4A3JG

Rna polymerase ii initial transcribing complex with a 2nt dna-rna hybrid and soaked with gmpcpp
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3jG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3jG01
1IBKL 2XTIA 4XTCS 4A3GG 2NVTH 2Q2IA 3HFZB 1WI5A 4LNQA 1VQIA 1AE3A 2Z6KA 1X3FA 3OW2A 1KD1C 2E2HH 5IYBG 3SGIA 5C3EG 4DV0Q 2GN5A 4YY3L 2ZM6L 1QZGA 5AJ3Q 4JI3Q 4AQYQ 4DK3C 1AE2A 2B63H 4BBSG 1K3RA 1XMOQ 1PH9A 3UDGA 3HOXG 1XMQL 1LTLA 5C44H 1KIXA 3U50C 1ASYA 2I5HA 1L1OA 1N8RC 2H5XA 3RZDH 4K0KQ 1JJCB 2UUBL 4RG1A 2F4VQ 3EBEA 4X66Q 2A19A 4LF6Q 5IP9H 2RF4A 3K7AH 1I3QH 2VQEL 3PO2H 2K4KA 1CKMA 1SN8A 2OCEA 4JI1L 5M5WH 3OTOL 3AFQA 4DR1Q 2NVQH 3M3YH 3S1QH 2I5LX 3GTJH 4DR2L 1VQBA 1G51A 1NBWA 2OQKA 3CCJA 1B7YB 1Q7YC 3CW2C 2JQOA 4IJLA 3D0FA 1X55A 4PMWA 2JA7G 3HOUH 1AH9A 2MO1A 2ATWA 2NVXH 2PQAA 1VQGA 3W5OA 1S72A 1I94Q 1HNWQ 4C2MH 3UDIA 3A5UA 4C3JH 2QEXA 3KFUA 4IPCA 4C3HH 1C0AA 4JI6L 2AWNA 4Y7NH 3NEMA 1HZCA 4JYAL 4BBRG 3CXCA 5LMNW 3ULPA 4A3EH 4UY8C 1QVFA 2JEAI 3NENA 4DAYB 1Q82C 1UWVA 3PF4A 1M90C 1HH2P 3KLWA 4AYBE 4IOAA 3KF6A 1VQ6A 4A3DH 1GD7A 1JT8A 4NXNL 4DV5Q 2Z6KC 1X3GA 1HJPA 4GN4B 1V9PA 2CKZB 4POFA 4OWWB 2JA8H 5LMNQ 3CPFA 3S24A 1Q8KA 5GAGC 5EAYA 2VW9A 3H3VI 2VS1A 4DV7L 1N9WA 1JJ2A 2VL6A 4DV4Q 3A5ZB 2LXJA 4BXXG 3AYHB 4H02A 3STBC 4OX9Q 2OTJA 4TQUS 4DPGA 3T1YL 2IY5B 2RHSB 4LF7Q 1L1OC 3J80i 3CCSA 2RCNA 1YI2A 5LMUQ 4DK6C 4DR4L 3HKSA 1CSQA 1MJCA 3OYYA 4X64Q 3HKZE 1TWAH 1EUJA 4A3IG 2XGTA 4A3MG 1Q46A 1K9MC 1VQLA 4A3GH 3K8AA 3LGJA 3H0GH 5ELNA 1N33L 1HZAA 3E9IA 2K75A 3KYHC 4MZ9A 5BR8Q 3PF5A 1YVCA 1KC8C 1EIYB 4B3RQ 3GO5A 4JCVE 4QL5A 3TRZA 4DR6L 4DUZQ 4DR3L 5IE8A 2HQLA 1FJGL 3KF8B 1CKNB 1Y1VG 5C0XJ 4BBSH 4LWCA 4O0AA 4KHPL 1NMFA 1PH7A 3HOWH 4GKJQ 3TQYA 4NXML 4JI8Q 2VZAA 3G4SA 4HIKA 2JK8A 4UP8A 5M3FG 3GTPH 3FHWA 2LXKA 5M5YH 2VQFQ 1W2BA 3A74A 1U0LA 3I55A 3J7A5 4AH6A 2UXDQ 1NY4A 5C4XG 3DM3A 4YWMA 1XJVA 2JA6G 1E22A 3RNUA 1PH3A 1CKOA 1YJWA 3CP0A 3GDEA 3U4VA 3J80c 1I6HH 1D7QA 1C9OA 4HIDA 4HJAA 3HOYG 1VQ9A 1A62A 2E5LL 1X54A 5IY0A 4PG3A 2MO0A 3CAMA 1VQNA 4LW1A 1VQ8A 1EWIA 3ICEA 4IO9A 1PFSA 1W3SA 1N34L 4DV2Q 2IHFA 2UXCL 1N36Q 4FDBA 1IYJB 5IT9c 4GNXB 4BBRH 1D8LA 4GLAC 4LF5Q 3AFPA 3M7NA 1A63A 4A76A 1VQCA 3JAMi 4DV1Q 3S16H 1EQRA 3KDFB 4A3LG 2HIVA 2UXBL 4GOPA 2ES2A 1IBLQ 1IXRA 2UU9Q 4LF9L 1XPOA 1E7ZA 4DR5L 3CCRA 4A3CG 3GTQH 1L0WA 3AQQA 4LFBL 2OQ0A 1X3EA 4A3JH 5JJKA 4BY1G 2A1AA 1TWHH 5GQOA 4JI0L 4BXXH 4R4OA 1NE3A 4JBWA 1SROA 4DV6L 4IOCA 1KAWA 3PGZA 2UUAL 2OWOA 4A4IA 1LM0A 1OXXK 4EX5A 1M1KC 4A3IH 1QUQB 3UDFA 4A3MH 2E2JH 2RHQB 4IPGA 2Q2UA 4DR7L 4JI7L 4ME3A 1XNQQ 1GO3E 1OTCA 2N3SA 4JI5Q 3ER0A 4A75A 3W1BA 2N78A 4GLXA 1GM5A 1LUZA 3PO3H 4Y52H 1NTGA 3JAMc 2VQEQ 1YJ9A 2KCMA 1Y1VH 3FKIG 4UPAA 1BBUA 4YCUA 3EN2A 4JI4Q 2Y0SE 1SFOH 1Z47A 1P16A 4X62Q 4DR2Q 1H95A 3K0XA 3M4PA 4B3TL 4AYBG 4YHHL 1VQEA 2K50A 1CKNA 4HJ7A 3I2ZA 1V43A 3UDXA 4L5SA 4OO1I 3GTKH 5DLQE 4R1JA 1G6PA 5C4XH 3KJOA 2NZHA 3RLOA 2IX0A 1S40A 2JA6H 3PUYA 4IFDI 4DV0L 4JI6Q 1EQQA 2BA0A 1PH4A 4JI3L 5AJ3L 4AQYL 4GOPC 1VQPA 1L2FA 2YV5A 2ZJQA 1XMOL 4MNOA 4A3KG 4LFCQ 5M3MH 3HOYH 5IWAQ 3AEVA 2GVBA 4DAMA 4LF4L 5FJ8G 3HKZG 3TS2A 4WJ3M 4HJ5A 1VQJA 1N32Q 4K0KL 2R7ZG 4GKKL 2AKWB 2MFIA 2F4VL 3T1HQ 1RL2A 4X66L 4LF6L 3M4QA 1QZHA 1SR3A 4B3SL 2WAQE 2NVYH 1KHIA 4ALPA 5FLMG 3S17H 2EQSA 1U5KA 4DR1L 4A3LH 1BKBA 1VQHA 4R4IA 1Y1WH 2R92G 3HOVG 3S15H 2FXQA 1HNXQ 4GNXA 4P73A 4A3BG 3MEFA 4GN3B 3NELA 2HIXA 4UP9A 4QIWE 2DGYA 1NJIC 1J6QA 4L5QA 4DR4Q 4QJFA 1Q12A 3KDFA 3J7ZC 1V1QA 1VQDA 3RLNA 2PI2A 1XNRQ 3S1NH 3PUWA 2HHHQ 3KOJA 3J81c 1E24A 2JE6I 4JBKA 2IHEA 3PCOB 1HR0Q 4BY1H 1GKHA 3H3VH 2NN6G 4JI2L 1X9NA 2ZTCA 3CCQA 3RN2A 4DR3Q 2D62A 2F3IA 4DUYL 3PUZA 5E7NA 4DKAC 1TWCH 3F8TA 3L2PA 1K8GA 1HNWL 1X56A 3S1MH 5IYBH 2KBNA 1EYGA 4P74A 5C3EH 2JA5G 1OXTA 4IJHA 2R7DA 2JA9A 1UEBA 4A3FG 3ULJA 3CCUA 1HNZQ 4DV5L 4NXMQ 1SMXA 3I4NG 1VQ5A 4APVA 2VUMG 4BY7G 2R93G 3PSIA 5LMNL 1KQSA 3I4OA 5GADC 1E1TA 3G48A 4YWLA 3HOXH 3GTOH 3F2CA 2CFMA 2R7FA 4DV4L 1IL2A 1WCMG 1QVCA 4X65Q 3M85A 1FL0A 4GLVB 4LF7L 4B3MQ 1SE8A 1VQ7A 3D31A 1FGUA 1I50H 1WOCA 4PZ8A 5LMUL 4X64L 1YIJA 1TWFH 3GTGH 5K36G 3K81C 2R93H 5C44G 2N8NA 1MIUA 3U4ZA 1K73C 2E5LQ 1IBML 1TXYA 1YEZA 4OO1G 4LF8Q 1LYLA 4DV3Q 1X65A 4C3IH 4B3RL 4OWTB 3U58A 4AIMA 2JA7H 4OONA 1K0RA 4LFAQ 5IP9G 3J81j 4GN5A 1I5FA 1RIPA 2E8GA 1YHQA 5HGQA 1PA6A 4PZ6A 4GNXC 4JBMA 1P8LA 3PO2G 5M5XH 3F1ZA 4A3KH 5IP7G 1JJGA 2ID0A 3K7UC 4GKJL 3BZCA 4HIOA 4XIGS 4JI8L 3E9HA 3GD7A 2JEBI 5FJ8H 4L5RC 4J15A 5ELOA 3M4OH 3CCLA 2R7ZH 4JV5Q 2PNHA 2QA4A 2UUCQ 2UXDL 2I5MX 2WB1E 3S14H 2YTXA 3W1GA 5C0XI 3KJPA 2JJQA 1QVGA 2N49A 1YBYA 5IYDG 1PV4A 4KI0A 1PH5A 1IBKQ 4WJ4A 3HOZG 1PH8A 1K83H 3UE1A 3HOVH 2ZJPA 1KRTA 4A3EG 1BBWA 3S2DH 2Y0SG 4A3BH 2EIFA 2AWOA 1VS0A 2B3GA 4R4QA 3UE0A 1J5EL 3I4NH 5JJLA 4NB3A 1VQOA 2QGQA 2BH8A 2GVAA 4YY3Q 2ZM6Q 1K8AC 4A93G 2CQOA 2VY3A 1NMGA 4DR7Q 1Z9FA 4DV2L 1VQFA 1PVOA 1OXUA 3RN5A 1XMQQ 4LF5L 2D0OA 2NZOA 3PUXA 1T9HA 3CMAA 4DV1L 3G71A 3L0OA 2UUBQ 2KCTA 1E1OA 1IBLL 2UU9L 2JA5H 4R4TA 3CC2A 4A3FH 4JC0A 4BY7H 2F52A 2L15A 3ULLA 2VUMH 4B3TQ 3CC4A 3GTMH 4JI1Q 1TWGH 3OTOQ 1KRSA 3H0GG 1KXLA 2IT1A 1CSPA 2ALYB 2WAQG 1SRUA 1WCMH 5IYCG 5M3FH 1YZ6A 4JBJA 1PYSB 3BJUA 4UP7A 1B70B 3H15A 3J81i 1KL9A 4YWKA 1DGSA 1UE1A 3ZJYC 4LF4Q 1YNXA 4GS3A 4JYAQ 1O7IA 1XNQL 3PV0A 4JOIA 4GKKQ 4YCWA 4JI5L 1PYBA 4LUOA 1JE5A 1MJEA 1WYDA 2Z0SA 1E3PA 4YCVA 4B3SQ 1VQ4A 2ZTEA 5GROA 4NXNQ 3CC7A 1Y14B 4X6AH 5IP7H 4JI4L 4O2DA 3CPWA 4X62L 1Q1BA 1HZ9A 2BA1A 4IPDA 4NPSA 1VQKA 3E0EA 2WP8J 3PUVA 4DV7Q 3B6YA 1SLJA 2K5HA 3MXNB 5JEAG 1PH2A 4LUZA 1HR0W 2ZJRA 3T1YQ 3I4MG 2LSSA 3WWVA 2K5VA 2WFWA 3FP9A 2D0PA 3F2DA 5C0XG 4PZ7A 4A3CH 3EIVA 4TVAB 3RLFA 3NBHB 4JI2Q 4OWXB 4DNIA 2V1CC 2R6GA 4GOPB 1I94L 1JMCA 2IX1A 3GTLH 3HOZH 4BA2I 5GAHC 4LFCL 4DUYQ 1N33Q 2ASBA 5IWAL 1XPUA 4QY7A 2CWPA 5JJIA 4QGUA 4DR6Q 1PHJA 1N32L 2DUDA 4A93H 3RR5A 1IZ6A 2YTYA 1FJGQ 5GAEC 3ERSX 2YYZA 4HIMA 3T1HL 3S2HH 3F2BA 4JG2A 1UE7A 5J3BA 5HY6A 4KHPQ 4BA1I 1XPRA 4A3JG 3S1RH 3G6EA 2KENA 1OXSC 2MNAA 3STBD 3CQZH 1FVIA 2YU9H 1QUQA 2Q2TA 2K52A 1G291 1HNXL 2Q2HA 3A0JA 4JOIC 3I56A 4OX9L 3TEHB 3FKIH 2K5NA 1XNRL 1WJJA 2B29A 2HHHL 1L1OB 4RMFA 1YJNA 1IBMQ 2C35B 2B63G 1HR0L 4LUVA 4EQ5A 5C4JH 2WB1G 1VCIA 5JEAJ 5IYCH 4MTNA 4R4CA 3PO3G 3CD6A 5BR8L 1Q1EA 1EOVA 4KHZA 4HJ8A 1PH6A 3DLLA 1YHBA 1X6OA 4HJ9A 3PIOA 2E2IH 4DUZL 1N34Q 2CWAA 1C7YA 4IFDG 2UXCQ 3IRBA 5H1SE 1HNZL 2AMCB 2BH2A 4OXPA 1YITA 3M9BA 5FLXc 3BU2A 2PQAB 3TREA 3CCVA 3K80C 2ZTDA 2UXBQ 3CMEA 1EIFA 1VQAA 4LF9Q 1B8AA 4DR5Q 4X65L 3CCMA 3VDYA 3HOUG 1UE6A 2KHJA 2VQFL 1UE5A 3RZOH 2AHOB 4B3ML 2OTLA 1A0IA 2YTVA 4P71A 1MKHA 4POGA 4LFBQ 1A8VA 5FLMH 5M3MG 1EFWA 1ASZA 1CUKA 3Q8DA 4QQBX 4JI0Q 2PMZE 3KF6B 1HZBA 3BZKA 4P72A 1J5EQ 4DV3L 2I0QA 4LF8L 2A8VA 2R92H 3I7FA 4DV6Q 2UUAQ 1R9TH 3I4MH 1S3OA 1Q86C 4LFAL 3CCEA 2EXDA 3L7ZC 1GVPA 1VQMA 4P75A 1BVSA 4A3DG 5IYDH 2VNUD 3TS0A 3PIPA 4JI7Q 2JA8G 1Q81C 1N36L 1WFQA 2KHIA 1OXVA 1JB7A 1Y1WG 2K14A 1XTDA 2MQHA 2CCZA 4JV5L 3CF5A 3JC66 4KLKA 2UUCL 4IFDJ 2HT1A 1YHAA 4L5TA 1PH1A 3HOWG 2NN6I 2PI2E 4YHHQ 4IPHA
chains in the Genus database with same CATH superfamily
4RWSC 1SNCA 2QF7A 4CDDC 3ZYYX 3EPIA 1VQIA 2W6ZA 3P7JA 2ZXOA 1M0WA 1KD1C 2B2UC 4UCUA 2F0MA 3KHHA 3EJIA 4JI3Q 4AQYQ 1EUDB 4BBSG 1K3RA 3KLSA 2R7KA 4BY1B 1PH9A 3UDGA 1XMQL 2ZXPA 1LTLA 2IPKD 1KIXA 3U50C 3GTQA 3GV3A 1EQVA 2F0EA 1TWCB 2I5HA 1N8RC 4YJ3F 4K0KQ 3TZUA 2HCCA 3P20A 1LT4D 1PFMA 2I8CA 4LF6Q 2CQYA 2EY6A 4XX0B 5IP9H 1CKMA 4ZKBB 4GZYC 3P1HA 5M5WH 3HOXB 4MA0A 1AN8A 3GIDA 2I5LX 1O80A 3GTJH 4DR2L 2OQKA 3CCJA 3T13A 4C3IG 1O78A 2JQOA 4IJLA 3FRPB 5LXTF 4MTEA 4PMWA 2MO1A 2HVQA 2A68D 2NVXH 5DLGA 1G91A 2BQUA 1CQVA 1HNWQ 3GTGB 2DLNA 4C3JH 2B2VA 3K59A 4P2CB 4JI6L 5JVLA 1HZCA 4CC5A 1VBGA 4A3EH 4LFCH 3NENA 1L2ZA 2QCPX 4DAYB 2JA7B 1M6VA 2W9AA 1RHPA 3VPCA 4IRCA 1HH2P 4AYBE 4FP5D 4DV5Q 4POFA 4JV2A 1HJPA 4A3KB 3PIP3 2A73B 1ENCA 3M4OB 3H3VI 2OT2A 1N9WA 4BS9A 1FNWA 2LXJA 4RFBA 4TQUS 2OTJA 1RYSA 4LF7Q 1WVLA 1YI2A 2RCNA 4IZOA 4X64Q 1MJCA 3HOWH 4A3MG 1DOMA 2FJ2A 3H0GH 1N33L 3C1FA 4KN4C 2K75A 5DG9A 4MZ9A 1EIYB 5FLXE 3N52A 2C22A 4JCVE 1RJPA 4DUZQ 4DR3L 5IE8A 5KYIA 1NCVA 2HQLA 1HA5A 5C5LA 1DIKA 2B2YA 1D1IA 5C0XJ 3D6CA 3DWPA 4KHPL 1NMFA 1PH7A 1IW7C 1HNZH 3G4SA 1WTWA 1ZYRC 2JK8A 1ZHSA 4M7EA 4YB8B 3AB9A 1ZXTA 2HCIA 1E4EA 3NWTA 1CI3M 2F0KA 1ULZA 4AH6A 3LNNA 2RGRA 4OEMB 4TSSA 5C4XG 3U9SA 1RDPD 4YWMA 4MAMA 3NWSA 3GTMB 1PH3A 2EY1A 3RUPA 3CP0A 4B3MH 3J80c 2XNAC 1D7QA 1XYIA 4HIDA 5M3FB 2FPGB 4I4TF 1X54A 5IYZF 2E5LH 1RJQA 3MFIA 2F0FA 3CAMA 2NUCA 3ICEA 5IT9W 1N34L 4ED1A 2IHFA 1VDZA 2UXCL 2VXWA 1IYJB 1U4PA 2IBKA 1KDAA 4UCOA 2Q8IB 4DV1Q 1EQRA 1AUVA 2HIVA 2B39A 2UU9Q 1KTKA 2JXMB 1XPOA 4DR5L 5JUMA 1RJTA 4H7BA 4A3CG 2EYLA 3I90A 3AQQA 3HGBA 1GUTA 2AQ3B 4A3JH 2EYJA 3HEJA 4Q8FA 4R9WA 4FNFA 1IBKH 4BXXH 2FFKB 3T56B 1QJOA 4IOCA 1EIGA 2OWOA 3JAME 2HVSA 1LM0A 1OXXK 4EX5A 1M1KC 3T5HA 1QUQB 5ELFA 3UDFA 2M05A 2ZM6H 4IPGA 5HURA 3V6KA 2Y0SB 1D2BA 1SJHD 3JAMW 2QK4A 4JI5Q 2NU9B 3OSPA 3W1BA 5C5MA 5CBAE 2R61A 5KFCA 4A93B 2W71A 1F2MA 4EVOA 1NTGA 2W9CA 1N48A 2KCMA 2C5CA 3FKIG 1BBUA 5C5JA 4YCUA 4ED7A 1Z47A 1P16A 2NUAB 3H4BA 3KUPA 3K0XA 1JDEA 2JEIA 4JI1H 1T3NA 2Z4HA 3BG3A 3GTKH 4R1JA 2R7LA 1LTRD 5CV9A 1Q3LA 2NZHA 3KJOA 1LTBD 3KAKA 4H44C 1QWYA 3T53B 2B2TA 1PH4A 4JI3L 4AQYL 1L2FA 5C4JB 1SE2A 4MNOA 4LFCQ 3N44B 5M3MH 5EOYA 4ED6A 2LFNA 2VUMA 4LF4H 5FJ8G 3TS2A 2OF1A 4K0KL 3IKJA 2KA7A 2AKWB 3PW5A 4GKKH 1RL2A 4LF6L 4QMGA 1KBLA 3GTKA 2P0AA 5KFXA 3WNZA 4ECQA 4B3SH 4FM9A 4RB3C 1KHIA 5D3IB 4ALPA 4APMA 3I3CA 1G6ZA 1WSCA 3VYSA 2UVWA 1BKBA 1VQHA 3HOVG 2PN1A 3PW7A 4ETSA 2FXQA 1X3QA 4P73A 3RZOB 4PQXA 1O7YA 2HIXA 1H9RA 2DGYA 1IL8A 3OUZA 3S1NH 1HNWL 2XIWA 2PI2A 2ENBA 3T1YH 1NUCA 1E24A 3J81c 2Q8TA 4MV7A 4C5AA 2NBFA 1JR0D 4K8IA 5KNBA 4JI2L 3SDZA 2XGPA 3EVQA 4Q45A 5L1KA 3QOLA 1I7LA 4K5VA 1R9TB 2J6UA 4RB0A 1SYFA 1F2LA 1N56A 1JORA 4TQRA 1X56A 2KBNA 3SK4A 5C3EH 3GTLH 2AGOA 1UEBA 1HNZQ 4DV5L 1SMXA 1C4QA 1VQ5A 4APVA 1B9NA 2VUMG 1JDBB 3R23A 3PSIA 1RK6A 4EEQA 3I4OA 5HV6A 3H4DA 5GADC 1E1TA 3SK5A 2MP1A 4L6TB 2V4DA 4RNMA 1M8AA 4ZHQF 5IOCA 2NU7B 2OH2A 4GLVB 4LF7L 4B3MQ 2AGQA 3D31A 1SNPA 1WOCA 4X64L 1Z2PX 1TWFH 3KALA 2YZNA 2R93H 5C44G 2E5LQ 4HR7A 4ZI7F 1YEZA 2FMMA 2DIKA 1LYLA 4ILWA 4O4LF 3CQZA 3VYUA 3RIZA 4Y8VB 2R8IA 4MN3A 3PO2G 4JBMA 4GNXC 2R6FA 2WB1B 3G8CA 2MHVA 1E2VA 2R7ZH 1TWFA 1KEEA 2PNHA 4AYBA 4J9PA 1AFPA 4GC6A 3PW2A 2UXBH 1IYVA 4XT3B 5KFNA 1V1OA 2YTXA 3KAJA 4LF9H 2R8JA 5M5WB 2N49A 1QVGA 1UEAB 3GTJB 1IBKQ 1PH5A 5ELEA 1KDBA 2Z4IA 4J9QA 1B1ZA 5KT7A 5C3WA 1XX8A 3MXUA 2NVXB 4JI0H 4R4QA 2F0NA 4NB3A 2QGQA 2ZM6Q 4YR2A 2O5IC 4C3JB 4YJ2F 3K5IA 3L4JA 4DV6H 2R7ZA 1EY6A 1OXUA 3RN5A 4X3UA 2N88A 1MSGA 1GYFA 4A3EB 4MV4A 1T9HA 4HCSA 2FK2A 3CMAA 5EZYF 4DV1L 1U4RA 1RF2D 3T5JA 2XSCA 2KCTA 1E1OA 2UU9L 4A3FH 4JC0A 4BY7H 1KJJA 2L15A 4IAJA 4FS1A 5CB4F 3OHBA 5TSSA 4JI1Q 3E5SA 1KRSA 4EGJA 1CSPA 4F4XA 3OWFA 5GONF 1B53A 5IYCG 1FYCA 3BJUA 4ECTA 4UP7A 1HXYD 4HN7A 3Q23A 3J81i 3HOWB 4ZQIA 1KAAA 1LLRD 2WKCA 4LF4Q 3H0GB 4GS3A 3PV0A 4J9NA 4JOIA 1QILA 4GKKQ 4DXGA 4YCWA 2FP4B 3R5XA 4JI5L 2R87A 2LS01 