H3V I;  3HOV H;  5LMN W;  4DV2 L;  3W1B A;  1NJI C;  4NPS A;  4UP9 A;  2A19 A;  3J81 i;  4RMF A;  4DR2 Q;  1Q7Y C;  2UUB Q;  4JI3 Q;  1XPU A;  4Y52 H;  4QIW E;  1UE1 A;  4LF4 Q;  3F8T A;  1Y1V H;  2AWN A;  3M4P A;  1XMO L;  3A0J A;  1HR0 Q;  4L5S A;  4DV1 Q;  1GD7 A;  4DR7 Q;  5GAH C;  3GTO H;  5IYD H;  5FLX c;  1YIJ A;  5M3M G;  4LFB Q;  2EQS A;  4YY3 Q;  1OXS C;  1PYB A;  5C0X G;  2GVA A;  1KHI A;  3UDX A;  1FVI A;  3HOZ H;  4IFD J;  5K36 G;  1D7Q A;  3G48 A;  1A63 A;  2WB1 E;  4WJ4 A;  1SRO A;  4QQB X;  1KXL A;  1VQH A;  2ES2 A;  1HR0 W;  1IBK L;  3S24 A;  1HZB A;  4JG2 A;  1VQ5 A;  3FKI H;  4JBK A;  5IWA Q;  3U4Z A;  3S1Q H;  3KDF A;  4LFA Q;  2N8N A;  4H02 A;  4IPH A;  4OO1 I;  1VQ7 A;  1PHJ A;  1U5K A;  2R92 H;  3A5Z B;  2QA4 A;  4BBS H;  1SMX A;  5M5Y H;  3AQQ A;  4MTN A;  2VS1 A;  4K0K L;  2NVX H;  4JBM A;  1YI2 A;  1CKN B;  2ATW A;  4FDB A;  3J80 c;  1T9H A;  4A3G G;  1X3E A;  1TWC H;  4NXN L;  1K8A C;  4DAM A;  5AJ3 L;  2VQF L;  4L5R C;  2K52 A;  4DR3 Q;  1HZ9 A;  4B3M L;  1Q1B A;  4GKK L;  1MIU A;  1J5E Q;  4A3L G;  4DV3 Q;  1JE5 A;  5JJL A;  4JOI C;  4GKJ Q;  5M5W H;  3PF5 A;  1YJ9 A;  4LFC Q;  4YCV A;  4DK3 C;  3J81 c;  3CP0 A;  4GN5 A;  1SFO H;  2A8V A;  2R6G A;  4GNX C;  4POF A;  4IPC A;  3CCM A;  3BJU A;  3CW2 C;  1VQP A;  1YHB A;  2EIF A;  1IBM Q;  2GN5 A;  1TXY A;  1UE7 A;  2KCT A;  3M4O H;  1I6H H;  3F2C A;  4OWT B;  1PFS A;  1XJV A;  3GTP H;  4DR6 Q;  2WAQ G;  3EIV A;  2PQA A;  1KL9 A;  1X55 A;  4LF8 L;  5C44 G;  3S15 H;  5FJ8 H;  4HJ8 A;  4BBS G;  4X65 Q;  4KLK A;  5H1S E;  4A4I A;  2MO1 A;  4JI0 L;  3EBE A;  4JI5 Q;  2I5H A;  4IPD A;  4A3G H;  1XPR A;  1M1K C;  3I4M G;  3MEF A;  3DM3 A;  2E5L Q;  2QEX A;  4P73 A;  4A3F G;  4B3R Q;  3I2Z A;  3PIP A;  1XMQ Q;  3M3Y H;  2I5L X;  4JYA Q;  1Y1W G;  1VQ8 A;  5JEA J;  4OX9 Q;  4IPG A;  4BXX H;  3GTL H;  2CQO A;  2B3G A;  1PH2 A;  2K5N A;  5C0X I;  3I55 A;  4DPG A;  1P16 A;  4KHZ A;  5IYC G;  3CC4 A;  1VQK A;  1I50 H;  2IX1 A;  2E5L L;  4JCV E;  3I4N G;  1A0I A;  3CCS A;  1BVS A;  1X56 A;  3GTK H;  3NBH B;  4ME3 A;  1RIP A;  3PO3 H;  4OON A;  5LMU L;  2B29 A;  4DAY B;  2BH2 A;  3MXN B;  2OCE A;  5BR8 Q;  3CF5 A;  4LWC A;  2JQO A;  1QVC A;  1Q1E A;  4YWM A;  2KBN A;  4A3M G;  4A3E G;  1PH6 A;  1VQA A;  2HT1 A;  1PYS B;  2Y0S E;  4A3I G;  3KFU A;  2AMC B;  1L1O B;  3STB D;  3G71 A;  4DUZ L;  1VQM A;  3CPF A;  2YU9 H;  1Y1W H;  1L2F A;  2B63 G;  3GTQ H;  4C3J H;  3JC6 6;  1N8R C;  5LMU Q;  4DK6 C;  5JJK A;  3S2H H;  3IRB A;  2OTJ A;  3TRE A;  4UPA A;  4AIM A;  1JMC A;  1YJN A;  4LNQ A;  4HIK A;  4LW1 A;  4BBR G;  2NN6 G;  3KF6 A;  4GKK Q;  5IYD G;  4J15 A;  4AQY L;  4DR5 L;  2NVT H;  1TWH H;  4YHH L;  5M3F H;  3CC2 A;  4A3L H;  4IFD I;  5IT9 c;  5AJ3 Q;  1YVC A;  5C0X J;  2VQF Q;  1X9N A;  3CQZ H;  1K8G A;  1TWF H;  3HKZ E;  4P74 A;  1BBU A;  2CKZ B;  5IP7 G;  4DV6 Q;  1GM5 A;  1YNX A;  2I5M X;  4Y7N H;  1KQS A;  1EFW A;  4JYA L;  3CXC A;  3W5O A;  3A5U A;  1PH8 A;  2UUC L;  3CPW A;  2JA6 G;  1N32 L;  2JA8 G;  4A93 G;  3GDE A;  2D0O A;  3RLO A;  3JAM i;  1E24 A;  1HNX L;  4A76 A;  4YCU A;  1GO3 E;  3ULJ A;  3TQY A;  1QZG A;  3L2P A;  1PV4 A;  2BA1 A;  4A3F H;  4A3I H;  1Y14 B;  2B63 H;  4DUY Q;  5FLM G;  3F2B A;  1IBL L;  2WFW A;  5HY6 A;  5GQO A;  3U4V A;  4B3T L;  2F4V Q;  1OXX K;  1SRU A;  4JI1 Q;  4GOP A;  4QJF A;  1Q8K A;  1YEZ A;  2JA5 G;  1KRT A;  1HJP A;  2K50 A;  4DV1 L;  4DR7 L;  3UDI A;  3HOY H;  2A1A A;  1B7Y B;  3Q8D A;  4YHH Q;  3BZC A;  3PO2 G;  2BH8 A;  3HOX G;  3AYH B;  1R9T H;  2UU9 L;  4PZ6 A;  1G51 A;  2PMZ E;  4KI0 A;  4DUY L;  2JA7 G;  1YZ6 A;  1B8A A;  2MO0 A;  4GN3 B;  2AWO A;  3PUW A;  4DR3 L;  3K7U C;  4OWW B;  3F1Z A;  1YHQ A;  4NXN Q;  3M9B A;  4O2D A;  1MKH A;  1PH9 A;  3RLF A;  3BZK A;  3TEH B;  4GLX A;  4XIG S;  1WJJ A;  2MNA A;  4HJ9 A;  3I4M H;  4X6A H;  4L5T A;  1WCM G;  4B3T Q;  2VUM H;  1YBY A;  2VNU D;  1MJC A;  4LFA L;  1C0A A;  1KIX A;  4UP8 A;  4NXM L;  2NZH A;  4YWK A;  5IP9 H;  1CUK A;  1VQL A;  2N3S A;  3TRZ A;  4A3C G;  3HOW G;  1OXT A;  3W1G A;  2UUA Q;  1BBW A;  3K0X A;  1L1O A;  1WFQ A;  4A3K G;  2I0Q A;  5IYB G;  1VQG A;  1VQE A;  1CSQ A;  2HIV A;  2DGY A;  4UY8 C;  1VQ6 A;  3NEL A;  4DV6 L;  1JJ2 A;  1JB7 A;  4X62 L;  1HNZ Q;  5C3E H;  1VQ4 A;  4K0K Q;  3GTM H;  2RCN A;  4HJ7 A;  3CCU A;  2CWA A;  4DR2 L;  3RN2 A;  4AQY Q;  1RL2 A;  2E2J H;  2K75 A;  4A3E H;  4JBW A;  4GKJ L;  1WI5 A;  3RR5 A;  2F3I A;  1UWV A;  4JI5 L;  1LYL A;  2H5X A;  2C35 B;  2IX0 A;  4NXM Q;  1HNX Q;  1K3R A;  1S72 A;  5DLQ E;  4LF8 Q;  1WCM H;  1FJG L;  4DR6 L;  1BKB A;  1IBM L;  1PH5 A;  2K4K A;  1Q82 C;  4BBR H;  4LFB L;  1EWI A;  3FHW A;  3KDF B;  5JJI A;  3E9I A;  2JK8 A;  1E22 A;  3ICE A;  3GTG H;  4LFC L;  4JOI A;  2CFM A;  3S1N H;  2PI2 E;  3GO5 A;  4DV2 Q;  1S3O A;  2NN6 I;  3G6E A;  1KC8 C;  1UEB A;  1IYJ B;  4TVA B;  1ASZ A;  4JI7 Q;  2JA6 H;  1GKH A;  2E2I H;  3T1Y Q;  2Z6K C;  4R4T A;  4DV0 L;  1VQI A;  4B3S L;  3ER0 A;  4AH6 A;  4A3M H;  4MZ9 A;  1V43 A;  2VL6 A;  1PH3 A;  2Q2U A;  1FL0 A;  4O0A A;  4DV4 L;  3RZD H;  1N36 L;  3B6Y A;  2IHE A;  1X3F A;  5J3B A;  4GLV B;  4R1J A;  1QUQ B;  5LMN L;  1IBL Q;  4LF5 L;  2CWP A;  5C4J H;  1XNR L;  2R92 G;  2WP8 J;  4IO9 A;  2CCZ A;  1K73 C;  3S16 H;  2YTV A;  2R7F A;  4R4O A;  3HOV G;  1LTL A;  3J81 j;  1IBK Q;  3UDF A;  4QY7 A;  3UE1 A;  4AYB E;  4JI8 Q;  3ULP A;  4A3J G;  2R7Z G;  1G6P A;  2OTL A;  2GVB A;  2OQ0 A;  2V1C C;  2YYZ A;  3KJO A;  1SR3 A;  4DV3 L;  3RN5 A;  2UXC Q;  3I56 A;  3UDG A;  3PO2 H;  2WAQ E;  4A3K H;  1Q81 C;  5IP7 H;  3D0F A;  4NB3 A;  1CKM A;  5IY0 A;  1EQQ A;  5HGQ A;  3OW2 A;  4JI1 L;  4LF9 Q;  1E3P A;  4C2M H;  1XMQ L;  3K80 C;  3D31 A;  3HFZ B;  1X6O A;  2NVY H;  3STB C;  4GNX B;  2F4V L;  3PO3 G;  3AFP A;  1DGS A;  4DR1 L;  3OTO Q;  3CCJ A;  3OTO L;  1N34 Q;  4MNO A;  1C9O A;  1M90 C;  2Z0S A;  2VUM G;  1EOV A;  1OXU A;  3H3V H;  3M85 A;  4JI6 L;  1AH9 A;  3HKZ G;  4X65 L;  5FLM H;  1AE3 A;  3RLN A;  2NZO A;  4DV7 Q;  4JI0 Q;  3S14 H;  2UXB Q;  5C4X G;  1NMF A;  1IXR A;  1EIF A;  1UE5 A;  2EXD A;  2L15 A;  3KLW A;  1KRS A;  4P75 A;  3K7A H;  3CCE A;  2UUC Q;  4BY7 H;  1N32 Q;  1L1O C;  1O7I A;  1Q46 A;  3HOU H;  3HKS A;  2ALY B;  1HH2 P;  3PUY A;  3K81 C;  3NEN A;  4EX5 A;  1CSP A;  2OWO A;  5IWA L;  2KHI A;  3T1H Q;  3TS0 A;  4IOC A;  1XMO Q;  1HR0 L;  4A3C H;  3I7F A;  5E7N A;  4RG1 A;  2VW9 A;  1I5F A;  2VY3 A;  4LUO A;  3I4N H;  2E8G A;  4DR5 Q;  3HOY G;  2QGQ A;  1NTG A;  5IYC H;  2PNH A;  5M3F G;  3CME A;  4GN4 B;  1NE3 A;  2N78 A;  2R93 G;  1XNQ Q;  1WYD A;  3J7Z C;  3AFQ A;  3PV0 A;  4IJL A;  4DR4 Q;  3ZJY C;  3UE0 A;  3RZO H;  1PA6 A;  2Z6K A;  4UP7 A;  1JJC B;  2YTX A;  4P71 A;  1VCI A;  4KHP Q;  4DNI A;  4A3B H;  3ERS X;  1E7Z A;  4JI2 Q;  1SN8 A;  4JBJ A;  1OTC A;  2AKW B;  2DUD A;  2VQE Q;  4OO1 G;  2JEB I;  5BR8 L;  1MJE A;  1J6Q A;  3F2D A;  4GS3 A;  4C3H H;  2PQA B;  3E0E A; 
