4A3JG

Rna polymerase ii initial transcribing complex with a 2nt dna-rna hybrid and soaked with gmpcpp
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3jG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3jG01
2UU9Q 3HOUH 1JJCB 1PFSA 3CCEA 5LMUL 3CC4A 3K7UC 2I5LX 3H3VI 1V43A 4A3IH 2VQEL 5JJKA 4DV4L 5LMUQ 5IY0A 5LMNL 2DUDA 2JA6G 3S17H 1K9MC 5JJIA 5FLXc 4DV3Q 1Q81C 1TWHH 1SFOH 1HR0W 1VS0A 2UXCQ 3PO3G 3KLWA 5IYCH 2WAQG 1VQEA 2QA4A 1PHJA 2JA7G 4A3LH 4DV0L 5DLQE 3K7AH 1TWGH 5HY6A 4A3JH 1XPOA 3J7A5 1A63A 1CSQA 4NXNL 2WP8J 4JG2A 1HNZL 2BA1A 2UU9L 1XNQL 2DGYA 3CPWA 2ES2A 1VQBA 1Y1VG 3KJOA 5IP9H 4L5QA 4X6AH 1PVOA 3E9HA 4AQYQ 4LFCL 1EOVA 2MO1A 3JC66 1QZHA 2XTIA 3PUXA 1XPRA 3FKIG 4IPCA 3S16H 3PO2G 1OXSC 3FKIH 1VQ5A 3GTKH 4H02A 3HOZG 4IJHA 4JOIA 4IFDJ 4TQUS 4BY7H 3G48A 1VQMA 1WI5A 1X54A 5H1SE 3EBEA 4HIDA 4MZ9A 4YCUA 3RZDH 3RN2A 2OQKA 3SGIA 3L0OA 1P8LA 1T9HA 3EIVA 4AQYL 4A3JG 5FJ8H 2PI2A 1CKNB 1KIXA 5M3FG 2JA6H 3GTOH 1AE3A 3GO5A 4DV1L 5FJ8G 1KXLA 1VQDA 4OXPA 1SR3A 2K75A 3S2DH 3CW2C 2AMCB 1VQCA 2ZTEA 1IL2A 1HNWL 1PH1A 3CPFA 1QVGA 1N33Q 3F2CA 4XTCS 4DR4L 1H95A 4A76A 1SLJA 2Z6KC 3HOWG 3PO2H 2I5MX 4A3EH 3M4OH 3JAMc 4UY8C 1LUZA 2N49A 3B6YA 4JI7L 4AH6A 3J81c 1EIFA 3GD7A 1XMOL 2D0OA 3ER0A 2JEBI 1NTGA 4LF9Q 2K52A 5IWAL 2HHHL 3RN5A 4IPGA 1L1OA 3TQYA 3ERSX 4DV5Q 1B7YB 1WCMG 2KCMA 4FDBA 4LF9L 1KD1C 1RL2A 1X55A 4OONA 1NE3A 4GN4B 4PG3A 4QY7A 4HJ9A 4X66Q 2YU9H 4LF4L 1GD7A 2OTJA 1YEZA 3F1ZA 4BY1G 1VQ6A 4DV7Q 3OTOQ 2E5LQ 2A19A 1AE2A 1X56A 4KI0A 4RG1A 4YWLA 4NXNQ 3AFQA 4NXMQ 2R92H 4OO1I 4JI4Q 1GM5A 3GTLH 4YCVA 3LGJA 4PZ8A 4JI7Q 1PV4A 1L0WA 2AHOB 1PH8A 4JI1L 2UXDQ 2LXJA 1UE7A 4WJ4A 3CCVA 1N8RC 5JEAJ 3NELA 4X62L 1JMCA 4MTNA 2CWPA 2JJQA 4P75A 1CKMA 3RR5A 4JI3Q 4X65Q 4A3MH 2UUCL 4A3KG 1QZGA 4A75A 4LF6L 5IYDG 4BXXG 3OTOL 4A3EG 5GQOA 4A3CG 4AIMA 2MFIA 1UE6A 5IWAQ 3J80i 1YI2A 4LF6Q 4DV2Q 1Y1VH 4LFAL 4JOIC 2C35B 4JI2Q 5C44G 4JI5Q 3M4QA 4YY3Q 4POGA 1AH9A 1VCIA 3G4SA 3K81C 2F4VL 1HR0L 3W1GA 4DR3Q 4JBKA 4DV7L 5IYBH 4BBRG 2R7DA 4R4TA 2YYZA 2VW9A 1IBMQ 3STBD 1X3GA 4QIWE 1VQJA 4QJFA 4LUZA 1D8LA 1ASYA 4B3TL 3PUZA 4IPDA 1YIJA 1HNXL 2GVAA 3CC7A 5M3MG 1VQGA 2YTVA 4POFA 4HIOA 1HZ9A 2Q2UA 4O2DA 1U5KA 3HKSA 4YWMA 1J5EQ 1I94L 3UDFA 1D7QA 3BZCA 2NN6G 4DUZL 1E1OA 1Q7YC 1IBLQ 2I5HA 3WWVA 3S24A 2NVYH 4B3MQ 1A8VA 4Y52H 4LFAQ 1K8AC 1JJGA 3A5ZB 3S2HH 2YTXA 3M4PA 4A3BH 3KF6B 1HR0Q 2ASBA 1S40A 2XGTA 2CQOA 1VQHA 3M85A 4X65L 2UUCQ 4LF5L 1HNXQ 4GLVB 3CCSA 4RMFA 2GN5A 1E24A 2WFWA 4OO1G 4QQBX 3CMAA 1IYJB 3K0XA 3J7ZC 1PH4A 3CAMA 4DV1Q 3U4ZA 1G51A 1UWVA 1Q46A 3EN2A 3CD6A 3STBC 4TVAB 4B3ML 2R7ZG 4KHPL 1N32Q 4DR7L 1BVSA 4X64L 4P71A 5EAYA 2EXDA 4NXML 2K5HA 3K8AA 2OTLA 2IX1A 4JI0Q 2NVTH 3CC2A 1NY4A 2Z6KA 4K0KL 4X64Q 3I4NH 1KRTA 2ZJQA 4C3JH 2D0PA 4JI2L 4JI8L 1V9PA 2GVBA 1NJIC 2WB1E 3KYHC 2D62A 4LWCA 4UP9A 3DM3A 3G71A 2ZM6Q 4YHHL 3UDXA 3HOWH 4C2MH 1UE5A 1M90C 3Q8DA 4KHZA 4LF7L 1J6QA 5IP7H 3HOXH 4A3FG 4GOPA 2ATWA 4DV0Q 2JA8H 3HOVG 4LF5Q 1KC8C 4A3DH 1MJEA 3L7ZC 4C3HH 1EQQA 5LMNW 2R92G 1HNZQ 2R6GA 5HGQA 2ZJRA 1VQ9A 2JA5H 4L5SA 3KF6A 3G6EA 5IYBG 3GDEA 1X3FA 4JCVE 2E2HH 1N33L 3PGZA 1FJGQ 1C7YA 2K14A 5ELOA 4LF8L 1P16A 3K80C 5C4XH 3MEFA 2AKWB 3CCMA 3UE0A 1EWIA 3I4MG 1L2FA 5FLMH 2FXQA 3BU2A 4A3IG 4LW1A 5FLMG 4KLKA 4GNXC 3A74A 1PYSB 4B3SL 1MJCA 2KBNA 3CQZH 3I4NG 1X9NA 3F2DA 4DR7Q 3W1BA 2H5XA 5C3EG 1HH2P 1UE1A 4L5TA 3I7FA 3L2PA 4DV6L 2VZAA 1LTLA 2WB1G 1EFWA 2Q2TA 2JE6I 4XIGS 4JYAL 1OXTA 3CMEA 3UE1A 3KOJA 4A3FH 5E7NA 3HKZG 3RLFA 1N9WA 4DV2L 3S1MH 1I5FA 4UP7A 1YJ9A 4YHHQ 1VQPA 3PO3H 1RIPA 3PUWA 4B3SQ 2JA5G 1C0AA 5M5XH 1YJWA 2JK8A 4LF8Q 4NPSA 2UUAL 4JI3L 3HOZH 4J15A 3GTQH 2PMZE 2AWOA 1Q1BA 4IPHA 1S3OA 4GKKL 1Q1EA 1W3SA 1R9TH 1JB7A 3T1HQ 3JAMi 1CKOA 3HKZE 5GAGC 1YHBA 5AJ3Q 3F2BA 4OWTB 1J5EL 3GTPH 1WOCA 2NZHA 3F8TA 2NZOA 3OW2A 3TS0A 5M5YH 4DV4Q 1N32L 4JV5L 2RHQB 5GAHC 1EQRA 4BXXH 1GO3E 3M7NA 2UXCL 4DPGA 1Q82C 5JJLA 2PNHA 3RZOH 3OYYA 4OWXB 2PI2E 1MIUA 2Y0SG 1OXXK 