1PYBA 5A2QE 1Z6HA 4ZCKA 4B3SQ 2ZTEA 2F1MA 1SE3A 3CC7A 2JP1A 2CH4W 1EHIA 1STGA 5A2QW 3CPWA 1IOWA 1VQKA 3MR3A 5LA6F 3P75A 1SYDA 4J0MA 5FD6A 3E0EA 4G57A 4LK1C 4DA2A 3UQ8A 3GV5B 2B63A 4UHVA 4DR1H 5JEAG 3BYYB 3G6XA 2ZJRA 3T1YQ 4R8NA 3TP5A 1KABA 3WWVA 3FP9A 2D0PA 3F2DA 5FKAC 2I07B 1JX4A 5C0XG 5IYDH 1QE6A 3Q1KA 1TY0A 1EEFD 2X0SA 3HOZH 4I55F 3BAAA 3H91A 4ECRA 5EBDA 4LFCL 1I3QA 5KT4A 4JUZA 5H80A 5KT5A 2PZWA 4FF4A 4YR0A 3RR5A 3GIJA 4B9XA 3S2HH 5KT6A 3ERSX 2YYZA 5C4HA 1GJXA 1PMRA 2A6ED 5LP6F 4G7ZC 1UE7A 3V4SA 1K8MA 2XIGA 1F77A 1OXSC 3H09A 1ZKOA 1JWUD 5DM73 1BCPC 1FVIA 5JPMC 5LMNH 5DGAA 3H94A 2AQ1B 2YU9H 1MHWC 1ESFA 3I56A 4EG0A 2W6QA 2DPJA 1T5EA 2FMAA 4XQQA 1YJNA 4A3JB 2B63G 4YIJA 4LUVA 4RHSA 2BQRA 1LT3D 1S4ZA 2PPBC 3MXGA 4IUTA 1PRTB 4R4CA 1WD1A 1Z2NX 5BMVF 5BR8L 5EWGA 4KD3A 3DLLA 4IN3A 4F88A 4HMJA 3PIOA 1RD9D 4FS2A 5KFYA 3V6HA 1CQFA 2CWAA 1HNZL 3J7AV 4CDFC 1E4GT 5L1JA 3PW4A 2PCFB 1YITA 5CR3A 3M9BA 3IL8A 1TWAA 2PQAB 3TREA 2UXBQ 3K80C 2B2UA 1ZHQA 4RA8A 4JI8H 2RSNA 4LF9Q 2PMZB 1KC7A 1FR3A 1O7ZA 3GQBA 1ZQ7A 3IN5A 4ECUA 1UE5A 3K0YA 2VQFH 4B3ML 5L1LA 5CGKA 3RAXA 3TQ1A 4I7HA 3Q8DA 2WACA 4QQBX 5CV5A 4JI0Q 2K28A 2A74C 3GTKB 1CK1A 2R92H 4C1NK 4P72A 3N6RA 3N41B 4DV6Q 1S3OA 1GVPA 1BVSA 2R8KA 3QO2A 2JA8G 3RD4A 3N42B 5M3MB 3DEPA 1WFQA 1OXVA 2MUYA 1N36H 2K1BA 5T14A 3NBHA 2CCZA 1F2ZA 3FDTA 1CZWA 1DXMA 3OIPA 3VR4A 2HT1A 1YHAA 2K05A 4L5TA 4U68A 1GXDC 1PH1A 2XWJB 1QCBD 3I4NH 5KFHA 2ASDA 2ASLA 2JEJA 1IBKL 2XTIA 2TMPA 4XTCS 4A3GG 3BA9A 2NVTH 2Q2IA 5KYLA 1WI5A 3OSOA 4F4WA 1X3FA 2E2HH 5IYBG 4UCVA 4OIJA 1HFGA 3SGIA 5L37A 2ZM6L 3S1NB 5DLFA 4LMYA 4YP3A 2FE3A 3OOCA 5F9LA 3ORRA 1M7JA 4IRKA 4TQSA 3SK8A 3HOXG 3QG1A 5K36H 4IURA 2H5XA 3QOJA 3RZDH 1YNND 4OO1H 3GV6A 3E3XA 5C3EB 2A19A 3GTLB 3PIO3 4IFDH 4J9MA 3K7AH 2OEOA 2VQEH 2E2HA 4JI1L 2OCEA 3NBIA 2NVQH 3AFQA 4DR1Q 4HMIA 1NBWA 4J1MA 3CW2C 3D0FA 2JA7G 3HOUH 2PBZA 5KFEA 3A5UA 1TWFB 1DOKA 2HDLA 4IPCA 4C3HH 1I4RA 2QEXA 3TZDA 2R93B 1V1PB 3WO0A 3CXCA 2YCHA 2PW7A 3EFXD 3ULPA 5KG6A 4UY8C 2BR0A 5JPNC 1F9QA 3KXYT 2CW8A 1Q82C 4PMBA 4IOAA 3KF6A 1N32H 4U673 1L0XB 3RUZA 1X3GA 3HP3A 2NWGA 4OWWB 4HQ6A 2JA6A 2RSOA 3K5LA 5LMNQ 2X69A 1BNCA 3CPFA 5DQHA 1BXRA 2VL6A 2JYOA 3V4ZA 3AYHB 5DQGA 3T1YL 2RHSB 1S5BD 2K01A 1L1OC 3CCSA 5DQIA 1HNXH 4DK6C 4DR4L 3HKSA 1CSQA 4A3IG 2YW2A 4DN4M 2QKIC 4RKLA 1K9MC 3MVVA 1PRTD 3RB0A 1HZAA 1GOZA 2KCCA 1PZID 3KYHC 3PF5A 3J81L 1FD7D 2F0QA 1Y1WA 2VUGA 3KF8B 5EDWA 5KFUA 2D2CC 1PXUA 4Q44A 4BBSH 4IRDA 5KFOA 4LWCA 3PN1A 2QEJC 2CH4A 4PNYA 3NTHA 4JI8Q 4NXMH 2F0LA 2IJ0A 4J9SA 3SEBA 5M3FG 2V58A 4KD4A 5M5YH 3K5NA 2VQFQ 2YZMA 2KSWA 3I55A 2C28A 1I4PA 1M4VA 3J80W 4BY7B 3FVQA 1HUMA 2JA6G 4X3KA 3RNUA 2EZVA 1B6RA 2J0TD 3IAYA 4ZUIA 2XWBB 2W8KA 2K5QA 1JKJB 4DK0A 3CVZA 4HJAA 4M1UB 2E76C 1A62A 4IZ8A 2W6OA 1CTMA 3TIGA 1VQNA 4L1KA 2IL8A 4IO9A 4ECXA 4E4TA 1FNVA 1ET6A 1SNQA 1N36Q 5KG5A 4EYHB 4LFAH 2RDIA 2CW0D 3BDCA 1D8LA 4GLAC 3M7NA 3AFPA 1I50A 3HOYB 3PQIA 5IGEA 2ICEC 1JOKA 4A3LG 2CQAA 4CDEC 2UXBL 2FLLA 3KDFB 3N40P 1K8OA 5FLXL 2ES2A 4LF9L 1JOOA 4HNUA 1VKZA 3D4WA 5LL6X 3NTKA 3ETJA 2F0SA 3GTQH 1XDNA 3TINA 5BPHA 1X3EA 5E3FA 2B2WC 5JJKA 1IYUA 5GQOA 4JI0L 1XXGA 2XD4A 2C2DA 1NE3A 1SAPA 5DG8A 1SROA 4DV6L 2AU0A 1KAWA 3CU7A 1D1KA 2UUAH 4HTHA 4A4IA 1J8IA 4A3MH 2EE1A 5DAUA 3HOZB 4DR7L 3RTXA 1Q8IA 1GO3E 1OTCA 4KJNA 1HA6A 2N3SA 1PTOF 1LUZA 5JAVA 1K83A 1A2TA 1MSHA 3S2HB 4JV0A 1KNAA 2J4XA 2VQEQ 4YQWA 4UPAA 5IGGA 4XDXA 3KHLA 1IHZA 3EN2A 1H95A 1SFOH 1S5CD 4FF1A 1LTGD 1EYDA 4B3TH 1CKNA 2YU9B 3UDXA 4L5SA 4OO1I 5C4XH 2VQDA 4DGZA 4RUCA 2A6HC 3RLOA 1AW7A 3T4AC 4IFDI 1EQQA 4LAAA 4DAVA 1E0BA 3GIMA 3D4DA 4GOPC 5D1OA 3VPDA 2EXZA 1CFMA 3AEVA 2GVBA 2N55A 4FXGC 4DAMA 3JRXA 1CZGA 1BJTA 1I6UA 1SFOA 4WJ3M 4HJ5A 1VQJA 1N32Q 1S0OA 4F4ZA 5KFIA 4JV1A 1WCMA 1GHJA 3M4QA 1WR2A 5AFWA 1HCZA 1Y8PB 1O7LA 1M0TA 1AN7A 5FLMG 4A2AA 3S17H 4ABNA 2EQSA 4DL6A 1U5KA 4DR1L 4RCOA 5DEHA 2I80A 3S15H 1CQIB 3A8JE 3HKZB 5DM63 3QZ7A 4A3BG 1HNXQ 4GNXA 3MEFA 4UP9A 2EJMA 3OMGA 1MZBA 5KFBA 1NJIC 2R7NA 3RLNA 1VQDA 4O2BF 3VMMA 3S14B 4Q43A 3KOJA 4B9WA 3L4KA 2R3ZA 4JBKA 1GKHA 5T1IA 1EY5A 2R92B 2F3IA 5E7NA 4EBCA 4DUYH 1HRJA 3RV3A 4UFZA 5LHY1 3GILA 3GIIA 3S1MH 4ID6A 4KN7C 4P74A 2XN9C 1C8CA 1BDOA 2R7DA 2BCOA 3CCUA 4NXMQ 1AZQA 2EDGA 2W9BA 1NR2A 5LMNL 1KQSA 4ECVA 1A15A 3G48A 4HSVA 2YRXA 3F2CA 2CFMA 4QUFA 5FD5A 1WCMG 1QVCA 4IWXA 3AU7A 1U4MA 5E4XA 3VYTA 4HNVA 2DN8A 2JA5B 2H4OA 1VQ7A 5KFSA 1QOHA 4PZ8A 2I46A 3I4NB 3QJYA 1JC7A 3O13A 1JWSD 4DL4A 2R8GA 4ME6A 2NVTB 4KHVA 1IBML 4DXFA 5IT9E 3Q8RB 4NKLA 2MCTA 4LSXA 2Z1CA 2E2HB 4OWTB 1H9SA 2LY7A 4K14A 4AIMA 4OONA 1SDFA 4LFAQ 5IP9G 3J81j 1I5FA 2E8GA 3I91A 4ECWA 1YNJD 4PZ6A 1P8LA 1E2WA 3DMUA 5M5XH 3F1ZA 1BCPF 3HZXA 4IUNA 5IP7G 2ID0A 1JJGA 3FKIA 3BZCA 4HIOA 4JI8L 3GD7A 2JEBI 5FJ8H 1S97A 3RZDB 4J15A 2F4IA 2O2LD 3CCLA 3UFXB 3I8ZA 3R3OA 1HPCA 2WAQA 2I5MX 1PRTF 3K7AB 4C3JG 2NVQB 2G5DA 2M00A 2IWHA 1BF4A 3RF2A 2JEFA 1YBYA 3V05A 2AQ2B 4K6DA 2O4XA 3UE1A 3HOVH 2ZJPA 1VAJA 4A3EG 4QIWA 5J2TF 1EZ1A 1GSAA 5L1IA 1KJIA 1D5XC 2ALZA 1MI2A 2EIFA 3HOUB 3TP7A 1CA6A 2M2LA 1J5EL 1W93A 1I6VC 4KY6A 2NU6B 2FPPB 2VY3A 5LL6b 4C3HB 4RNOA 3JSNA 1VQFA 3G6JB 3H3VC 1PVOA 5JVH3 1EY4A 5CORA 5F9NA 3PUXA 2NZOA 3K6OA 1UC8A 1ZEQX 1SMYD 2QDLA 3L0OA 4EFEA 3LWBA 1CHPD 3HS0C 1R4QB 1B6SA 1EYZA 3GLKA 3MFGA 2VUMH 2BDOA 2K03A 4B3TQ 3CC4A 4RGNA 4MV1A 1TWGH 2UVRA 3H0GG 1KXLA 3OHXC 2IT1A 2ALYB 5CV4A 2WAQG 5EGTA 1SRUA 4YHHH 2XRSD 5FO8B 1JB3A 1B4OA 1NR4A 2K32A 1B70B 1IKLA 2HD3A 3MJFA 3NE5B 4WJWA 4DV0H 1DGSA 3SXHA 5C6AA 4I7ZC 1TS5A 4YR3A 1HQRD 2M9VA 5BN3A 1JE5A 1MJEA 1TWGA 5G3LD 4J9OA 1E3PA 1SXTA 3Q2OA 4BBSB 3BZDB 4X6AH 4X66H 4O2DA 2PNRC 1HZ9A 3R2IA 4IPDA 3MXPA 2R7MA 3QZ8A 2WKDA 3PUVA 5M5YB 3MXNB 2F0DA 2DNEA 4EGQA 1WTRA 1PH2A 4LUZA 1HR0W 3C46A 2F0PA 3I4MG 3A7LA 2WFWA 4FYDA 1ILQA 4O4IF 5I2YA 2NYZD 4K5WA 4DFAA 4F50A 4DNIA 2V1CC 2NZ1D 5J22A 1JMCA 4BA2I 1I94H 5GAHC 4DUYQ 1EEID 2ASBA 2R8HA 3CKIB 4QY7A 3U9OA 5JJIA 2BQ3A 3WOFA 1S5ED 5C4ZA 1N32L 4CKBA 1S9FA 1IZ6A 3KLSX 3DWQA 3F2BA 1Z7TA 2V59A 4JG2A 1B9MA 1LABA 5J3BA 4BA1I 4A3JG 4C2MA 3S1RH 3G6EA 2KENA 2EYOA 5CV8A 2MNAA 3CQZH 5KFZA 2QILA 2O03A 4O3OA 5FPRA 2BDNA 1HNXL 4QWDA 5LYJF 1F9PA 4DV4H 3NUCA 4MTKA 1A3UA 3TEHB 2K5NA 3GTQB 4OX9H 5CMDA 4KJOA 1MBYA 1WJJA 4V0BA 1K1SA 3T5LA 2IMWP 3DUZA 2C35B 3LP8A 3ITPA 1KNEA 4EQ5A 4FVMA 1VCIA 5IYCH 3BQ2A 2EPBA 4UDUC 3C0FB 2X6GA 2E75C 4EQNA 4ECZA 3CD6A 5T1GA 4JVZA 4KHZA 1PH6A 1YHBA 4HJ9A 4B3RH 4DUZL 4A3MB 5FPOA 1IW7D 1BOSA 4OIKA 5H1SE 1ZYRD 5FLXc 2FK1A 1E4FT 4EBEA 4RU9A 4CJ0B 3VDYA 1UE6A 2AHOB 1SFOB 4P71A 1PTOC 4LFBQ 3R93A 5M3MG 1K28A 1QB5D 1HZBA 1I4GA 5JEAH 2I0QA 5KG0A 5C4XB 5D1PA 3GTPA 3K58A 4LFAL 3C3LA 3L7ZC 4IALA 4A3DG 2Q8RE 4G3IA 5EPJA 3TS0A 4ED2A 1Q81C 2K5WA 1RJRA 3RB3A 3E5NA 2KHIA 4DV2H 4CKCA 5LL6S 3EYYA 3CF5A 4XZ3B 2CZGA 5JVDF 5KT2A 4IFDJ 4OELB 1LT5D 1GGOA 1ICWA 3E6ZX 3S17B 1GUWA 3EPGA 4YHHQ 2MJ8A 2VA3A 4ZRZA 3A8KE 2GLTA 4LNQA 3X3MA 4UCRA 4NMZA 1AE3A 1QNUA 5CV7A 3OW2A 3TSSA 3M9OB 2G9HD 4DNRB 5C3EG 4DV0Q 3J7YW 4K6LA 1QZGA 1A6XA 2DWCA 1AE2A 2B63H 5KNCA 1E4EB 5KFQA 5I47A 3MA2B 1ASYA 1L1OA 4OL7A 3TQTA 1SEBD 1FNUA 4RB2C 1RTOA 1XNQH 1JJCB 3S1MB 4RG1A 1PX2A 3EBEA 4X66Q 2F3VA 5JJZA 1EWHA 2ATLA 2RF4A 4N9PA 2E2DC 1I3QH 2K4KA 2R93G 3S1QH 3K5MA 4JI4H 1VQBA 1G51A 4X62H 4DR2H 3NPPA 1S0MA 4GC7A 3V96A 1D6EC 1X55A 3MR5A 1AH9A 4G7OC 5CC4A 3TP8A 5KGUA 1DZ1A 1VQGA 1S72A 1I94Q 3BA8A 4EYIB 3KFUA 3Q24A 1C0AA 4JI6H 4L8JA 1K0SA 4Y7NH 3NEMA 5D3DA 4MV6A 4MV9A 4R8UA 4BBRG 1PFBA 1TQOA 5KFVA 1QVFA 2JEAI 1BQQT 3BQ0A 1V51A 1UAPA 5IWAH 3IG0A 3PF4A 1M90C 3KLWA 1DOLA 1VQ6A 1EZ8A 4NP5A 2Z6KC 5M5XB 3VR5A 2JA8H 1V9PA 2CKZB 3T1HH 5F2DA 1S5FD 1B3QA 1H9MA 5KG1A 1Q8KA 5GAGC 5I6YA 3ORQA 2RA4A 1JJ2A 4DV4Q 4DK1A 3D6WA 3STBC 2LMCB 4OX9Q 5KFTA 4RGMA 2IY5B 4RB1A 2VR1A 5CYUA 1EY8A 4FXDA 5I9OA 3DWAA 1BBXC 4Q8EA 1TWAH 1EUJA 1Q46A 2QW7A 2Z6BA 4A3GH 3K8AA 4Q5VA 5G3LF 3HOVB 1RK5A 3RFCA 3I72A 1PRTC 5ELNA 2W9CB 4DL7A 1HR0H 2EY2A 1KC8C 4B3RQ 1TT2A 4QL5A 2J9GA 3TRZA 4C5BA 4DR3H 2Z8LA 2B2WA 4TRDA 1Y1VG 4R7RA 2PVPA 1ENAA 1STHA 3MR2A 4LMQD 5KFLA 2PO4A 5KT3A 4HIKA 4UP8A 3UI2A 3A74A 1U0LA 1SEIA 3J7A5 1CM9A 1NY4A 2FINB 1TWCA 1NNXA 1XJVA 2VUMB 1A9XA 4X65H 5D14A 1L0YB 1TWGB 1CKOA 1KLUD 1YJWA 3KK7A 4DL3A 1H9KA 3G6YA 3HOYG 1VQ9A 2E5LL 5IY0A 4PG3A 1S03G 4O3RA 4H13C 1TR5A 1VQ8A 1EWIA 3N6XA 4DV3H 4UCTA 4DV2Q 1PFNA 4ZYSA 2WDTA 3DM1A 2CW0C 1I4HA 3GTGA 2XCLA 4A76A 3JAMi 3S9WA 2GPSA 4CJ1B 1LTSD 4MV3A 4F4YA 5ELBA 3ND9A 3D3RA 1MGSA 4GOPA 1IKMA 2KHSA 1SBBB 5LOVF 3V6JA 2C2RA 1FGBD 2A5HA 4RAUC 2IX3A 3GV7B 4DAYA 4RZQA 4MTDA 2UUCH 4LFBH 2JA7A 1L0WA 4KY7A 4LFBL 3QIAA 4KK7A 4BY1G 1Y69U 3LMLA 1XTCD 5KRUA 2KCNA 3TMEA 2RCFA 1GSOA 5FO9B 5EWEA 3LX0A 3PGZA 4N8X1 3GQCA 1BXTA 4A3IH 3VPBA 3LWUA 4YY3H 2RHQB 2Q2UA 2KQ3A 4ME3A 1XNQQ 3KBGA 5K2MA 3N8DA 1GM5A 3PO3H 2W6NA 3GIQA 4S3SA 2KUMA 3MWMA 1YJ9A 4HR7B 2UUBH 1BR9A 1WD0A 4JI4Q 1DD2A 4X62Q 4DR2Q 1S68A 3M4PA 3S1RB 4YHHL 2V4QA 2K50A 3CQZB 5KKNB 3OTOH 1EU3A 5HGTA 4HNTA 5KFFA 5CBEE 1U4LA 2FB9A 2ZDGA 1DJRD 2IX0A 2JA6H 5J39A 1QNKA 3FMCA 4DV0L 4JI6Q 2IP4A 2A68C 1B44D 4K2LA 1VQPA 2YV5A 3DF7A 2ZJQA 4AYBB 4A3KG 5IWAQ 2A69D 4LF4L 3GTMA 4PV1C 3HKZG 1RYRA 4JYAH 1X3PA 4GKKL 1D5MC 2CVRA 3T1HQ 5IIFA 4X66L 3NXWA 3CRKC 3R5FA 1QZHA 4B3SL 5JH7F 4IQZA 2WAQE 2NVYH 4NXNH 2PW5A 4A3LH 3WDNA 2R92G 1Y1WH 3HG9A 2ZXRA 2R7ZB 5BN5A 4DV7H 4QIWE 2QYZA 1J6QA 4QJFA 3J7ZC 2BE5D 1V1QA 4Z9CB 5I4DA 3PUWA 3VA7A 4LJZC 4CC6A 3TBIB 1CS0A 2IHEA 3PCOB 1HR0Q 4FF3A 1HUNA 5KFRA 3H3VH 2NN6G 1ILPA 3OW7A 2KECA 3CCQA 2KVMA 4DR3Q 2D62A 3RN2A 2NVYA 4ULLA 2DJGC 3PUZA 4DKAC 3F8TA 3T16A 1K8GA 1T36A 4TUYF 3RAQA 1B2TA 5C3XA 4CHTB 1EYGA 1PK8A 2JA5G 4DR6H 4IJHA 3ULJA 1FJGH 3I4NG 2YRWA 1W6KA 1LTAD 3W2DA 4OHJA 4YWLA 2R82A 3J80E 3GTOH 2V4RA 2R7FA 3RBDA 3M4YA 4DV4L 4QCLA 4FBTA 2VPQA 4HCEA 4X65Q 2VOBA 3HXLA 1VF5C 1UNSA 3HB9A 3RV4A 3A55A 4A3FB 1FGUA 1I50H 2RGVA 4DAPA 1TVXA 2VB3X 3K81C 2EYPA 5K36G 1K73C 1MIUA 1VMPA 1ML0D 4O1NA 5KFGA 1TU2B 4OO1G 4DV3Q 1X65A 4C3IH 4B3RL 2DPIA 2YS7A 1OWTA 3K57A 4G7HC 3U58A 2JSOA 1OO9B 4GN5A 3GTOA 5KFMA 1PA6A 5HGQA 2B63B 1WTXA 1PLFA 1V4YA 2PZTA 5IGBA 1YNJC 5KG3A 2KJXA 3K7UC 2WV6D 2NB0A 3E9HA 4RCNA 3NGDA 1STYA 1ESRA 3Q22A 5ELDA 2CW7A 1Z2OX 1ET9A 2UUCQ 1TIID 1I3QB 2EJGC 5NUCA 2AGPA 4I50F 3KJPA 1JXLA 5COYA 3S1QB 4XYMB 1PV4A 4WJ4A 1RTNA 1WH2A 3S2DH 1K83H 1KRTA 2Y0SG 4A3BH 5EKIA 1VS0A 2RDFA 3UE0A 5JJLA 1VQOA 1K8AC 1EYCA 2BH8A 2GVAA 4YY3Q 4A93G 1NMGA 1Z9FA 4DV2L 4QW8A 4Y7NB 4FBUA 5EWFA 2EY5A 3TP6A 5KNDA 2D0OA 1PYWD 3I73A 3T5KA 4JI7H 2RDGA 4DNTB 5IT9L 2EYHA 2L11A 3BYTB 2UUBQ 3PR4A 3M9NB 2XVSA 4R4TA 2SNSA 3CC2A 3SK6A 2F52A 3ULLA 2JA8B 1R9TA 3ONAB 3OTOQ 1JWMD 3EA6A 3L3OC 1WCMH 2SOBA 1YZ6A 3KHRA 2MGSA 4O42A 4JBJA 1PYSB 1AEXA 3DEOA 4ODGA 1TWAB 4YWKA 5IGCA 1EL0A 5IGDA 4A3GB 5I6WA 3ZJYC 3V2TA 3NTIA 3KHGA 3BQ1A 4JYAQ 1O7IA 1XNQL 1HQMC 1XMOH 2ICIA 3NK9A 4LUOA 4JI5H 4Q0FA 4IR1A 3PW0A 4YCVA 2ZDHA 1EWCA 2DJFC 1VQ4A 3U9TA 4NXNQ 2F4VH 4IHJF 1I7NA 4BWSC 5IP7H 4JI4L 3JAML 4X62L 2BA1A 1PTOH 3J81E 2UVUA 2WP8J 4DV7Q 3FPPA 1LO5D 1KDCA 2H1EA 3B6YA 4C56C 5A35A 1BGWA 2K5HA 1B3AA 2WB1A 5EPKA 5ELCA 1F2YA 2LSSA 3J81W 