#chains in the Genus database with same CATH topology
 4X64 L;  1TKW B;  3TP8 A;  1TY0 A;  3U9O A;  5KFV A;  1L0W A;  2M05 A;  3W2D A;  1Q3L A;  1UE6 A;  1G29 1;  4KKU A;  5KFG A;  2LFN A;  4J8Q A;  1H9M A;  1PTO F;  3T13 A;  4LF4 L;  3CCR A;  1O7Y A;  1B70 B;  2N88 A;  2L1B A;  1TWF A;  3MFI A;  3U58 A;  3D6C A;  4DKA C;  4NLG A;  4H7B A;  1CQI B;  4DV5 L;  4LF5 Q;  2LSS A;  1K9M C;  1JWM D;  2A68 C;  2WB1 G;  2A74 C;  5GAG C;  2YZN A;  4ECY A;  2UXD Q;  2B2V A;  1ASY A;  1SE2 A;  5C8Y F;  1PZI D;  4OXP A;  2FMM A;  4HCS A;  1JDB B;  1DV1 A;  3VYR A;  2HIX A;  3U50 C;  4O4I F;  3QO2 A;  4CHT B;  4BA2 I;  2ZXO A;  1WTX A;  4JI7 L;  1PRT D;  1LM0 A;  2EOT A;  4PMW A;  3Q0A A;  1HNW Q;  4MA0 A;  3CQZ A;  5JVD F;  4CC6 A;  1TY2 A;  2F0Q A;  2WAC A;  1S5B D;  5KND A;  4RKB A;  2JEI A;  5FD5 A;  4RAU C;  4GLA C;  1EQT A;  3MR2 A;  4PV1 C;  3J7A F;  1BJT A;  5M3F B;  3TZU A;  4DR1 H;  1Q86 C;  1A62 A;  5K5P A;  3PUV A;  3OOC A;  2RKS A;  3EN2 A;  2IBK A;  3LGJ A;  3SGI A;  5DGB A;  2QIL A;  4P72 A;  2PVP A;  3K0Y A;  2YV5 A;  2K5H A;  2ZTC A;  5LP6 F;  2B2U C;  4OWX B;  2X6L A;  3HXL A;  5KFW A;  1TWG H;  4LF9 L;  1EUJ A;  2QF7 A;  2FHT A;  4KTA A;  2F0H A;  3HOX B;  1VAJ A;  1ILQ A;  4ZHQ F;  3J81 L;  3V4S A;  5KFH A;  2UU9 H;  4A3D G;  4JV5 Q;  1SCU B;  1KD1 C;  4C2M B;  1J5E H;  2ZJQ A;  3PUX A;  2WAQ B;  1CKN A;  2R92 B;  5C4Z A;  4TQU S;  3I4L A;  2E2H H;  1IZ6 A;  4CJ0 B;  1X3G A;  1CHP D;  5JJZ A;  2CH4 W;  4F88 A;  4K2L A;  5LHY 1;  5J1Z A;  4B9X A;  2ENB A;  5DNF A;  3T5H A;  5EGT A;  4CDD C;  1VF5 C;  3T5J A;  4LF7 L;  1F2M A;  1NY4 A;  4EG0 A;  5HV6 A;  2AQ1 B;  4JV1 A;  5KT3 A;  2Q2H A;  1WVL A;  4FO2 A;  4UCR A;  1YJW A;  3NBH A;  2W7O A;  4ALP A;  2I80 A;  3H0G H;  1UC8 A;  1NBW A;  1BOS A;  5IP9 G;  5M5X H;  5IYB H;  1JOR A;  1GUO A;  4RUA A;  4GNX A;  4MV8 A;  4IFD G;  4HQ6 A;  5LXT F;  4ILW A;  1PH4 A;  4WJ3 M;  4EYH B;  5EJW A;  1W2B A;  4E4T A;  5C3E G;  3SE7 A;  1N33 L;  2RHQ B;  3CRK C;  1OXV A;  3WWV A;  2YCH A;  1KBL A;  3BAA A;  1DV2 A;  5C4H A;  1VQD A;  3CCL A;  4DNT B;  2W9C B;  5LMN W;  3GV8 B;  4N9P A;  1TWA B;  1VF7 A;  4NPS A;  2E75 C;  4RMF A;  4DR2 Q;  1Q7Y C;  2FK3 A;  1Z2O X;  4LF4 Q;  4L5S A;  1Y1V H;  4NXM H;  1GD7 A;  5IYD H;  2K1B A;  3A8J E;  2W6M A;  5C3W A;  1MGS A;  4JUZ A;  1KHI A;  1FVI A;  5K36 G;  2JYO A;  5E4W C;  1G6Z A;  4ED2 A;  2WB1 E;  2VQD A;  2ZDQ A;  1I4G A;  2RSO A;  4QQB X;  3GTO A;  4DR4 H;  3N43 B;  1QNU A;  2J6T A;  2WB1 A;  3GTJ B;  1HRJ A;  1W6J A;  3NTI A;  5J22 A;  2OLS A;  1ROD A;  5I9P A;  4H02 A;  4OO1 I;  4C2M A;  3RFC A;  2CQY A;  1B3A A;  1SYF A;  1K1Q A;  4WBN F;  3A5Z B;  2AGP A;  4C3I G;  1EY0 A;  2NVX H;  2ATW A;  3J80 W;  4FDB A;  5E3F A;  5KRU A;  4DAM A;  5AJ3 L;  1Y69 U;  1ET6 A;  4DR3 Q;  1Q1B A;  2R92 A;  4EBC A;  4EQP A;  4GKK L;  1J5E Q;  1B53 A;  1NNX A;  4BWS C;  4JOI C;  2W9A A;  1XTC D;  1SNQ A;  2R61 A;  1PZK D;  4EGV A;  3J81 c;  5IT9 W;  2R6G A;  3OSO A;  4POF A;  4FF4 A;  2EZV A;  3SK5 A;  3CW2 C;  3CCM A;  4C5A A;  2F0D A;  2EIF A;  3RZO B;  4O3S A;  2GN5 A;  2KCT A;  1PFS A;  2B2U A;  1XJV A;  1QB5 D;  5KT2 A;  4LF8 L;  4YQW A;  5FJ8 H;  5A2Q W;  2R93 B;  2FPI B;  4IQZ A;  5H1S E;  4CDF C;  2MCT A;  2I5H A;  4UDU C;  1M1K C;  3I4M G;  2AGO A;  3GTP A;  3GV7 B;  4V19 0;  4RB3 C;  2QEX A;  1JOQ A;  4P73 A;  1S5D D;  1I6U A;  3PIP A;  3M3Y H;  4N8X 1;  2R84 A;  5IGC A;  5H80 A;  4DK0 A;  2K33 A;  4IPG A;  3GTL H;  1SYX B;  4C5C A;  1C8C A;  5C0X I;  2YS7 A;  2NZ1 D;  4I55 F;  4KHZ A;  2F03 A;  4WJW A;  1H9S A;  3BG3 A;  3LML A;  2HJW A;  2KVM A;  1I50 H;  3EFX D;  5BN5 A;  3VMM A;  4ZUJ A;  2DPJ A;  4RZQ A;  4ME3 A;  2RGR A;  4DAY B;  1ESF A;  2OCE A;  5DG9 A;  3FDT A;  2UXD H;  1Y8O B;  1Q1E A;  2KJX A;  4JK1 C;  1U9R A;  1PYS B;  2I87 A;  2AMC B;  1B04 A;  2BDN A;  1O78 A;  1Y1W H;  1BUV T;  1ML0 D;  1N8R C;  2F1M A;  2OTJ A;  5C6A A;  3TQT A;  2F0F A;  1EFI D;  4UPA A;  1YJN A;  1IYU A;  4LNQ A;  4HIK A;  4BBR G;  2B2T A;  1STN A;  4YHH L;  3T5L A;  2UVV A;  3N44 B;  2ASD A;  5C0X H;  5C0X J;  1TS5 A;  1EYD A;  1TWF H;  1BBU A;  1CA5 A;  2K04 A;  1EY5 A;  1D1K A;  1J8I A;  2KQ3 A;  3CXC A;  3A5U A;  1N32 L;  4TV8 F;  3KBG A;  2DN8 A;  3RLO A;  1STB A;  4O3Q A;  2IP4 A;  4A76 A;  5L1J A;  4K0K H;  3ULJ A;  2HVS A;  2E2I B;  1PV4 A;  4OX9 H;  4O3N A;  2BA1 A;  2UVU A;  2NTS A;  2QDB A;  1D5Z C;  2FPG B;  1PTO D;  5CBE E;  1DZ1 A;  3F2B A;  2XCL A;  1TWH B;  2TMP A;  5HY6 A;  4B3T L;  2F4V Q;  5COY A;  3MR3 A;  1PRT B;  5I6Y A;  2EJG C;  3RF2 A;  1OXX K;  1SRU A;  3BQ2 A;  4QJF A;  3T4A C;  4JVZ A;  4DR5 H;  2JA5 G;  4DV1 L;  4IWX A;  1E4F T;  3PO2 G;  3S17 B;  1TT2 A;  2KOL A;  3MFY A;  2PMZ E;  4CKE A;  4DUY L;  2R8K A;  4GN3 B;  1GUN A;  2F0U A;  2K32 A;  4DR3 L;  2V59 A;  3EPG A;  4C56 C;  1C48 A;  3H20 A;  4LK1 C;  3RLF A;  1KJ8 A;  1STE A;  4GLX A;  1FR3 A;  2L55 A;  4XIG S;  5JOB A;  1F9Q A;  3P1H A;  3I4M H;  3V2T A;  4H0L C;  2VNU D;  4RCO A;  4ID6 A;  4LF9 H;  2CQA A;  1U4R A;  4DLK A;  5KFS A;  4DAP A;  3C3L A;  4YWK A;  1LTG D;  2NN6 H;  1VQL A;  1CUK A;  4A3D B;  2N3S A;  1JXL A;  3OWE B;  1FYC A;  2VUM A;  4A3C G;  3W1G A;  4ECZ A;  3K0X A;  1L1O A;  1NAP A;  1I4P A;  2I0Q A;  3I90 A;  1O75 A;  4WOR A;  1HTP A;  