2B63G 4IO9A 1I3QH 1E7ZA 3ZJYC 5IYCG 5GADC 3FHWA 4OX9L 1XMQL 2UUBL 2JA7H 2YV5A 5GAEC 1N34Q 1K3RA 1WCMH 4DR5L 2F4VQ 3AFPA 1G6PA 3PV0A 2A8VA 2B63H 2EIFA 4GOPB 4DR5Q 3IRBA 3CF5A 3PIOA 2R93H 1YITA 2JEAI 4A3GG 1YJNA 1PH7A 1FL0A 4YY3L 1VQLA 1X3EA 1BKBA 2R7FA 2LSSA 1HJPA 4GN5A 2VS1A 4B3TQ 1SN8A 2ZJPA 2IHFA 3ULLA 2IX0A 3FP9A 1VQIA 3W5OA 4A93G 1PH2A 1K8GA 1E3PA 1VQFA 2KCTA 3KDFB 4DAYB 1LYLA 3I4OA 4LF4Q 4A3GH 4R1JA 1CKNA 2Q2IA 4LF7Q 4UPAA 1N36Q 2RHSB 3TEHB 2IY5B 4DR3L 1WJJA 3HOYG 3ULJA 1Z9FA 1VQ4A 1Y1WH 1B70B 4O0AA 4DR2Q 1TXYA 1O7IA 4DR4Q 2VNUD 2V1CC 3GTJH 4HIMA 3U58A 2CWAA 4C3IH 4GLXA 2UUAQ 1PYBA 1Z47A 1QUQB 2N3SA 4A3BG 5C4JH 1XTDA 4BBSH 1Q8KA 1VQ8A 4GN3B 5ELNA 1XJVA 4OX9Q 2ZTCA 2K50A 1XMOQ 1TWFH 2B3GA 3T1YL 1XNRQ 2KHJA 4UP8A 4JBJA 4MNOA 3H0GG 1SMXA 2MQHA 1XNQQ 3RNUA 2K5VA 1VQAA 1YBYA 3H0GH 3ULPA 1VQOA 5BR8Q 4LNQA 3NEMA 1YZ6A 3J81j 1VQKA 3TS2A 4K0KQ 5J3BA 1QUQA 4R4IA 1JJ2A 3CCUA 1NBWA 1KL9A 4GLAC 3PIPA 4BY1H 4P74A 1WFQA 2K5NA 3A0JA 1N36L 5IP9G 5C4XG 2HQLA 1BBWA 1IZ6A 4GKKQ 2BH2A 1CUKA 1NMGA 4A3LG 1MKHA 1JT8A 1VQNA 2AWNA 4R4QA 2VUMH 1PH6A 1I6HH 3TREA 3GTGH 1K83H 1U0LA 5M5WH 3BZKA 2N8NA 1SE8A 2A1AA 3PCOB 3S1RH 1LM0A 4LUOA 1YNXA 4HJ8A 2KENA 1M1KC 3KDFA 1FGUA 4DK6C 2JA8G 1V1QA 3HOVH 5C44H 4A3DG 3PUVA 4HJ5A 4DR1Q 3PF5A 1N34L 1X65A 3KF8B 4IOCA 3H3VH 1Q12A 2BH8A 2PQAA 4QL5A 1Y14B 3J81i 3J80c 2NVQH 3S14H 1TWCH 4LFBL 2ALYB 5M3MH 1S72A 3I2ZA 3PUYA 4IOAA 1A0IA 3M9BA 4P73A 2UXBQ 2IHEA 3ICEA 3E9IA 1OXUA 4BA1I 5IT9c 1QVFA 1E22A 1XNRL 4GS3A 2IT1A 1CSPA 2UXBL 4GNXB 1GKHA 2R7ZH 1YHAA 4BBRH 2HIVA 4IJLA 2VQFQ 4L5RC 1Q86C 4GKJQ 1XPUA 1HZCA 4HJ7A 4Y7NH 2HHHQ 4JI6L 1IBKQ 4DV6Q 2EQSA 3S1NH 1FVIA 2VY3A 2F52A 2OWOA 3KJPA 4DUYQ 4B3RL 5K36G 1A62A 2BA0A 3D0FA 1IBKL 4JI0L 1VQ7A 2KHIA 4JI1Q 2UXDL 3H15A 1W2BA 2MO0A 4DAMA 2E2JH 3HOYH 5IE8A 2QEXA 1L1OB 1OXVA 1X6OA 1BBUA 4R4CA 4GNXA 4YCWA 1XMQQ 1PH3A 2UUBQ 4LFCQ 2E8GA 4BA2I 4BY7G 1HNWQ 3TRZA 5JEAG 1E1TA 1EUJA 4PMWA 3CCRA 3A5UA 4JBMA 2ZM6L 4AYBG 1ASZA 3U4VA 4JYAQ 4BBSG 2NN6I 4QGUA 3I4MH 3M3YH 5GROA 3T1YQ 1DGSA 2HIXA 2YTYA 4DUYL 4B3RQ 1HZAA 4ME3A 4DUZQ 3CP0A 4R4OA 3RLOA 3D31A 3HFZB 1Y1WG 1IBLL 1YVCA 1B8AA 4LFBQ 3CCJA 4IFDG 4HIKA 1C9OA 1HZBA 4IFDI 2B29A 4AYBE 2VQFL 1PA6A 1FJGL 4DNIA 4KHPQ 4P72A 2VL6A 2CCZA 4LUVA 2QGQA 4PZ7A 1KQSA 3U50C 3NENA 1KAWA 1YHQA 1WYDA 3T1HL 2E5LL 3PF4A 2E2IH 2CFMA 5IP7G 3AYHB 3S15H 4PZ6A 4A93H 4YWKA 4JI8Q 3DLLA 3GTMH 2OQ0A 2JQOA 3I56A 1IBML 1EYGA 2ID0A 1G291 3HOXG 3I55A 4DV5L 4A3KH 4A3MG 4DR2L 4DR6L 1NMFA 2WAQE 2HT1A 2RCNA 3RLNA 4JBWA 3NBHB 2I0QA 5C0XI 2ZTDA 5C0XG 4GOPC 3KFUA 3CXCA 2Z0SA 1UEBA 2NVXH 5BR8L 1IXRA 2LXKA 4A4IA 3AQQA 3PSIA 1L1OC 4JI4L 2Y0SE 1KHIA 2L15A 1I94Q 4HJAA 1PH9A 1PH5A 4GKJL 2RF4A 2R93G 3E0EA 5LMNQ 1I50H 4JC0A 1K73C 2F3IA 2VQEQ 4X66L 1OTCA 4JI5L 3AEVA 1SRUA 3BJUA 2VUMG 1KRSA 3MXNB 5M3FH 4X62Q 2K4KA 4WJ3M 2N78A 2OCEA 2JA9A 3CCLA 2Q2HA 4DKAC 4NB3A 5C3EH 1SROA 5IYDH 4DK3C 4APVA 4A3CH 5AJ3L 2MNAA 3HOUG 3UDIA 4EX5A 5C0XJ 4DV3L 3UDGA 4EQ5A 2PQAB 4DR1L 4DR6Q 1JE5A 3CCQA 4ALPA 1K0RA 4OWWB 4JV5Q 1TWAH 1EIYB 1GVPA 1QVCA 4JI6Q 2CKZB 3VDYA 3S1QH
chains in the Genus database with same CATH superfamily
2UU9Q 1CE8A 3CCEA 1PFSA 5LMUL 1IYVA 2D9UA 2R7NA 4A3IH 3OWEB 1VF5C 5LMUQ 5IY0A 2JA6G 1K9MC 2SNSA 5JJIA 1Q81C 1TWHH 4PMBA 1SFOH 3PO3G 1BCPF 1TWGB 1V1OA 1PHJA 4A3LH 3N8DA 3MXNA 3WOEA 4DV0L 4A3JH 2UVVA 1QCBD 3DEOA 5KT4A 1JICA 3MTSA 4NXNL 1WTRA 1RTNA 2DGYA 1TR5A 1TAEA 4G7HC 2XVSA 5L37A 2MO1A 5KFXA 1XPRA 2YYAA 4FBUA 3FKIG 2Z4HA 3PO2G 3N42B 4I7HA 3GTKH 5I6WA 4H02A 3K0YA 2E74C 1EY9A 2VQEH 1HUMA 3HOZG 4TQUS 3E5NA 1A3VA 3G48A 5LL6S 3NTIA 1X54A 5IWAH 2F03A 2G5DA 1AFPA 1FJGH 2JN4A 1PTOH 4QW8A 2YU9B 3QFFA 1KIXA 5M3FG 4J9MA 5ELFA 3G7LA 4X64H 5FJ8G 4DAYA 4DL2A 2CW0D 2K75A 3HOYB 2PW7A 5KFKA 2AMCB 5LA6F 1SYBA 3JSLA 1QVGA 4RB3C 3F2CA 1H95A 2R7MA 4JI7H 3RBDA 2I5MX 3G6XA 1FNVA 3M4OH 4ZAIA 2DJGC 3GQCA 3VYRA 1CM9A 1EIFA 5KGUA 5DG8A 2PCFB 3W3AA 3NUCA 3GTLA 3DXJC 1L1OA 1X3PA 