4ME5A 2TSSA 4PZ7A 2EYMA 3EIVA 4TVAB 3RLFA 3NBHB 4JI2Q 4GOPB 2IX1A 4A3CH 2R6GA 4ED8A 5IWAL 1TS3A 4KTAA 4J6HA 3GTJA 4DR6Q 1PHJA 1SYXB 2DUDA 4QUCA 3CHBD 4QWAA 1GHKA 1FJGQ 5GAEC 3T1HL 1Y8OB 5KFWA 4XXEA 5KIXA 2NVXA 4YBZB 2F0OA 4KV6A 4IR9A 5FO7B 2Q2TA 2K52A 3VR2A 3H6MA 3BS1A 4O4HF 2C9OA 1V8QA 3FKIH 1I4XA 1MD2D 2B29A 4N9TA 2HGSA 2KOLA 5LMUH 1HR0L 2F0IA 2WB1G 5JEAJ 3I4LA 1EY0A 4MTNA 4KKSA 1STNA 2L55A 1Q1EA 3G6VA 4B08A 5BR8H 1SSOA 1IOVA 2E2IH 4A3IB 2EVBA 5FLXW 4DF7A 5D8DA 3IRBA 4JI2H 2AMCB 2BH2A 4OXPA 2PQEA 2L5TA 1TS4A 3Q0AA 2ZTDA 4GKJH 2B8FA 3CMEA 3PO3B 3H0GA 1EIFA 1B50A 4EQPA 4LSAA 4X65L 3CCMA 1S10A 2VQFL 3MR6A 2OTLA 4HYKA 2UXDH 3WO1A 3SHLA 1SCUB 1A8VA 4NW2A 1TKWB 2K33A 4U7CA 1ASZA 2E2IA 2IW3A 5HBRB 2SDFA 5IGFA 1BNZA 1E2ZA 3KF6B 1SYEA 3BZKA 4DV3L 1TY2A 5C1OA 3I4MH 2UUAQ 2JA6B 5DGBA 4KY5A 1Q86C 3CCEA 4P75A 4ED3A 4FU0A 1AUXA 5JOBA 4N8FA 4JI7Q 1JE4A 4WFN3 2J6TA 1N36L 3GIPA 3MFHA 3VR3A 1EU4A 1XTDA 3MHBA 1S0NA 4LF5H 4WD3A 3JC66 4J8QA 1FKAH 2UUCL 3ND8A 1VBHA 4V190 2NVYB 1A3TA 1IBLH 3GIKA 3HOWG 4MHEA 4BWGB 4IPHA 2V9WA 1EUCB 1WTPA 2YL2A 1Y1WB 2RDJA 3K3VA 3HFZB 2NU8B 4J9LA 1EZ6A 4IUQA 2Z6KA 4CKEA 5JQWA 3H20A 2GN5A 4YY3L 2VB2X 3MWYW 5AJ3Q 2KEDA 3A54A 4CBVA 4DK3C 3SE7A 1W6JA 1LTTD 1GUOA 1XMOQ 5C44H 2F0WA 1C48A 5KG4A 2C2EA 4UCSA 2UUBL 2F4VQ 5E1FA 2V5AA 3RBEA 1SE4A 4FXKC 2VQEL 3PO2H 1SN8A 3OSNA 3OTOL 1JOQA 3M3YH 3GTOB 3I12A 1B7YB 1Q7YC 2YYAA 2A6HD 4RUAA 3SI8A 2ATWA 2PQAA 2PZUA 3W5OA 3KTMA 1I50B 4C2MH 1II3A 3UDIA 5CA0F 1A2UA 3BDLA 5JVG3 3J7AF 3EQLC 2PMZA 1KJ8A 3TN2A 2AWNA 4QF4A 3K3PA 4JYAL 3C1EA 2WTFA 4A2BA 5LMNW 4C3IB 4YAJB 3A56A 5KFDA 1SNOA 4NLGA 1EY7A 1UWVA 3R8BA 4A3DH 1GD7A 1JT8A 4NXNL 4ZK9B 1EIHA 2UVVA 2WIIB 4GN4B 4WRDA 4FF2A 1CA5A 2A6EC 3S24A 4O3QA 3CRLC 5EAYA 4X3TA 2VW9A 2VS1A 4DV7L 3A5ZB 5J2UF 4BXXG 5KG7A 3DHQA 4H02A 3G7LA 4JK1C 5KX5F 4DPGA 5A2QL 4ED0A 3NQTA 3J80i 5LMUQ 1ONLA 3OYYA 3HKZE 4K8JA 1VQLA 4DR4H 2XGTA 1LV9A 3S2DB 1K83B 3OIQA 1XNRH 3LGJA 2HHHH 4A3BB 1F9SA 3E9IA 4HSPA 5BR8Q 4RHRA 2W7OA 1YVCA 1SYGA 5CV6A 1WTOA 3GO5A 5IODA 4DR6L 1JIHA 4QWCA 1PDQA 1FJGL 2FLPA 1LT6D 1CKNB 2F0VA 2G9DA 4O0AA 3IFTA 3W3AA 4GKJQ 3TQYA 1HHVA 2SEBD 4NXML 1WTHA 2VZAA 2HVRA 3URYA 2B2VC 3GTPH 1GUNA 3FHWA 2LXKA 1W2BA 5DG7A 1JQYD 2UXDQ 1GLVA 5D1OB 2FLNA 4DL5A 3DM3A 3N43B 1E22A 2WYOA 2F0UA 3GDEA 3U4VA 3GTLA 3F8NA 1I6HH 1C9OA 4UAIA 3MC0B 4KKUA 1WCMB 2HJWA 1DV2A 3OMCA 2J6SA 2MO0A 3VA5A 1DM0B 4LW1A 4HAEA 4LF8H 3J7AK 1PFSA 2F03A 1GSHA 2BOSA 1W3SA 4M9UA 2K7VA 4LH6A 5C0XH 4FDBA 3QR8A 5IT9c 4GNXB 4BBRH 4LF5Q 5DNFA 1A63A 3BVMA 1VQCA 3S16H 2R93A 1CQJB 1V1PA 2HDMA 2W70A 4X3SA 1IBLQ 1IXRA 4JV5H 4EEYA 1E7ZA 4M8AA 5FK9C 1GUSA 3CCRA 4DU9A 1ZETA 1PTOB 2DNCA 2OQ0A 1BUVT 4OGQC 3MWEA 2W6PA 3OPOA 2B2YC 3M7GA 2W8LA 2A1AA 1TWHH 1Y8NB 3S15B 1ICFB 4R4OA 4JBWA 4DL2A 2LKVA 2UUAL 2W9BB 4ZLTF 3NP8A 4H0LC 2O5JC 1CHQD 3ERQA 2E2JH 3F2UA 1RKNA 4JI7L 4DR7H 2GA4B 4F87A 4IWYA 2ZT9C 4QWBA 4K5XA 3ER0A 1VMCA 4A75A 4GLXA 2N78A 5EKKA 4F7XA 5K5PA 1XMQH 4RGTA 4Y52H 5KFAA 2XCPA 3JAMc 2ASJA 1YNNC 2I87A 4ZOLF 1Y1VH 1TWHA 3OUUA 5D65A 2Y0SE 3MWDA 3KF8A 4AYBG 4B3TL 1H9SB 1VQEA 4J9RA 4HJ7A 1O75A 3I2ZA 1W96A 1V43A 2L1BA 4XYLB 2XGQA 5DLQE 1LTID 1G6PA 2L12A 2EYFA 3JRWA 3FKIB 1S40A 1B04A 3PUYA 2L9HA 2R84A 2BA0A 3HBLA 5I2XA 5AJ3L 4CDCC 5L9XA 5KEEA 4WBNF 1XMOL 2WAQB 1DV1A 3HOYH 4XQNA 1X32A 1Y1VA 2Z9HA 2A69C 1S5DD 2KEEA 3VYRA 2R7ZG 2MFIA 2F4VL 2E2IB 3FMAA 1VF7A 4Q0YA 1SR3A 4QIWB 1PZKD 1G2SA 1SNMA 3PVXA 2EJFC 3I70A 1HTLD 3EROA 4R4IA 1DYQA 4J9KA 4GN3B 3NELA 2K04A 4DR4Q 1B33N 3QFFA 5J1ZA 4L5QA 3GV8B 1Q12A 3KDFA 3FEWX 3H40A 1STEA 1XNRQ 2BE5C 2HHHQ 3IFDA 2JE6I 4C5CA 2HQEA 3MEHA 4BY1H 3M9MB 2FK3A 1X9NA 2ZTCA 3MZ5A 4MV8A 4PDBA 3MFYA 2K6AA 5EPLA 1R4PB 4DUYL 3L2PA 1TWCH 3I4MB 4RAZA 1N33H 3NSWA 4NDXA 2YZGA 3K5OA 5IYBH 1OXTA 3OWEB 2JA9A 4A3FG 4BY7G 4LH7A 2XCAA 3PMFA 3HOXH 4KHPH 2B2TC 2DY8A 4R8IA 1GUGA 1KJ9A 1HTPA 3LWEA 1IL2A 1BCPB 1UC9A 2OLSA 1I4QA 3M85A 1FL0A 4PMCA 1SE8A 1EOTA 3BDOA 5LMUL 3L9AX 1YIJA 3GTGH 4I7AA 2XC9A 2R85A 2N8NA 1ENFA 3U4ZA 3K5HA 1TXYA 5EJWA 2D9UA 1IBMH 2WINB 2P5ZX 4LF8Q 1LACA 3AMUA 2JA7H 1H9JA 1K0RA 4G4KA 4PWQA 2YU9A 4QW9A 1RIPA 1YHQA 4A3KH 3WOEA 5E4WC 4IUUA 5C44B 4GKJL 2FKLA 3JZIA 4WORA 4XIGS 1N34H 1Q90A 2C00A 2X6LA 2UXCH 4L5RC 3M4OH 5ELOA 4JV5Q 4TKOB 1EQTA 3VR6A 1PZJD 2QA4A 2GPWA 2UXDL 1PTOD 3D8GA 3R2TA 1NSNS 2FJZA 2YS6A 2WB1E 3S14H 3PO2B 3W1GA 4DR5H 5C0XI 2JJQA 4QWEA 2SCUB 3M3YB 5IYDG 2W6MA 2W7PA 4KI0A 1SYCA 3HOZG 1PH8A 3RB4A 4MA5A 1BBWA 3Q8QB 3KLRA 4MIUA 3J80L 1EYAA 2AWOA 2B3GA 4O3NA 1J5EH 4ZUJA 1TA8A 3RB6A 4C2MB 3HKZA 3DXJC 2CQOA 4DR7Q 4RKBA 2JEGA 5BN4A 1NAPA 2F0TA 3QB3A 5FOBB 3BVZA 1XMQQ 2NN6H 1D5ZC 4K2KA 4LF5L 2F0JA 1BO0A 4RGOS 1XWEA 1T94A 3BJYA 2VA2A 3ETHA 3G71A 2EOTA 2J7ZA 1IBLL 2JA5H 1TS2A 4A3DB 1AP0A 2R92A 2L0CA 1JCKB 2F0GA 1KJQA 3GTMH 4O3PA 4EQOA 5ISRA 2RVLA 2E74C 4CJ2C 2DY7A 2FHTA 2K5DA 5M3FH 1UUPA 2IA6A 1U9RA 1G2TA 3PR5B 3H15A 4TV8F 3Q8PB 1KL9A 5KG2A 1UE1A 2RBMA 2JA5A 1YNXA 5I9PA 4AQYH 4JI3H 4DLKA 3T51B 3JSLA 5KFJA 4E6IA 4XYOA 1WYDA 2Z0SA 4ZAIA 4RAYA 1JICA 4K0KH 5GROA 3KBXA 1Y14B 3RGZA 3RJ0A 4YAKB 4LF6H 4JPBW 4KKTA 1Q1BA 1G8ZD 4NPSA 2D5DA 3Q6SA 3TDQA 2QDBA 5M9OA 1HFNA 3GTPB 2RQXA 3E0JA 4RH6A 1SLJA 1CE8A 2R86A 4FO2A 4F8MA 4XQJA 2K5VA 3MTSA 2RKSA 3TIIA 1I94L 2W57A 4OWXB 2FPIB 1I6HB 1HNWH 4RZRA 1N33Q 1XPUA 4XYQA 4IUPA 2CWPA 2SNMA 4QGUA 4A93H 4ECYA 2YTYA 4EBDA 1J9OA 4HIMA 4IUVA 3BG5A 2NTTA 3HRZC 5HY6A 4KHPQ 1WTVA 1QG7A 4BBRB 1XPRA 3A7AB 1DCZA 2F0HA 4DV5H 1TAEA 3RMHA 1BCPD 1EY9A 3X3NA 3STBD 3S16B 3MAQA 1JLLB 4C1NI 1QUQA 1SJED 4HEDA 1G291 3R5HA 5CA1F 3A8IE 4ECSA 4JW0A 2Q2HA 2JN4A 2PYKA 3A0JA 2CHBD 4QB4A 4JOIC 1C30A 2ZJTA 2Y0SA 4I65A 4OX9L 3NHHA 1AZPA 1RCVD 1XNRL 3NQIA 5CAEB 2HHHL 1K1QA 1L1OB 1KLGD 4RMFA 4LF7H 1IBMQ 4L63B 5C4JH 4X64H 1TWHB 2XRQD 5EBCA 4EGVA 1SNDA 4XT1B 3PO3G 3FPUB 4O2AF 1EOVA 2VPSA 4HJ8A 2NTSA 1X6OA 1DONA 1N34Q 4DUZH 2DZDA 1C7YA 4IFDG 2UXCQ 2E2JB 1C3OA 1RODA 3QWNA 1EFID 2AUJD 3BU2A 3BVGA 3CCVA 1STBA 2RDHA 1VQAA 5EKLA 1B8AA 4DR5Q 1CT1D 1Y1VB 3RZOH 3HOUG 3Q8SB 2KHJA 3OHAA 1STAA 1UNNC 3C2PA 3BABA 4R8UB 1A0IA 1F9RA 2YTVA 1MKHA 4CGYB 3SE0A 4POGA 4C3HG 3SR1A 5FLMH 5C8YF 1T5XD 1EFWA 1CUKA 1WTQA 3PZPA 5BPFA 4KMUC 2MPMA 4EFBA 2PMZE 4RNNA 1J5EQ 5KFPA 4LF8L 2WE6A 4O3SA 2A8VA 3GP7A 3SVMA 3FDSA 3I7FA 1R9TH 1SYBA 5KFKA 2OXPA 2EXDA 2F3WA 1VQMA 3MXNA 2AQ4A 3M4IA 2VNUD 1K3BC 4ZQ3A 3PIPA 2HUGA 3D4RA 1A3VA 1JB7A 2FMCA 3RGXA 1Y1WG 2K14A 5EQ0A 4TV9F 2MQHA 4JV5L 4U6PA 4KLKA 2ZDQA 4DV1H 4ZKCB 2AUKA 2L4NA 1SMYC 2UU9H 5C1PA 2NN6I 2PI2E 2B8GA
chains in the Genus database with same CATH topology
1IBKL 2XTIA 4XTCS 4A3GG 2NVTH 2Q2IA 3HFZB 1WI5A 4LNQA 1VQIA 1AE3A 2Z6KA 1X3FA 3OW2A 1KD1C 2E2HH 5IYBG 3SGIA 5C3EG 4DV0Q 2GN5A 4YY3L 2ZM6L 1QZGA 5AJ3Q 4JI3Q 4AQYQ 4DK3C 1AE2A 2B63H 4BBSG 1K3RA 1XMOQ 1PH9A 3UDGA 3HOXG 1XMQL 1LTLA 5C44H 1KIXA 3U50C 1ASYA 2I5HA 1L1OA 1N8RC 2H5XA 3RZDH 4K0KQ 1JJCB 2UUBL 4RG1A 2F4VQ 3EBEA 4X66Q 2A19A 4LF6Q 5IP9H 2RF4A 3K7AH 1I3QH 2VQEL 3PO2H 2K4KA 1CKMA 1SN8A 2OCEA 4JI1L 5M5WH 3OTOL 3AFQA 4DR1Q 2NVQH 3M3YH 3S1QH 2I5LX 3GTJH 4DR2L 1VQBA 1G51A 1NBWA 2OQKA 3CCJA 1B7YB 1Q7YC 3CW2C 2JQOA 4IJLA 3D0FA 1X55A 4PMWA 2JA7G 3HOUH 1AH9A 2MO1A 2ATWA 2NVXH 2PQAA 1VQGA 3W5OA 1S72A 1I94Q 1HNWQ 4C2MH 3UDIA 3A5UA 4C3JH 2QEXA 3KFUA 4IPCA 4C3HH 1C0AA 4JI6L 2AWNA 4Y7NH 3NEMA 1HZCA 4JYAL 4BBRG 3CXCA 5LMNW 3ULPA 4A3EH 4UY8C 1QVFA 2JEAI 3NENA 4DAYB 1Q82C 1UWVA 3PF4A 1M90C 1HH2P 3KLWA 4AYBE 4IOAA 3KF6A 1VQ6A 4A3DH 1GD7A 1JT8A 4NXNL 4DV5Q 2Z6KC 1X3GA 1HJPA 4GN4B 1V9PA 2CKZB 4POFA 4OWWB 2JA8H 5LMNQ 3CPFA 3S24A 1Q8KA 5GAGC 5EAYA 2VW9A 3H3VI 2VS1A 4DV7L 1N9WA 1JJ2A 2VL6A 4DV4Q 3A5ZB 2LXJA 4BXXG 3AYHB 4H02A 3STBC 4OX9Q 2OTJA 4TQUS 4DPGA 3T1YL 2IY5B 2RHSB 4LF7Q 1L1OC 3J80i 3CCSA 2RCNA 1YI2A 5LMUQ 4DK6C 4DR4L 3HKSA 1CSQA 1MJCA 3OYYA 4X64Q 3HKZE 1TWAH 1EUJA 4A3IG 2XGTA 4A3MG 1Q46A 1K9MC 1VQLA 4A3GH 3K8AA 3LGJA 3H0GH 5ELNA 1N33L 1HZAA 3E9IA 2K75A 3KYHC 4MZ9A 5BR8Q 3PF5A 1YVCA 1KC8C 1EIYB 4B3RQ 3GO5A 4JCVE 4QL5A 3TRZA 4DR6L 4DUZQ 4DR3L 5IE8A 2HQLA 1FJGL 3KF8B 1CKNB 1Y1VG 5C0XJ 4BBSH 4LWCA 4O0AA 4KHPL 1NMFA 1PH7A 3HOWH 4GKJQ 3TQYA 4NXML 4JI8Q 2VZAA 3G4SA 4HIKA 2JK8A 4UP8A 5M3FG 3GTPH 3FHWA 2LXKA 5M5YH 2VQFQ 1W2BA 3A74A 1U0LA 3I55A 3J7A5 4AH6A 2UXDQ 1NY4A 5C4XG 3DM3A 4YWMA 1XJVA 2JA6G 1E22A 3RNUA 1PH3A 1CKOA 1YJWA 3CP0A 3GDEA 3U4VA 3J80c 1I6HH 1D7QA 1C9OA 4HIDA 4HJAA 3HOYG 1VQ9A 1A62A 2E5LL 1X54A 5IY0A 4PG3A 2MO0A 3CAMA 1VQNA 4LW1A 1VQ8A 1EWIA 3ICEA 4IO9A 1PFSA 1W3SA 1N34L 4DV2Q 2IHFA 2UXCL 1N36Q 4FDBA 1IYJB 5IT9c 4GNXB 4BBRH 1D8LA 4GLAC 4LF5Q 3AFPA 3M7NA 1A63A 4A76A 1VQCA 3JAMi 4DV1Q 3S16H 1EQRA 3KDFB 4A3LG 2HIVA 2UXBL 4GOPA 2ES2A 1IBLQ 1IXRA 2UU9Q 4LF9L 1XPOA 1E7ZA 4DR5L 3CCRA 4A3CG 3GTQH 1L0WA 3AQQA 4LFBL 2OQ0A 1X3EA 4A3JH 5JJKA 4BY1G 2A1AA 1TWHH 5GQOA 4JI0L 4BXXH 4R4OA 1NE3A 4JBWA 1SROA 4DV6L 4IOCA 1KAWA 3PGZA 2UUAL 2OWOA 4A4IA 1LM0A 1OXXK 4EX5A 1M1KC 4A3IH 1QUQB 3UDFA 4A3MH 2E2JH 2RHQB 4IPGA 2Q2UA 4DR7L 4JI7L 4ME3A 1XNQQ 1GO3E 1OTCA 2N3SA 4JI5Q 3ER0A 4A75A 3W1BA 2N78A 4GLXA 1GM5A 1LUZA 3PO3H 4Y52H 1NTGA 3JAMc 2VQEQ 1YJ9A 2KCMA 1Y1VH 3FKIG 4UPAA 1BBUA 4YCUA 3EN2A 4JI4Q 2Y0SE 1SFOH 1Z47A 1P16A 4X62Q 4DR2Q 1H95A 3K0XA 3M4PA 4B3TL 4AYBG 4YHHL 1VQEA 2K50A 1CKNA 4HJ7A 3I2ZA 1V43A 3UDXA 4L5SA 4OO1I 3GTKH 5DLQE 4R1JA 1G6PA 5C4XH 3KJOA 2NZHA 3RLOA 2IX0A 1S40A 2JA6H 3PUYA 4IFDI 4DV0L 4JI6Q 1EQQA 2BA0A 1PH4A 4JI3L 5AJ3L 4AQYL 4GOPC 1VQPA 1L2FA 2YV5A 2ZJQA 1XMOL 4MNOA 4A3KG 4LFCQ 5M3MH 3HOYH 5IWAQ 3AEVA 2GVBA 4DAMA 4LF4L 5FJ8G 3HKZG 3TS2A 4WJ3M 4HJ5A 1VQJA 1N32Q 4K0KL 2R7ZG 4GKKL 2AKWB 2MFIA 2F4VL 3T1HQ 1RL2A 4X66L 4LF6L 3M4QA 1QZHA 1SR3A 4B3SL 2WAQE 2NVYH 1KHIA 4ALPA 5FLMG 3S17H 2EQSA 1U5KA 4DR1L 4A3LH 1BKBA 1VQHA 4R4IA 1Y1WH 2R92G 3HOVG 3S15H 2FXQA 1HNXQ 4GNXA 4P73A 4A3BG 3MEFA 4GN3B 3NELA 2HIXA 4UP9A 4QIWE 2DGYA 1NJIC 1J6QA 4L5QA 4DR4Q 4QJFA 1Q12A 3KDFA 3J7ZC 1V1QA 1VQDA 3RLNA 2PI2A 1XNRQ 3S1NH 3PUWA 2HHHQ 3KOJA 3J81c 1E24A 2JE6I 4JBKA 2IHEA 3PCOB 1HR0Q 4BY1H 1GKHA 3H3VH 2NN6G 4JI2L 1X9NA 2ZTCA 3CCQA 3RN2A 4DR3Q 2D62A 2F3IA 4DUYL 3PUZA 5E7NA 4DKAC 1TWCH 3F8TA 3L2PA 1K8GA 1HNWL 1X56A 3S1MH 5IYBH 2KBNA 1EYGA 4P74A 5C3EH 2JA5G 1OXTA 4IJHA 2R7DA 2JA9A 1UEBA 4A3FG 3ULJA 3CCUA 1HNZQ 4DV5L 4NXMQ 1SMXA 3I4NG 1VQ5A 4APVA 2VUMG 4BY7G 2R93G 3PSIA 5LMNL 1KQSA 3I4OA 5GADC 1E1TA 3G48A 4YWLA 3HOXH 3GTOH 3F2CA 2CFMA 2R7FA 4DV4L 1IL2A 1WCMG 1QVCA 4X65Q 3M85A 1FL0A 4GLVB 4LF7L 4B3MQ 1SE8A 1VQ7A 3D31A 1FGUA 1I50H 1WOCA 4PZ8A 5LMUL 4X64L 1YIJA 1TWFH 3GTGH 5K36G 3K81C 2R93H 5C44G 2N8NA 1MIUA 3U4ZA 1K73C 2E5LQ 1IBML 1TXYA 1YEZA 4OO1G 4LF8Q 1LYLA 4DV3Q 1X65A 4C3IH 4B3RL 4OWTB 3U58A 4AIMA 2JA7H 4OONA 1K0RA 4LFAQ 5IP9G 3J81j 4GN5A 1I5FA 1RIPA 2E8GA 1YHQA 5HGQA 1PA6A 4PZ6A 4GNXC 4JBMA 1P8LA 3PO2G 5M5XH 3F1ZA 4A3KH 5IP7G 1JJGA 2ID0A 3K7UC 4GKJL 3BZCA 4HIOA 4XIGS 4JI8L 3E9HA 3GD7A 2JEBI 5FJ8H 4L5RC 4J15A 5ELOA 3M4OH 3CCLA 2R7ZH 4JV5Q 2PNHA 2QA4A 2UUCQ 2UXDL 2I5MX 2WB1E 3S14H 2YTXA 3W1GA 5C0XI 3KJPA 2JJQA 1QVGA 2N49A 1YBYA 5IYDG 1PV4A 4KI0A 1PH5A 1IBKQ 4WJ4A 3HOZG 1PH8A 1K83H 3UE1A 3HOVH 2ZJPA 1KRTA 4A3EG 1BBWA 3S2DH 2Y0SG 