4ECV A;  2HIV A;  3WNZ A;  1PMR A;  5ELE A;  3AMU A;  3Q23 A;  5IOC A;  4DV6 L;  1JB7 A;  2W6Z A;  3GTM H;  2V58 A;  5J2U F;  5DM6 3;  2RCN A;  1KJ9 A;  4ED1 A;  3MVV A;  4HJ7 A;  2CWA A;  1IOW A;  4AQY Q;  1RL2 A;  2JA8 B;  4A93 B;  2PYK A;  5DG8 A;  3H09 A;  3R93 A;  3VA7 A;  3N41 B;  3ETH A;  2W70 A;  3RR5 A;  2F3I A;  4ED0 A;  2VUG A;  2W8K A;  4JV2 A;  1HNX Q;  4LF8 Q;  2CW7 A;  1BCP C;  4LF5 H;  3N42 B;  1EL0 A;  4X3U A;  3G6V A;  3RBD A;  4LMY A;  1PH5 A;  4DL7 A;  2V9W A;  4X3T A;  1U4M A;  1Q82 C;  4YR0 A;  4DL5 A;  4LMQ D;  5JJI A;  1I50 B;  2JA5 B;  1AZQ A;  4PDB A;  5I6W A;  4LFC L;  3MXU A;  4FF3 A;  3A8K E;  3G6E A;  1KC8 C;  5KG1 A;  1SJH D;  3PN1 A;  4WRD A;  2G9H D;  2Z6K C;  3VPC A;  1OO9 B;  2F0G A;  2L9H A;  2EY1 A;  2K01 A;  1V43 A;  5FK9 C;  3HGB A;  3T16 A;  4DNR B;  1PH3 A;  2A69 D;  2WKC A;  2O03 A;  3LX0 A;  2EY5 A;  1IW7 D;  1TWC B;  3AB9 A;  4FNF A;  1ONL A;  1IBL Q;  3EPI A;  2CWP A;  4DV0 H;  1SSO A;  2F3W A;  1QJO A;  5D3I B;  4LF7 H;  1RK5 A;  3UE1 A;  3ULP A;  4JI8 Q;  4A3J G;  2R7Z G;  2GVB A;  2V1C C;  1SR3 A;  3DWQ A;  3OIQ A;  3RN5 A;  4MTE A;  2UXC Q;  3PO2 H;  3N6R A;  5HUR A;  4FVM A;  4NB3 A;  1FNW A;  2ZXP A;  1JIC A;  3GTP B;  5JPN C;  5KFB A;  2WIN B;  1EWC A;  1PTO H;  3HFZ B;  4GNX B;  2F4V L;  2NVT B;  3L4K A;  1X3P A;  5TSS A;  3MXP A;  3OTO L;  4MNO A;  5D65 A;  1M90 C;  4JW0 A;  1OXU A;  3H3V H;  1AH9 A;  3HKZ G;  1AE3 A;  2UXB Q;  3MA2 B;  4DV7 Q;  2SOB A;  5JH7 F;  1N33 H;  3OMC A;  3KLW A;  2C22 A;  1I3Q B;  4K5W A;  4Q44 A;  4P75 A;  3L3O C;  3K7A H;  1N32 Q;  5EDW A;  1CE8 A;  4DV3 H;  3HKS A;  2W6P A;  3MJF A;  2RDF A;  1H9R A;  4DR3 H;  4RCN A;  2KSW A;  1XMO Q;  5E7N A;  2E2D C;  2VW9 A;  4LUO A;  2VY3 A;  5J39 A;  1JE4 A;  4DK1 A;  3HOY G;  1NTG A;  1HXY D;  1JB3 A;  1VMC A;  5JQW A;  4LH6 A;  1BNC A;  4C3H B;  4Y8V B;  4J9P A;  1PZJ D;  3OWF A;  2C28 A;  1X3Q A;  2R93 G;  1WYD A;  2EYM A;  3J7Z C;  4O3P A;  5KFT A;  1JJC B;  4P71 A;  2PO4 A;  3V6K A;  1E7Z A;  4M9U A;  2HUG A;  4JI2 Q;  1RTN A;  2FK2 A;  1SN8 A;  4YJ3 F;  4JBJ A;  3RB6 A;  1ILP A;  2VQE Q;  1M8A A;  4XQN A;  1SE3 A;  4S3S A;  4GS3 A;  2Z6B A;  4GN5 A;  1IL2 A;  5BN3 A;  2OEO A;  4FXK C;  2KCM A;  2C00 A;  1VS0 A;  3CKI B;  4F4Y A;  4MTK A;  4XQJ A;  1YNN D;  1EIY B;  2R82 A;  5KFC A;  4XTC S;  2J0T D;  3RJ0 A;  3AEV A;  3A54 A;  3FDS A;  1HZC A;  4LF6 L;  1RTO A;  1Y8N B;  4F50 A;  5LOV F;  4IJH A;  1EZ6 A;  2LXJ A;  1HZA A;  4BY1 H;  3S2D B;  5KFP A;  4JI2 L;  4RH6 A;  5ELD A;  2W6O A;  5BR8 H;  4FXD A;  1LUZ A;  1W3S A;  4C3I H;  1EEF D;  3NBI A;  1II3 A;  2NVQ H;  2ZTD A;  4YIJ A;  1XPO A;  4DUZ Q;  1HA5 A;  3NUC A;  4XT3 B;  2JA5 H;  1Y1V G;  4EEQ A;  5DM7 3;  1SNM A;  3VR4 A;  1KEE A;  3CD6 A;  3HOU G;  3RUZ A;  1DYQ A;  1HNZ H;  4C1N I;  1SNC A;  4KV6 A;  3Q22 A;  4XQQ A;  1KDA A;  4RB2 C;  3S2D H;  2ZJR A;  1STG A;  1PFB A;  3J80 i;  4IUN A;  1RYS A;  2R93 H;  3KUP A;  4B3R H;  2FK1 A;  4YAK B;  3HG9 A;  4ED6 A;  3S14 B;  1R9T A;  3Q6S A;  4IZ8 A;  3GTG B;  3S1R H;  3LWU A;  3DWP A;  1GSH A;  3JAM c;  5IGF A;  3R5F A;  4CGY B;  1S5E D;  3NPP A;  2F0N A;  3HKZ A;  2VA2 A;  2MHV A;  4BY1 G;  1D5X C;  3GTO B;  1AW7 A;  4MTD A;  1G91 A;  2F52 A;  1GUS A;  1VQN A;  3IN5 A;  3DEP A;  2UU9 Q;  3Q8P B;  1M6V A;  2JJQ A;  3RZD B;  3QZ7 A;  3AU7 A;  3FPU B;  1N33 Q;  4K5X A;  4QWE A;  2YYA A;  1SE8 A;  1TR5 A;  5EAY A;  5GAD C;  2ZM6 Q;  5K36 H;  3DMU A;  1MI2 A;  4JV5 L;  3TS2 A;  2K14 A;  1SYB A;  4KJN A;  1HPC A;  3M4Q A;  4AYB G;  4JI4 Q;  1C3O A;  2W57 A;  4YHH H;  5KFX A;  4Q8E A;  4E6I A;  1UEA B;  2UUB L;  1S4Z A;  4EYI B;  3KF6 B;  3TZD A;  4ED7 A;  3T1H L;  3KAK A;  4R4Q A;  3GD7 A;  4LSX A;  2EY6 A;  1F9P A;  1GJX A;  1B1Z A;  2MUY A;  5C4X H;  2J4X A;  5IGB A;  1N36 Q;  4A2A A;  1G2S A;  1S03 G;  4Q8F A;  2I07 B;  4YCW A;  3K5I A;  1FKA H;  1DIK A;  1VQJ A;  3H94 A;  4RGN A;  1F2Y A;  4DV0 Q;  4RU9 A;  3RGX A;  3BAB A;  3IFD A;  1EU4 A;  1I3Q H;  2DLN A;  1DOM A;  1TQO A;  3PF4 A;  3DXJ C;  3V96 A;  2JA7 H;  4FS2 A;  1V9P A;  4TUY F;  2FLL A;  5M3M H;  1I94 Q;  5CV9 A;  4EVO A;  4IUU A;  2VQE L;  1T94 A;  3J81 W;  2K5V A;  2Q2I A;  4I7Z C;  3KOJ A;  2E74 C;  1L0Y B;  2OQK A;  3OPO A;  1GHK A;  2KEE A;  3KLS A;  1ZKO A;  2JEA I;  1K3B C;  4ZKC B;  4EGJ A;  1P8L A;  2OT2 A;  5LMU H;  2KHJ A;  1VDZ A;  3FKI G;  4DV7 L;  3RUP A;  2ASB A;  2ZDH A;  2FMA A;  4MV1 A;  2IHF A;  2MGS A;  3H0G B;  4DV5 Q;  4IOA A;  1KAW A;  2XGT A;  3H3V I;  5G3L F;  2AQ3 B;  2KUM A;  3V4Z A;  1XMO L;  1LT4 D;  3BVG A;  2EJM A;  1SEI A;  4DR7 Q;  4K5V A;  5FLX W;  2UVW A;  1KJI A;  2EQS A;  1CZW A;  2NU9 B;  1K1S A;  3G48 A;  3DEO A;  3L4J A;  5KEE A;  1SRO A;  1QG7 A;  5BPF A;  4KY6 A;  4HCE A;  1AFP A;  2XVS A;  2ES2 A;  1HR0 W;  5C1O A;  1HZB A;  4JG2 A;  2NVX A;  4I7H A;  4JYA H;  3U4Z A;  3KDF A;  4LFA Q;  4L63 B;  2IWH A;  4CJ1 B;  1VQ7 A;  2R8H A;  1U5K A;  2M9V A;  1SEB D;  2R92 H;  4X3S A;  4R9W A;  1HFG A;  5KFR A;  4B9W A;  1SMX A;  4IRD A;  4ETS A;  2A68 D;  1EYA A;  4A3G G;  1X3E A;  4NXN L;  1PX2 A;  1JX4 A;  2K52 A;  4Q5V A;  1JDE A;  4B3M L;  4A3L G;  1I4Q A;  2F3V A;  1AN8 A;  3PF5 A;  1TWF B;  3T53 B;  1YJ9 A;  1TWC A;  2YRX A;  4YCV A;  2B2Y C;  1AP0 A;  2L4N A;  2A8V A;  1RF2 D;  1CT1 D;  3WOF A;  3T51 B;  3TII A;  2RQX A;  3JSL A;  1UUP A;  3M4O H;  1I6H H;  3F2C A;  2VA3 A;  4DR6 Q;  1T3N A;  3E6Z X;  2PQA A;  3K57 A;  4OEM B;  3FEW X;  1KAA A;  5DEH A;  3KBX A;  1IHZ A;  4OHJ A;  1CA6 A;  4ZI7 F;  2DWC A;  4IPD A;  3J7A K;  1AEX A;  1U4L A;  4A3G H;  4HNT A;  4FBU A;  1XXG A;  1B6R A;  3C0F B;  4IWY A;  2A6E D;  2QDL A;  4QCL A;  1TVX A;  1VQ8 A;  1D2B A;  4ECQ A;  4BXX H;  1SYG A;  1IBK H;  4H44 C;  4I7A A;  4HSV A;  2K5N A;  1H9K A;  4DPG A;  1P16 A;  3EVQ A;  4FYD A;  2VOB A;  2E2H B;  3OHA A;  5GON F;  3HP3 A;  2G9D A;  4JCV E;  4ZRZ A;  3I4N G;  1A0I A;  3GTL A;  1X56 A;  4DUZ H;  4K8I A;  2B29 A;  4DV1 H;  4HMI A;  5BR8 Q;  3I4M B;  3A55 A;  3CQZ B;  4EFB A;  2P0A A;  1B33 N;  2FLP A;  4JI7 H;  5KT6 A;  3D3R A;  4J9S A;  3KFU A;  2JEF A;  2NUC A;  