3TQYA 3ERSX 4DV5Q 1RF2D 5KG5A 4FDBA 2R6FA 1RKNA 4QF4A 2OTJA 4X66Q 2YU9H 3L3OC 3F1ZA 1UNSA 2A19A 1AE2A 1X56A 2K5QA 2AQ2B 3AFQA 4TRDA 1KJJA 4JI7Q 3ETHA 3H4BA 3G8CA 3FMAA 1U4MA 2SOBA 3GTLB 4FF4A 3PO3B 4I4TF 2AHOB 4JI1L 1EY6A 2LXJA 4DR7H 1N8RC 3MEHA 5JEAJ 3MWYW 2NU7B 1JMCA 2VPQA 1H9MA 4JI3Q 4C3JG 2DPJA 1N32H 1QG7A 3EPIA 4XDXA 1ET9A 4A3MH 4BXXG 5IYDG 4AIMA 2L0CA 1LLRD 5C0XH 4JOIC 2C35B 3M4QA 4QB4A 4POGA 1CTMA 3SE0A 5I6YA 3S16B 2WTFA 4DR3Q 4JBKA 4DFAA 3HOZB 2EY1A 4BBRG 2F1MA 2W8LA 3J80E 4RKLA 1D5XC 4B3TL 4Y7NB 2FLLA 1YIJA 3C46A 2GVAA 4NP5A 1VQGA 1JWUD 2JYOA 4POFA 5FO9B 2R86A 2GA4B 5EKIA 1K1QA 1RJQA 3VPBA 2W9CB 4O2DA 1J5EQ 4YWMA 1SCUB 1D7QA 2XC9A 1Z2NX 1E2WA 1Q7YC 1IBLQ 5C4HA 2NVYH 1SYGA 2E2DC 4DAVA 2AQ1B 3I90A 4K2LA 3NTKA 1LT3D 1VMCA 2FMAA 2EE1A 3KF6B 2F0KA 2ASBA 2JA6A 5COYA 2CQOA 4LF5L 5LOVF 4RMFA 3GTKB 2GN5A 1E24A 4LSXA 2B8FA 4WJWA 4FS2A 2X6GA 1NR4A 3CAMA 1WTWA 1CQFA 3DMUA 1CHQD 1G51A 2ZXPA 1DM0B 4S3SA 5LL6X 3CD6A 3STBC 3RIZA 4B3ML 3BG3A 2EYPA 4GC6A 4N8FA 4KY6A 5EAYA 3ZYYX 1S0OA 2OTLA 2NVTH 4ILWA 2BCOA 1J8IA 3CC2A 1K8MA 2EYFA 4ED0A 5KFCA 1NJIC 5C4XB 4LWCA 3G71A 3KLSX 3R2IA 3HOWH 4J9LA 4JPBW 3GIKA 3M9MB 4IWYA 3Q8DA 4KHZA 1EL0A 2N88A 4A3FG 3HOVG 4DV0Q 1MJEA 3R23A 1EQQA 2R92G 2B63A 4JW0A 3VR3A 1JB3A 3RMHA 2E2HH 1N33L 3NSWA 1STHA 2K01A 2WKCA 1C7YA 1P16A 3PR5B 2JA7A 3MR5A 4HCSA 4F4YA 1W93A 2Q8IB 1STGA 3BU2A 4E4TA 5ELDA 3RAXA 3FEWX 4HEDA 2YL2A 4GNXC 1I50B 3A74A 1VF7A 1PYSB 2F0EA 3VYTA 4FS1A 4Y8VB 2KBNA 3CQZH 5F2DA 1Q8IA 2RCFA 3I4NG 4DR7Q 5BPFA 4H0LC 2VR1A 1C4QA 5C3EG 1HH2P 1RDPD 3MWMA 2VB3X 4Q0FA 2H4OA 2R82A 4A2BA 2YZMA 1HPCA 1V1PB 1MI2A 3X3NA 4TSSA 2VQDA 2Q8RE 3JAMW 3LWUA 2WB1B 3S1MH 1FGBD 4UP7A 2NUCA 3S1RB 2E2HA 1VQPA 1RIPA 1TS5A 3QWNA 5FLXE 3K5MA 2F0UA 3LP8A 2K7VA 1PTOC 4NPSA 2W9AA 4JI3L 4MN3A 3J7AF 4Z9CB 3GTQH 2AWOA 1S3OA 1Q1EA 3TP8A 5AJ3Q 1JKJB 2JEJA 4OWTB 1WOCA 3F8TA 2NZOA 4N9PA 3TS0A 1N32L 2W7OA 4GKJH 2QF7A 4JV5L 2RHQB 5GAHC 4ZHQF 4BXXH 4C5CA 1GO3E 2UXCL 4ZQIA 3BABA 3EJIA 5BPHA 1Q82C 2PNHA 3R5FA 4FNFA 3RZOH 3OYYA 1SMYD 2XRQD 1O7LA 4HNTA 2IBKA 2W7PA 3VA7A 5GADC 3FHWA 2FLNA 2UUBL 2FPPB 2F0NA 4O2BF 2DY8A 3M7GA 3EYYA 3AFPA 2EJFC 2NN6H 3PV0A 5KRUA 2A8VA 4ED7A 4RGMA 4DR5Q 2A73B 4ECRA 1S5ED 1M7JA 2R93H 2HQEA 4KKTA 3E0JA 3K6OA 4YY3L 1VQLA 5JQWA 1ZETA 5IYZF 1X3EA 1I4PA 1HJPA 2ZJPA 3GV7B 3ULLA 3FP9A 5KFHA 4RKBA 3RD4A 3J7YW 3KDFB 4DAYB 1WTOA 4LF4Q 4IAJA 4LF7Q 2B2WC 4UPAA 1N36Q 2F0HA 1N56A 3RGXA 1TS2A 4A93B 5EKKA 5C5JA 4JI4H 1WJJA 2RGVA 1CHPD 3D4WA 4CKBA 4DR2Q 4C56C 4Q0YA 3GTJH 4HIMA 3U58A 4U6PA 3NWSA 1IW7D 1PYBA 1NAPA 1O78A 4L1KA 1GUNA 1Z47A 2DNEA 1QUQB 2K04A 1U4RA 1B9NA 1XMOQ 4ODGA 3KLRA 2B3GA 1BCPD 1XNRQ 2C2DA 4RUAA 4JBJA 5KFWA 1R4QB 3V4SA 4DXGA 5BR8Q 2QDBA 2EYJA 3NEMA 4XQNA 4LNQA 2V9WA 3TS2A 4K0KQ 1QUQA 5FOBB 3R8BA 2VPSA 1NBWA 3OUZA 4F4XA 1PK8A 4P74A 2K5NA 2DPIA 1N36L 5IP9G 1IZ6A 4DV0H 4DV6H 5HV6A 5EPLA 1MKHA 1KTKA 3CQZB 2KCCA 2RKSA 4R4QA 2J9GA 2VB2X 1LTTD 1K8OA 1RK5A 4DXFA 3S1RH 4K14A 2DJFC 3DEPA 2KENA 2HCCA 3FPUB 5IOCA 3HOVH 1DZ1A 1XNRH 5C44H 1STEA 2ZXRA 4RA8A 5A2QE 3MHBA 1HRJA 1RCVD 3J81i 3URYA 3S14H 1Y14B 1TWCH 5IT9E 3I2ZA 4IOAA 1PTOD 3M9BA 3UFXB 3SK8A 4UCRA 4P73A 5IGEA 1CA5A 2V4DA 4HSVA 5C1PA 4CDEC 5EQ0A 1E22A 1CSPA 2K5DA 3BS1A 1YHAA 3OMCA 4BBRH 1HHVA 1SEIA 3C1FA 2VQFQ 1GHJA 3MR2A 2E75C 1STAA 4DV6Q 4ZOLF 2EQSA 2OWOA 2BQUA 2F52A 4B3RL 2QCPX 1A62A 3BG5A 1PZKD 2NUAB 5JVLA 4ED2A 1F9QA 4KJNA 2UXDL 2TMPA 2MO0A 2D5DA 3U9OA 5HGTA 5IE8A 1W2BA 3HOYH 1G91A 3S14B 4LAAA 4LFCQ 4BA2I 1JOKA 2EOTA 3PIP3 4XYQA 1EUJA 3CCRA 4MIUA 1KJIA 3I3CA 4AYBG 1WH2A 2UUCH 3PQIA 1H9SA 4IUTA 4IUUA 4QGUA 4BBSG 2QKIC 5GROA 5EBCA 4HSPA 2HIXA 4F7XA 4MHEA 1SNPA 2NZ1D 4ME3A 4OL7A 4DUZQ 3D31A 2CQYA 1B9MA 1B8AA 4ME6A 3CCJA 1C9OA 2PQEA 2RSNA 1HZBA 1PTOF 2VQFL 1B04A 3E3XA 1FJGL 4KHPQ 1UC8A 2ASLA 4LUVA 1EIHA 2DZDA 3NENA 4IURA 3PF4A 4NXMH 3SK4A 2CFMA 2FLPA 1K1SA 4ZKBB 4ECYA 4F4ZA 4A93H 4YWKA 3BVMA 4JI8Q 1EYGA 4O3PA 2XCAA 4A3KH 2V58A 