4A3BH 2EIFA 2AWOA 1VS0A 2B3GA 4R4QA 3UE0A 1J5EL 3I4NH 5JJLA 4NB3A 1VQOA 2QGQA 2BH8A 2GVAA 4YY3Q 2ZM6Q 1K8AC 4A93G 2CQOA 2VY3A 1NMGA 4DR7Q 1Z9FA 4DV2L 1VQFA 1PVOA 1OXUA 3RN5A 1XMQQ 4LF5L 2D0OA 2NZOA 3PUXA 1T9HA 3CMAA 4DV1L 3G71A 3L0OA 2UUBQ 2KCTA 1E1OA 1IBLL 2UU9L 2JA5H 4R4TA 3CC2A 4A3FH 4JC0A 4BY7H 2F52A 2L15A 3ULLA 2VUMH 4B3TQ 3CC4A 3GTMH 4JI1Q 1TWGH 3OTOQ 1KRSA 3H0GG 1KXLA 2IT1A 1CSPA 2ALYB 2WAQG 1SRUA 1WCMH 5IYCG 5M3FH 1YZ6A 4JBJA 1PYSB 3BJUA 4UP7A 1B70B 3H15A 3J81i 1KL9A 4YWKA 1DGSA 1UE1A 3ZJYC 4LF4Q 1YNXA 4GS3A 4JYAQ 1O7IA 1XNQL 3PV0A 4JOIA 4GKKQ 4YCWA 4JI5L 1PYBA 4LUOA 1JE5A 1MJEA 1WYDA 2Z0SA 1E3PA 4YCVA 4B3SQ 1VQ4A 2ZTEA 5GROA 4NXNQ 3CC7A 1Y14B 4X6AH 5IP7H 4JI4L 4O2DA 3CPWA 4X62L 1Q1BA 1HZ9A 2BA1A 4IPDA 4NPSA 1VQKA 3E0EA 2WP8J 3PUVA 4DV7Q 3B6YA 1SLJA 2K5HA 3MXNB 5JEAG 1PH2A 4LUZA 1HR0W 2ZJRA 3T1YQ 3I4MG 2LSSA 3WWVA 2K5VA 2WFWA 3FP9A 2D0PA 3F2DA 5C0XG 4PZ7A 4A3CH 3EIVA 4TVAB 3RLFA 3NBHB 4JI2Q 4OWXB 4DNIA 2V1CC 2R6GA 4GOPB 1I94L 1JMCA 2IX1A 3GTLH 3HOZH 4BA2I 5GAHC 4LFCL 4DUYQ 1N33Q 2ASBA 5IWAL 1XPUA 4QY7A 2CWPA 5JJIA 4QGUA 4DR6Q 1PHJA 1N32L 2DUDA 4A93H 3RR5A 1IZ6A 2YTYA 1FJGQ 5GAEC 3ERSX 2YYZA 4HIMA 3T1HL 3S2HH 3F2BA 4JG2A 1UE7A 5J3BA 5HY6A 4KHPQ 4BA1I 1XPRA 4A3JG 3S1RH 3G6EA 2KENA 1OXSC 2MNAA 3STBD 3CQZH 1FVIA 2YU9H 1QUQA 2Q2TA 2K52A 1G291 1HNXL 2Q2HA 3A0JA 4JOIC 3I56A 4OX9L 3TEHB 3FKIH 2K5NA 1XNRL 1WJJA 2B29A 2HHHL 1L1OB 4RMFA 1YJNA 1IBMQ 2C35B 2B63G 1HR0L 4LUVA 4EQ5A 5C4JH 2WB1G 1VCIA 5JEAJ 5IYCH 4MTNA 4R4CA 3PO3G 3CD6A 5BR8L 1Q1EA 1EOVA 4KHZA 4HJ8A 1PH6A 3DLLA 1YHBA 1X6OA 4HJ9A 3PIOA 2E2IH 4DUZL 1N34Q 2CWAA 1C7YA 4IFDG 2UXCQ 3IRBA 5H1SE 1HNZL 2AMCB 2BH2A 4OXPA 1YITA 3M9BA 5FLXc 3BU2A 2PQAB 3TREA 3CCVA 3K80C 2ZTDA 2UXBQ 3CMEA 1EIFA 1VQAA 4LF9Q 1B8AA 4DR5Q 4X65L 3CCMA 3VDYA 3HOUG 1UE6A 2KHJA 2VQFL 1UE5A 3RZOH 2AHOB 4B3ML 2OTLA 1A0IA 2YTVA 4P71A 1MKHA 4POGA 4LFBQ 1A8VA 5FLMH 5M3MG 1EFWA 1ASZA 1CUKA 3Q8DA 4QQBX 4JI0Q 2PMZE 3KF6B 1HZBA 3BZKA 4P72A 1J5EQ 4DV3L 2I0QA 4LF8L 2A8VA 2R92H 3I7FA 4DV6Q 2UUAQ 1R9TH 3I4MH 1S3OA 1Q86C 4LFAL 3CCEA 2EXDA 3L7ZC 1GVPA 1VQMA 4P75A 1BVSA 4A3DG 5IYDH 2VNUD 3TS0A 3PIPA 4JI7Q 2JA8G 1Q81C 1N36L 1WFQA 2KHIA 1OXVA 1JB7A 1Y1WG 2K14A 1XTDA 2MQHA 2CCZA 4JV5L 3CF5A 3JC66 4KLKA 2UUCL 4IFDJ 2HT1A 1YHAA 4L5TA 1PH1A 3HOWG 2NN6I 2PI2E 4YHHQ 4IPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBK L;  2XTI A;  4XTC S;  4A3G G;  2NVT H;  2Q2I A;  3HFZ B;  1WI5 A;  4LNQ A;  1VQI A;  1AE3 A;  2Z6K A;  1X3F A;  3OW2 A;  1KD1 C;  2E2H H;  5IYB G;  3SGI A;  5C3E G;  4DV0 Q;  2GN5 A;  4YY3 L;  2ZM6 L;  1QZG A;  5AJ3 Q;  4JI3 Q;  4AQY Q;  4DK3 C;  1AE2 A;  2B63 H;  4BBS G;  1K3R A;  1XMO Q;  1PH9 A;  3UDG A;  3HOX G;  1XMQ L;  1LTL A;  5C44 H;  1KIX A;  3U50 C;  1ASY A;  2I5H A;  1L1O A;  1N8R C;  2H5X A;  3RZD H;  4K0K Q;  1JJC B;  2UUB L;  4RG1 A;  2F4V Q;  3EBE A;  4X66 Q;  2A19 A;  4LF6 Q;  5IP9 H;  2RF4 A;  3K7A H;  1I3Q H;  2VQE L;  3PO2 H;  2K4K A;  1CKM A;  1SN8 A;  2OCE A;  4JI1 L;  5M5W H;  3OTO L;  3AFQ A;  4DR1 Q;  2NVQ H;  3M3Y H;  3S1Q H;  2I5L X;  3GTJ H;  4DR2 L;  1VQB A;  1G51 A;  1NBW A;  2OQK A;  3CCJ A;  1B7Y B;  1Q7Y C;  3CW2 C;  2JQO A;  4IJL A;  3D0F A;  1X55 A;  4PMW A;  2JA7 G;  3HOU H;  1AH9 A;  2MO1 A;  2ATW A;  2NVX H;  2PQA A;  1VQG A;  3W5O A;  1S72 A;  1I94 Q;  1HNW Q;  4C2M H;  3UDI A;  3A5U A;  4C3J H;  2QEX A;  3KFU A;  4IPC A;  4C3H H;  1C0A A;  4JI6 L;  2AWN A;  4Y7N H;  3NEM A;  1HZC A;  4JYA L;  4BBR G;  3CXC A;  5LMN W;  3ULP A;  4A3E H;  4UY8 C;  1QVF A;  2JEA I;  3NEN A;  4DAY B;  1Q82 C;  1UWV A;  3PF4 A;  1M90 C;  1HH2 P;  3KLW A;  4AYB E;  4IOA A;  3KF6 A;  1VQ6 A;  4A3D H;  1GD7 A;  1JT8 A;  4NXN L;  4DV5 Q;  2Z6K C;  1X3G A;  1HJP A;  4GN4 B;  1V9P A;  2CKZ B;  4POF A;  4OWW B;  2JA8 H;  5LMN Q;  3CPF A;  3S24 A;  1Q8K A;  5GAG C;  5EAY A;  2VW9 A;  3H3V I;  2VS1 A;  4DV7 L;  1N9W A;  1JJ2 A;  2VL6 A;  4DV4 Q;  3A5Z B;  2LXJ A;  4BXX G;  3AYH B;  4H02 A;  3STB C;  4OX9 Q;  2OTJ A;  4TQU S;  4DPG A;  3T1Y L;  2IY5 B;  2RHS B;  4LF7 Q;  1L1O C;  3J80 i;  3CCS A;  2RCN A;  1YI2 A;  5LMU Q;  4DK6 C;  4DR4 L;  3HKS A;  1CSQ A;  1MJC A;  3OYY A;  4X64 Q;  3HKZ E;  1TWA H;  1EUJ A;  4A3I G;  2XGT A;  4A3M G;  1Q46 A;  1K9M C;  1VQL A;  4A3G H;  3K8A A;  3LGJ A;  3H0G H;  5ELN A;  1N33 L;  1HZA A;  3E9I A;  2K75 A;  3KYH C;  4MZ9 A;  5BR8 Q;  3PF5 A;  1YVC A;  1KC8 C;  1EIY B;  4B3R Q;  3GO5 A;  4JCV E;  4QL5 A;  3TRZ A;  4DR6 L;  4DUZ Q;  4DR3 L;  5IE8 A;  2HQL A;  1FJG L;  3KF8 B;  1CKN B;  1Y1V G;  5C0X J;  4BBS H;  4LWC A;  4O0A A;  4KHP L;  1NMF A;  1PH7 A;  3HOW H;  4GKJ Q;  3TQY A;  4NXM L;  4JI8 Q;  2VZA A;  3G4S A;  4HIK A;  2JK8 A;  4UP8 A;  5M3F G;  3GTP H;  3FHW A;  2LXK A;  5M5Y H;  2VQF Q;  1W2B A;  3A74 A;  1U0L A;  3I55 A;  3J7A 5;  4AH6 A;  2UXD Q;  1NY4 A;  5C4X G;  3DM3 A;  4YWM A;  1XJV A;  2JA6 G;  1E22 A;  3RNU A;  1PH3 A;  1CKO A;  1YJW A;  3CP0 A;  3GDE A;  3U4V A;  3J80 c;  1I6H H;  1D7Q A;  1C9O A;  4HID A;  4HJA A;  3HOY G;  1VQ9 A;  1A62 A;  2E5L L;  1X54 A;  5IY0 A;  4PG3 A;  2MO0 A;  3CAM A;  1VQN A;  4LW1 A;  1VQ8 A;  1EWI A;  3ICE A;  4IO9 A;  1PFS A;  1W3S A;  1N34 L;  4DV2 Q;  2IHF A;  2UXC L;  1N36 Q;  4FDB A;  1IYJ B;  5IT9 c;  4GNX B;  4BBR H;  1D8L A;  4GLA C;  4LF5 Q;  3AFP A;  3M7N A;  1A63 A;  4A76 A;  1VQC A;  3JAM i;  4DV1 Q;  3S16 H;  1EQR A;  3KDF B;  4A3L G;  2HIV A;  2UXB L;  4GOP A;  2ES2 A;  1IBL Q;  1IXR A;  2UU9 Q;  4LF9 L;  1XPO A;  1E7Z A;  4DR5 L;  3CCR A;  4A3C G;  3GTQ H;  1L0W A;  3AQQ A;  4LFB L;  2OQ0 A;  1X3E A;  4A3J H;  5JJK A;  4BY1 G;  2A1A A;  1TWH H;  5GQO A;  4JI0 L;  4BXX H;  4R4O A;  1NE3 A;  4JBW A;  1SRO A;  4DV6 L;  4IOC A;  1KAW A;  3PGZ A;  2UUA L;  2OWO A;  4A4I A;  1LM0 A;  1OXX K;  4EX5 A;  1M1K C;  4A3I H;  1QUQ B;  3UDF A;  4A3M H;  2E2J H;  2RHQ B;  4IPG A;  2Q2U A;  4DR7 L;  4JI7 L;  4ME3 A;  1XNQ Q;  1GO3 E;  1OTC A;  2N3S A;  4JI5 Q;  3ER0 A;  4A75 A;  3W1B A;  2N78 A;  4GLX A;  1GM5 A;  1LUZ A;  3PO3 H;  4Y52 H;  1NTG A;  3JAM c;  2VQE Q;  1YJ9 A;  2KCM A;  1Y1V H;  3FKI G;  4UPA A;  1BBU A;  4YCU A;  3EN2 A;  4JI4 Q;  2Y0S E;  1SFO H;  1Z47 A;  1P16 A;  4X62 Q;  4DR2 Q;  1H95 A;  3K0X A;  3M4P A;  4B3T L;  4AYB G;  4YHH L;  1VQE A;  2K50 A;  1CKN A;  4HJ7 A;  3I2Z A;  1V43 A;  3UDX A;  4L5S A;  4OO1 I;  3GTK H;  5DLQ E;  4R1J A;  1G6P A;  5C4X H;  3KJO A;  2NZH A;  3RLO A;  2IX0 A;  1S40 A;  2JA6 H;  3PUY A;  4IFD I;  4DV0 L;  4JI6 Q;  1EQQ A;  2BA0 A;  1PH4 A;  4JI3 L;  5AJ3 L;  4AQY L;  4GOP C;  1VQP A;  1L2F A;  2YV5 A;  2ZJQ A;  1XMO L;  4MNO A;  4A3K G;  4LFC Q;  5M3M H;  3HOY H;  5IWA Q;  3AEV A;  2GVB A;  4DAM A;  4LF4 L;  5FJ8 G;  3HKZ G;  3TS2 A;  4WJ3 M;  4HJ5 A;  1VQJ A;  1N32 Q;  4K0K L;  2R7Z G;  4GKK L;  2AKW B;  2MFI A;  2F4V L;  3T1H Q;  1RL2 A;  4X66 L;  4LF6 L;  3M4Q A;  1QZH A;  1SR3 A;  4B3S L;  2WAQ E;  2NVY H;  1KHI A;  4ALP A;  5FLM G;  3S17 H;  2EQS A;  1U5K A;  4DR1 L;  4A3L H;  1BKB A;  1VQH A;  4R4I A;  1Y1W H;  2R92 G;  3HOV G;  3S15 H;  2FXQ A;  1HNX Q;  4GNX A;  4P73 A;  4A3B G;  3MEF A;  4GN3 B;  3NEL A;  2HIX A;  4UP9 A;  4QIW E;  2DGY A;  1NJI C;  1J6Q A;  4L5Q A;  4DR4 Q;  4QJF A;  1Q12 A;  3KDF A;  3J7Z C;  1V1Q A;  1VQD A;  3RLN A;  2PI2 A;  1XNR Q;  3S1N H;  3PUW A;  2HHH Q;  3KOJ A;  3J81 c;  1E24 A;  2JE6 I;  4JBK A;  2IHE A;  3PCO B;  1HR0 Q;  4BY1 H;  1GKH A;  3H3V H;  2NN6 G;  4JI2 L;  1X9N A;  2ZTC A;  3CCQ A;  3RN2 A;  4DR3 Q;  2D62 A;  2F3I A;  4DUY L;  3PUZ A;  5E7N A;  4DKA C;  1TWC H;  3F8T A;  3L2P A;  1K8G A;  1HNW L;  1X56 A;  3S1M H;  5IYB H;  2KBN A;  1EYG A;  4P74 A;  5C3E H;  2JA5 G;  1OXT A;  4IJH A;  2R7D A;  2JA9 A;  1UEB A;  4A3F G;  3ULJ A;  3CCU A;  1HNZ Q;  4DV5 L;  4NXM Q;  1SMX A;  3I4N G;  1VQ5 A;  4APV A;  2VUM G;  4BY7 G;  2R93 G;  3PSI A;  5LMN L;  1KQS A;  3I4O A;  5GAD C;  1E1T A;  3G48 A;  4YWL A;  3HOX H;  3GTO H;  3F2C A;  2CFM A;  2R7F A;  4DV4 L;  1IL2 A;  1WCM G;  1QVC A;  4X65 Q;  3M85 A;  1FL0 A;  4GLV B;  4LF7 L;  4B3M Q;  1SE8 A;  1VQ7 A;  3D31 A;  1FGU A;  1I50 H;  1WOC A;  4PZ8 A;  5LMU L;  4X64 L;  1YIJ A;  1TWF H;  3GTG H;  5K36 G;  3K81 C;  2R93 H;  5C44 G;  2N8N A;  1MIU A;  3U4Z A;  1K73 C;  2E5L Q;  1IBM L;  1TXY A;  1YEZ A;  4OO1 G;  4LF8 Q;  1LYL A;  4DV3 Q;  1X65 A;  4C3I H;  4B3R L;  4OWT B;  3U58 A;  4AIM A;  2JA7 H;  4OON A;  1K0R A;  4LFA Q;  5IP9 G;  3J81 j;  4GN5 A;  1I5F A;  1RIP A;  2E8G A;  1YHQ A;  5HGQ A;  1PA6 A;  4PZ6 A;  4GNX C;  4JBM A;  1P8L A;  3PO2 G;  5M5X H;  3F1Z A;  4A3K H;  5IP7 G;  1JJG A;  2ID0 A;  3K7U C;  4GKJ L;  3BZC A;  4HIO A;  4XIG S;  4JI8 L;  3E9H A;  3GD7 A;  2JEB I;  5FJ8 H;  4L5R C;  4J15 A;  5ELO A;  3M4O H;  3CCL A;  2R7Z H;  4JV5 Q;  2PNH A;  2QA4 A;  2UUC Q;  2UXD L;  2I5M X;  2WB1 E;  3S14 H;  2YTX A;  3W1G A;  5C0X I;  3KJP A;  2JJQ A;  1QVG A;  2N49 A;  1YBY A;  5IYD G;  1PV4 A;  4KI0 A;  1PH5 A;  1IBK Q;  4WJ4 A;  3HOZ G;  1PH8 A;  1K83 H;  3UE1 A;  3HOV H;  2ZJP A;  1KRT A;  4A3E G;  1BBW A;  3S2D H;  2Y0S G;  4A3B H;  2EIF A;  2AWO A;  1VS0 A;  2B3G A;  4R4Q A;  3UE0 A;  1J5E L;  3I4N H;  5JJL A;  4NB3 A;  1VQO A;  2QGQ A;  2BH8 A;  2GVA A;  4YY3 Q;  2ZM6 Q;  1K8A C;  4A93 G;  2CQO A;  2VY3 A;  1NMG A;  4DR7 Q;  1Z9F A;  4DV2 L;  1VQF A;  1PVO A;  1OXU A;  3RN5 A;  1XMQ Q;  4LF5 L;  2D0O A;  2NZO A;  3PUX A;  1T9H A;  3CMA A;  4DV1 L;  3G71 A;  3L0O A;  2UUB Q;  2KCT A;  1E1O A;  1IBL L;  2UU9 L;  2JA5 H;  4R4T A;  3CC2 A;  4A3F H;  4JC0 A;  4BY7 H;  2F52 A;  2L15 A;  3ULL A;  2VUM H;  4B3T Q;  3CC4 A;  3GTM H;  4JI1 Q;  1TWG H;  3OTO Q;  1KRS A;  3H0G G;  1KXL A;  2IT1 A;  1CSP A;  2ALY B;  2WAQ G;  1SRU A;  1WCM H;  5IYC G;  5M3F H;  1YZ6 A;  4JBJ A;  1PYS B;  3BJU A;  4UP7 A;  1B70 B;  3H15 A;  3J81 i;  1KL9 A;  4YWK A;  1DGS A;  1UE1 A;  3ZJY C;  4LF4 Q;  1YNX A;  4GS3 A;  4JYA Q;  1O7I A;  1XNQ L;  3PV0 A;  4JOI A;  4GKK Q;  4YCW A;  4JI5 L;  1PYB A;  4LUO A;  1JE5 A;  1MJE A;  1WYD A;  2Z0S A;  1E3P A;  4YCV A;  4B3S Q;  1VQ4 A;  2ZTE A;  5GRO A;  4NXN Q;  3CC7 A;  1Y14 B;  4X6A H;  5IP7 H;  4JI4 L;  4O2D A;  3CPW A;  4X62 L;  1Q1B A;  1HZ9 A;  2BA1 A;  4IPD A;  4NPS A;  1VQK A;  3E0E A;  2WP8 J;  3PUV A;  4DV7 Q;  3B6Y A;  1SLJ A;  2K5H A;  3MXN B;  5JEA G;  1PH2 A;  4LUZ A;  1HR0 W;  2ZJR A;  3T1Y Q;  3I4M G;  2LSS A;  3WWV A;  2K5V A;  2WFW A;  3FP9 A;  2D0P A;  3F2D A;  5C0X G;  4PZ7 A;  4A3C H;  3EIV A;  4TVA B;  3RLF A;  3NBH B;  4JI2 Q;  4OWX B;  4DNI A;  2V1C C;  2R6G A;  4GOP B;  1I94 L;  1JMC A;  2IX1 A;  3GTL H;  3HOZ H;  4BA2 I;  5GAH C;  4LFC L;  4DUY Q;  1N33 Q;  2ASB A;  5IWA L;  1XPU A;  4QY7 A;  2CWP A;  5JJI A;  4QGU A;  4DR6 Q;  1PHJ A;  1N32 L;  2DUD A;  4A93 H;  3RR5 A;  1IZ6 A;  2YTY A;  1FJG Q;  5GAE C;  3ERS X;  2YYZ A;  4HIM A;  3T1H L;  3S2H H;  3F2B A;  4JG2 A;  1UE7 A;  5J3B A;  5HY6 A;  4KHP Q;  4BA1 I;  1XPR A;  4A3J G;  3S1R H;  3G6E A;  2KEN A;  1OXS C;  2MNA A;  3STB D;  3CQZ H;  1FVI A;  2YU9 H;  1QUQ A;  2Q2T A;  2K52 A;  1G29 1;  1HNX L;  2Q2H A;  3A0J A;  4JOI C;  3I56 A;  4OX9 L;  3TEH B;  3FKI H;  2K5N A;  1XNR L;  1WJJ A;  2B29 A;  2HHH L;  1L1O B;  4RMF A;  1YJN A;  1IBM Q;  2C35 B;  2B63 G;  1HR0 L;  4LUV A;  4EQ5 A;  5C4J H;  2WB1 G;  1VCI A;  5JEA J;  5IYC H;  4MTN A;  4R4C A;  3PO3 G;  3CD6 A;  5BR8 L;  1Q1E A;  1EOV A;  4KHZ A;  4HJ8 A;  1PH6 A;  3DLL A;  1YHB A;  1X6O A;  4HJ9 A;  3PIO A;  2E2I H;  4DUZ L;  1N34 Q;  2CWA A;  1C7Y A;  4IFD G;  2UXC Q;  3IRB A;  5H1S E;  1HNZ L;  2AMC B;  2BH2 A;  4OXP A;  1YIT A;  3M9B A;  5FLX c;  3BU2 A;  2PQA B;  3TRE A;  3CCV A;  3K80 C;  2ZTD A;  2UXB Q;  3CME A;  1EIF A;  1VQA A;  4LF9 Q;  1B8A A;  4DR5 Q;  4X65 L;  3CCM A;  3VDY A;  3HOU G;  1UE6 A;  2KHJ A;  2VQF L;  1UE5 A;  3RZO H;  2AHO B;  4B3M L;  2OTL A;  1A0I A;  2YTV A;  4P71 A;  1MKH A;  4POG A;  4LFB Q;  1A8V A;  5FLM H;  5M3M G;  1EFW A;  1ASZ A;  1CUK A;  3Q8D A;  4QQB X;  4JI0 Q;  2PMZ E;  3KF6 B;  1HZB A;  3BZK A;  4P72 A;  1J5E Q;  4DV3 L;  2I0Q A;  4LF8 L;  2A8V A;  2R92 H;  3I7F A;  4DV6 Q;  2UUA Q;  1R9T H;  3I4M H;  1S3O A;  1Q86 C;  4LFA L;  3CCE A;  2EXD A;  3L7Z C;  1GVP A;  1VQM A;  4P75 A;  1BVS A;  4A3D G;  5IYD H;  2VNU D;  3TS0 A;  3PIP A;  4JI7 Q;  2JA8 G;  1Q81 C;  1N36 L;  1WFQ A;  2KHI A;  1OXV A;  1JB7 A;  1Y1W G;  2K14 A;  1XTD A;  2MQH A;  2CCZ A;  4JV5 L;  3CF5 A;  3JC6 6;  4KLK A;  2UUC L;  4IFD J;  2HT1 A;  1YHA A;  4L5T A;  1PH1 A;  3HOW G;  2NN6 I;  2PI2 E;  4YHH Q;  4IPH A; 