4V0B A;  1L1O B;  4NDX A;  2YU9 H;  3BG5 A;  5CA1 F;  2HDM A;  2P5Z X;  2EE1 A;  3FKI B;  1G8Z D;  4O3O A;  4C3J H;  2J7Z A;  1JKJ B;  5KX5 F;  3NGD A;  3V6J A;  4DU9 A;  1S9F A;  4LW1 A;  1LTT D;  4GKK Q;  3BA8 A;  5IYD G;  4AQY L;  2NVT H;  3CC2 A;  5M3F H;  5DLG A;  3J81 E;  2VQF Q;  1CQF A;  1X9N A;  1IKM A;  1S0N A;  2R7Z A;  3CQZ H;  1YNN C;  5M5W B;  1K8G A;  4DV6 Q;  5IP7 G;  1TS2 A;  3ERQ A;  3P20 A;  2AUK A;  1QWY A;  1KTK A;  3W5O A;  4JI2 H;  1ZYR C;  1MSG A;  1PH8 A;  1GUW A;  4KD3 A;  3RD4 A;  4CDC C;  4B3S H;  4TSS A;  1CTM A;  3GQC A;  4YCU A;  4TQS A;  4P2C B;  4TQR A;  5KGU A;  4TKO B;  3DM1 A;  1IOV A;  4A3I H;  4AYB A;  2RDG A;  4CKB A;  3Q24 A;  1I4X A;  4BBR B;  4DUY Q;  1EY7 A;  2WFW A;  1SNP A;  4GZY C;  4C3H G;  4KKS A;  4HYK A;  3GTJ A;  4RB1 A;  3IKJ A;  3GIP A;  3UDI A;  3VR6 A;  2A1A A;  3GQB A;  2R93 A;  1BCP B;  4JI4 H;  1F2L A;  2F0K A;  3BZC A;  4ECR A;  3HOX G;  1R9T H;  2AQ2 B;  3RIZ A;  1G51 A;  2PBZ A;  1YZ6 A;  2MO0 A;  1N32 H;  3PUW A;  3QZ8 A;  5ELC A;  4XDX A;  2ZM6 H;  3RBE A;  3F1Z A;  1YHQ A;  1LTA D;  3X3N A;  4NXN Q;  3WO0 A;  4F8M A;  3S16 B;  4EEY A;  2ATL A;  3HOZ B;  4XXE A;  3NQT A;  4LFC H;  3TEH B;  2C9O A;  5CGK A;  3M7G A;  3PIO 3;  4N8F A;  1WCM G;  2VUM H;  4LFA L;  1Z7T A;  1GLV A;  2FP4 B;  1GUT A;  4KKT A;  2EYO A;  1C0A A;  2L11 A;  1BF4 A;  3A8I E;  4DAY A;  3VPB A;  2XN9 C;  5CR3 A;  2NUA B;  1OXT A;  5M5Y B;  2AU0 A;  3S2H B;  3I91 A;  1VQE A;  4DUY H;  3NSW A;  4KD4 A;  3C46 A;  4BY7 B;  2DGY A;  4UY8 C;  1TU2 B;  1VQ6 A;  3GTQ B;  3NEL A;  1B6S A;  5FD6 A;  3SK6 A;  2KCC A;  4X62 L;  3KHL A;  2ALZ A;  5BN4 A;  5EBC A;  4APM A;  1K8M A;  4IR9 A;  3GV6 A;  2E2J H;  1VBH A;  2F0V A;  5KFZ A;  1B44 D;  3OHX C;  4JBW A;  4KY7 A;  4DGZ A;  3PIP 3;  1SFO B;  3HOU B;  3NHH A;  4DL3 A;  3M9N B;  3PZP A;  3MFG A;  2IX0 A;  2RSN A;  2F0P A;  3A56 A;  2VQF H;  1ZYR D;  5DLQ E;  3Q2O A;  4DV4 H;  5FO7 B;  4JI3 H;  1FJG L;  2HD3 A;  2BQU A;  4DR6 L;  1BKB A;  5LA6 F;  1IBM L;  1EY9 A;  4LFB L;  4CKC A;  2PW7 A;  2XRQ D;  3KDF B;  3BYT B;  2F0W A;  3D4W A;  2FJZ A;  4ECS A;  1NR4 A;  5FLX L;  1E22 A;  3OIP A;  5EKL A;  5KT7 A;  3KAL A;  5EKK A;  3GTG H;  3SI8 A;  4X64 H;  2DY8 A;  1ICW A;  1UEB A;  1IYJ B;  2WV6 D;  4I65 A;  3F8N A;  4O3R A;  3N8D A;  3ER0 A;  2JSO A;  1HNX H;  2EYJ A;  4A3M H;  4FF2 A;  1WH2 A;  5CB4 F;  4EBE A;  2XD4 A;  3JAM W;  2IL8 A;  1AUV A;  1B2T A;  1TWG B;  4MHE A;  1N36 L;  4LF5 L;  1QUQ B;  1XNR L;  2GLT A;  4UCV A;  1TAE A;  4AQY H;  2R92 G;  2WP8 J;  2CCZ A;  1S0O A;  1BCP F;  1A3T A;  1K73 C;  2R7F A;  4R4O A;  4Q43 A;  1IBK Q;  1BR9 A;  1G6P A;  2OTL A;  2YYZ A;  2OQ0 A;  1A15 A;  2EXZ A;  3MTS A;  3VR5 A;  2VPQ A;  3C2P A;  3R5X A;  3VR2 A;  3I56 A;  4DL4 A;  2WAQ E;  4IUQ A;  2E5L H;  1Q81 C;  1V4Y A;  2R87 A;  3D0F A;  1JOK A;  1CKM A;  5IY0 A;  4WD3 A;  1WTV A;  3TDQ A;  1L2Z A;  1KAB A;  3OW2 A;  3FKI A;  4J0M A;  4KMU C;  3R2I A;  3TSS A;  5C44 B;  1XMQ L;  3K3V A;  3H6M A;  4FF1 A;  3P7J A;  3QOL A;  4DR1 L;  1E2Z A;  1O7L A;  3OTO Q;  4O42 A;  3E5N A;  2IX3 A;  3PW0 A;  2VUM G;  2Z0S A;  1EOV A;  3M85 A;  4JI6 L;  5KFE A;  1QIL A;  4IUT A;  1FD7 D;  3JRX A;  2A5H A;  2XWJ B;  1M4V A;  2D2C C;  2Z4I A;  3K3P A;  4DV7 H;  1NMF A;  4FXG C;  4RWS C;  1BBX C;  1UE5 A;  2EXD A;  2L15 A;  3Q8S B;  3CCE A;  3QFF A;  2R6F A;  1L1O C;  1HUN A;  2ALY B;  3PUY A;  4EX5 A;  3NEN A;  2FJ2 A;  3NWS A;  4IOC A;  1K28 A;  5JVG 3;  2XGP A;  4RG1 A;  2D5D A;  4J9M A;  1I5F A;  3TIN A;  4DR5 Q;  2C2E A;  1STH A;  2PNH A;  5M3F G;  4ECT A;  2F4V H;  2C2R A;  4QUC A;  2CW8 A;  2YL2 A;  3CME A;  4FU0 A;  4QMG A;  4GN4 B;  2R8J A;  1NE3 A;  2SEB D;  5BPH A;  1XNQ Q;  2HVQ A;  4MV7 A;  4JI8 H;  4FS1 A;  1ZXT A;  3AFQ A;  1IW7 C;  2YTX A;  1VCI A;  4XYO A;  1HNW H;  4A3B H;  3ERS X;  3C1F A;  2RVL A;  2NYZ D;  5A2Q E;  1OTC A;  2ZXR A;  2AKW B;  3GP7 A;  4IAJ A;  3JAM E;  2JEB I;  2V4D A;  3I12 A;  4ME6 A;  4J9O A;  1LLR D;  1HA6 A;  4RFB A;  3ND9 A;  1SMY C;  4C3H H;  4MV3 A;  5D3D A;  5CMD A;  4POG A;  4PWQ A;  2J6S A;  1EIH A;  2EPB A;  1F77 A;  1I4H A;  4JC0 A;  5T1G A;  3Q8R B;  4OX9 L;  4EQN A;  1JT8 A;  1XDN A;  1AE2 A;  1A8V A;  3MEH A;  2AGQ A;  1Z9F A;  4JI3 L;  2GPW A;  2Q2T A;  1N34 L;  2MJ8 A;  2BR0 A;  2PN1 A;  5CV7 A;  2V4R A;  3T5K A;  3PUZ A;  1V1O A;  1FGB D;  4R8N A;  3K59 A;  3PO2 B;  4R4C A;  4XYL B;  1VKZ A;  5D8D A;  1VQO A;  4UAI A;  2O5J C;  1B4O A;  5CAE B;  2BOS A;  1WTQ A;  3G6Y A;  2R7Z H;  4C3J G;  1Y1W B;  1UNN C;  4HID A;  3I4O A;  5CA0 F;  1RK6 A;  5IOD A;  3DLL A;  1X54 A;  2MFI A;  4QGU A;  3PW4 A;  2HDL A;  2HQL A;  1HQR D;  2RHS B;  1N36 H;  1CK1 A;  2N49 A;  4LSA A;  4LF6 H;  4B3M Q;  5J2T F;  3RAX A;  3H15 A;  5EQ0 A;  1SJE D;  2HHH Q;  3L7Z C;  1PVO A;  3ORR A;  2NVQ B;  4LUZ A;  1JJG A;  4X65 H;  3KYH C;  1JWS D;  3NEM A;  4PG3 A;  2UXB L;  1BXT A;  3WO1 A;  1TWA H;  2D0P A;  3D6W A;  5JPM C;  1BGW A;  3VYS A;  4A75 A;  4JI6 Q;  3PCO B;  1YIT A;  2JP1 A;  2L0C A;  1Y1V B;  3GTJ H;  1KNE A;  1VQ9 A;  1VQF A;  4QL5 A;  1SNO A;  2RF4 A;  5KFD A;  3URY A;  3MXG A;  2RDJ A;  3H4B A;  4JI0 H;  5E4X A;  2IPK D;  3G6X A;  3SR1 A;  2OF1 A;  3K8A A;  2YTY A;  2O5I C;  4HJ5 A;  3J7A 5;  2IT1 A;  3FPP A;  3SVM A;  1XTD A;  1S40 A;  1I94 L;  1PTO C;  3EQL C;  3OYY A;  4BS9 A;  5JVH 3;  2R8I A;  1XX8 A;  1BDO A;  1V51 A;  3U9T A;  3GTM A;  1J5E L;  3PIO A;  3PSI A;  2ID0 A;  1MZB A;  5IT9 E;  4RZR A;  3H3V C;  1XNR Q;  4U68 A;  1DON A;  2M2L A;  3SHL A;  2BA0 A;  2DNC A;  2X6G A;  2A73 B;  3KF8 B;  4X62 Q;  2K28 A;  1LAB A;  1WSC A;  4TV9 F;  3FP9 A;  3BQ1 A;  4IUR A;  3IG0 A;  3T1Y L;  3BVZ A;  1TA8 A;  1CZG A;  3A74 A;  3SE0 A;  4EQ5 A;  2W9B A;  4O1N A;  4NW2 A;  2ICI A;  2UUA L;  3M7N A;  2CH4 A;  3PMF A;  3E0J A;  3MFH A;  1SND A;  3E9H A;  2XTI A;  2AHO B;  5DQH A;  2FLN A;  1D8L A;  4YWL A;  3KLS X;  1I6H B;  2ZJT A;  1BXR A;  1LV9 A;  3CAM A;  3OSP A;  1HNW L;  2JE6 I;  2W9C A;  1SLJ A;  1G2T A;  4J9N A;  2JA9 A;  4RNM A;  3BU2 A;  4L5Q A;  1A3V A;  3SXH A;  3BYY B;  1ZQ7 A;  2PI2 A;  