1I50A 2BE5C 4WRDA 3RLNA 2I0QA 5KFFA 3KLSA 2ZTDA 4GOPC 3KFUA 3I4MB 1UEBA 4MV7A 2WE6A 2LXKA 2PW5A 4LH6A 2NWGA 4K8IA 4FXGC 3SEBA 1STYA 2RF4A 1PH9A 3J81W 3M4IA 2F3IA 2LS01 3DWAA 5CV8A 5IGCA 1N36H 4ETSA 1KRSA 3NQTA 2JP1A 5C6AA 5FO8B 4X62Q 3PIO3 2B2UC 4EQOA 2QYZA 3GIMA 1M4VA 2N78A 3CCLA 5KFMA 1LT4D 4DKAC 5C5LA 3PN1A 1SROA 5IYDH 1KABA 5KFUA 1M8AA 4DK3C 3T5JA 3MC0B 4EX5A 1CZWA 4EQ5A 1EIGA 2PQAB 1LTBD 3BDLA 4OWWB 1EIYB 4IUVA 2XCPA 1GVPA 1BQQT 4CKCA 3CC4A 2I5LX 3H3VI 1ET6A 3HKZB 2FINB 2DUDA 1PFMA 5DM63 5FLXc 2KUMA 2UXCQ 4LMYA 4DN4M 3N6XA 1A3TA 2L11A 2WAQG 5IYCH 2JA7G 3Q8PB 5DLQE 3TMEA 1TWGH 3J7A5 4OHJA 1PRTC 4ED6A 2EY5A 4JG2A 1HNZL 2BA1A 3DHQA 2UU9L 1XNQH 1ILQA 1E4EB 3KJOA 4DLKA 1E4FT 5CORA 3V4ZA 3E9HA 1JC7A 4AQYQ 3CU7A 1EOVA 2XTIA 5KG6A 3S16H 2IP4A 5E4XA 2ASJA 3FKIH 1SE3A 4IUPA 2HDMA 3X3MA 4XT3B 2L12A 5JEAH 3N40P 4UFZA 4JOIA 4ECTA 4QW9A 3CVZA 1VQMA 5CV9A 3ETJA 1L2ZA 1WI5A 5H1SE 3EBEA 4X3SA 5KFTA 3Q8SB 3L0OA 3S1NB 1P8LA 3EIVA 4A3JG 1I4XA 2K03A 2PI2A 1AE3A 3GO5A 4DV1L 3V6HA 2ICEC 3J81L 4TUYF 3KALA 4FBTA 2NB0A 3CW2C 1T36A 4DR4H 3H94A 3LWEA 1DJRD 4ECXA 4DR4L 3E5SA 4QUCA 5CV7A 1OO9B 1SLJA 4ZUIA 1X3QA 2Z6KC 2VXWA 3PO2H 3S2HB 2HJWA 1D5ZC 2JEGA 4UY8C 4PNYA 2N49A 3B6YA 4JI7L 1JDEA 4AH6A 4XZ3B 2IPKD 4EQNA 1F2MA 3A54A 4QIWB 5EGTA 1KBLA 3J7AK 3WNZA 4RZRA 2BE5D 1B7YB 4XXEA 4MV9A 1F2YA 4ULLA 4KJOA 1S68A 1X55A 1NE3A 4GN4B 4KMUC 4PG3A 4YHHH 2C2RA 2V4RA 3GIIA 1GD7A 4ECVA 1YEZA 3BYTB 4BY1G 1VQ6A 5IT9W 4DV7Q 2W70A 2E5LQ 3WO0A 4RG1A 4YWLA 4NXNQ 5DQHA 1LT5D 4NXMQ 4RNMA 3S15B 4JI4Q 4OO1I 1CS0A 4IR1A 2KVMA 1MBYA 1N48A 2O4XA 3SK6A 1L0WA 2XCLA 3Q23A 4WJ4A 1GOZA 3T1HH 2R7ZA 2MCTA 4MTNA 3A8JE 3P7JA 2F0MA 1CKMA 4IUNA 4P75A 5D14A 3RR5A 2YRWA 2B2VC 1I4RA 4A3KG 4J8QA 1QZGA 4LF6L 1J5EH 4R9WA 1GSAA 4K0KH 3OTOL 2OXPA 4A3EG 1IOWA 3RV4A 2B2YC 2ZT9C 5IWAQ 2AQ3B 4LF6Q 4LFAL 2FPGB 1NCVA 1FD7D 5KFSA 2E2HB 1AH9A 4ECSA 3VMMA 4X3KA 3RZOB 5I9PA 2AQ4A 4TKOB 1TA8A 4R8UA 3HBLA 2NU6B 5C44B 1EYAA 2CQAA 1HTLD 3E6ZX 4DK0A 5K2MA 4LF8H 3I72A 2WYOA 2VW9A 2C00A 4GKKH 5J1ZA 4F88A 2BQRA 4QJFA 4LUZA 3Q1KA 4ED3A 3FPPA 5LYJF 3MVVA 2F0LA 5BN5A 4ZYSA 4O3RA 4C5BA 1TKWB 3GIPA 2MUYA 1JWSD 1D2BA 2EYMA 3OOCA 2Q2UA 1EYCA 2P5ZX 5JH7F 1I94H 1B6RA 4KV6A 2E2JB 2M05A 3RV3A 4B3MQ 4G4KA 5EPJA 4Y52H 4LFAQ 3PZPA 2K05A 3A5ZB 2YTXA 1TVXA 4A3BH 3QR8A 2EZVA 1S40A 4A2AA 1IKMA 4RU9A 3GTMA 1VQHA 3M85A 5D3DA 4LF5H 2M00A 3CCSA 3LWBA 3R3OA 3I70A 1NSNS 2R8JA 4JI5H 1WCMA 5DNFA 1AZQA 1IYJB 3K0XA 2IL8A 2HCIA 2PPBC 4TV8F 1HNWH 1H9KA 3HKZA 2I46A 3EFXD 3GTJB 3D8GA 5IGDA 4KHPL 3J80W 2ASDA 5LXTF 3D6CA 2EXDA 4NXML 2K5HA 5DQGA 1SEBD 4CDDC 1NY4A 2Z6KA 1ZHQA 4X64Q 2CH4A 2NBFA 3I4NH 3TZDA 1KRTA 3VR6A 1PZID 4JI8L 1Y1WB 1DOKA 2FK3A 3GTJA 4UP9A 1T5XD 2NVXA 4YHHL 3UDXA 1CFMA 3PO2B 5IP7H 3HOXH 1ZQ7A 4YR3A 4GOPA 1JOQA 1KC8C 2EXZA 5C4JB 2EY2A 4JK1C 2BR0A 4OX9H 2WINB 1HNZQ 5HGQA 1VQ9A 2JA5H 4XYLB 4M7EA 3PVXA 3KF6A 1KEEA 4FVMA 4JCVE 3OHAA 1EZ1A 2PYKA 4EEYA 2LMCB 4EBEA 3MEFA 3LX0A 1D1KA 5M5XB 5JAVA 3UE0A 1EZ8A 5FLMH 3I4NB 1NR2A 2NTSA 2OT2A 3DM1A 2N55A 4JI1H 2OLSA 1MJCA 4KD3A 1ML0D 3F2DA 4EFEA 3H40A 3W1BA 4L5TA 3J7AV 4C3IB 4DV6L 2WB1G 3MJFA 1ZHSA 1BXTA 4JI6H 2J4XA 3P1HA 4V0BA 4DR5H 2NVYB 3KOJA 3UE1A 2WB1A 3C2PA 1N9WA 4B08A 4DV2L 1I5FA 1BXRA 2XGQA 2NYZD 4YHHQ 4OEMB 3PUWA 4K2KA 4O3NA 3S1MB 1MD2D 1YJWA 2JK8A 2PZWA 2L1BA 1PX2A 4ZI7F 3JAME 2W6MA 3OIPA 1SXTA 4GKKL 1Q1BA 2R61A 2UU9H 1W3SA 3FDSA 3T1HQ 1B6SA 3GTPH 4Q5VA 3T5KA 3BYYB 1Y1VB 5M5YH 2Q8TA 2K6AA 1TS4A 1EQRA 1EWHA 4C1NI 2NU8B 1EOTA 2DN8A 4C1NK 1TWAA 3RB0A 2A6HC 4OWXB 4WFN3 1OXXK 2DNCA 2F4IA 5KFGA 5IYCG 3ZJYC 2JA7H 3U9TA 1XMQL 1KJ8A 4YBZB 2YV5A 1ESRA 2EDGA 3NP8A 3MFGA 2WACA 1SYDA 2F4VQ 2B63B 2DLNA 4DGZA 4LSAA 4KHVA 2J0TD 1XDNA 5HURA 4GOPB 3HGBA 2ZJTA 3FKIB 5FPOA 4IN3A 3CF5A 3BQ1A 1CZGA 1YITA 3GTOB 2KOLA 1PH7A 3DWPA 3TIGA 5KIXA 1XMOH 2DWCA 1GYFA 1XTCD 4RH6A 3DUZA 3N6RA 1BKBA 2LSSA 4GN5A 2F0GA 2VS1A 4B3TQ 2IX0A 3K5IA 2R7KA 1H9JA 4A93G 1E4GT 1B3QA 1LYLA 