#chains in the Genus database with same CATH topology
 4RWS C;  1SNC A;  2QF7 A;  4CDD C;  3ZYY X;  3EPI A;  1VQI A;  2W6Z A;  3P7J A;  2ZXO A;  1M0W A;  1KD1 C;  2B2U C;  4UCU A;  2F0M A;  3KHH A;  3EJI A;  4JI3 Q;  4AQY Q;  1EUD B;  4BBS G;  1K3R A;  3KLS A;  2R7K A;  4BY1 B;  1PH9 A;  3UDG A;  1XMQ L;  2ZXP A;  1LTL A;  2IPK D;  1KIX A;  3U50 C;  3GTQ A;  3GV3 A;  1EQV A;  2F0E A;  1TWC B;  2I5H A;  1N8R C;  4YJ3 F;  4K0K Q;  3TZU A;  2HCC A;  3P20 A;  1LT4 D;  1PFM A;  2I8C A;  4LF6 Q;  2CQY A;  2EY6 A;  4XX0 B;  5IP9 H;  1CKM A;  4ZKB B;  4GZY C;  3P1H A;  5M5W H;  3HOX B;  4MA0 A;  1AN8 A;  3GID A;  2I5L X;  1O80 A;  3GTJ H;  4DR2 L;  2OQK A;  3CCJ A;  3T13 A;  4C3I G;  1O78 A;  2JQO A;  4IJL A;  3FRP B;  5LXT F;  4MTE A;  4PMW A;  2MO1 A;  2HVQ A;  2A68 D;  2NVX H;  5DLG A;  1G91 A;  2BQU A;  1CQV A;  1HNW Q;  3GTG B;  2DLN A;  4C3J H;  2B2V A;  3K59 A;  4P2C B;  4JI6 L;  5JVL A;  1HZC A;  4CC5 A;  1VBG A;  4A3E H;  4LFC H;  3NEN A;  1L2Z A;  2QCP X;  4DAY B;  2JA7 B;  1M6V A;  2W9A A;  1RHP A;  3VPC A;  4IRC A;  1HH2 P;  4AYB E;  4FP5 D;  4DV5 Q;  4POF A;  4JV2 A;  1HJP A;  4A3K B;  3PIP 3;  2A73 B;  1ENC A;  3M4O B;  3H3V I;  2OT2 A;  1N9W A;  4BS9 A;  1FNW A;  2LXJ A;  4RFB A;  4TQU S;  2OTJ A;  1RYS A;  4LF7 Q;  1WVL A;  1YI2 A;  2RCN A;  4IZO A;  4X64 Q;  1MJC A;  3HOW H;  4A3M G;  1DOM A;  2FJ2 A;  3H0G H;  1N33 L;  3C1F A;  4KN4 C;  2K75 A;  5DG9 A;  4MZ9 A;  1EIY B;  5FLX E;  3N52 A;  2C22 A;  4JCV E;  1RJP A;  4DUZ Q;  4DR3 L;  5IE8 A;  5KYI A;  1NCV A;  2HQL A;  1HA5 A;  5C5L A;  1DIK A;  2B2Y A;  1D1I A;  5C0X J;  3D6C A;  3DWP A;  4KHP L;  1NMF A;  1PH7 A;  1IW7 C;  1HNZ H;  3G4S A;  1WTW A;  1ZYR C;  2JK8 A;  1ZHS A;  4M7E A;  4YB8 B;  3AB9 A;  1ZXT A;  2HCI A;  1E4E A;  3NWT A;  1CI3 M;  2F0K A;  1ULZ A;  4AH6 A;  3LNN A;  2RGR A;  4OEM B;  4TSS A;  5C4X G;  3U9S A;  1RDP D;  4YWM A;  4MAM A;  3NWS A;  3GTM B;  1PH3 A;  2EY1 A;  3RUP A;  3CP0 A;  4B3M H;  3J80 c;  2XNA C;  1D7Q A;  1XYI A;  4HID A;  5M3F B;  2FPG B;  4I4T F;  1X54 A;  5IYZ F;  2E5L H;  1RJQ A;  3MFI A;  2F0F A;  3CAM A;  2NUC A;  3ICE A;  5IT9 W;  1N34 L;  4ED1 A;  2IHF A;  1VDZ A;  2UXC L;  2VXW A;  1IYJ B;  1U4P A;  2IBK A;  1KDA A;  4UCO A;  2Q8I B;  4DV1 Q;  1EQR A;  1AUV A;  2HIV A;  2B39 A;  2UU9 Q;  1KTK A;  2JXM B;  1XPO A;  4DR5 L;  5JUM A;  1RJT A;  4H7B A;  4A3C G;  2EYL A;  3I90 A;  3AQQ A;  3HGB A;  1GUT A;  2AQ3 B;  4A3J H;  2EYJ A;  3HEJ A;  4Q8F A;  4R9W A;  4FNF A;  1IBK H;  4BXX H;  2FFK B;  3T56 B;  1QJO A;  4IOC A;  1EIG A;  2OWO A;  3JAM E;  2HVS A;  1LM0 A;  1OXX K;  4EX5 A;  1M1K C;  3T5H A;  1QUQ B;  5ELF A;  3UDF A;  2M05 A;  2ZM6 H;  4IPG A;  5HUR A;  3V6K A;  2Y0S B;  1D2B A;  1SJH D;  3JAM W;  2QK4 A;  4JI5 Q;  2NU9 B;  3OSP A;  3W1B A;  5C5M A;  5CBA E;  2R61 A;  5KFC A;  4A93 B;  2W71 A;  1F2M A;  4EVO A;  1NTG A;  2W9C A;  1N48 A;  2KCM A;  2C5C A;  3FKI G;  1BBU A;  5C5J A;  4YCU A;  4ED7 A;  1Z47 A;  1P16 A;  2NUA B;  3H4B A;  3KUP A;  3K0X A;  1JDE A;  2JEI A;  4JI1 H;  1T3N A;  2Z4H A;  3BG3 A;  3GTK H;  4R1J A;  2R7L A;  1LTR D;  5CV9 A;  1Q3L A;  2NZH A;  3KJO A;  1LTB D;  3KAK A;  4H44 C;  1QWY A;  3T53 B;  2B2T A;  1PH4 A;  4JI3 L;  4AQY L;  1L2F A;  5C4J B;  1SE2 A;  4MNO A;  4LFC Q;  3N44 B;  5M3M H;  5EOY A;  4ED6 A;  2LFN A;  2VUM A;  4LF4 H;  5FJ8 G;  3TS2 A;  2OF1 A;  4K0K L;  3IKJ A;  2KA7 A;  2AKW B;  3PW5 A;  4GKK H;  1RL2 A;  4LF6 L;  4QMG A;  1KBL A;  3GTK A;  2P0A A;  5KFX A;  3WNZ A;  4ECQ A;  4B3S H;  4FM9 A;  4RB3 C;  1KHI A;  5D3I B;  4ALP A;  4APM A;  3I3C A;  1G6Z A;  1WSC A;  3VYS A;  2UVW A;  1BKB A;  1VQH A;  3HOV G;  2PN1 A;  3PW7 A;  4ETS A;  2FXQ A;  1X3Q A;  4P73 A;  3RZO B;  4PQX A;  1O7Y A;  2HIX A;  1H9R A;  2DGY A;  1IL8 A;  3OUZ A;  3S1N H;  1HNW L;  2XIW A;  2PI2 A;  2ENB A;  3T1Y H;  1NUC A;  1E24 A;  3J81 c;  2Q8T A;  4MV7 A;  4C5A A;  2NBF A;  1JR0 D;  4K8I A;  5KNB A;  4JI2 L;  3SDZ A;  2XGP A;  3EVQ A;  4Q45 A;  5L1K A;  3QOL A;  1I7L A;  4K5V A;  1R9T B;  2J6U A;  4RB0 A;  1SYF A;  1F2L A;  1N56 A;  1JOR A;  4TQR A;  1X56 A;  2KBN A;  3SK4 A;  5C3E H;  3GTL H;  2AGO A;  1UEB A;  1HNZ Q;  4DV5 L;  1SMX A;  1C4Q A;  1VQ5 A;  4APV A;  1B9N A;  2VUM G;  1JDB B;  3R23 A;  3PSI A;  1RK6 A;  4EEQ A;  3I4O A;  5HV6 A;  3H4D A;  5GAD C;  1E1T A;  3SK5 A;  2MP1 A;  4L6T B;  2V4D A;  4RNM A;  1M8A A;  4ZHQ F;  5IOC A;  2NU7 B;  2OH2 A;  4GLV B;  4LF7 L;  4B3M Q;  2AGQ A;  3D31 A;  1SNP A;  1WOC A;  4X64 L;  1Z2P X;  1TWF H;  3KAL A;  2YZN A;  2R93 H;  5C44 G;  2E5L Q;  4HR7 A;  4ZI7 F;  1YEZ A;  2FMM A;  2DIK A;  1LYL A;  4ILW A;  4O4L F;  3CQZ A;  3VYU A;  3RIZ A;  4Y8V B;  2R8I A;  4MN3 A;  3PO2 G;  4JBM A;  4GNX C;  2R6F A;  2WB1 B;  3G8C A;  2MHV A;  1E2V A;  2R7Z H;  1TWF A;  1KEE A;  2PNH A;  4AYB A;  4J9P A;  1AFP A;  4GC6 A;  3PW2 A;  2UXB H;  1IYV A;  4XT3 B;  5KFN A;  1V1O A;  2YTX A;  3KAJ A;  4LF9 H;  2R8J A;  5M5W B;  2N49 A;  1QVG A;  1UEA B;  3GTJ B;  1IBK Q;  1PH5 A;  5ELE A;  1KDB A;  2Z4I A;  4J9Q A;  1B1Z A;  5KT7 A;  5C3W A;  1XX8 A;  3MXU A;  2NVX B;  4JI0 H;  4R4Q A;  2F0N A;  4NB3 A;  2QGQ A;  2ZM6 Q;  4YR2 A;  2O5I C;  4C3J B;  4YJ2 F;  3K5I A;  3L4J A;  4DV6 H;  2R7Z A;  1EY6 A;  1OXU A;  3RN5 A;  4X3U A;  2N88 A;  1MSG A;  1GYF A;  4A3E B;  4MV4 A;  1T9H A;  4HCS A;  2FK2 A;  3CMA A;  5EZY F;  4DV1 L;  1U4R A;  1RF2 D;  3T5J A;  2XSC A;  2KCT A;  1E1O A;  2UU9 L;  4A3F H;  4JC0 A;  4BY7 H;  1KJJ A;  2L15 A;  4IAJ A;  4FS1 A;  5CB4 F;  3OHB A;  5TSS A;  4JI1 Q;  3E5S A;  1KRS A;  4EGJ A;  1CSP A;  4F4X A;  3OWF A;  5GON F;  1B53 A;  5IYC G;  1FYC A;  3BJU A;  4ECT A;  4UP7 A;  1HXY D;  4HN7 A;  3Q23 A;  3J81 i;  3HOW B;  4ZQI A;  1KAA A;  1LLR D;  2WKC A;  4LF4 Q;  3H0G B;  4GS3 A;  3PV0 A;  4J9N A;  4JOI A;  1QIL A;  4GKK Q;  4DXG A;  4YCW A;  2FP4 B;  3R5X A;  4JI5 L;  2R87 A;  2LS0 1;  1PYB A;  5A2Q E;  1Z6H A;  4ZCK A;  4B3S Q;  2ZTE A;  2F1M A;  1SE3 A;  3CC7 A;  2JP1 A;  2CH4 W;  1EHI A;  1STG A;  5A2Q W;  3CPW A;  1IOW A;  1VQK A;  3MR3 A;  5LA6 F;  3P75 A;  1SYD A;  4J0M A;  5FD6 A;  3E0E A;  4G57 A;  4LK1 C;  4DA2 A;  3UQ8 A;  3GV5 B;  2B63 A;  4UHV A;  4DR1 H;  5JEA G;  3BYY B;  3G6X A;  2ZJR A;  3T1Y Q;  4R8N A;  3TP5 A;  1KAB A;  3WWV A;  3FP9 A;  2D0P A;  3F2D A;  5FKA C;  2I07 B;  1JX4 A;  5C0X G;  5IYD H;  1QE6 A;  3Q1K A;  1TY0 A;  1EEF D;  2X0S A;  3HOZ H;  4I55 F;  3BAA A;  3H91 A;  4ECR A;  5EBD A;  4LFC L;  1I3Q A;  5KT4 A;  4JUZ A;  5H80 A;  5KT5 A;  2PZW A;  4FF4 A;  4YR0 A;  3RR5 A;  3GIJ A;  4B9X A;  3S2H H;  5KT6 A;  3ERS X;  2YYZ A;  5C4H A;  1GJX A;  1PMR A;  2A6E D;  5LP6 F;  4G7Z C;  1UE7 A;  3V4S A;  1K8M A;  2XIG A;  1F77 A;  1OXS C;  3H09 A;  1ZKO A;  1JWU D;  5DM7 3;  1BCP C;  1FVI A;  5JPM C;  5LMN H;  5DGA A;  3H94 A;  2AQ1 B;  2YU9 H;  1MHW C;  1ESF A;  3I56 A;  4EG0 A;  2W6Q A;  2DPJ A;  1T5E A;  2FMA A;  4XQQ A;  1YJN A;  4A3J B;  2B63 G;  4YIJ A;  4LUV A;  4RHS A;  2BQR A;  1LT3 D;  1S4Z A;  2PPB C;  3MXG A;  4IUT A;  1PRT B;  4R4C A;  1WD1 A;  1Z2N X;  5BMV F;  5BR8 L;  5EWG A;  4KD3 A;  3DLL A;  4IN3 A;  4F88 A;  4HMJ A;  3PIO A;  1RD9 D;  4FS2 A;  5KFY A;  3V6H A;  1CQF A;  2CWA A;  1HNZ L;  3J7A V;  4CDF C;  1E4G T;  5L1J A;  3PW4 A;  2PCF B;  1YIT A;  5CR3 A;  3M9B A;  3IL8 A;  1TWA A;  2PQA B;  3TRE A;  2UXB Q;  3K80 C;  2B2U A;  1ZHQ A;  4RA8 A;  4JI8 H;  2RSN A;  4LF9 Q;  2PMZ B;  1KC7 A;  1FR3 A;  1O7Z A;  3GQB A;  1ZQ7 A;  3IN5 A;  4ECU A;  1UE5 A;  3K0Y A;  2VQF H;  4B3M L;  5L1L A;  5CGK A;  3RAX A;  3TQ1 A;  4I7H A;  3Q8D A;  2WAC A;  4QQB X;  5CV5 A;  4JI0 Q;  2K28 A;  2A74 C;  3GTK B;  1CK1 A;  2R92 H;  4C1N K;  4P72 A;  3N6R A;  3N41 B;  4DV6 Q;  1S3O A;  1GVP A;  1BVS A;  2R8K A;  3QO2 A;  2JA8 G;  3RD4 A;  3N42 B;  5M3M B;  3DEP A;  1WFQ A;  1OXV A;  2MUY A;  1N36 H;  2K1B A;  5T14 A;  3NBH A;  2CCZ A;  1F2Z A;  3FDT A;  1CZW A;  1DXM A;  3OIP A;  3VR4 A;  2HT1 A;  1YHA A;  2K05 A;  4L5T A;  4U68 A;  1GXD C;  1PH1 A;  2XWJ B;  1QCB D;  3I4N H;  5KFH A;  2ASD A;  2ASL A;  2JEJ A;  1IBK L;  2XTI A;  2TMP A;  4XTC S;  4A3G G;  3BA9 A;  2NVT H;  2Q2I A;  5KYL A;  1WI5 A;  3OSO A;  4F4W A;  1X3F A;  2E2H H;  5IYB G;  4UCV A;  4OIJ A;  1HFG A;  3SGI A;  5L37 A;  2ZM6 L;  3S1N B;  5DLF A;  4LMY A;  4YP3 A;  2FE3 A;  3OOC A;  5F9L A;  3ORR A;  1M7J A;  4IRK A;  4TQS A;  3SK8 A;  3HOX G;  3QG1 A;  5K36 H;  4IUR A;  2H5X A;  3QOJ A;  3RZD H;  1YNN D;  4OO1 H;  3GV6 A;  3E3X A;  5C3E B;  2A19 A;  3GTL B;  3PIO 3;  4IFD H;  4J9M A;  3K7A H;  2OEO A;  2VQE H;  2E2H A;  4JI1 L;  2OCE A;  3NBI A;  2NVQ H;  3AFQ A;  4DR1 Q;  4HMI A;  1NBW A;  4J1M A;  3CW2 C;  3D0F A;  2JA7 G;  3HOU H;  2PBZ A;  5KFE A;  3A5U A;  1TWF B;  1DOK A;  2HDL A;  4IPC A;  4C3H H;  1I4R A;  2QEX A;  3TZD A;  2R93 B;  1V1P B;  3WO0 A;  3CXC A;  2YCH A;  2PW7 A;  3EFX D;  3ULP A;  5KG6 A;  4UY8 C;  2BR0 A;  5JPN C;  1F9Q A;  3KXY T;  2CW8 A;  1Q82 C;  4PMB A;  4IOA A;  3KF6 A;  1N32 H;  4U67 3;  1L0X B;  3RUZ A;  1X3G A;  3HP3 A;  2NWG A;  4OWW B;  4HQ6 A;  2JA6 A;  2RSO A;  3K5L A;  5LMN Q;  2X69 A;  1BNC A;  3CPF A;  5DQH A;  1BXR A;  2VL6 A;  2JYO A;  3V4Z A;  3AYH B;  5DQG A;  3T1Y L;  2RHS B;  1S5B D;  2K01 A;  1L1O C;  3CCS A;  5DQI A;  1HNX H;  4DK6 C;  4DR4 L;  3HKS A;  1CSQ A;  4A3I G;  2YW2 A;  4DN4 M;  2QKI C;  4RKL A;  1K9M C;  3MVV A;  