2EDG A;  4GC6 A;  4F4Z A;  5C4J B;  3MZ5 A;  4A3B G;  5EOY A;  2KEN A;  2B63 B;  3PQI A;  2UXD L;  1SAP A;  3GTL B;  3M3Y B;  4QIW A;  2D62 A;  3HOV H;  1K8O A;  3VYT A;  3ORQ A;  3W3A A;  5IGE A;  3W1B A;  1PDQ A;  4UP9 A;  1NJI C;  4A3B B;  2A19 A;  4JI3 Q;  2EYP A;  2K5D A;  5JVL A;  2UUB Q;  4A3F B;  5CC4 A;  2AWN A;  2E76 C;  3UQ8 A;  3A0J A;  4RGT A;  5IGD A;  3V05 A;  1JLL B;  2XC9 A;  5FLX c;  5M3M G;  2VQE H;  1E2W A;  1OXS C;  3GIL A;  3K6O A;  2GVA A;  3UDX A;  3HOZ H;  5KFN A;  1D7Q A;  1A63 A;  3SK8 A;  5KKN B;  3IAY A;  4L6T B;  2VB2 X;  3SDZ A;  2DJG C;  1IBK L;  2HQE A;  3GV5 B;  3MAQ A;  4JBK A;  5IWA Q;  4XX0 B;  2W8L A;  2N8N A;  1XNR H;  1ESR A;  4XYQ A;  1XYI A;  1PHJ A;  3K5O A;  1JIH A;  3V6H A;  2BDO A;  4BBS H;  3AQQ A;  4MTN A;  2VS1 A;  1LT5 D;  3BVM A;  4JBM A;  4K0K L;  1WR2 A;  1CKN B;  3ONA B;  3J80 c;  1TWC H;  2VQF L;  5JUM A;  1MIU A;  4B3T H;  1HCZ A;  4DV3 Q;  1JE5 A;  4HNU A;  1IBM H;  2NTT A;  2Z9H A;  4LFC Q;  1QNK A;  1A6X A;  5T14 A;  5DQG A;  2JEG A;  1SFO H;  3IFT A;  2UXB H;  2CVR A;  4GNX C;  3KF8 A;  1HQM C;  3BJU A;  2EYH A;  1YHB A;  1IBM Q;  4M7E A;  1EYZ A;  1TXY A;  4ZAI A;  2JA7 B;  4O4H F;  2EYF A;  4OWT B;  5C3E B;  2WAQ G;  4R8U A;  2ICE C;  2Z4H A;  2YW2 A;  1X55 A;  1ZHS A;  5C44 G;  3S15 H;  4QF4 A;  4HJ8 A;  4PQX A;  1IL8 A;  3RV4 A;  4X65 Q;  4KLK A;  4A3E B;  4A4I A;  3O13 A;  4JI0 L;  1N56 A;  3U9S A;  1XPR A;  3QR8 A;  5I2Y A;  3DM3 A;  3E5S A;  5EPL A;  4B3M H;  3P75 A;  3PR4 A;  4A3F G;  2UXC H;  3I2Z A;  3I72 A;  1VBG A;  1KC7 A;  3LP8 A;  1E2V A;  5I47 A;  1EOT A;  2N55 A;  2VB3 X;  1S5F D;  2X0S A;  1CHQ D;  1JCK B;  2B3G A;  1GGO A;  3R3O A;  4UHV A;  5IYC G;  4F7X A;  3PW5 A;  1VQK A;  3FVQ A;  5KFJ A;  1PK8 A;  3BS1 A;  2M00 A;  2E5L L;  2B8F A;  3S15 B;  4MA5 A;  2A6E C;  4U7C A;  1K83 B;  2DIK A;  3GTK H;  3NBH B;  1RIP A;  3PO3 H;  4DV6 H;  3BJY A;  2BH2 A;  2WKD A;  2YU9 A;  3MXN B;  2VPS A;  3J80 E;  4LWC A;  1QVC A;  4K6D A;  4YWM A;  2KBN A;  4A3M G;  3T1Y H;  3GTQ A;  2HT1 A;  3NK9 A;  3K5N A;  4EBD A;  4OL7 A;  1VQM A;  2EY2 A;  3G71 A;  3CPF A;  5EPJ A;  4KY5 A;  3BDL A;  4Q0Y A;  2RGV A;  2HGS A;  3JC6 6;  1HTL D;  4DK6 C;  5LL6 S;  3MWY W;  5F2D A;  3TBI B;  1EQV A;  2EJF C;  4O2A F;  2J6U A;  1ET9 A;  4AIM A;  1JMC A;  3GTM B;  5EWE A;  1ENC A;  1WCM B;  2NN6 G;  4YR3 A;  2NVX B;  5KFF A;  2XCA A;  4A3L H;  2JN4 A;  4U6P A;  3WDN A;  4IFD I;  5IT9 c;  2F4I A;  4F4W A;  4IAL A;  4CC5 A;  2WDT A;  4YR2 A;  3HKZ E;  3QJY A;  4P74 A;  2CKZ B;  3S9W A;  2O4X A;  1GM5 A;  1YNX A;  2I5M X;  4Y7N H;  1KQS A;  1WD1 A;  1TWH A;  2UUC L;  2JA6 G;  2F0J A;  2JA8 G;  4A93 G;  3GDE A;  2D0O A;  2PMZ B;  3HOV B;  3QB3 A;  4LAA A;  4X62 H;  1GO3 E;  4M1U B;  5EBD A;  4A3F H;  1B9N A;  2FIN B;  2XNA C;  2YRW A;  2B63 H;  4EGQ A;  4HMJ A;  1IBL L;  5I4D A;  3PR5 B;  1GHJ A;  4YBZ B;  4JI1 Q;  1Q8K A;  4R8U B;  1HJP A;  4DR7 L;  1EZ1 A;  3HOY H;  3Q8D A;  1B7Y B;  3T1H H;  5KFK A;  1LT3 D;  1ZEQ X;  2FFK B;  2BH8 A;  3SK4 A;  4DR6 H;  3D8G A;  2JA7 G;  4KI0 A;  1EEI D;  3T56 B;  5KFM A;  1A3U A;  3H4D A;  3RV3 A;  2ASJ A;  3E3X A;  3D4D A;  4OWW B;  3GIJ A;  1ZET A;  4I4T F;  3QG1 A;  5C4X B;  4O2D A;  1MKH A;  2MP1 A;  1WD0 A;  3BZK A;  1SE4 A;  3KLR A;  1AN7 A;  2W7P A;  4GKJ H;  1E4E A;  1WJJ A;  2HCI A;  2MNA A;  4X6A H;  4L5T A;  2WYO A;  1YBY A;  1MJC A;  1EIG A;  2CHB D;  4BBS B;  3GII A;  3MR6 A;  5IP9 H;  1X32 A;  1V1P B;  3TRZ A;  4CJ2 C;  2F0L A;  3HOW G;  5KG0 A;  2WE6 A;  1WFQ A;  4ME5 A;  1CSQ A;  2NU7 B;  1PRT C;  1I3Q A;  4RAY A;  1LTR D;  3OUU A;  4K0K Q;  5KNC A;  2FPP B;  2FMC A;  3FMC A;  3CRL C;  4DR2 L;  1F9R A;  5KG2 A;  2K75 A;  1WCM A;  1T5X D;  4YB8 B;  3K7A B;  4YY3 H;  2JEJ A;  1KJQ A;  5CV6 A;  5CYU A;  1HFN A;  4J9K A;  1J9O A;  4MIU A;  2R85 A;  4Z9C B;  1LYL A;  3MWD A;  2C35 B;  1EWH A;  3A7A B;  4ZKB B;  2PQE A;  1Z6H A;  2RDI A;  5LL6 b;  5DGA A;  2Q8R E;  2IW3 A;  3GTG A;  3IL8 A;  5T1I A;  2I8C A;  4RGM A;  1D6E C;  1CQV A;  1S68 A;  1LT6 D;  3LNN A;  2K4K A;  3VYU A;  1EWI A;  4HSP A;  3FHW A;  5FPR A;  3G7L A;  4FBT A;  2O2L D;  1JC7 A;  2PZU A;  4K2K A;  4OEL B;  3S1N H;  2PI2 E;  3GO5 A;  2YZG A;  1S3O A;  2NN6 I;  5C5L A;  4TVA B;  1QCB D;  3TP6 A;  1ASZ A;  2JA6 H;  2E2I H;  3DUZ A;  3T1Y Q;  3G8C A;  4DV0 L;  4AH6 A;  3OMG A;  1I94 H;  4QWB A;  2VL6 A;  4HR7 B;  5COR A;  4ECX A;  2Q2U A;  4KK7 A;  3RTX A;  4HN7 A;  4QWA A;  2BQR A;  4O0A A;  4DV4 L;  1SYD A;  3RZD H;  2K5W A;  5AFW A;  4ZQ3 A;  1X3F A;  4GLV B;  1SYC A;  5LMN L;  1O7Z A;  4IO9 A;  3DWA A;  3S16 H;  2YTV A;  1JQY D;  1S0M A;  1LTL A;  2B2V C;  4QY7 A;  4AYB E;  4OIK A;  1XNQ H;  3HOW B;  4A3K H;  2NVY A;  1EQQ A;  4EFE A;  5HGQ A;  2A6H D;  5KFY A;  5L9X A;  3G6J B;  3BA9 A;  3MR5 A;  4JI1 L;  2CW0 C;  2NWG A;  1E3P A;  4C2M H;  2NU8 B;  4ED8 A;  4G3I A;  3K80 C;  3D31 A;  1X6O A;  3PO3 G;  4X66 H;  3AFP A;  5E1F A;  2W9B B;  1CFM A;  2ZT9 C;  3CCJ A;  4A3I B;  1BQQ T;  2FB9 A;  1UC9 A;  2YZM A;  2PZW A;  1JR0 D;  4IRC A;  3N52 A;  5CBA E;  1I7N A;  3R23 A;  3RLN A;  2NZO A;  3S14 H;  5C5J A;  1NR2 A;  5CV8 A;  1E4G T;  4QW9 A;  4RAZ A;  3LWE A;  2LMC B;  2UUC Q;  4BY7 H;  1N34 H;  3HOY B;  3OTO H;  1O7I A;  1YNJ C;  2RCF A;  5L37 A;  1HH2 P;  3K81 C;  3HKZ B;  2AQ4 A;  1DM0 B;  3I73 A;  4JV0 A;  1HR0 L;  2BCO A;  3I7F A;  1RJP A;  5DQI A;  2AUJ D;  2E8G A;  2QGQ A;  3OW7 A;  2JXM B;  5IYC H;  3GIQ A;  4RHS A;  3I8Z A;  2B2W C;  2RBM A;  2VUM B;  1LTI D;  3M4Y A;  5CV4 A;  1O80 A;  1PFN A;  3PV0 A;  4DR4 Q;  3RZO H;  3UE0 A;  4DAV A;  3ETJ A;  3KTM A;  1PA6 A;  2Z6K A;  4UP7 A;  4DNI A;  3UFX B;  3RB4 A;  4CBV A;  1DOL A;  2F0S A;  4K6L A;  2V5A A;  1CQJ B;  2GPS A;  1J6Q A;  1I6V C;  3JRW A;  4G7H C;  3OSN A;  2DZD A;  4A3K G;  5F9N A;  3M9O B;  2GA4 B;  1PRT F;  1Z2N X;  4DR2 H;  1D1I A;  2WII B;  4FM9 A;  3HS0 C;  4GOP C;  1QUQ A;  5KFQ A;  4DV2 H;  1QZH A;  1EUD B;  1SBB B;  4YY3 L;  4X64 Q;  1FJG Q;  4A3D H;  4GC7 A;  3GLK A;  5M5X B;  3K5L A;  1E1T A;  2Q8I B;  4JI8 L;  4NKL A;  2MQH A;  2VR1 A;  4GOP B;  