2UVRA 4ZK9B 1GSOA 1B3AA 3T5LA 2A74C 1IOVA 3HOYG 5KFNA 1Z9FA 3F8NA 3HZXA 2VNUD 1TXYA 1WCMB 4C3IG 4DNRB 1CK1A 3MFHA 5L9XA 1IL8A 2M9VA 2N3SA 3M4YA 4A3BG 4DL6A 4V190 4BBSH 1Q8KA 4MV4A 4OX9Q 2K50A 2ZTCA 1WD1A 1B53A 1TWFH 4XQQA 1SMYC 4UP8A 4MNOA 3K5OA 2YRXA 5C5MA 2W71A 5I47A 1XNQQ 2F0SA 2NVQB 4JI2H 1VQAA 2PBZA 1IHZA 1ENFA 2JSOA 2KA7A 4WD3A 2AUJD 1JJ2A 1STBA 1F2LA 2F3WA 4BY1H 4JUZA 5C4XG 3A0JA 4NMZA 1U4PA 4J1MA 4EEQA 5BN4A 1CUKA 1GUTA 1NMGA 4A3LG 1TWFB 1VQNA 4ID6A 4OIJA 1G2TA 2AWNA 1PH6A 5KFQA 3GTGH 2A1AA 4DL5A 1LM0A 4LUOA 4G57A 3M9NB 4A3DG 1B1ZA 5ISRA 1WVLA 4EBCA 2WDTA 4DR1Q 2PO4A 1X65A 3KF8B 4YQWA 2PQAA 4LFBL 2NVQH 1JR0D 2EYOA 4DUZH 2Z1CA 1EY0A 2KSWA 1I6UA 2L5TA 2UXBQ 1C3OA 5DLFA 2RGRA 5KT3A 5JPMC 4EBDA 2C22A 5FD6A 1TY2A 3HS0C 4BBRB 3E9IA 4O2AF 1GXDC 2SDFA 2IT1A 5LP6F 1II3A 2R7ZH 5IIFA 4AYBA 1KNAA 1Q86C 4ZLTF 4GKJQ 4HJ7A 2F0QA 4KHPH 2B2TC 3S1NH 2HVRA 4DUYQ 5K36G 1DXMA 2A6ED 2FJ2A 3MWEA 3H15A 1MSHA 4DAMA 2E2JH 4AYBB 4MTDA 2FK1A 1L1OB 3W2DA 3RJ0A 4R4CA 2KEDA 2FJZA 1XXGA 4BY7G 2E8GA 2AGQA 5DLGA 4UCUA 3TRZA 1GSHA 4A3BB 4JBMA 3OW7A 1JLLB 2FK2A 3H6MA 4B9WA 3H0GA 2YTYA 2ENBA 5DEHA 3CP0A 3RLOA 4FYDA 1YVCA 5L1LA 1UEAB 1G6ZA 3UQ8A 1GHKA 3OSPA 4IFDG 1IKLA 4IFDI 2B29A 1CQVA 1EY7A 2VA2A 2AUKA 2QGQA 5KFRA 3U50C 2YZNA 1MGSA 4MV3A 3T1HL 1UC9A 3CQZA 2CW8A 3S15H 2FE3A 5KG7A 3DLLA 4O1NA 3GTMH 3JSNA 2JQOA 4WORA 5EPKA 2ID0A 1G291 1PZJD 3HOXG 2RDGA 4DR2L 1NMFA 3GV6A 4B3TH 4IRKA 2RCNA 1DD2A 2KEEA 3NBHB 4QWDA 4A3DB 5F9NA 1IW7C 3G6JB 5ELEA 3HOVB 3T1YH 2A68D 4HN7A 1KNEA 2C28A 3AQQA 4JI4L 2R92B 1D1IA 1DOLA 1SE2A 3JAML 1KHIA 2CH4W 4UCTA 1AZPA 4HJAA 1BF4A 1PH5A 3E0EA 1I50H 4JC0A 1QE6A 2RDHA 3N52A 3J80L 2VQEQ 5KG4A 4Q45A 1OTCA 2VUMG 5KNCA 3EPGA 4RB0A 3A56A 2SNMA 2X0SA 2HVSA 1V8QA 4H44C 2EYLA 2OCEA 1TWGA 4AQYH 2Z6BA 1RD9D 2R8HA 4IRDA 3A8KE 4O4HF 1SNQA 5AJ3L 5EKLA 4RZQA 3KF8A 4DR6Q 1JE5A 3CCQA 4JV5Q 1K0RA 3OUUA 4HQ6A 5FLXW 3T13A 2XN9C 2BDNA 3HOUB 1PRTF 1QVCA 3QJYA 3T4AC 3VDYA 1SE4A 1EYDA 2RBMA 1U4LA 3K7UC 1S0MA 4FF3A 1V43A 3KAKA 1FNWA 5JJKA 3J81E 2W6NA 5KFOA 3KTMA 4DV3Q 1HR0W 3S17B 2L55A 1SSOA 3KLWA 3NQIA 2AGPA 1XPOA 1PFNA 1CSQA 4J9RA 4KKUA 2WP8J 1I3QB 1XNQL 3Q8QB 2B2YA 5KFJA 3CPWA 2ES2A 1VQBA 3MXPA 4X3UA 2EJMA 2GPWA 1TWCB 4X6AH 4XYMB 1A15A 1PVOA 2ALZA 3IL8A 4PWQA 4LFCL 2B8GA 3JC66 5CV4A 5CR3A 4DV5H 3NBHA 1OXSC 1AN7A 1VQ5A 1AEXA 4BWSC 1HXYD 3Q6SA 4HMIA 1MSGA 3K58A 5C1OA 4HIDA 4IWXA 2UXBH 5C3XA 2K33A 3ONAB 4CDCC 2KCNA 2OQKA 1TWHA 5TSSA 2KQ3A 1MHWC 4AQYL 4CJ1B 1TQOA 2GPSA 2W8KA 3GTOH 5NUCA 4LF4H 2HGSA 4ZRZA 1HNZH 3CHBD 3TSSA 1S5FD 1KXLA 4OXPA 4DR3H 5CBAE 1TU2B 2FMCA 4G3IA 4YB8B 3IN5A 1BR9A 3TBIB 1IL2A 3RGZA 1HNWL 3I8ZA 1N33Q 3A55A 3SK5A 4XTCS 5L1KA 2ZM6H 1GJXA 4R8NA 4A3EH 5KNBA 3JAMc 1LUZA 4CC5A 3IG0A 2OF1A 1S0NA 3GD7A 2D0OA 3ER0A 2JEBI 4LF9Q 2K52A 2FMMA 3HOWB 5IWAL 3Q2OA 5I9OA 2F0TA 4LF9L 1EY4A 1RL2A 3VR4A 3I91A 3C1EA 4QY7A 4HJ9A 2VA3A 1AW7A 5EJWA 3OIQA 2PZTA 5FK9C 3OTOQ 4K8JA 3G6YA 1BOSA 4F4WA 2R92H 2FHTA 1GM5A 1JDBB 4PZ8A 1PV4A 4LH7A 3GTPA 4A3KB 1PH8A 2A5HA 5JOBA 4A3EB 4B3MH 4X62L 1K3BC 5KFAA 4C2MB 2JJQA 5KG1A 3TQ1A 3MWDA 4A75A 1FR3A 1GUOA 4I55F 3BQ0A 5GQOA 4A3CG 2MFIA 1UE6A 1YI2A 4DV2Q 1Y1VH 4R7RA 2RSOA 3D4DA 1W6JA 5C44G 4JI5Q 4YY3Q 3OTOH 3HXLA 4JV5H 1SJED 2RDFA 3K81C 3W1GA 2F4VL 2R7LA 1DCZA 4LK1C 4F87A 4DV7L 3KBXA 3WO1A 5IYBH 4LJZC 1EEID 1IYUA 1TWHB 1VMPA 1IBMQ 4UCOA 3STBD 5G3LD 1T5EA 4A3IB 4J9KA 1I7NA 1M0WA 1D8LA 2FKLA 4IZOA 2UXDH 1ASYA 4ECWA 4ECZA 5A35A 4DR6H 2B2VA 4J6HA 2BQ3A 3NPPA 2AU0A 3TP7A 2EVBA 5BMVF 3K3VA 3O13A 2F0WA 2NVTB 3HKSA 4UAIA 4HAEA 5JJZA 4O4IF 3UDFA 3QOLA 1C48A 1ICFB 3BZCA 4I7ZC 1B33N 2XGPA 3SI8A 4NLGA 4DUZL 3IFDA 2I5HA 3WWVA 3S24A 1WR2A 4LFBH 2IA6A 1A8VA 1JJGA 3S2HH 1HR0Q 1JWMD 1JIHA 3OSNA 5BR8H 3Q24A 5J2TF 5EWFA 4DU9A 1HNXQ 5IODA 3GILA 1EEFD 5ELBA 2WFWA 4OO1G 4QQBX 3CMAA 3SE7A 3VYSA 5KFLA 2NTTA 3QG1A 4DV1Q 4YR0A 1W96A 5JUMA 1UWVA 1G8ZD 1Q46A 1IBMH 3A7LA 1Y1WA 2FFKB 4G7ZC 1N32Q 4DR7L 5C8YF 1BVSA 3MXGA 