1PRT D;  3RB0 A;  1HZA A;  1GOZ A;  2KCC A;  1PZI D;  3KYH C;  3PF5 A;  3J81 L;  1FD7 D;  2F0Q A;  1Y1W A;  2VUG A;  3KF8 B;  5EDW A;  5KFU A;  2D2C C;  1PXU A;  4Q44 A;  4BBS H;  4IRD A;  5KFO A;  4LWC A;  3PN1 A;  2QEJ C;  2CH4 A;  4PNY A;  3NTH A;  4JI8 Q;  4NXM H;  2F0L A;  2IJ0 A;  4J9S A;  3SEB A;  5M3F G;  2V58 A;  4KD4 A;  5M5Y H;  3K5N A;  2VQF Q;  2YZM A;  2KSW A;  3I55 A;  2C28 A;  1I4P A;  1M4V A;  3J80 W;  4BY7 B;  3FVQ A;  1HUM A;  2JA6 G;  4X3K A;  3RNU A;  2EZV A;  1B6R A;  2J0T D;  3IAY A;  4ZUI A;  2XWB B;  2W8K A;  2K5Q A;  1JKJ B;  4DK0 A;  3CVZ A;  4HJA A;  4M1U B;  2E76 C;  1A62 A;  4IZ8 A;  2W6O A;  1CTM A;  3TIG A;  1VQN A;  4L1K A;  2IL8 A;  4IO9 A;  4ECX A;  4E4T A;  1FNV A;  1ET6 A;  1SNQ A;  1N36 Q;  5KG5 A;  4EYH B;  4LFA H;  2RDI A;  2CW0 D;  3BDC A;  1D8L A;  4GLA C;  3M7N A;  3AFP A;  1I50 A;  3HOY B;  3PQI A;  5IGE A;  2ICE C;  1JOK A;  4A3L G;  2CQA A;  4CDE C;  2UXB L;  2FLL A;  3KDF B;  3N40 P;  1K8O A;  5FLX L;  2ES2 A;  4LF9 L;  1JOO A;  4HNU A;  1VKZ A;  3D4W A;  5LL6 X;  3NTK A;  3ETJ A;  2F0S A;  3GTQ H;  1XDN A;  3TIN A;  5BPH A;  1X3E A;  5E3F A;  2B2W C;  5JJK A;  1IYU A;  5GQO A;  4JI0 L;  1XXG A;  2XD4 A;  2C2D A;  1NE3 A;  1SAP A;  5DG8 A;  1SRO A;  4DV6 L;  2AU0 A;  1KAW A;  3CU7 A;  1D1K A;  2UUA H;  4HTH A;  4A4I A;  1J8I A;  4A3M H;  2EE1 A;  5DAU A;  3HOZ B;  4DR7 L;  3RTX A;  1Q8I A;  1GO3 E;  1OTC A;  4KJN A;  1HA6 A;  2N3S A;  1PTO F;  1LUZ A;  5JAV A;  1K83 A;  1A2T A;  1MSH A;  3S2H B;  4JV0 A;  1KNA A;  2J4X A;  2VQE Q;  4YQW A;  4UPA A;  5IGG A;  4XDX A;  3KHL A;  1IHZ A;  3EN2 A;  1H95 A;  1SFO H;  1S5C D;  4FF1 A;  1LTG D;  1EYD A;  4B3T H;  1CKN A;  2YU9 B;  3UDX A;  4L5S A;  4OO1 I;  5C4X H;  2VQD A;  4DGZ A;  4RUC A;  2A6H C;  3RLO A;  1AW7 A;  3T4A C;  4IFD I;  1EQQ A;  4LAA A;  4DAV A;  1E0B A;  3GIM A;  3D4D A;  4GOP C;  5D1O A;  3VPD A;  2EXZ A;  1CFM A;  3AEV A;  2GVB A;  2N55 A;  4FXG C;  4DAM A;  3JRX A;  1CZG A;  1BJT A;  1I6U A;  1SFO A;  4WJ3 M;  4HJ5 A;  1VQJ A;  1N32 Q;  1S0O A;  4F4Z A;  5KFI A;  4JV1 A;  1WCM A;  1GHJ A;  3M4Q A;  1WR2 A;  5AFW A;  1HCZ A;  1Y8P B;  1O7L A;  1M0T A;  1AN7 A;  5FLM G;  4A2A A;  3S17 H;  4ABN A;  2EQS A;  4DL6 A;  1U5K A;  4DR1 L;  4RCO A;  5DEH A;  2I80 A;  3S15 H;  1CQI B;  3A8J E;  3HKZ B;  5DM6 3;  3QZ7 A;  4A3B G;  1HNX Q;  4GNX A;  3MEF A;  4UP9 A;  2EJM A;  3OMG A;  1MZB A;  5KFB A;  1NJI C;  2R7N A;  3RLN A;  1VQD A;  4O2B F;  3VMM A;  3S14 B;  4Q43 A;  3KOJ A;  4B9W A;  3L4K A;  2R3Z A;  4JBK A;  1GKH A;  5T1I A;  1EY5 A;  2R92 B;  2F3I A;  5E7N A;  4EBC A;  4DUY H;  1HRJ A;  3RV3 A;  4UFZ A;  5LHY 1;  3GIL A;  3GII A;  3S1M H;  4ID6 A;  4KN7 C;  4P74 A;  2XN9 C;  1C8C A;  1BDO A;  2R7D A;  2BCO A;  3CCU A;  4NXM Q;  1AZQ A;  2EDG A;  2W9B A;  1NR2 A;  5LMN L;  1KQS A;  4ECV A;  1A15 A;  3G48 A;  4HSV A;  2YRX A;  3F2C A;  2CFM A;  4QUF A;  5FD5 A;  1WCM G;  1QVC A;  4IWX A;  3AU7 A;  1U4M A;  5E4X A;  3VYT A;  4HNV A;  2DN8 A;  2JA5 B;  2H4O A;  1VQ7 A;  5KFS A;  1QOH A;  4PZ8 A;  2I46 A;  3I4N B;  3QJY A;  1JC7 A;  3O13 A;  1JWS D;  4DL4 A;  2R8G A;  4ME6 A;  2NVT B;  4KHV A;  1IBM L;  4DXF A;  5IT9 E;  3Q8R B;  4NKL A;  2MCT A;  4LSX A;  2Z1C A;  2E2H B;  4OWT B;  1H9S A;  2LY7 A;  4K14 A;  4AIM A;  4OON A;  1SDF A;  4LFA Q;  5IP9 G;  3J81 j;  1I5F A;  2E8G A;  3I91 A;  4ECW A;  1YNJ D;  4PZ6 A;  1P8L A;  1E2W A;  3DMU A;  5M5X H;  3F1Z A;  1BCP F;  3HZX A;  4IUN A;  5IP7 G;  2ID0 A;  1JJG A;  3FKI A;  3BZC A;  4HIO A;  4JI8 L;  3GD7 A;  2JEB I;  5FJ8 H;  1S97 A;  3RZD B;  4J15 A;  2F4I A;  2O2L D;  3CCL A;  3UFX B;  3I8Z A;  3R3O A;  1HPC A;  2WAQ A;  2I5M X;  1PRT F;  3K7A B;  4C3J G;  2NVQ B;  2G5D A;  2M00 A;  2IWH A;  1BF4 A;  3RF2 A;  2JEF A;  1YBY A;  3V05 A;  2AQ2 B;  4K6D A;  2O4X A;  3UE1 A;  3HOV H;  2ZJP A;  1VAJ A;  4A3E G;  4QIW A;  5J2T F;  1EZ1 A;  1GSA A;  5L1I A;  1KJI A;  1D5X C;  2ALZ A;  1MI2 A;  2EIF A;  3HOU B;  3TP7 A;  1CA6 A;  2M2L A;  1J5E L;  1W93 A;  1I6V C;  4KY6 A;  2NU6 B;  2FPP B;  2VY3 A;  5LL6 b;  4C3H B;  4RNO A;  3JSN A;  1VQF A;  3G6J B;  3H3V C;  1PVO A;  5JVH 3;  1EY4 A;  5COR A;  5F9N A;  3PUX A;  2NZO A;  3K6O A;  1UC8 A;  1ZEQ X;  1SMY D;  2QDL A;  3L0O A;  4EFE A;  3LWB A;  1CHP D;  3HS0 C;  1R4Q B;  1B6S A;  1EYZ A;  3GLK A;  3MFG A;  2VUM H;  2BDO A;  2K03 A;  4B3T Q;  3CC4 A;  4RGN A;  4MV1 A;  1TWG H;  2UVR A;  3H0G G;  1KXL A;  3OHX C;  2IT1 A;  2ALY B;  5CV4 A;  2WAQ G;  5EGT A;  1SRU A;  4YHH H;  2XRS D;  5FO8 B;  1JB3 A;  1B4O A;  1NR4 A;  2K32 A;  1B70 B;  1IKL A;  2HD3 A;  3MJF A;  3NE5 B;  4WJW A;  4DV0 H;  1DGS A;  3SXH A;  5C6A A;  4I7Z C;  1TS5 A;  4YR3 A;  1HQR D;  2M9V A;  5BN3 A;  1JE5 A;  1MJE A;  1TWG A;  5G3L D;  4J9O A;  1E3P A;  1SXT A;  3Q2O A;  4BBS B;  3BZD B;  4X6A H;  4X66 H;  4O2D A;  2PNR C;  1HZ9 A;  3R2I A;  4IPD A;  3MXP A;  2R7M A;  3QZ8 A;  2WKD A;  3PUV A;  5M5Y B;  3MXN B;  2F0D A;  2DNE A;  4EGQ A;  1WTR A;  1PH2 A;  4LUZ A;  1HR0 W;  3C46 A;  2F0P A;  3I4M G;  3A7L A;  2WFW A;  4FYD A;  1ILQ A;  4O4I F;  5I2Y A;  2NYZ D;  4K5W A;  4DFA A;  4F50 A;  4DNI A;  2V1C C;  2NZ1 D;  5J22 A;  1JMC A;  4BA2 I;  1I94 H;  5GAH C;  4DUY Q;  1EEI D;  2ASB A;  2R8H A;  3CKI B;  4QY7 A;  3U9O A;  5JJI A;  2BQ3 A;  3WOF A;  1S5E D;  5C4Z A;  1N32 L;  4CKB A;  1S9F A;  1IZ6 A;  3KLS X;  3DWQ A;  3F2B A;  1Z7T A;  2V59 A;  4JG2 A;  1B9M A;  1LAB A;  5J3B A;  4BA1 I;  4A3J G;  4C2M A;  3S1R H;  3G6E A;  2KEN A;  2EYO A;  5CV8 A;  2MNA A;  3CQZ H;  5KFZ A;  2QIL A;  2O03 A;  4O3O A;  5FPR A;  2BDN A;  1HNX L;  4QWD A;  5LYJ F;  1F9P A;  4DV4 H;  3NUC A;  4MTK A;  1A3U A;  3TEH B;  2K5N A;  3GTQ B;  4OX9 H;  5CMD A;  4KJO A;  1MBY A;  1WJJ A;  4V0B A;  1K1S A;  3T5L A;  2IMW P;  3DUZ A;  2C35 B;  3LP8 A;  3ITP A;  1KNE A;  4EQ5 A;  4FVM A;  1VCI A;  5IYC H;  3BQ2 A;  2EPB A;  4UDU C;  3C0F B;  2X6G A;  2E75 C;  4EQN A;  4ECZ A;  3CD6 A;  5T1G A;  4JVZ A;  4KHZ A;  1PH6 A;  1YHB A;  4HJ9 A;  4B3R H;  4DUZ L;  4A3M B;  5FPO A;  1IW7 D;  1BOS A;  4OIK A;  5H1S E;  1ZYR D;  5FLX c;  2FK1 A;  1E4F T;  4EBE A;  4RU9 A;  4CJ0 B;  3VDY A;  1UE6 A;  2AHO B;  1SFO B;  4P71 A;  1PTO C;  4LFB Q;  3R93 A;  5M3M G;  1K28 A;  1QB5 D;  1HZB A;  1I4G A;  5JEA H;  2I0Q A;  5KG0 A;  5C4X B;  5D1P A;  3GTP A;  3K58 A;  4LFA L;  3C3L A;  3L7Z C;  4IAL A;  4A3D G;  2Q8R E;  4G3I A;  5EPJ A;  3TS0 A;  4ED2 A;  1Q81 C;  2K5W A;  1RJR A;  3RB3 A;  3E5N A;  2KHI A;  4DV2 H;  4CKC A;  5LL6 S;  3EYY A;  3CF5 A;  4XZ3 B;  2CZG A;  5JVD F;  5KT2 A;  4IFD J;  4OEL B;  1LT5 D;  1GGO A;  1ICW A;  3E6Z X;  3S17 B;  1GUW A;  3EPG A;  4YHH Q;  2MJ8 A;  2VA3 A;  4ZRZ A;  3A8K E;  2GLT A;  4LNQ A;  3X3M A;  4UCR A;  4NMZ A;  1AE3 A;  1QNU A;  5CV7 A;  3OW2 A;  3TSS A;  3M9O B;  2G9H D;  4DNR B;  5C3E G;  4DV0 Q;  3J7Y W;  4K6L A;  1QZG A;  1A6X A;  2DWC A;  1AE2 A;  2B63 H;  5KNC A;  1E4E B;  5KFQ A;  5I47 A;  3MA2 B;  1ASY A;  1L1O A;  4OL7 A;  3TQT A;  1SEB D;  1FNU A;  4RB2 C;  1RTO A;  1XNQ H;  1JJC B;  3S1M B;  4RG1 A;  1PX2 A;  3EBE A;  4X66 Q;  2F3V A;  5JJZ A;  1EWH A;  2ATL A;  2RF4 A;  4N9P A;  2E2D C;  1I3Q H;  2K4K A;  2R93 G;  3S1Q H;  3K5M A;  4JI4 H;  1VQB A;  1G51 A;  4X62 H;  4DR2 H;  3NPP A;  1S0M A;  4GC7 A;  3V96 A;  1D6E C;  1X55 A;  3MR5 A;  1AH9 A;  4G7O C;  5CC4 A;  3TP8 A;  5KGU A;  1DZ1 A;  1VQG A;  1S72 A;  1I94 Q;  3BA8 A;  4EYI B;  3KFU A;  3Q24 A;  1C0A A;  4JI6 H;  4L8J A;  1K0S A;  4Y7N H;  3NEM A;  5D3D A;  4MV6 A;  4MV9 A;  4R8U A;  4BBR G;  1PFB A;  1TQO A;  5KFV A;  1QVF A;  2JEA I;  1BQQ T;  3BQ0 A;  1V51 A;  1UAP A;  5IWA H;  3IG0 A;  3PF4 A;  1M90 C;  3KLW A;  1DOL A;  1VQ6 A;  1EZ8 A;  4NP5 A;  2Z6K C;  5M5X B;  3VR5 A;  2JA8 H;  1V9P A;  2CKZ B;  3T1H H;  5F2D A;  1S5F D;  1B3Q A;  1H9M A;  5KG1 A;  1Q8K A;  5GAG C;  5I6Y A;  3ORQ A;  2RA4 A;  1JJ2 A;  4DV4 Q;  4DK1 A;  3D6W A;  3STB C;  2LMC B;  4OX9 Q;  5KFT A;  4RGM A;  2IY5 B;  4RB1 A;  2VR1 A;  5CYU A;  1EY8 A;  4FXD A;  5I9O A;  3DWA A;  1BBX C;  4Q8E A;  1TWA H;  1EUJ A;  1Q46 A;  2QW7 A;  2Z6B A;  4A3G H;  3K8A A;  4Q5V A;  5G3L F;  3HOV B;  1RK5 A;  3RFC A;  3I72 A;  1PRT C;  5ELN A;  2W9C B;  4DL7 A;  1HR0 H;  2EY2 A;  1KC8 C;  4B3R Q;  1TT2 A;  4QL5 A;  2J9G A;  3TRZ A;  4C5B A;  4DR3 H;  2Z8L A;  2B2W A;  4TRD A;  1Y1V G;  4R7R A;  2PVP A;  1ENA A;  1STH A;  3MR2 A;  4LMQ D;  5KFL A;  2PO4 A;  5KT3 A;  4HIK A;  4UP8 A;  3UI2 A;  3A74 A;  1U0L A;  1SEI A;  3J7A 5;  1CM9 A;  1NY4 A;  2FIN B;  1TWC A;  1NNX A;  1XJV A;  2VUM B;  1A9X A;  4X65 H;  5D14 A;  1L0Y B;  1TWG B;  1CKO A;  1KLU D;  1YJW A;  3KK7 A;  4DL3 A;  1H9K A;  3G6Y A;  3HOY G;  1VQ9 A;  2E5L L;  5IY0 A;  4PG3 A;  1S03 G;  4O3R A;  4H13 C;  1TR5 A;  1VQ8 A;  1EWI A;  3N6X A;  4DV3 H;  4UCT A;  4DV2 Q;  1PFN A;  4ZYS A;  2WDT A;  3DM1 A;  2CW0 C;  1I4H A;  3GTG A;  2XCL A;  4A76 A;  3JAM i;  3S9W A;  2GPS A;  4CJ1 B;  1LTS D;  4MV3 A;  4F4Y A;  5ELB A;  3ND9 A;  3D3R A;  1MGS A;  4GOP A;  1IKM A;  2KHS A;  1SBB B;  5LOV F;  3V6J A;  2C2R A;  1FGB D;  2A5H A;  4RAU C;  2IX3 A;  3GV7 B;  4DAY A;  4RZQ A;  4MTD A;  2UUC H;  4LFB H;  2JA7 A;  1L0W A;  4KY7 A;  4LFB L;  3QIA A;  4KK7 A;  4BY1 G;  1Y69 U;  3LML A;  1XTC D;  5KRU A;  2KCN A;  3TME A;  2RCF A;  1GSO A;  5FO9 B;  5EWE A;  3LX0 A;  3PGZ A;  4N8X 1;  3GQC A;  1BXT A;  4A3I H;  3VPB A;  3LWU A;  4YY3 H;  2RHQ B;  2Q2U A;  2KQ3 A;  4ME3 A;  1XNQ Q;  3KBG A;  5K2M A;  3N8D A;  1GM5 A;  3PO3 H;  2W6N A;  3GIQ A;  4S3S A;  2KUM A;  3MWM A;  1YJ9 A;  4HR7 B;  2UUB H;  1BR9 A;  1WD0 A;  4JI4 Q;  1DD2 A;  4X62 Q;  4DR2 Q;  1S68 A;  3M4P A;  3S1R B;  4YHH L;  2V4Q A;  2K50 A;  3CQZ B;  5KKN B;  3OTO H;  1EU3 A;  5HGT A;  4HNT A;  5KFF A;  5CBE E;  1U4L A;  2FB9 A;  2ZDG A;  1DJR D;  2IX0 A;  2JA6 H;  5J39 A;  1QNK A;  3FMC A;  4DV0 L;  4JI6 Q;  2IP4 A;  2A68 C;  1B44 D;  4K2L A;  1VQP A;  2YV5 A;  3DF7 A;  2ZJQ A;  4AYB B;  4A3K G;  5IWA Q;  2A69 D;  4LF4 L;  3GTM A;  4PV1 C;  3HKZ G;  1RYR A;  4JYA H;  1X3P A;  4GKK L;  1D5M C;  2CVR A;  3T1H Q;  5IIF A;  4X66 L;  3NXW A;  3CRK C;  3R5F A;  1QZH A;  4B3S L;  5JH7 F;  4IQZ A;  2WAQ E;  2NVY H;  4NXN H;  2PW5 A;  4A3L H;  3WDN A;  2R92 G;  1Y1W H;  3HG9 A;  2ZXR A;  2R7Z B;  5BN5 A;  4DV7 H;  4QIW E;  2QYZ A;  1J6Q A;  4QJF A;  3J7Z C;  2BE5 D;  1V1Q A;  4Z9C B;  5I4D A;  3PUW A;  3VA7 A;  4LJZ C;  4CC6 A;  3TBI B;  1CS0 A;  2IHE A;  3PCO B;  1HR0 Q;  4FF3 A;  1HUN A;  5KFR A;  3H3V H;  2NN6 G;  1ILP A;  3OW7 A;  2KEC A;  3CCQ A;  2KVM A;  4DR3 Q;  2D62 A;  3RN2 A;  2NVY A;  4ULL A;  2DJG C;  3PUZ A;  4DKA C;  3F8T A;  3T16 A;  1K8G A;  1T36 A;  4TUY F;  3RAQ A;  1B2T A;  5C3X A;  4CHT B;  1EYG A;  1PK8 A;  2JA5 G;  4DR6 H;  4IJH A;  3ULJ A;  1FJG H;  3I4N G;  2YRW A;  1W6K A;  1LTA D;  3W2D A;  4OHJ A;  4YWL A;  2R82 A;  3J80 E;  3GTO H;  2V4R A;  2R7F A;  3RBD A;  3M4Y A;  4DV4 L;  4QCL