5LYJ F;  1MSH A;  4PNY A;  4R4I A;  1K0R A;  3VR3 A;  4R7R A;  1WTP A;  2EYL A;  2KHS A;  2R7D A;  1N9W A;  2QKI C;  3RNU A;  1AZP A;  1EYG A;  4KHP L;  2R7M A;  4HED A;  5C44 H;  1X65 A;  2SDF A;  4DV4 Q;  4BA1 I;  3S1Q B;  4MV9 A;  2QW7 A;  4JI4 L;  4ZOL F;  1HNZ L;  3H0G G;  5GAE C;  4APV A;  4NMZ A;  1GSA A;  2HHH L;  2RA4 A;  2UXC L;  2ZM6 L;  1GSO A;  5D1O A;  5JEA G;  2W71 A;  3ZYY X;  1ENA A;  4LJZ C;  2J9G A;  2A6H C;  4LUV A;  3HOZ G;  3KJP A;  1KDC A;  3HOX H;  1GVP A;  5I2X A;  1TWA A;  3L9A X;  3CCV A;  4Q0F A;  4R8I A;  2UUA H;  3NE5 B;  4B08 A;  1C4Q A;  2BQ3 A;  4YP3 A;  4JI5 H;  1YNJ D;  2VZA A;  3CC7 A;  5KNB A;  1PH1 A;  2NU6 B;  1XNQ L;  1C7Y A;  1YHA A;  3G4S A;  1VQC A;  3NTH A;  4PZ7 A;  2R7N A;  5F9L A;  4QWC A;  5FJ8 G;  4HIO A;  4B3R L;  3KHH A;  2R7L A;  4ZK9 B;  2R3Z A;  1V1Q A;  1GUG A;  4G4K A;  4JV5 H;  3TP7 A;  4HJA A;  4A3J H;  1ENF A;  5IGG A;  4RUC A;  1F9S A;  4BY7 G;  2ZDG A;  1E0B A;  1FGU A;  3NP8 A;  4A3K B;  1CKO A;  1H95 A;  4NXN H;  4UCT A;  3GTK B;  1WOC A;  3CVZ A;  3PGZ A;  1QVF A;  4BXX G;  4X66 L;  1SYE A;  3VA5 A;  5IE8 A;  3CU7 A;  3HOW H;  1B3Q A;  1RJT A;  1K83 H;  2IA6 A;  1HUM A;  2E2J B;  4X66 Q;  1KJJ A;  1TWG A;  3H40 A;  2Y0S G;  1TII D;  4IN3 A;  1EQR A;  1U0L A;  5GRO A;  1QVG A;  2ZJP A;  5IWA H;  3ULL A;  3S17 H;  5DLF A;  2LXK A;  1EY8 A;  1XWE A;  1CM9 A;  4H13 C;  4DR1 Q;  4O2B F;  5ELN A;  4LF6 Q;  4RA8 A;  5KFL A;  5LMN Q;  2NVY B;  5A35 A;  4PMB A;  5I9O A;  3CCQ A;  1VQB A;  2BE5 D;  3Q8Q B;  1JOO A;  1Z47 A;  4PZ8 A;  5KFU A;  1NMG A;  1EY6 A;  2XRS D;  3MHB A;  4RKL A;  3R8B A;  4LF7 Q;  2Y0S A;  2QYZ A;  3EYY A;  4B3S Q;  1IBL H;  2NBF A;  2SNS A;  2FXQ A;  5HGT A;  4C3I B;  3F2U A;  2ZTE A;  1E1O A;  1EYC A;  3CMA A;  2IY5 B;  1E4E B;  5L1L A;  3PVX A;  1S97 A;  4IZO A;  3S1M H;  4A3M B;  4G57 A;  3JZI A;  4HIM A;  5ELO A;  3TN2 A;  1PH7 A;  3I4N B;  5M9O A;  4DR4 L;  3L0O A;  3RB0 A;  2ASL A;  1V8Q A;  1Q12 A;  2JA8 H;  4A93 H;  4QWD A;  1NCV A;  4DV2 L;  1H9S B;  3JSN A;  3J81 i;  4Y52 H;  1WTR A;  1XPU A;  2F0T A;  1S10 A;  1K0S A;  4QIW E;  1UE1 A;  3F8T A;  3M4P A;  2B39 A;  1T36 A;  1HR0 Q;  4DV1 Q;  1GXD C;  5GAH C;  3GTO H;  4DFA A;  2IMW P;  1LAC A;  4HAE A;  5EKI A;  1YIJ A;  1B9M A;  4LFB Q;  4YY3 Q;  5C0X G;  1CS0 A;  1PYB A;  1EZ8 A;  4IFD H;  4IFD J;  4U67 3;  4MV6 A;  3EA6 A;  1Y1V A;  4WJ4 A;  4KHP H;  3J80 L;  1CI3 M;  1KXL A;  1A9X A;  1VQH A;  3S24 A;  5KFA A;  1VQ5 A;  5ISR A;  1L0X B;  5LL6 X;  4KJO A;  3FKI H;  1GOZ A;  3S1Q H;  4IPH A;  5LMN H;  1LO5 D;  3KK7 A;  3HB9 A;  2XSC A;  3GV3 A;  3UI2 A;  4ECW A;  2QA4 A;  5EZY F;  2BE5 C;  5M5Y H;  4ZQI A;  1YI2 A;  4I50 F;  1T9H A;  2PCF B;  1K8A C;  4BY1 B;  1S5C D;  4L5R C;  2B8G A;  2PMZ A;  1HZ9 A;  1SFO A;  1W6K A;  4UFZ A;  3KHR A;  3R5H A;  4KN4 C;  5JJL A;  1U4P A;  3RMH A;  4GKJ Q;  5M5W H;  4QB4 A;  4AYB B;  2TSS A;  4M8A A;  4DK3 C;  5JAV A;  4Y7N B;  3ERO A;  4K14 A;  3CP0 A;  3HEJ A;  4F87 A;  1IYV A;  1HHV A;  2H1E A;  3QOJ A;  3R2T A;  4IPC A;  3I3C A;  4RGO S;  1WTH A;  3HRZ C;  1VQP A;  1UE7 A;  3RAQ A;  1SMY D;  5FO8 B;  3GTP H;  3RGZ A;  2Y0S B;  3EIV A;  1KL9 A;  1DCZ A;  3KAJ A;  1WTO A;  4MV4 A;  5BMV F;  1MD2 D;  4BBS G;  4G7Z C;  2MO1 A;  3NXW A;  3EBE A;  4JI5 Q;  2R8G A;  3RB3 A;  5G3L D;  4DXG A;  5FLX E;  2SNM A;  4RB0 A;  1FNU A;  3MEF A;  2E5L Q;  5HBR B;  3PW7 A;  3LWB A;  2KEC A;  4B3R Q;  1R9T B;  4LFA H;  1XMQ Q;  4PMC A;  2I5L X;  3FRP B;  5ELB A;  1Y1W G;  1D5M C;  4JYA Q;  3VPD A;  5JEA J;  5JEA H;  4OX9 Q;  3GIK A;  4A3J B;  3FMA A;  2CQO A;  4OIJ A;  4RHR A;  2PZT A;  2WTF A;  1PH2 A;  3J7A V;  2EVB A;  3NQI A;  4CDE C;  1LTB D;  4LH7 A;  3I55 A;  5EPK A;  2HCC A;  3CC4 A;  4Q45 A;  4QUF A;  2LY7 A;  3C1E A;  2IX1 A;  1AUX A;  3CCS A;  1BVS A;  1V1P A;  5KG7 A;  4F4X A;  4ECU A;  4OON A;  5DG7 A;  5LMU L;  4DR7 H;  4XYM B;  3ITP A;  3CF5 A;  1QE6 A;  2JQO A;  2Z8L A;  1Y1W A;  1NSN S;  1PH6 A;  4A3E G;  4RNN A;  1PLF A;  1Q90 A;  4L8J A;  1VQA A;  2F0I A;  4IUP A;  3OHB A;  2Y0S E;  4A3I G;  4YAJ B;  4DXF A;  4XZ3 B;  3HZX A;  4DUZ L;  3STB D;  5KFO A;  3N40 P;  3NWT A;  4ULL A;  4DV5 H;  3TP5 A;  2XGQ A;  1L2F A;  3MXN A;  2B63 G;  3GTQ H;  5LMU Q;  5JJK A;  3S2H H;  5CV5 A;  3IRB A;  3TRE A;  4KHV A;  4X3K A;  2FKL A;  3KF6 A;  1STA A;  4J15 A;  1KLU D;  4DR5 L;  1TWH H;  3KHG A;  2IJ0 A;  4BWG B;  5AJ3 Q;  3BDC A;  1RCV D;  1H9J A;  1YVC A;  1RYR A;  2K6A A;  4K8J A;  1EU3 A;  4IR1 A;  2QCP X;  3K5H A;  5KG6 A;  1R4Q B;  4JYA L;  1EFW A;  1M7J A;  5C3X A;  3A7L A;  3J7Y W;  3N6X A;  3CPW A;  2OH2 A;  4FP5 D;  2VXW A;  4RNO A;  1GYF A;  2L12 A;  4HNV A;  3JAM i;  2HVR A;  3WOE A;  3TQ1 A;  1E24 A;  1PTO B;  5IIF A;  1HNX L;  3TQY A;  1STY A;  5KYI A;  1MBY A;  1QZG A;  3L2P A;  2R86 A;  5KG3 A;  2JA5 A;  5L1K A;  1NUC A;  1Y14 B;  2WAQ A;  5FLM G;  2B2T C;  5ELF A;  5GQO A;  3U4V A;  4KN7 C;  3K58 A;  2F0O A;  4GOP A;  1YEZ A;  4ED3 A;  1KRT A;  3S1N B;  4A3G B;  2K50 A;  2B63 A;  1EHI A;  3BZD B;  2FE3 A;  1KLG D;  4YHH Q;  1BNZ A;  2XIG A;  2PW5 A;  4DL6 A;  2JA6 B;  3AYH B;  2UU9 L;  4PZ6 A;  4WFN 3;  5C1P A;  5L1I A;  1B8A A;  2UUC H;  2AWO A;  1OWT A;  1KNA A;  3K7U C;  4UCS A;  1T5E A;  2H4O A;  1PXU A;  3M9B A;  1DD2 A;  3JAM L;  1PH9 A;  4G7O C;  2LS0 1;  5KFI A;  4HJ9 A;  2E2H A;  2LKV A;  4O4L F;  4B3T Q;  2OXP A;  3X3M A;  4EQO A;  1QOH A;  2MPM A;  3SEB A;  1KIX A;  4DL2 A;  4UP8 A;  2PPB C;  4NXM L;  4MAM A;  3D4R A;  4OO1 H;  1RHP A;  2NZH A;  2YU9 B;  3DF7 A;  2NB0 A;  2QEJ C;  4XT1 B;  5M3M B;  1K83 A;  3ND8 A;  1DOK A;  2UUA Q;  1BBW A;  1VMP A;  3DHQ A;  3M4I A;  4YJ2 F;  1Z2P X;  2WB1 B;  5IYB G;  1VQG A;  2F0E A;  3H0G A;  2KA7 A;  4IRK A;  5EWG A;  1JJ2 A;  3BDO A;  1HNZ Q;  2RDH A;  1M0W A;  5C3E H;  1VQ4 A;  5FPO A;  1RJQ A;  1Y8P B;  1ICF B;  3CCU A;  3QWN A;  3RN2 A;  1SXT A;  1RDP D;  5D1O B;  4A3E H;  4GKJ L;  4A2B A;  4C1N K;  1WI5 A;  1MHW C;  1PYW D;  2QK4 A;  2C2D A;  2V4Q A;  4IHJ F;  1UWV A;  2K5Q A;  4JI5 L;  1N48 A;  2H5X A;  4NXM Q;  4C5B A;  5KT5 A;  3TIG A;  3NTK