3L4KA 2UUAH 5CC4A 4JI0Q 2IX1A 1QWYA 4BBSB 2WV6D 3QIAA 3QB3A 2D0PA 1L0XB 4C3JH 3M4OB 4UDUC 4JI2L 3K3PA 2WB1E 3KYHC 1BCPB 2D62A 3GV5B 3DM3A 1I7LA 4MTKA 1PYWD 2L9HA 1J6QA 3QO2A 4RFBA 2JA8H 4ME5A 3ITPA 2PMZB 3L7ZC 2G9DA 3DF7A 2XWBB 3TIIA 2IMWP 1HR0H 2R6GA 2R84A 2F0JA 3G6EA 3S2DB 5E3FA 1ENCA 4IALA 5IYBG 1EUDB 3PGZA 2WIIB 1F9PA 1Q3LA 5ELCA 4LF8L 3BDOA 3K80C 5C4XH 4FXKC 2AKWB 3CCMA 3SVMA 2EY6A 4KN7C 3I4MG 2R85A 2W9CA 2CHBD 3TZUA 1B4OA 3HB9A 4A3IG 4LW1A 5FLMG 5D1PA 2B39A 4KLKA 4PMCA 2XIGA 1DOMA 1Y1VA 4LFAH 4B3SL 2CW0C 4TV9F 4EQPA 4DA2A 2O5JC 2IW3A 4DAPA 4K5VA 4KD4A 5KFPA 4YAKB 2J7ZA 3I7FA 3L2PA 1RJRA 2Q2TA 3MR3A 3KHRA 1B44D 4JYAL 3KAJA 4RAUC 1XYIA 1OXTA 4L6TB 4PQXA 3CMEA 4I7AA 4FO2A 3KK7A 5E7NA 4N9TA 2QW7A 1F2ZA 4KTAA 3S9WA 2ATLA 1YJ9A 1S5CD 5J2UF 1XMQH 4LMQD 2JA5G 3SDZA 4LF8Q 5DG9A 2QDLA 1YNND 1VDZA 4J15A 3HOZH 3QZ8A 2PMZE 4IPHA 4RGTA 3TQTA 1R9TH 4C2MA 3K7AB 1S9FA 1CKOA 1E2ZA 3HKZE 3F2BA 4MTEA 1DV2A 4DV4Q 4RAZA 4RCOA 2R8GA 4IZ8A 5CYUA 3VPDA 4DPGA 4F50A 4X65H 4MAMA 3GTGB 3BDCA 2EYHA 2UXCH 2JA7B 3NGDA 1MIUA 2Y0SG 2B63G 4UCVA 1PRTB 1E7ZA 1I3QH 2O2LD 3GTQB 5KX5F 3ND9A 1M0TA 1WTQA 1RJPA 5CA0F 4U7CA 5GAEC 1N34Q 1HQRD 4DR5L 3KBGA 3ORQA 1PRTD 3V96A 5DGBA 1G6PA 5J22A 1GUWA 2B63H 1SDFA 2F3VA 5CV6A 1K28A 2CVRA 3IRBA 4QWAA 1HNXH 3PIOA 1R9TB 3D6WA 1FL0A 2FPIB 4QCLA 4IHJF 2R7FA 2PNRC 4XYOA 2SCUB 5CB4F 1SN8A 3PR4A 2IHFA 4BS9A 3W5OA 4A3GB 1K8GA 1E3PA 1VQFA 2KCTA 1AUVA 4YJ3F 3I4OA 5KFDA 2XNAC 4R1JA 3Q8RB 1CKNA 2Q2IA 2R93A 4J0MA 3TEHB 2IY5B 4DR3L 1VQ4A 5LMNH 1TWFA 3PW7A 1B70B 1O7IA 3R93A 4DR4Q 2V1CC 2B2WA 4C3IH 2UUAQ 1SNDA 3GTKA 3JZIA 5M9OA 1GGOA 3T51B 3M9OB 5L1IA 4L63B 3GP7A 5ELNA 3T1YL 4DR1H 3NWTA 5KKNB 5J39A 1I6HB 3TP6A 3RNUA 2K5VA 3H0GH 3H20A 3ULPA 1SAPA 1T94A 3EROA 4LFCH 2ICIA 2ZXOA 1YZ6A 3J81j 5A2QL 1VQKA 4BY1B 5J3BA 1SFOA 4QMGA 4UCSA 3EA6A 1QILA 5D65A 4GLAC 3PIPA 2V5AA 4DNTB 5IGGA 1BNZA 1F9RA 1BBWA 3P75A 2BH2A 4EYIB 5K36H 1WD0A 2SEBD 1EWCA 1I6HH 1SNMA 3KHGA 5M5WH 3BZKA 4OELB 1SE8A 3SHLA 2NU9B 1YNXA 4HJ8A 4NXNH 3KDFA 1FGUA 2JA8G 1V1QA 4KY7A 4EYHB 4HJ5A 2W9BB 5EWEA 1N34L 4Q44A 3H3VH 1Q12A 4QL5A 5KYIA 2W6OA 5M3MH 4IRCA 2LY7A 2IWHA 4MV1A 2X69A 3OWFA 2D2CC 1KDAA 4OGQC 5H80A 2X6LA 5D3IB 4BA1I 1OXUA 5IT9c 1XNRL 2O5IC 4GS3A 4APMA 1YNJC 3TN2A 1EQTA 4L5RC 2JEFA 1HZCA 1ZYRC 2HHHQ 4Y7NH 3ORRA 4MV6A 3GTQA 4O3SA 1IBKQ 1DYQA 3LNNA 3V6KA 2VY3A 3K5LA 1A9XA 1TWAB 3GTGA 5LHY1 3D0FA 1IBKL 1VQ7A 3KUPA 1HTPA 1E2VA 2G9HD 5JVDF 1QB5D 1X6OA 1XMQQ 1E0BA 4B3SH 4YCWA 4ZCKA 5FO7B 3GQBA 5IGBA 3T16A 5JEAG 3L4JA 3HEJA 4QWBA 3IFTA 3A5UA 2ZM6L 1KJ9A 3U4VA 4UHVA 4JYAQ 4RUCA 3I4MH 3VPCA 3T1YQ 2K32A 1DGSA 2A69C 4DUYL 1HZAA 3A7AB 1IBLL 2OH2A 4R4OA 1SYEA 3HFZB 2W9BA 1ZEQX 3QOJA 4OO1H 4HIKA 5I2YA 4N8X1 4Q8EA 4AYBE 3TP5A 2A69D 3Q0AA 4ED1A 1BO0A 4P72A 5L1JA 2BDOA 5CMDA 5LL6b 3HOXB 2R3ZA 1KAWA 1YHQA 1WYDA 2E5LL 4TQRA 2K5WA 4C3JB 1A2UA 3AYHB 5IP7G 5KG3A 2VUMA 2W57A 4XX0B 4DV3H 3RFCA 4QWEA 1QOHA 1LTGD 4DV5L 2WAQE 1KJQA 4JBWA 2CZGA 2J6SA 5C0XI 2JA8B 5G3LF 1CI3M 2Z0SA 3ND8A 5E4WC 2NVXH 4A3MB 3A8IE 4A4IA 3VR2A 2F0OA 1TWCA 2Y0SE 1BJTA 1I94Q 2R93G 4GKJL 5LMNQ 1K73C 4FU0A 1I3QA 3K5HA 4X66L 3U9SA 1NUCA 3AEVA 4WJ3M 3HG9A 1S97A 4NW2A 2VOBA 2PMZA 2JA9A 3K5NA 4JI3H 1D5MC 4M9UA 3N43B 4NB3A 2NVXB 1AN8A 4A3CH 2MNAA 3BVZA 3HOUG 1ZYRD 3UDIA 4DV3L 4DR1L 1TIID 2MGSA 1O7YA 1ONLA 4ALPA 4ZKCB 1LO5D 4QUFA 4CGYB 1K83A 4IUQA 2CKZB 1PDQA 3S1QH 4GZYC 2YW2A 2YS7A 3HOUH 1JJCB 1V4YA 2CW7A 2FB9A 2VQEL 2UVWA 4DV4L 1KDBA 4KN4C 5LMNL 3OSOA 3S17H 1IBLH 4MA5A 1LABA 4YJ2F 1JOOA 1VS0A 4HR7B 5EWGA 2KJXA 4ABNA 2P0AA 2QA4A 1PFBA 1VQEA 1SFOB 1A63A 2JA6B 3K7AH 5HY6A 1CQIB 5T1IA 3R5HA 2ZDQA 1KC7A 4O3QA 4J9OA 1O75A 1I4QA 2VUGA 1Y8OB 1JCKB 1ENAA 1Y1VG 1BCPC 5IP9H 4L5QA 3BA8A 4RB2C 1EHIA 3MFYA 1QZHA 1IBKH 2YZGA 3PUXA 5D1OA 1RK6A 5CV5A 4IPCA 2RVLA 3I73A 5JVG3 2YS6A 4FM9A 1LTID 1C8CA 3V6JA 1QNKA 4IJHA 1ESFA 4IFDJ 4BY7H 2PZUA 4G7OC 2QEJC 1WTPA 3P20A 2MP1A 4MZ9A 4YCUA 3RZDH 3RN2A 2V4QA 3SGIA 