A;  4FBT A;  2VPQ A;  4HCE A;  4X65 Q;  2VOB A;  3HXL A;  1VF5 C;  1UNS A;  3HB9 A;  3RV4 A;  3A55 A;  4A3F B;  1FGU A;  1I50 H;  2RGV A;  4DAP A;  1TVX A;  2VB3 X;  3K81 C;  2EYP A;  5K36 G;  1K73 C;  1MIU A;  1VMP A;  1ML0 D;  4O1N A;  5KFG A;  1TU2 B;  4OO1 G;  4DV3 Q;  1X65 A;  4C3I H;  4B3R L;  2DPI A;  2YS7 A;  1OWT A;  3K57 A;  4G7H C;  3U58 A;  2JSO A;  1OO9 B;  4GN5 A;  3GTO A;  5KFM A;  1PA6 A;  5HGQ A;  2B63 B;  1WTX A;  1PLF A;  1V4Y A;  2PZT A;  5IGB A;  1YNJ C;  5KG3 A;  2KJX A;  3K7U C;  2WV6 D;  2NB0 A;  3E9H A;  4RCN A;  3NGD A;  1STY A;  1ESR A;  3Q22 A;  5ELD A;  2CW7 A;  1Z2O X;  1ET9 A;  2UUC Q;  1TII D;  1I3Q B;  2EJG C;  5NUC A;  2AGP A;  4I50 F;  3KJP A;  1JXL A;  5COY A;  3S1Q B;  4XYM B;  1PV4 A;  4WJ4 A;  1RTN A;  1WH2 A;  3S2D H;  1K83 H;  1KRT A;  2Y0S G;  4A3B H;  5EKI A;  1VS0 A;  2RDF A;  3UE0 A;  5JJL A;  1VQO A;  1K8A C;  1EYC A;  2BH8 A;  2GVA A;  4YY3 Q;  4A93 G;  1NMG A;  1Z9F A;  4DV2 L;  4QW8 A;  4Y7N B;  4FBU A;  5EWF A;  2EY5 A;  3TP6 A;  5KND A;  2D0O A;  1PYW D;  3I73 A;  3T5K A;  4JI7 H;  2RDG A;  4DNT B;  5IT9 L;  2EYH A;  2L11 A;  3BYT B;  2UUB Q;  3PR4 A;  3M9N B;  2XVS A;  4R4T A;  2SNS A;  3CC2 A;  3SK6 A;  2F52 A;  3ULL A;  2JA8 B;  1R9T A;  3ONA B;  3OTO Q;  1JWM D;  3EA6 A;  3L3O C;  1WCM H;  2SOB A;  1YZ6 A;  3KHR A;  2MGS A;  4O42 A;  4JBJ A;  1PYS B;  1AEX A;  3DEO A;  4ODG A;  1TWA B;  4YWK A;  5IGC A;  1EL0 A;  5IGD A;  4A3G B;  5I6W A;  3ZJY C;  3V2T A;  3NTI A;  3KHG A;  3BQ1 A;  4JYA Q;  1O7I A;  1XNQ L;  1HQM C;  1XMO H;  2ICI A;  3NK9 A;  4LUO A;  4JI5 H;  4Q0F A;  4IR1 A;  3PW0 A;  4YCV A;  2ZDH A;  1EWC A;  2DJF C;  1VQ4 A;  3U9T A;  4NXN Q;  2F4V H;  4IHJ F;  1I7N A;  4BWS C;  5IP7 H;  4JI4 L;  3JAM L;  4X62 L;  2BA1 A;  1PTO H;  3J81 E;  2UVU A;  2WP8 J;  4DV7 Q;  3FPP A;  1LO5 D;  1KDC A;  2H1E A;  3B6Y A;  4C56 C;  5A35 A;  1BGW A;  2K5H A;  1B3A A;  2WB1 A;  5EPK A;  5ELC A;  1F2Y A;  2LSS A;  3J81 W;  4ME5 A;  2TSS A;  4PZ7 A;  2EYM A;  3EIV A;  4TVA B;  3RLF A;  3NBH B;  4JI2 Q;  4GOP B;  2IX1 A;  4A3C H;  2R6G A;  4ED8 A;  5IWA L;  1TS3 A;  4KTA A;  4J6H A;  3GTJ A;  4DR6 Q;  1PHJ A;  1SYX B;  2DUD A;  4QUC A;  3CHB D;  4QWA A;  1GHK A;  1FJG Q;  5GAE C;  3T1H L;  1Y8O B;  5KFW A;  4XXE A;  5KIX A;  2NVX A;  4YBZ B;  2F0O A;  4KV6 A;  4IR9 A;  5FO7 B;  2Q2T A;  2K52 A;  3VR2 A;  3H6M A;  3BS1 A;  4O4H F;  2C9O A;  1V8Q A;  3FKI H;  1I4X A;  1MD2 D;  2B29 A;  4N9T A;  2HGS A;  2KOL A;  5LMU H;  1HR0 L;  2F0I A;  2WB1 G;  5JEA J;  3I4L A;  1EY0 A;  4MTN A;  4KKS A;  1STN A;  2L55 A;  1Q1E A;  3G6V A;  4B08 A;  5BR8 H;  1SSO A;  1IOV A;  2E2I H;  4A3I B;  2EVB A;  5FLX W;  4DF7 A;  5D8D A;  3IRB A;  4JI2 H;  2AMC B;  2BH2 A;  4OXP A;  2PQE A;  2L5T A;  1TS4 A;  3Q0A A;  2ZTD A;  4GKJ H;  2B8F A;  3CME A;  3PO3 B;  3H0G A;  1EIF A;  1B50 A;  4EQP A;  4LSA A;  4X65 L;  3CCM A;  1S10 A;  2VQF L;  3MR6 A;  2OTL A;  4HYK A;  2UXD H;  3WO1 A;  3SHL A;  1SCU B;  1A8V A;  4NW2 A;  1TKW B;  2K33 A;  4U7C A;  1ASZ A;  2E2I A;  2IW3 A;  5HBR B;  2SDF A;  5IGF A;  1BNZ A;  1E2Z A;  3KF6 B;  1SYE A;  3BZK A;  4DV3 L;  1TY2 A;  5C1O A;  3I4M H;  2UUA Q;  2JA6 B;  5DGB A;  4KY5 A;  1Q86 C;  3CCE A;  4P75 A;  4ED3 A;  4FU0 A;  1AUX A;  5JOB A;  4N8F A;  4JI7 Q;  1JE4 A;  4WFN 3;  2J6T A;  1N36 L;  3GIP A;  3MFH A;  3VR3 A;  1EU4 A;  1XTD A;  3MHB A;  1S0N A;  4LF5 H;  4WD3 A;  3JC6 6;  4J8Q A;  1FKA H;  2UUC L;  3ND8 A;  1VBH A;  4V19 0;  2NVY B;  1A3T A;  1IBL H;  3GIK A;  3HOW G;  4MHE A;  4BWG B;  4IPH A;  2V9W A;  1EUC B;  1WTP A;  2YL2 A;  1Y1W B;  2RDJ A;  3K3V A;  3HFZ B;  2NU8 B;  4J9L A;  1EZ6 A;  4IUQ A;  2Z6K A;  4CKE A;  5JQW A;  3H20 A;  2GN5 A;  4YY3 L;  2VB2 X;  3MWY W;  5AJ3 Q;  2KED A;  3A54 A;  4CBV A;  4DK3 C;  3SE7 A;  1W6J A;  1LTT D;  1GUO A;  1XMO Q;  5C44 H;  2F0W A;  1C48 A;  5KG4 A;  2C2E A;  4UCS A;  2UUB L;  2F4V Q;  5E1F A;  2V5A A;  3RBE A;  1SE4 A;  4FXK C;  2VQE L;  3PO2 H;  1SN8 A;  3OSN A;  3OTO L;  1JOQ A;  3M3Y H;  3GTO B;  3I12 A;  1B7Y B;  1Q7Y C;  2YYA A;  2A6H D;  4RUA A;  3SI8 A;  2ATW A;  2PQA A;  2PZU A;  3W5O A;  3KTM A;  1I50 B;  4C2M H;  1II3 A;  3UDI A;  5CA0 F;  1A2U A;  3BDL A;  5JVG 3;  3J7A F;  3EQL C;  2PMZ A;  1KJ8 A;  3TN2 A;  2AWN A;  4QF4 A;  3K3P A;  4JYA L;  3C1E A;  2WTF A;  4A2B A;  5LMN W;  4C3I B;  4YAJ B;  3A56 A;  5KFD A;  1SNO A;  4NLG A;  1EY7 A;  1UWV A;  3R8B A;  4A3D H;  1GD7 A;  1JT8 A;  4NXN L;  4ZK9 B;  1EIH A;  2UVV A;  2WII B;  4GN4 B;  4WRD A;  4FF2 A;  1CA5 A;  2A6E C;  3S24 A;  4O3Q A;  3CRL C;  5EAY A;  4X3T A;  2VW9 A;  2VS1 A;  4DV7 L;  3A5Z B;  5J2U F;  4BXX G;  5KG7 A;  3DHQ A;  4H02 A;  3G7L A;  4JK1 C;  5KX5 F;  4DPG A;  5A2Q L;  4ED0 A;  3NQT A;  3J80 i;  5LMU Q;  1ONL A;  3OYY A;  3HKZ E;  4K8J A;  1VQL A;  4DR4 H;  2XGT A;  1LV9 A;  3S2D B;  1K83 B;  3OIQ A;  1XNR H;  3LGJ A;  2HHH H;  4A3B B;  1F9S A;  3E9I A;  4HSP A;  5BR8 Q;  4RHR A;  2W7O A;  1YVC A;  1SYG A;  5CV6 A;  1WTO A;  3GO5 A;  5IOD A;  4DR6 L;  1JIH A;  4QWC A;  1PDQ A;  1FJG L;  2FLP A;  1LT6 D;  1CKN B;  2F0V A;  2G9D A;  4O0A A;  3IFT A;  3W3A A;  4GKJ Q;  3TQY A;  1HHV A;  2SEB D;  4NXM L;  1WTH A;  2VZA A;  2HVR A;  3URY A;  2B2V C;  3GTP H;  1GUN A;  3FHW A;  2LXK A;  1W2B A;  5DG7 A;  1JQY D;  2UXD Q;  1GLV A;  5D1O B;  2FLN A;  4DL5 A;  3DM3 A;  3N43 B;  1E22 A;  2WYO A;  2F0U A;  3GDE A;  3U4V A;  3GTL A;  3F8N A;  1I6H H;  1C9O A;  4UAI A;  3MC0 B;  4KKU A;  1WCM B;  2HJW A;  1DV2 A;  3OMC A;  2J6S A;  2MO0 A;  3VA5 A;  1DM0 B;  4LW1 A;  4HAE A;  4LF8 H;  3J7A K;  1PFS A;  2F03 A;  1GSH A;  2BOS A;  1W3S A;  4M9U A;  2K7V A;  4LH6 A;  5C0X H;  4FDB A;  3QR8 A;  5IT9 c;  4GNX B;  4BBR H;  4LF5 Q;  5DNF A;  1A63 A;  3BVM A;  1VQC A;  3S16 H;  2R93 A;  1CQJ B;  1V1P A;  2HDM A;  2W70 A;  4X3S A;  1IBL Q;  1IXR A;  4JV5 H;  4EEY A;  1E7Z A;  4M8A A;  5FK9 C;  1GUS A;  3CCR A;  4DU9 A;  1ZET A;  1PTO B;  2DNC A;  2OQ0 A;  1BUV T;  4OGQ C;  3MWE A;  2W6P A;  3OPO A;  2B2Y C;  3M7G A;  2W8L A;  2A1A A;  1TWH H;  1Y8N B;  3S15 B;  1ICF B;  4R4O A;  4JBW A;  4DL2 A;  2LKV A;  2UUA L;  2W9B B;  4ZLT F;  3NP8 A;  4H0L C;  2O5J C;  1CHQ D;  3ERQ A;  2E2J H;  3F2U A;  1RKN A;  4JI7 L;  4DR7 H;  2GA4 B;  4F87 A;  4IWY A;  2ZT9 C;  4QWB A;  4K5X A;  3ER0 A;  1VMC A;  4A75 A;  4GLX A;  2N78 A;  5EKK A;  4F7X A;  5K5P A;  1XMQ H;  4RGT A;  4Y52 H;  5KFA A;  2XCP A;  3JAM c;  2ASJ A;  1YNN C;  2I87 A;  4ZOL F;  1Y1V H;  1TWH A;  3OUU A;  5D65 A;  2Y0S E;  3MWD A;  3KF8 A;  4AYB G;  4B3T L;  1H9S B;  1VQE A;  4J9R A;  4HJ7 A;  1O75 A;  3I2Z A;  1W96 A;  1V43 A;  2L1B A;  4XYL B;  2XGQ A;  5DLQ E;  1LTI D;  1G6P A;  2L12 A;  2EYF A;  3JRW A;  3FKI B;  1S40 A;  1B04 A;  3PUY A;  2L9H A;  2R84 A;  2BA0 A;  3HBL A;  5I2X A;  5AJ3 L;  4CDC C;  5L9X A;  5KEE A;  4WBN F;  1XMO L;  2WAQ B;  1DV1 A;  3HOY H;  4XQN A;  1X32 A;  1Y1V A;  2Z9H A;  2A69 C;  1S5D D;  2KEE A;  3VYR A;  2R7Z G;  2MFI A;  2F4V L;  2E2I B;  3FMA A;  1VF7 A;  4Q0Y A;  1SR3 A;  4QIW B;  1PZK D;  1G2S A;  1SNM A;  3PVX A;  2EJF C;  3I70 A;  1HTL D;  3ERO A;  4R4I A;  1DYQ A;  4J9K A;  4GN3 B;  3NEL A;  2K04 A;  4DR4 Q;  1B33 N;  3QFF A;  5J1Z A;  4L5Q A;  3GV8 B;  1Q12 A;  3KDF A;  3FEW X;  3H40 A;  1STE A;  1XNR Q;  2BE5 C;  2HHH Q;  3IFD A;  2JE6 I;  4C5C A;  2HQE A;  3MEH A;  4BY1 H;  3M9M B;  2FK3 A;  1X9N A;  2ZTC A;  3MZ5 A;  4MV8 A;  4PDB A;  3MFY A;  2K6A A;  5EPL A;  1R4P B;  4DUY L;  3L2P A;  1TWC H;  3I4M B;  4RAZ A;  1N33 H;  3NSW A;  4NDX A;  2YZG A;  3K5O A;  5IYB H;  1OXT A;  3OWE B;  2JA9 A;  4A3F G;  4BY7 G;  4LH7 A;  2XCA A;  3PMF A;  3HOX H;  4KHP H;  2B2T C;  2DY8 A;  4R8I A;  1GUG A;  1KJ9 A;  1HTP A;  3LWE A;  1IL2 A;  1BCP B;  1UC9 A;  2OLS A;  1I4Q A;  3M85 A;  1FL0 A;  4PMC A;  1SE8 A;  1EOT A;  3BDO A;  5LMU L;  3L9A X;  1YIJ A;  3GTG H;  4I7A A;  2XC9 A;  2R85 A;  2N8N A;  1ENF A;  3U4Z A;  3K5H A;  1TXY A;  5EJW A;  2D9U A;  1IBM H;  2WIN B;  2P5Z X;  4LF8 Q;  1LAC A;  3AMU A;  2JA7 H;  1H9J A;  1K0R A;  4G4K A;  4PWQ A;  2YU9 A;  4QW9 A;  1RIP A;  1YHQ A;  4A3K H;  3WOE A;  5E4W C;  4IUU A;  5C44 B;  4GKJ L;  2FKL A;  3JZI A;  4WOR A;  4XIG S;  1N34 H;  1Q90 A;  2C00 A;  2X6L A;  2UXC H;  4L5R C;  3M4O H;  5ELO A;  4JV5 Q;  4TKO B;  1EQT A;  3VR6 A;  1PZJ D;  2QA4 A;  2GPW A;  2UXD L;  1PTO D;  3D8G A;  3R2T A;  1NSN S;  2FJZ A;  2YS6 A;  2WB1 E;  3S14 H;  3PO2 B;  3W1G A;  4DR5 H;  5C0X I;  2JJQ A;  4QWE A;  2SCU B;  3M3Y B;  5IYD G;  2W6M A;  2W7P A;  4KI0 A;  1SYC A;  3HOZ G;  1PH8 A;  3RB4 A;  4MA5 A;  1BBW A;  3Q8Q B;  3KLR A;  4MIU A;  3J80 L;  1EYA A;  2AWO A;  2B3G A;  4O3N A;  1J5E H;  4ZUJ A;  1TA8 A;  3RB6 A;  4C2M B;  3HKZ A;  3DXJ C;  2CQO A;  4DR7 Q;  4RKB A;  2JEG A;  5BN4 A;  1NAP A;  2F0T A;  3QB3 A;  5FOB B;  3BVZ A;  1XMQ Q;  2NN6 H;  1D5Z C;  4K2K A;  4LF5 L;  2F0J A;  1BO0 A;  4RGO S;  1XWE A;  1T94 A;  3BJY A;  2VA2 A;  3ETH A;  3G71 A;  2EOT A;  2J7Z A;  1IBL L;  2JA5 H;  1TS2 A;  4A3D B;  1AP0 A;  2R92 A;  2L0C A;  1JCK B;  2F0G A;  1KJQ A;  3GTM H;  4O3P A;  4EQO A;  5ISR A;  2RVL A;  2E74 C;  4CJ2 C;  2DY7 A;  2FHT A;  2K5D A;  5M3F H;  1UUP A;  2IA6 A;  1U9R A;  1G2T A;  3PR5 B;  3H15 A;  4TV8 F;  3Q8P B;  1KL9 A;  5KG2 A;  1UE1 A;  2RBM A;  2JA5 A;  1YNX A;  5I9P A;  4AQY H;  4JI3 H;  4DLK A;  3T51 B;  3JSL A;  5KFJ A;  4E6I A;  4XYO A;  1WYD A;  2Z0S A;  4ZAI A;  4RAY A;  1JIC A;  4K0K H;  5GRO A;  3KBX A;  1Y14 B;  3RGZ A;  3RJ0 A;  4YAK B;  4LF6 H;  4JPB W;  4KKT A;  1Q1B A;  1G8Z D;  4NPS A;  2D5D A;  3Q6S A;  3TDQ A;  2QDB A;  5M9O A;  1HFN A;  3GTP B;  2RQX A;  3E0J A;  4RH6 A;  1SLJ A;  1CE8 A;  2R86 A;  4FO2 A;  4F8M A;  4XQJ A;  2K5V A;  3MTS A;  2RKS A;  3TII A;  1I94 L;  2W57 A;  4OWX B;  2FPI B;  1I6H B;  1HNW H;  4RZR A;  1N33 Q;  1XPU A;  4XYQ A;  4IUP A;  2CWP A;  2SNM A;  4QGU A;  4A93 H;  4ECY A;  2YTY A;  4EBD A;  1J9O A;  4HIM A;  4IUV A;  3BG5 A;  2NTT A;  3HRZ C;  5HY6 A;  4KHP Q;  1WTV A;  1QG7 A;  4BBR B;  1XPR A;  3A7A B;  1DCZ A;  2F0H A;  4DV5 H;  1TAE A;  3RMH A;  1BCP D;  1EY9 A;  3X3N A;  3STB D;  3S16 B;  3MAQ A;  1JLL B;  4C1N I;  1QUQ A;  1SJE D;  4HED A;  1G29 1;  3R5H A;  5CA1 F;  3A8I E;  4ECS A;  4JW0 A;  2Q2H A;  2JN4 A;  2PYK A;  3A0J A;  2CHB D;  4QB4 A;  4JOI C;  1C30 A;  2ZJT A;  2Y0S A;  4I65 A;  4OX9 L;  3NHH A;  1AZP A;  1RCV D;  1XNR L;  3NQI A;  5CAE B;  2HHH L;  1K1Q A;  1L1O B;  1KLG D;  4RMF A;  4LF7 H;  1IBM Q;  4L63 B;  5C4J H;  4X64 H;  1TWH B;  2XRQ D;  5EBC A;  4EGV A;  1SND A;  4XT1 B;  3PO3 G;  3FPU B;  4O2A F;  1EOV A;  2VPS A;  4HJ8 A;  2NTS A;  1X6O A;  1DON A;  1N34 Q;  4DUZ H;  2DZD A;  1C7Y A;  4IFD G;  2UXC Q;  2E2J B;  1C3O A;  1ROD A;  3QWN A;  1EFI D;  2AUJ D;  3BU2 A;  3BVG A;  3CCV A;  1STB A;  2RDH A;  1VQA A;  5EKL A;  1B8A A;  4DR5 Q;  1CT1 D;  1Y1V B;  3RZO H;  3HOU G;  3Q8S B;  2KHJ A;  3OHA A;  1STA A;  1UNN C;  3C2P A;  3BAB A;  4R8U B;  1A0I A;  1F9R A;  2YTV A;  1MKH A;  4CGY B;  3SE0 A;  4POG A;  4C3H G;  3SR1 A;  5FLM H;  5C8Y F;  1T5X D;  1EFW A;  1CUK A;  1WTQ A;  3PZP A;  5BPF A;  4KMU C;  2MPM A;  4EFB A;  2PMZ E;  4RNN A;  1J5E Q;  5KFP A;  4LF8 L;  2WE6 A;  4O3S A;  2A8V A;  3GP7 A;  3SVM A;  3FDS A;  3I7F A;  1R9T H;  1SYB A;  5KFK A;  2OXP A;  2EXD A;  2F3W A;  1VQM A;  3MXN A;  2AQ4 A;  3M4I A;  2VNU D;  1K3B C;  4ZQ3 A;  3PIP A;  2HUG A;  3D4R A;  1A3V A;  1JB7 A;  2FMC A;  3RGX A;  1Y1W G;  2K14 A;  5EQ0 A;  4TV9 F;  2MQH A;  4JV5 L;  4U6P A;  4KLK A;  2ZDQ A;  4DV1 H;  4ZKC B;  2AUK A;  2L4N A;  1SMY C;  2UU9 H;  5C1P A;  2NN6 I;  2PI2 E;  2B8G A; 