A;  1K3R A;  2KED A;  1S72 A;  1RJR A;  4UCU A;  4LF4 H;  1WCM H;  2K03 A;  2UUB H;  1UAP A;  3H91 A;  4GKK H;  4TRD A;  2L5T A;  2SCU B;  2JA7 A;  3MC0 B;  4ZCK A;  4BBR H;  4DF7 A;  1I7L A;  4L1K A;  2CW0 D;  1I4R A;  2X69 A;  1EY4 A;  2E2I A;  3E9I A;  5KT4 A;  2F0M A;  4DN4 M;  2JK8 A;  2UVR A;  3ICE A;  2D9U A;  1FJG H;  2DJF C;  3M9M B;  4JOI A;  2CFM A;  3I70 A;  2W6Q A;  4J9Q A;  4J9L A;  4DV2 Q;  1FNV A;  1W96 A;  1BCP D;  4JI7 Q;  1GKH A;  2DY7 A;  4B3S L;  4R4T A;  5FKA C;  1VQI A;  4LF8 H;  4QW8 A;  4MZ9 A;  5NUC A;  3MWM A;  1FL0 A;  2K7V A;  3B6Y A;  3MWE A;  2JA6 A;  2IHE A;  3S1R B;  5J3B A;  4R1J A;  5C4J H;  2G5D A;  2PNR C;  4J1M A;  3HOV G;  3J81 j;  4MN3 A;  5KG5 A;  1LTS D;  3UDF A;  1WTW A;  3PW2 A;  2B2Y A;  2CZG A;  3KJO A;  4J9R A;  1W93 A;  1TS4 A;  1EUC B;  2R7K A;  4DV3 L;  3TME A;  5KG4 A;  1XMQ H;  3UDG A;  5IP7 H;  4C3J B;  4ZLT F;  4DA2 A;  2KCN A;  2W6N A;  1XMO H;  4LF9 Q;  5D1P A;  2Q8T A;  3STB C;  4IUV A;  2NVY H;  3BQ0 A;  4OGQ C;  1B50 A;  1DGS A;  5D14 A;  1N34 Q;  1A2U A;  1C9O A;  1SDF A;  2XWB B;  4NP5 A;  3K5M A;  4HTH A;  5C5M A;  5FLM H;  4X65 L;  4ODG A;  4JI0 Q;  4J6H A;  1BO0 A;  4N9T A;  5C4X G;  2B2W A;  2Z1C A;  1IXR A;  1EIF A;  4ABN A;  2R7Z B;  1KRS A;  4UCO A;  3HOU H;  1Q46 A;  4JI6 H;  1CSP A;  2OWO A;  5IWA L;  1DJR D;  3QIA A;  2KHI A;  3T1H Q;  1TS3 A;  3TS0 A;  3S1M B;  4QIW B;  4A3C H;  5FOB B;  1RKN A;  3I4N H;  5K2M A;  3PO3 B;  5IT9 L;  3HBL A;  2DPI A;  1JWU D;  5EWF A;  4JPB W;  3KXY T;  4JI1 H;  2HHH H;  2C5C A;  3GID A;  2YS6 A;  1RD9 D;  4ZYS A;  1ULZ A;  3Q1K A;  2N78 A;  1F2Z A;  1IKL A;  1ZHQ A;  1I50 A;  1PFM A;  3GIM A;  2XCP A;  5FO9 B;  5KIX A;  2K05 A;  4IJL A;  3GTK A;  5DAU A;  3ZJY C;  1KDB A;  5KYL A;  5A2Q L;  1M0T A;  1DXM A;  3M4O B;  4KHP Q;  2I46 A;  3OUZ A;  1Q8I A;  3EJI A;  2DUD A;  4OO1 G;  1UNS A;  1C30 A;  5BR8 L;  3CHB D;  4LFB H;  1MJE A;  4ZUI A;  2A69 C;  1HR0 H;  2XIW A;  1A2T A;  3F2D A;  1R4P B;  4HR7 A;  5IYZ F;  3VDY A;  2PQA B;  2DNE A;  3E0E A; 
#chains in the Genus database with same CATH homology
 1IL2 A;  4X64 L;  4GOP C;  1QUQ A;  2KCM A;  1VS0 A;  4POG A;  1QZH A;  4YY3 L;  4X64 Q;  1EIY B;  1L0W A;  4JC0 A;  1FJG Q;  4A3D H;  1UE6 A;  4XTC S;  1G29 1;  4OX9 L;  1E1T A;  3AEV A;  4LF4 L;  3CCR A;  4JI8 L;  1AE2 A;  1JT8 A;  1A8V A;  1B70 B;  2MQH A;  4GOP B;  1Z9F A;  4JI3 L;  1HZC A;  4LF6 L;  2Q2T A;  3U58 A;  4R4I A;  1N34 L;  1K0R A;  4IJH A;  4DKA C;  2LXJ A;  1HZA A;  4BY1 H;  4JI2 L;  4DV5 L;  2R7D A;  1N9W A;  3RNU A;  2LSS A;  1K9M C;  1EYG A;  4LF5 Q;  4KHP L;  5GAG C;  2WB1 G;  5C44 H;  1X65 A;  4DV4 Q;  2UXD Q;  3PUZ A;  4BA1 I;  1ASY A;  1LUZ A;  1W3S A;  4C3I H;  4OXP A;  4JI4 L;  4R4C A;  2NVQ H;  2ZTD A;  1XPO A;  1HNZ L;  4DUZ Q;  1VQO A;  3H0G G;  5GAE C;  2HIX A;  1Y1V G;  3U50 C;  4APV A;  2JA5 H;  4BA2 I;  2HHH L;  4JI7 L;  2UXC L;  1LM0 A;  4PMW A;  2R7Z H;  1HNW Q;  3CD6 A;  2ZM6 L;  3HOU G;  4HID A;  3I4O A;  5JEA G;  3DLL A;  1X54 A;  2MFI A;  4QGU A;  2HQL A;  2RHS B;  3S2D H;  4GLA C;  4LUV A;  2ZJR A;  3HOZ G;  2N49 A;  3J80 i;  3KJP A;  3HOX H;  1GVP A;  2R93 H;  3CCV A;  4B3M Q;  3H15 A;  1Q86 C;  2HHH Q;  1A62 A;  3L7Z C;  1PVO A;  3PUV A;  3S1R H;  3EN2 A;  3JAM c;  4LUZ A;  2VZA A;  1JJG A;  3KYH C;  3LGJ A;  3CC7 A;  3SGI A;  3NEM A;  1PH1 A;  1XNQ L;  1C7Y A;  1YHA A;  4PG3 A;  3G4S A;  1VQC A;  2UXB L;  1TWA H;  2D0P A;  4PZ7 A;  4P72 A;  4BY1 G;  5FJ8 G;  4HIO A;  4A75 A;  2YV5 A;  4B3R L;  4JI6 Q;  2K5H A;  3PCO B;  1V1Q A;  2F52 A;  1YIT A;  2ZTC A;  3GTJ H;  1VQN A;  4OWX B;  4HJA A;  1VQ9 A;  1VQF A;  4QL5 A;  4A3J H;  2RF4 A;  2UU9 Q;  2JJQ A;  1TWG H;  4BY7 G;  1FGU A;  4LF9 L;  1CKO A;  1EUJ A;  1N33 Q;  1H95 A;  1SE8 A;  5EAY A;  1WOC A;  5GAD C;  2ZM6 Q;  3PGZ A;  1QVF A;  4BXX G;  4X66 L;  3HOW H;  5IE8 A;  3TS2 A;  4A3D G;  4JV5 Q;  3K8A A;  2YTY A;  1K83 H;  4JV5 L;  2K14 A;  1KD1 C;  2ZJQ A;  4X66 Q;  4HJ5 A;  3PUX A;  3J7A 5;  2Y0S G;  2IT1 A;  3M4Q A;  4AYB G;  1XTD A;  1CKN A;  1EQR A;  1S40 A;  4JI4 Q;  1U0L A;  5GRO A;  1QVG A;  1I94 L;  2ZJP A;  3OYY A;  4TQU S;  2UUB L;  3ULL A;  3S17 H;  2E2H H;  2LXK A;  3KF6 B;  1IZ6 A;  3T1H L;  4R4Q A;  3GD7 A;  1X3G A;  3PIO A;  3PSI A;  2ID0 A;  4DR1 Q;  1J5E L;  5ELN A;  4LF6 Q;  5LMN Q;  1XNR Q;  5C4X H;  1N36 Q;  4LF7 L;  1NY4 A;  3CCQ A;  1VQB A;  2BA0 A;  4YCW A;  2Q2H A;  1Z47 A;  3KF8 B;  4PZ8 A;  1NMG A;  4X62 Q;  4LF7 Q;  3FP9 A;  1YJW A;  1VQJ A;  3T1Y L;  4B3S Q;  4DV0 Q;  3A74 A;  4ALP A;  4EQ5 A;  3H0G H;  1I3Q H;  2FXQ A;  1NBW A;  5IP9 G;  5M5X H;  5IYB H;  2UUA L;  3PF4 A;  3M7N A;  4GNX A;  2JA7 H;  4IFD G;  2ZTE A;  1E1O A;  3E9H A;  1V9P A;  2XTI A;  3CMA A;  3VDY A;  2IY5 B;  5M3M H;  2AHO B;  1I94 Q;  1D8L A;  4YWL A;  2VQE L;  3S1M H;  2K5V A;  1PH4 A;  3CAM A;  2Q2I A;  1HNW L;  4WJ3 M;  2JE6 I;  3KOJ A;  4HIM A;  1SLJ A;  2OQK A;  5ELO A;  2JA9 A;  3BU2 A;  2JEA I;  1W2B A;  4L5Q A;  5C3E G;  1PH7 A;  4DR4 L;  1P8L A;  2PI2 A;  3L0O A;  4A3B G;  2KHJ A;  1N33 L;  2KEN A;  2RHQ B;  3FKI G;  1OXV A;  3WWV A;  4DV7 L;  2UXD L;  1Q12 A;  2ASB A;  2JA8 H;  4A93 H;  2IHF A;  4DV5 Q;  1VQD A;  4IOA A;  1KAW A;  2XGT A;  3CCL A;  2D62 A;  3H3V I;  3HOV H;  5LMN W;  4DV2 L;  3W1B A;  1NJI C;  4NPS A;  4UP9 A;  2A19 A;  3J81 i;  4RMF A;  4DR2 Q;  1Q7Y C;  2UUB Q;  4JI3 Q;  1XPU A;  4Y52 H;  4QIW E;  1UE1 A;  4LF4 Q;  3F8T A;  1Y1V H;  2AWN A;  3M4P A;  1XMO L;  3A0J A;  1HR0 Q;  4L5S A;  4DV1 Q;  1GD7 A;  4DR7 Q;  5GAH C;  3GTO H;  5IYD H;  5FLX c;  1YIJ A;  5M3M G;  4LFB Q;  2EQS A;  4YY3 Q;  1OXS C;  1PYB A;  5C0X G;  2GVA A;  1KHI A;  3UDX A;  1FVI A;  3HOZ H;  4IFD J;  5K36 G;  1D7Q A;  3G48 A;  1A63 A;  2WB1 E;  4WJ4 A;  1SRO A;  4QQB X;  1KXL A;  1VQH A;  2ES2 A;  1HR0 W;  1IBK L;  3S24 A;  1HZB A;  4JG2 A;  1VQ5 A;  3FKI H;  4JBK A;  5IWA Q;  3U4Z A;  3S1Q H;  3KDF A;  4LFA Q;  2N8N A;  4H02 A;  4IPH A;  4OO1 I;  1VQ7 A;  1PHJ A;  1U5K A;  2R92 H;  3A5Z B;  2QA4 A;  4BBS H;  1SMX A;  5M5Y H;  3AQQ A;  4MTN A;  2VS1 A;  4K0K L;  2NVX H;  4JBM A;  1YI2 A;  1CKN