1T9HA 1S10A 2I8CA 2LFNA 4RCNA 1LTSD 1YNNC 1CKNB 5FJ8H 2JA6H 3AMUA 2R93B 4R8UB 1VAJA 4B9XA 1VQDA 1PMRA 1SR3A 1LV9A 3S2DH 1Z6HA 3FMCA 1VQCA 2ZTEA 2NVYA 1V51A 1V1PA 1PH1A 3CPFA 5M3FB 2JA5A 4EVOA 5KG0A 1MZBA 3LMLA 4U68A 4A76A 3HOWG 2H1EA 4FP5D 4I65A 4O3OA 3D4RA 5C3EB 1VBGA 1Y69U 3CRLC 3GIQA 5KFYA 1W6KA 3FKIA 3J81c 1XMOL 5EZYF 1NTGA 5KYLA 4BY7B 5KT7A 2K1BA 2HHHL 2UVUA 3RN5A 4IPGA 1WSCA 1WCMG 2KCMA 4HNVA 3RZDB 1KD1C 5AFWA 4OONA 4LF4L 2EJGC 1TT2A 4KI0A 3I12A 4JV1A 5DG7A 2E2IB 3GTLH 4YCVA 3LGJA 4RNOA 1SNOA 3RF2A 4KK7A 4K5WA 2EPBA 1JE4A 1A2TA 2UXDQ 4QIWA 1KDCA 1UE7A 4NDXA 2WKDA 3CCVA 3AB9A 4P2CB 3NELA 2CWPA 3H91A 3VR5A 5FLXL 3MZ5A 1Z2OX 3PW2A 4NKLA 3SXHA 4X65Q 2UUCL 1O80A 1VKZA 1RYSA 1C0AA 5KT2A 1F9SA 3J80i 1ILPA 4DV4H 5GONF 4JI2Q 3S1QB 2PN1A 5CAEB 1TY0A 2I07B 2Z9HA 1VCIA 3G4SA 4X66H 4ZQ3A 1HR0L 4CJ0B 2R8IA 4OIKA 4CBVA 1HFNA 1UAPA 2YU9A 3QZ7A 2R7DA 4R4TA 2YYZA 1ICWA 4Q8FA 1Y8NB 4XT1B 1X3GA 4QIWE 1VQJA 1Y8PB 2XIWA 3PUZA 4IPDA 1LT6D 2OEOA 1HNXL 4GC7A 3CC7A 5M3MG 2YTVA 2W6ZA 2B2TA 4HIOA 1HZ9A 1U5KA 1I94L 5D1OB 3PW0A 3FDTA 2Z4IA 4KKSA 4M1UB 1HA6A 2A68C 2NN6G 1U9RA 1E1OA 4CHTB 3SR1A 1K8AC 1D6EC 4DL7A 1DONA 3M4PA 3NXWA 5KFBA 4JV0A 4RB1A 2XGTA 4WBNF 4ZUJA 3BVGA 3T5HA 4X65L 2UUCQ 2XD4A 2R87A 3RAQA 4GLVB 4KY5A 2RDIA 4HR7A 4IFDH 1DIKA 2BOSA 3J7ZC 1PH4A 5HBRB 3U4ZA 5KFEA 3EN2A 4TVAB 2R7ZG 5A2QW 1PLFA 3RTXA 2K28A 4P71A 4X64L 3DWQA 4K6LA 3K8AA 2B2UA 3IAYA 3NBIA 1RYRA 4K0KL 4JI8H 2ZJQA 2RDJA 1V9PA 5FKAC 2GVBA 1M6VA 3RB3A 1ZKOA 2ZM6Q 2I80A 3GTOA 4C2MH 1R9TA 1UE5A 1M90C 4LF7L 1AP0A 4RHSA 2ATWA 4A3DH 2GLTA 4LF5Q 1FNUA 4J9SA 4C3HH 5LMNW 3MA2B 1FYCA 2JXMB 2ZJRA 5IGFA 4L5SA 2F0PA 4A3FB 3GDEA 1O7ZA 1X3FA 1QJOA 2E2IA 1FJGQ 4M8AA 2K14A 3EQLC 5ELOA 5JPNC 1YNJD 1EWIA 1L2FA 4R8IA 1LACA 2FXQA 4L8JA 1CQJB 4RHRA 4ECUA 3PW4A 2Y0SA 1K0SA 5K5PA 2ZDGA 3I4LA 5M3MB 1BGWA 2KECA 3H4DA 1X32A 1X9NA 5LMUH 2VUMB 3L9AX 3H3VC 2H5XA 1UE1A 2AGOA 1S4ZA 3OMGA 2WAQA 3GV3A 2VZAA 1LTLA 1EFWA 2JE6I 4XIGS 4H13C 3VA5A 2JA5B 1A6XA 5KFIA 4DV1H 3MR6A 4A3FH 3T56B 3HKZG 3RLFA 4K5XA 5CGKA 3T53B 2IX3A 4YAJB 3TINA 3PO3H 2UUBH 4B3SQ 1N34H 1PXUA 3TDQA 5M5XH 3H0GB 2JEIA 2F0DA 1KLUD 2UUAL 2MJ8A 2WAQB 4IQZA 1H9SB 5FD5A 4PV1C 2IJ0A 2QK4A 2A6HD 3C3LA 1JB7A 1FKAH 4J9PA 3JAMi 2W6PA 5GAGC 1HFGA 1EY5A 1YHBA 1J5EL 2R7ZB 3JRWA 4J9NA 2NZHA 1EQVA 3OW2A 4IR9A 2Y0SB 1EY8A 5KT6A 3M7NA 5DQIA 3GIJA 1S03G 1JX4A 5JJLA 4RGNA 2LKVA 3NE5B 3C0FB 1SJHD 3NHHA 2PI2E 5M5WB 1Z2PX 4IO9A 4OX9L 1LTRD 2TSSA 5C3WA 2Z8LA 4B3RH 1S5BD 3BAAA 2L4NA 4BWGB 1K3RA 1WCMH 5F9LA 4DK1A 1UNNC 3KHHA 1JXLA 2E76C 5M5YB 2DY7A 1CA6A 1R4PB 2EIFA 1SBBB 4RWSC 1LTAD 2KHSA 1WTVA 2JEAI 1YJNA 4A3GG 3MFIA 1L0YB 5DGAA 5E1FA 3OHBA 3FRPB 1BBXC 4RAYA 4XQJA 1VBHA 1SNCA 1H9RA 1VQIA 2PVPA 5EBDA 3K57A 1PH2A 1Z7TA 3V2TA 3MAQA 4A3GH 4EGJA 4ED8A 4DF7A 2ZDHA 5JVH3 2O03A 1ULZA 4HNUA 2XSCA 1HCZA 2RHSB 2W6QA 3H09A 1WTHA 1ZXTA 5I2XA 3ULJA 1Y1WH 3RUZA 4U673 1HUNA 4RNNA 1N33H 1Q90A 1B2TA 5IT9L 4O0AA 4HTHA 5KFZA 3HP3A 5KNDA 2CWAA 3UI2A 4GLXA 4F8MA 4JI0H 4EGQA 1XX8A 2C2EA 3GTMB 5C4JH 1XTDA 4X62H 3ERQA 1VQ8A 2HD3A 4GN3B 1RODA 1B50A 4RGOS 1UUPA 1XJVA 2HVQA 1OWTA 2KHJA 3AU7A 2FP4B 3H0GG 1SMXA 2MQHA 4CKEA 1KAAA 1EFID 1SYXB 3KHLA 1YBYA 1I6VC 1VQOA 1EU3A 2MPMA 4JV2A 4O42A 1RTOA 4LF7H 4R4IA 3CCUA 5KG2A 1KL9A 2HDLA 4LF9H 3HRZC 4DUYH 1WFQA 3JRXA 1HA5A 2HQLA 4GKKQ 3PW5A 5CBEE 4I50F 1JT8A 3BZDB 1RHPA 2RQXA 2VUMH 4TQSA 5D8DA 3GV8B 3TREA 3OPOA 1BDOA 1K83H 1U0LA 2N8NA 3PCOB 1M1KC 4ECQA 3CRKC 2C5CA 4JVZA 4DK6C 3Q22A 2XWJB 3PUVA 4K6DA 4C3HG 4LF6H 3PF5A 5T14A 4IOCA 5DM73 2YCHA 2DIKA 2BH8A 3BJYA 3J80c 5I4DA 3BQ2A 2ALYB 1S72A 3RB6A 3PUYA 3IKJA 1EUCB 1I4HA 1A0IA 2IHEA 1JORA 3N41B 4JYAH 1BNCA 4A3JB 3ICEA 3RB4A 1QVFA 2UXBL 1F77A 4EG0A 1C30A 4GNXB 1GKHA 3GTPB 4DV2H 1QNUA 4YR2A 2HIVA 3EVQA 4IJLA 1XPUA 3RUPA 1TS3A 3GIDA 5T1GA 4JI6L 3CKIB 1WTXA 1GLVA 3D3RA 1FVIA 3NK9A 2A6EC 3KJPA 2R92A 2RA4A 4J9QA 2BA0A 4FF1A 1XWEA 4JI0L 4Q43A 2KHIA 4JI1Q 5KFVA 5EOYA 3PMFA 