#chains in the Genus database with same CATH homology
 1IBK L;  2XTI A;  4XTC S;  4A3G G;  2NVT H;  2Q2I A;  3HFZ B;  1WI5 A;  4LNQ A;  1VQI A;  1AE3 A;  2Z6K A;  1X3F A;  3OW2 A;  1KD1 C;  2E2H H;  5IYB G;  3SGI A;  5C3E G;  4DV0 Q;  2GN5 A;  4YY3 L;  2ZM6 L;  1QZG A;  5AJ3 Q;  4JI3 Q;  4AQY Q;  4DK3 C;  1AE2 A;  2B63 H;  4BBS G;  1K3R A;  1XMO Q;  1PH9 A;  3UDG A;  3HOX G;  1XMQ L;  1LTL A;  5C44 H;  1KIX A;  3U50 C;  1ASY A;  2I5H A;  1L1O A;  1N8R C;  2H5X A;  3RZD H;  4K0K Q;  1JJC B;  2UUB L;  4RG1 A;  2F4V Q;  3EBE A;  4X66 Q;  2A19 A;  4LF6 Q;  5IP9 H;  2RF4 A;  3K7A H;  1I3Q H;  2VQE L;  3PO2 H;  2K4K A;  1CKM A;  1SN8 A;  2OCE A;  4JI1 L;  5M5W H;  3OTO L;  3AFQ A;  4DR1 Q;  2NVQ H;  3M3Y H;  3S1Q H;  2I5L X;  3GTJ H;  4DR2 L;  1VQB A;  1G51 A;  1NBW A;  2OQK A;  3CCJ A;  1B7Y B;  1Q7Y C;  3CW2 C;  2JQO A;  4IJL A;  3D0F A;  1X55 A;  4PMW A;  2JA7 G;  3HOU H;  1AH9 A;  2MO1 A;  2ATW A;  2NVX H;  2PQA A;  1VQG A;  3W5O A;  1S72 A;  1I94 Q;  1HNW Q;  4C2M H;  3UDI A;  3A5U A;  4C3J H;  2QEX A;  3KFU A;  4IPC A;  4C3H H;  1C0A A;  4JI6 L;  2AWN A;  4Y7N H;  3NEM A;  1HZC A;  4JYA L;  4BBR G;  3CXC A;  5LMN W;  3ULP A;  4A3E H;  4UY8 C;  1QVF A;  2JEA I;  3NEN A;  4DAY B;  1Q82 C;  1UWV A;  3PF4 A;  1M90 C;  1HH2 P;  3KLW A;  4AYB E;  4IOA A;  3KF6 A;  1VQ6 A;  4A3D H;  1GD7 A;  1JT8 A;  4NXN L;  4DV5 Q;  2Z6K C;  1X3G A;  1HJP A;  4GN4 B;  1V9P A;  2CKZ B;  4POF A;  4OWW B;  2JA8 H;  5LMN Q;  3CPF A;  3S24 A;  1Q8K A;  5GAG C;  5EAY A;  2VW9 A;  3H3V I;  2VS1 A;  4DV7 L;  1N9W A;  1JJ2 A;  2VL6 A;  4DV4 Q;  3A5Z B;  2LXJ A;  4BXX G;  3AYH B;  4H02 A;  3STB C;  4OX9 Q;  2OTJ A;  4TQU S;  4DPG A;  3T1Y L;  2IY5 B;  2RHS B;  4LF7 Q;  1L1O C;  3J80 i;  3CCS A;  2RCN A;  1YI2 A;  5LMU Q;  4DK6 C;  4DR4 L;  3HKS A;  1CSQ A;  1MJC A;  3OYY A;  4X64 Q;  3HKZ E;  1TWA H;  1EUJ A;  4A3I G;  2XGT A;  4A3M G;  1Q46 A;  1K9M C;  1VQL A;  4A3G H;  3K8A A;  3LGJ A;  3H0G H;  5ELN A;  1N33 L;  1HZA A;  3E9I A;  2K75 A;  3KYH C;  4MZ9 A;  5BR8 Q;  3PF5 A;  1YVC A;  1KC8 C;  1EIY B;  4B3R Q;  3GO5 A;  4JCV E;  4QL5 A;  3TRZ A;  4DR6 L;  4DUZ Q;  4DR3 L;  5IE8 A;  2HQL A;  1FJG L;  3KF8 B;  1CKN B;  1Y1V G;  5C0X J;  4BBS H;  4LWC A;  4O0A A;  4KHP L;  1NMF A;  1PH7 A;  3HOW H;  4GKJ Q;  3TQY A;  4NXM L;  4JI8 Q;  2VZA A;  3G4S A;  4HIK A;  2JK8 A;  4UP8 A;  5M3F G;  3GTP H;  3FHW A;  2LXK A;  5M5Y H;  2VQF Q;  1W2B A;  3A74 A;  1U0L A;  3I55 A;  3J7A 5;  4AH6 A;  2UXD Q;  1NY4 A;  5C4X G;  3DM3 A;  4YWM A;  1XJV A;  2JA6 G;  1E22 A;  3RNU A;  1PH3 A;  1CKO A;  1YJW A;  3CP0 A;  3GDE A;  3U4V A;  3J80 c;  1I6H H;  1D7Q A;  1C9O A;  4HID A;  4HJA A;  3HOY G;  1VQ9 A;  1A62 A;  2E5L L;  1X54 A;  5IY0 A;  4PG3 A;  2MO0 A;  3CAM A;  1VQN A;  4LW1 A;  1VQ8 A;  1EWI A;  3ICE A;  4IO9 A;  1PFS A;  1W3S A;  1N34 L;  4DV2 Q;  2IHF A;  2UXC L;  1N36 Q;  4FDB A;  1IYJ B;  5IT9 c;  4GNX B;  4BBR H;  1D8L A;  4GLA C;  4LF5 Q;  3AFP A;  3M7N A;  1A63 A;  4A76 A;  1VQC A;  3JAM i;  4DV1 Q;  3S16 H;  1EQR A;  3KDF B;  4A3L G;  2HIV A;  2UXB L;  4GOP A;  2ES2 A;  1IBL Q;  1IXR A;  2UU9 Q;  4LF9 L;  1XPO A;  1E7Z A;  4DR5 L;  3CCR A;  4A3C G;  3GTQ H;  1L0W A;  3AQQ A;  4LFB L;  2OQ0 A;  1X3E A;  4A3J H;  5JJK A;  4BY1 G;  2A1A A;  1TWH H;  5GQO A;  4JI0 L;  4BXX H;  4R4O A;  1NE3 A;  4JBW A;  1SRO A;  4DV6 L;  4IOC A;  1KAW A;  3PGZ A;  2UUA L;  2OWO A;  4A4I A;  1LM0 A;  1OXX K;  4EX5 A;  1M1K C;  4A3I H;  1QUQ B;  3UDF A;  4A3M H;  2E2J H;  2RHQ B;  4IPG A;  2Q2U A;  4DR7 L;  4JI7 L;  4ME3 A;  1XNQ Q;  1GO3 E;  1OTC A;  2N3S A;  4JI5 Q;  3ER0 A;  4A75 A;  3W1B A;  2N78 A;  4GLX A;  1GM5 A;  1LUZ A;  3PO3 H;  4Y52 H;  1NTG A;  3JAM c;  2VQE Q;  1YJ9 A;  2KCM A;  1Y1V H;  3FKI G;  4UPA A;  1BBU A;  4YCU A;  3EN2 A;  4JI4 Q;  2Y0S E;  1SFO H;  1Z47 A;  1P16 A;  4X62 Q;  4DR2 Q;  1H95 A;  3K0X A;  3M4P A;  4B3T L;  4AYB G;  4YHH L;  1VQE A;  2K50 A;  1CKN A;  4HJ7 A;  3I2Z A;  1V43 A;  3UDX A;  4L5S A;  4OO1 I;  3GTK H;  5DLQ E;  4R1J A;  1G6P A;  5C4X H;  3KJO A;  2NZH A;  3RLO A;  2IX0 A;  1S40 A;  2JA6 H;  3PUY A;  4IFD I;  4DV0 L;  4JI6 Q;  1EQQ A;  2BA0 A;  1PH4 A;  4JI3 L;  5AJ3 L;  4AQY L;  4GOP C;  1VQP A;  1L2F A;  2YV5 A;  2ZJQ A;  1XMO L;  4MNO A;  4A3K G;  4LFC Q;  5M3M H;  3HOY H;  5IWA Q;  3AEV A;  2GVB A;  4DAM A;  4LF4 L;  5FJ8 G;  3HKZ G;  3TS2 A;  4WJ3 M;  4HJ5 A;  1VQJ A;  1N32 Q;  4K0K L;  2R7Z G;  4GKK L;  2AKW B;  2MFI A;  2F4V L;  3T1H Q;  1RL2 A;  4X66 L;  4LF6 L;  3M4Q A;  1QZH A;  1SR3 A;  4B3S L;  2WAQ E;  2NVY H;  1KHI A;  4ALP A;  5FLM G;  3S17 H;  2EQS A;  1U5K A;  4DR1 L;  4A3L H;  1BKB A;  1VQH A;  4R4I A;  1Y1W H;  2R92 G;  3HOV G;  3S15 H;  2FXQ A;  1HNX Q;  4GNX A;  4P73 A;  4A3B G;  3MEF A;  4GN3 B;  3NEL A;  2HIX A;  4UP9 A;  4QIW E;  2DGY A;  1NJI C;  1J6Q A;  4L5Q A;  4DR4 Q;  4QJF A;  1Q12 A;  3KDF A;  3J7Z C;  1V1Q A;  1VQD A;  3RLN A;  2PI2 A;  1XNR Q;  3S1N H;  3PUW A;  2HHH Q;  3KOJ A;  3J81 c;  1E24 A;  2JE6 I;  4JBK A;  2IHE A;  3PCO B;  1HR0 Q;  4BY1 H;  1GKH A;  3H3V H;  2NN6 G;  4JI2 L;  1X9N A;  2ZTC A;  3CCQ A;  3RN2 A;  4DR3 Q;  2D62 A;  2F3I A;  4DUY L;  3PUZ A;  5E7N A;  4DKA C;  1TWC H;  3F8T A;  3L2P A;  1K8G A;  1HNW L;  1X56 A;  3S1M H;  5IYB H;  2KBN A;  1EYG A;  4P74 A;  5C3E H;  2JA5 G;  1OXT A;  4IJH A;  2R7D A;  2JA9 A;  1UEB A;  4A3F G;  3ULJ A;  3CCU A;  1HNZ Q;  4DV5 L;  4NXM Q;  1SMX A;  3I4N G;  1VQ5 A;  4APV A;  2VUM G;  4BY7 G;  2R93 G;  3PSI A;  5LMN L;  1KQS A;  3I4O A;  5GAD C;  1E1T A;  3G48 A;  4YWL A;  3HOX H;  3GTO H;  3F2C A;  2CFM A;  2R7F A;  4DV4 L;  1IL2 A;  1WCM G;  1QVC A;  4X65 Q;  3M85 A;  1FL0 A;  4GLV B;  4LF7 L;  4B3M Q;  1SE8 A;  1VQ7 A;  3D31 A;  1FGU A;  1I50 H;  1WOC A;  4PZ8 A;  5LMU L;  4X64 L;  1YIJ A;  1TWF H;  3GTG H;  5K36 G;  3K81 C;  2R93 H;  5C44 G;  2N8N A;  1MIU A;  3U4Z A;  1K73 C;  2E5L Q;  1IBM L;  1TXY A;  1YEZ A;  4OO1 G;  4LF8 Q;  1LYL A;  4DV3 Q;  1X65 A;  4C3I H;  4B3R L;  4OWT B;  3U58 A;  4AIM A;  2JA7 H;  4OON A;  1K0R A;  4LFA Q;  5IP9 G;  3J81 j;  4GN5 A;  1I5F A;  1RIP A;  2E8G A;  1YHQ A;  5HGQ A;  1PA6 A;  4PZ6 A;  4GNX C;  4JBM A;  1P8L A;  3PO2 G;  5M5X H;  3F1Z A;  4A3K H;  5IP7 G;  1JJG A;  2ID0 A;  3K7U C;  4GKJ L;  3BZC A;  4HIO A;  4XIG S;  4JI8 L;  3E9H A;  3GD7 A;  2JEB I;  5FJ8 H;  4L5R C;  4J15 A;  5ELO A;  3M4O H;  3CCL A;  2R7Z H;  4JV5 Q;  2PNH A;  2QA4 A;  2UUC Q;  2UXD L;  2I5M X;  2WB1 E;  3S14 H;  2YTX A;  3W1G A;  5C0X I;  3KJP A;  2JJQ A;  1QVG A;  2N49 A;  1YBY A;  5IYD G;  1PV4 A;  4KI0 A;  1PH5 A;  1IBK Q;  4WJ4 A;  3HOZ G;  1PH8 A;  1K83 H;  3UE1 A;  3HOV H;  2ZJP A;  1KRT A;  4A3E G;  1BBW A;  3S2D H;  2Y0S G;  4A3B H;  2EIF A;  2AWO A;  1VS0 A;  2B3G A;  4R4Q A;  3UE0 A;  1J5E L;  3I4N H;  5JJL A;  4NB3 A;  1VQO A;  2QGQ A;  2BH8 A;  2GVA A;  4YY3 Q;  2ZM6 Q;  1K8A C;  4A93 G;  2CQO A;  2VY3 A;  1NMG A;  4DR7 Q;  1Z9F A;  4DV2 L;  1VQF A;  1PVO A;  1OXU A;  3RN5 A;  1XMQ Q;  4LF5 L;  2D0O A;  2NZO A;  3PUX A;  1T9H A;  3CMA A;  4DV1 L;  3G71 A;  3L0O A;  2UUB Q;  2KCT A;  1E1O A;  1IBL L;  2UU9 L;  2JA5 H;  4R4T A;  3CC2 A;  4A3F H;  4JC0 A;  4BY7 H;  2F52 A;  2L15 A;  3ULL A;  2VUM H;  4B3T Q;  3CC4 A;  3GTM H;  4JI1 Q;  1TWG H;  3OTO Q;  1KRS A;  3H0G G;  1KXL A;  2IT1 A;  1CSP A;  2ALY B;  2WAQ G;  1SRU A;  1WCM H;  5IYC G;  5M3F H;  1YZ6 A;  4JBJ A;  1PYS B;  3BJU A;  4UP7 A;  1B70 B;  3H15 A;  3J81 i;  1KL9 A;  4YWK A;  1DGS A;  1UE1 A;  3ZJY C;  4LF4 Q;  1YNX A;  4GS3 A;  4JYA Q;  1O7I A;  1XNQ L;  3PV0 A;  4JOI A;  4GKK Q;  4YCW A;  4JI5 L;  1PYB A;  4LUO A;  1JE5 A;  1MJE A;  1WYD A;  2Z0S A;  1E3P A;  4YCV A;  4B3S Q;  1VQ4 A;  2ZTE A;  5GRO A;  4NXN Q;  3CC7 A;  1Y14 B;  4X6A H;  5IP7 H;  4JI4 L;  4O2D A;  3CPW A;  4X62 L;  1Q1B A;  1HZ9 A;  2BA1 A;  4IPD A;  4NPS A;  1VQK A;  3E0E A;  2WP8 J;  3PUV A;  4DV7 Q;  3B6Y A;  1SLJ A;  2K5H A;  3MXN B;  5JEA G;  1PH2 A;  4LUZ A;  1HR0 W;  2ZJR A;  3T1Y Q;  3I4M G;  2LSS A;  3WWV A;  2K5V A;  2WFW A;  3FP9 A;  2D0P A;  3F2D A;  5C0X G;  4PZ7 A;  4A3C H;  3EIV A;  4TVA B;  3RLF A;  3NBH B;  4JI2 Q;  4OWX B;  4DNI A;  2V1C C;  2R6G A;  4GOP B;  1I94 L;  1JMC A;  2IX1 A;  3GTL H;  3HOZ H;  4BA2 I;  5GAH C;  4LFC L;  4DUY Q;  1N33 Q;  2ASB A;  5IWA L;  1XPU A;  4QY7 A;  2CWP A;  5JJI A;  4QGU A;  4DR6 Q;  1PHJ A;  1N32 L;  2DUD A;  4A93 H;  3RR5 A;  1IZ6 A;  2YTY A;  1FJG Q;  5GAE C;  3ERS X;  2YYZ A;  4HIM A;  3T1H L;  3S2H H;  3F2B A;  4JG2 A;  1UE7 A;  5J3B A;  5HY6 A;  4KHP Q;  4BA1 I;  1XPR A;  4A3J G;  3S1R H;  3G6E A;  2KEN A;  1OXS C;  2MNA A;  3STB D;  3CQZ H;  1FVI A;  2YU9 H;  1QUQ A;  2Q2T A;  2K52 A;  1G29 1;  1HNX L;  2Q2H A;  3A0J A;  4JOI C;  3I56 A;  4OX9 L;  3TEH B;  3FKI H;  2K5N A;  1XNR L;  1WJJ A;  2B29 A;  2HHH L;  1L1O B;  4RMF A;  1YJN A;  1IBM Q;  2C35 B;  2B63 G;  1HR0 L;  4LUV A;  4EQ5 A;  5C4J H;  2WB1 G;  1VCI A;  5JEA J;  5IYC H;  4MTN A;  4R4C A;  3PO3 G;  3CD6 A;  5BR8 L;  1Q1E A;  1EOV A;  4KHZ A;  4HJ8 A;  1PH6 A;  3DLL A;  1YHB A;  1X6O A;  4HJ9 A;  3PIO A;  2E2I H;  4DUZ L;  1N34 Q;  2CWA A;  1C7Y A;  4IFD G;  2UXC Q;  3IRB A;  5H1S E;  1HNZ L;  2AMC B;  2BH2 A;  4OXP A;  1YIT A;  3M9B A;  5FLX c;  3BU2 A;  2PQA B;  3TRE A;  3CCV A;  3K80 C;  2ZTD A;  2UXB Q;  3CME A;  1EIF A;  1VQA A;  4LF9 Q;  1B8A A;  4DR5 Q;  4X65 L;  3CCM A;  3VDY A;  3HOU G;  1UE6 A;  2KHJ A;  2VQF L;  1UE5 A;  3RZO H;  2AHO B;  4B3M L;  2OTL A;  1A0I A;  2YTV A;  4P71 A;  1MKH A;  4POG A;  4LFB Q;  1A8V A;  5FLM H;  5M3M G;  1EFW A;  1ASZ A;  1CUK A;  3Q8D A;  4QQB X;  4JI0 Q;  2PMZ E;  3KF6 B;  1HZB A;  3BZK A;  4P72 A;  1J5E Q;  4DV3 L;  2I0Q A;  4LF8 L;  2A8V A;  2R92 H;  3I7F A;  4DV6 Q;  2UUA Q;  1R9T H;  3I4M H;  1S3O A;  1Q86 C;  4LFA L;  3CCE A;  2EXD A;  3L7Z C;  1GVP A;  1VQM A;  4P75 A;  1BVS A;  4A3D G;  5IYD H;  2VNU D;  3TS0 A;  3PIP A;  4JI7 Q;  2JA8 G;  1Q81 C;  1N36 L;  1WFQ A;  2KHI A;  1OXV A;  1JB7 A;  1Y1W G;  2K14 A;  1XTD A;  2MQH A;  2CCZ A;  4JV5 L;  3CF5 A;  3JC6 6;  4KLK A;  2UUC L;  4IFD J;  2HT1 A;  1YHA A;  4L5T A;  1PH1 A;  3HOW G;  2NN6 I;  2PI2 E;  4YHH Q;  4IPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...