B;  2ATW A;  4FDB A;  3J80 c;  1T9H A;  4A3G G;  1X3E A;  1TWC H;  4NXN L;  1K8A C;  4DAM A;  5AJ3 L;  2VQF L;  4L5R C;  2K52 A;  4DR3 Q;  1HZ9 A;  4B3M L;  1Q1B A;  4GKK L;  1MIU A;  1J5E Q;  4A3L G;  4DV3 Q;  1JE5 A;  5JJL A;  4JOI C;  4GKJ Q;  5M5W H;  3PF5 A;  1YJ9 A;  4LFC Q;  4YCV A;  4DK3 C;  3J81 c;  3CP0 A;  4GN5 A;  1SFO H;  2A8V A;  2R6G A;  4GNX C;  4POF A;  4IPC A;  3CCM A;  3BJU A;  3CW2 C;  1VQP A;  1YHB A;  2EIF A;  1IBM Q;  2GN5 A;  1TXY A;  1UE7 A;  2KCT A;  3M4O H;  1I6H H;  3F2C A;  4OWT B;  1PFS A;  1XJV A;  3GTP H;  4DR6 Q;  2WAQ G;  3EIV A;  2PQA A;  1KL9 A;  1X55 A;  4LF8 L;  5C44 G;  3S15 H;  5FJ8 H;  4HJ8 A;  4BBS G;  4X65 Q;  4KLK A;  5H1S E;  4A4I A;  2MO1 A;  4JI0 L;  3EBE A;  4JI5 Q;  2I5H A;  4IPD A;  4A3G H;  1XPR A;  1M1K C;  3I4M G;  3MEF A;  3DM3 A;  2E5L Q;  2QEX A;  4P73 A;  4A3F G;  4B3R Q;  3I2Z A;  3PIP A;  1XMQ Q;  3M3Y H;  2I5L X;  4JYA Q;  1Y1W G;  1VQ8 A;  5JEA J;  4OX9 Q;  4IPG A;  4BXX H;  3GTL H;  2CQO A;  2B3G A;  1PH2 A;  2K5N A;  5C0X I;  3I55 A;  4DPG A;  1P16 A;  4KHZ A;  5IYC G;  3CC4 A;  1VQK A;  1I50 H;  2IX1 A;  2E5L L;  4JCV E;  3I4N G;  1A0I A;  3CCS A;  1BVS A;  1X56 A;  3GTK H;  3NBH B;  4ME3 A;  1RIP A;  3PO3 H;  4OON A;  5LMU L;  2B29 A;  4DAY B;  2BH2 A;  3MXN B;  2OCE A;  5BR8 Q;  3CF5 A;  4LWC A;  2JQO A;  1QVC A;  1Q1E A;  4YWM A;  2KBN A;  4A3M G;  4A3E G;  1PH6 A;  1VQA A;  2HT1 A;  1PYS B;  2Y0S E;  4A3I G;  3KFU A;  2AMC B;  1L1O B;  3STB D;  3G71 A;  4DUZ L;  1VQM A;  3CPF A;  2YU9 H;  1Y1W H;  1L2F A;  2B63 G;  3GTQ H;  4C3J H;  3JC6 6;  1N8R C;  5LMU Q;  4DK6 C;  5JJK A;  3S2H H;  3IRB A;  2OTJ A;  3TRE A;  4UPA A;  4AIM A;  1JMC A;  1YJN A;  4LNQ A;  4HIK A;  4LW1 A;  4BBR G;  2NN6 G;  3KF6 A;  4GKK Q;  5IYD G;  4J15 A;  4AQY L;  4DR5 L;  2NVT H;  1TWH H;  4YHH L;  5M3F H;  3CC2 A;  4A3L H;  4IFD I;  5IT9 c;  5AJ3 Q;  1YVC A;  5C0X J;  2VQF Q;  1X9N A;  3CQZ H;  1K8G A;  1TWF H;  3HKZ E;  4P74 A;  1BBU A;  2CKZ B;  5IP7 G;  4DV6 Q;  1GM5 A;  1YNX A;  2I5M X;  4Y7N H;  1KQS A;  1EFW A;  4JYA L;  3CXC A;  3W5O A;  3A5U A;  1PH8 A;  2UUC L;  3CPW A;  2JA6 G;  1N32 L;  2JA8 G;  4A93 G;  3GDE A;  2D0O A;  3RLO A;  3JAM i;  1E24 A;  1HNX L;  4A76 A;  4YCU A;  1GO3 E;  3ULJ A;  3TQY A;  1QZG A;  3L2P A;  1PV4 A;  2BA1 A;  4A3F H;  4A3I H;  1Y14 B;  2B63 H;  4DUY Q;  5FLM G;  3F2B A;  1IBL L;  2WFW A;  5HY6 A;  5GQO A;  3U4V A;  4B3T L;  2F4V Q;  1OXX K;  1SRU A;  4JI1 Q;  4GOP A;  4QJF A;  1Q8K A;  1YEZ A;  2JA5 G;  1KRT A;  1HJP A;  2K50 A;  4DV1 L;  4DR7 L;  3UDI A;  3HOY H;  2A1A A;  1B7Y B;  3Q8D A;  4YHH Q;  3BZC A;  3PO2 G;  2BH8 A;  3HOX G;  3AYH B;  1R9T H;  2UU9 L;  4PZ6 A;  1G51 A;  2PMZ E;  4KI0 A;  4DUY L;  2JA7 G;  1YZ6 A;  1B8A A;  2MO0 A;  4GN3 B;  2AWO A;  3PUW A;  4DR3 L;  3K7U C;  4OWW B;  3F1Z A;  1YHQ A;  4NXN Q;  3M9B A;  4O2D A;  1MKH A;  1PH9 A;  3RLF A;  3BZK A;  3TEH B;  4GLX A;  4XIG S;  1WJJ A;  2MNA A;  4HJ9 A;  3I4M H;  4X6A H;  4L5T A;  1WCM G;  4B3T Q;  2VUM H;  1YBY A;  2VNU D;  1MJC A;  4LFA L;  1C0A A;  1KIX A;  4UP8 A;  4NXM L;  2NZH A;  4YWK A;  5IP9 H;  1CUK A;  1VQL A;  2N3S A;  3TRZ A;  4A3C G;  3HOW G;  1OXT A;  3W1G A;  2UUA Q;  1BBW A;  3K0X A;  1L1O A;  1WFQ A;  4A3K G;  2I0Q A;  5IYB G;  1VQG A;  1VQE A;  1CSQ A;  2HIV A;  2DGY A;  4UY8 C;  1VQ6 A;  3NEL A;  4DV6 L;  1JJ2 A;  1JB7 A;  4X62 L;  1HNZ Q;  5C3E H;  1VQ4 A;  4K0K Q;  3GTM H;  2RCN A;  4HJ7 A;  3CCU A;  2CWA A;  4DR2 L;  3RN2 A;  4AQY Q;  1RL2 A;  2E2J H;  2K75 A;  4A3E H;  4JBW A;  4GKJ L;  1WI5 A;  3RR5 A;  2F3I A;  1UWV A;  4JI5 L;  1LYL A;  2H5X A;  2C35 B;  2IX0 A;  4NXM Q;  1HNX Q;  1K3R A;  1S72 A;  5DLQ E;  4LF8 Q;  1WCM H;  1FJG L;  4DR6 L;  1BKB A;  1IBM L;  1PH5 A;  2K4K A;  1Q82 C;  4BBR H;  4LFB L;  1EWI A;  3FHW A;  3KDF B;  5JJI A;  3E9I A;  2JK8 A;  1E22 A;  3ICE A;  3GTG H;  4LFC L;  4JOI A;  2CFM A;  3S1N H;  2PI2 E;  3GO5 A;  4DV2 Q;  1S3O A;  2NN6 I;  3G6E A;  1KC8 C;  1UEB A;  1IYJ B;  4TVA B;  1ASZ A;  4JI7 Q;  2JA6 H;  1GKH A;  2E2I H;  3T1Y Q;  2Z6K C;  4R4T A;  4DV0 L;  1VQI A;  4B3S L;  3ER0 A;  4AH6 A;  4A3M H;  4MZ9 A;  1V43 A;  2VL6 A;  1PH3 A;  2Q2U A;  1FL0 A;  4O0A A;  4DV4 L;  3RZD H;  1N36 L;  3B6Y A;  2IHE A;  1X3F A;  5J3B A;  4GLV B;  4R1J A;  1QUQ B;  5LMN L;  1IBL Q;  4LF5 L;  2CWP A;  5C4J H;  1XNR L;  2R92 G;  2WP8 J;  4IO9 A;  2CCZ A;  1K73 C;  3S16 H;  2YTV A;  2R7F A;  4R4O A;  3HOV G;  1LTL A;  3J81 j;  1IBK Q;  3UDF A;  4QY7 A;  3UE1 A;  4AYB E;  4JI8 Q;  3ULP A;  4A3J G;  2R7Z G;  1G6P A;  2OTL A;  2GVB A;  2OQ0 A;  2V1C C;  2YYZ A;  3KJO A;  1SR3 A;  4DV3 L;  3RN5 A;  2UXC Q;  3I56 A;  3UDG A;  3PO2 H;  2WAQ E;  4A3K H;  1Q81 C;  5IP7 H;  3D0F A;  4NB3 A;  1CKM A;  5IY0 A;  1EQQ A;  5HGQ A;  3OW2 A;  4JI1 L;  4LF9 Q;  1E3P A;  4C2M H;  1XMQ L;  3K80 C;  3D31 A;  3HFZ B;  1X6O A;  2NVY H;  3STB C;  4GNX B;  2F4V L;  3PO3 G;  3AFP A;  1DGS A;  4DR1 L;  3OTO Q;  3CCJ A;  3OTO L;  1N34 Q;  4MNO A;  1C9O A;  1M90 C;  2Z0S A;  2VUM G;  1EOV A;  1OXU A;  3H3V H;  3M85 A;  4JI6 L;  1AH9 A;  3HKZ G;  4X65 L;  5FLM H;  1AE3 A;  3RLN A;  2NZO A;  4DV7 Q;  4JI0 Q;  3S14 H;  2UXB Q;  5C4X G;  1NMF A;  1IXR A;  1EIF A;  1UE5 A;  2EXD A;  2L15 A;  3KLW A;  1KRS A;  4P75 A;  3K7A H;  3CCE A;  2UUC Q;  4BY7 H;  1N32 Q;  1L1O C;  1O7I A;  1Q46 A;  3HOU H;  3HKS A;  2ALY B;  1HH2 P;  3PUY A;  3K81 C;  3NEN A;  4EX5 A;  1CSP A;  2OWO A;  5IWA L;  2KHI A;  3T1H Q;  3TS0 A;  4IOC A;  1XMO Q;  1HR0 L;  4A3C H;  3I7F A;  5E7N A;  4RG1 A;  2VW9 A;  1I5F A;  2VY3 A;  4LUO A;  3I4N H;  2E8G A;  4DR5 Q;  3HOY G;  2QGQ A;  1NTG A;  5IYC H;  2PNH A;  5M3F G;  3CME A;  4GN4 B;  1NE3 A;  2N78 A;  2R93 G;  1XNQ Q;  1WYD A;  3J7Z C;  3AFQ A;  3PV0 A;  4IJL A;  4DR4 Q;  3ZJY C;  3UE0 A;  3RZO H;  1PA6 A;  2Z6K A;  4UP7 A;  1JJC B;  2YTX A;  4P71 A;  1VCI A;  4KHP Q;  4DNI A;  4A3B H;  3ERS X;  1E7Z A;  4JI2 Q;  1SN8 A;  4JBJ A;  1OTC A;  2AKW B;  2DUD A;  2VQE Q;  4OO1 G;  2JEB I;  5BR8 L;  1MJE A;  1J6Q A;  3F2D A;  4GS3 A;  4C3H H;  2PQA B;  3E0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...