4MV8A 1CT1D 4FXDA 2QEXA 1OXVA 2F0IA 1BBUA 4GNXA 1PH3A 1SYFA 1GUGA 2UUBQ 2J6TA 1BUVT 1HNWQ 4HCEA 1E1TA 4PMWA 1PTOB 3R2TA 1ASZA 5EDWA 2NN6I 3M3YH 1SYCA 3NTHA 3N44B 2V59A 4B3RQ 2J6UA 3KXYT 1T3NA 5FPRA 1Y1WG 4LFBQ 4YP3A 4CDFC 3R5XA 1EZ6A 1PA6A 4DNIA 1G2SA 3GLKA 2VL6A 1A3UA 2CCZA 1EYZA 2QILA 1AUXA 4PZ7A 2VQFH 1KQSA 4QWCA 1S5DD 2MHVA 3F2UA 5DAUA 4FF2A 3FVQA 2E2IH 2C9OA 4PZ6A 2E5LH 2OQ0A 4X3TA 3I56A 1IBML 2F0FA 3I55A 4A3MG 4DR6L 1J9OA 5BN3A 2HT1A 4O4LF 4MA0A 3WDNA 1DV1A 2M2LA 2R8KA 5C0XG 5KT5A 3K59A 5KEEA 4HMJA 3CXCA 4C3HB 3M3YB 3G6VA 5BR8L 5CA1F 1IXRA 1I4GA 3PSIA 1HQMC 1L1OC 3V05A 2L15A 3OHXC 4DV7H 2HHHH 1E4EA 4CJ2C 4C5AA 5C4ZA 2F4VH 1NNXA 4JI5L 4H7BA 1STNA 1GUSA 1SRUA 3BJUA 2I87A 3MXNB 5M3FH 2K4KA 3BA9A 3RBEA 1RJTA 2Q2HA 2XRSD 4DL3A 4EGVA 5C3EH 4PDBA 4CC6A 2HUGA 4DR2H 4APVA 3MXUA 2F0VA 3UDGA 1KLGD 5C0XJ 4E6IA 4EFBA 4HYKA 3VYUA 1TWAH 1K83B 4YY3H 3WOFA 4DL4A 1JQYD 4JI6Q 1EU4A 4YIJA
chains in the Genus database with same CATH topology
2UU9Q 3HOUH 1JJCB 1PFSA 3CCEA 5LMUL 3CC4A 3K7UC 2I5LX 3H3VI 1V43A 4A3IH 2VQEL 5JJKA 4DV4L 5LMUQ 5IY0A 5LMNL 2DUDA 2JA6G 3S17H 1K9MC 5JJIA 5FLXc 4DV3Q 1Q81C 1TWHH 1SFOH 1HR0W 1VS0A 2UXCQ 3PO3G 3KLWA 5IYCH 2WAQG 1VQEA 2QA4A 1PHJA 2JA7G 4A3LH 4DV0L 5DLQE 3K7AH 1TWGH 5HY6A 4A3JH 1XPOA 3J7A5 1A63A 1CSQA 4NXNL 2WP8J 4JG2A 1HNZL 2BA1A 2UU9L 1XNQL 2DGYA 3CPWA 2ES2A 1VQBA 1Y1VG 3KJOA 5IP9H 4L5QA 4X6AH 1PVOA 3E9HA 4AQYQ 4LFCL 1EOVA 2MO1A 3JC66 1QZHA 2XTIA 3PUXA 1XPRA 3FKIG 4IPCA 3S16H 3PO2G 1OXSC 3FKIH 1VQ5A 3GTKH 4H02A 3HOZG 4IJHA 4JOIA 4IFDJ 4TQUS 4BY7H 3G48A 1VQMA 1WI5A 1X54A 5H1SE 3EBEA 4HIDA 4MZ9A 4YCUA 3RZDH 3RN2A 2OQKA 3SGIA 3L0OA 1P8LA 1T9HA 3EIVA 4AQYL 4A3JG 5FJ8H 2PI2A 1CKNB 1KIXA 5M3FG 2JA6H 3GTOH 1AE3A 3GO5A 4DV1L 5FJ8G 1KXLA 1VQDA 4OXPA 1SR3A 2K75A 3S2DH 3CW2C 2AMCB 1VQCA 2ZTEA 1IL2A 1HNWL 1PH1A 3CPFA 1QVGA 1N33Q 3F2CA 4XTCS 4DR4L 1H95A 4A76A 1SLJA 2Z6KC 3HOWG 3PO2H 2I5MX 4A3EH 3M4OH 3JAMc 4UY8C 1LUZA 2N49A 3B6YA 4JI7L 4AH6A 3J81c 1EIFA 3GD7A 1XMOL 2D0OA 3ER0A 2JEBI 1NTGA 4LF9Q 2K52A 5IWAL 2HHHL 3RN5A 4IPGA 1L1OA 3TQYA 3ERSX 4DV5Q 1B7YB 1WCMG 2KCMA 4FDBA 4LF9L 1KD1C 1RL2A 1X55A 4OONA 1NE3A 4GN4B 4PG3A 4QY7A 4HJ9A 4X66Q 2YU9H 4LF4L 1GD7A 2OTJA 1YEZA 3F1ZA 4BY1G 1VQ6A 4DV7Q 3OTOQ 2E5LQ 2A19A 1AE2A 1X56A 4KI0A 4RG1A 4YWLA 4NXNQ 3AFQA 4NXMQ 2R92H 4OO1I 4JI4Q 1GM5A 3GTLH 4YCVA 3LGJA 4PZ8A 4JI7Q 1PV4A 1L0WA 2AHOB 1PH8A 4JI1L 2UXDQ 2LXJA 1UE7A 4WJ4A 3CCVA 1N8RC 5JEAJ 3NELA 4X62L 1JMCA 4MTNA 2CWPA 2JJQA 4P75A 1CKMA 3RR5A 4JI3Q 4X65Q 4A3MH 2UUCL 4A3KG 1QZGA 4A75A 4LF6L 5IYDG 4BXXG 3OTOL 4A3EG 5GQOA 4A3CG 4AIMA 2MFIA 1UE6A 5IWAQ 3J80i 1YI2A 4LF6Q 4DV2Q 1Y1VH 4LFAL 4JOIC 2C35B 4JI2Q 5C44G 4JI5Q 3M4QA 4YY3Q 4POGA 1AH9A 1VCIA 3G4SA 3K81C 2F4VL 1HR0L 3W1GA 4DR3Q 4JBKA 4DV7L 5IYBH 4BBRG 2R7DA 4R4TA 2YYZA 2VW9A 1IBMQ 3STBD 1X3GA 4QIWE 1VQJA 4QJFA 4LUZA 1D8LA 1ASYA 4B3TL 3PUZA 4IPDA 1YIJA 1HNXL 2GVAA 3CC7A 5M3MG 1VQGA 2YTVA 4POFA 4HIOA 1HZ9A 2Q2UA 4O2DA 1U5KA 3HKSA 4YWMA 1J5EQ 1I94L 3UDFA 1D7QA 3BZCA 2NN6G 4DUZL 1E1OA 1Q7YC 1IBLQ 2I5HA 3WWVA 3S24A 2NVYH 4B3MQ 1A8VA 4Y52H 4LFAQ 1K8AC 1JJGA 3A5ZB 3S2HH 2YTXA 3M4PA 4A3BH 3KF6B 1HR0Q 2ASBA 1S40A 2XGTA 2CQOA 1VQHA 3M85A 4X65L 2UUCQ 4LF5L 1HNXQ 4GLVB 3CCSA 4RMFA 2GN5A 1E24A 2WFWA 4OO1G 4QQBX 3CMAA 1IYJB 3K0XA 3J7ZC 1PH4A 3CAMA 4DV1Q 3U4ZA 1G51A 1UWVA 1Q46A 3EN2A 3CD6A 3STBC 4TVAB 4B3ML 2R7ZG 4KHPL 1N32Q 4DR7L 1BVSA 4X64L 4P71A 5EAYA 2EXDA 4NXML 2K5HA 3K8AA 2OTLA 2IX1A 4JI0Q 2NVTH 3CC2A 1NY4A 2Z6KA 4K0KL 4X64Q 3I4NH 1KRTA 2ZJQA 4C3JH 2D0PA 4JI2L 4JI8L 1V9PA 2GVBA 1NJIC 2WB1E 3KYHC 2D62A 4LWCA 4UP9A 3DM3A 3G71A 2ZM6Q 4YHHL 3UDXA 3HOWH 4C2MH 1UE5A 1M90C 3Q8DA 4KHZA 4LF7L 1J6QA 5IP7H 3HOXH 4A3FG 4GOPA 2ATWA 4DV0Q 2JA8H 3HOVG 4LF5Q 1KC8C 4A3DH 1MJEA 3L7ZC 4C3HH 1EQQA 5LMNW 2R92G 1HNZQ 2R6GA 5HGQA 2ZJRA 1VQ9A 2JA5H 4L5SA 3KF6A 3G6EA 5IYBG 3GDEA 1X3FA 4JCVE 2E2HH 1N33L 3PGZA 1FJGQ 1C7YA 2K14A 5ELOA 4LF8L 1P16A 3K80C 5C4XH 3MEFA 2AKWB 3CCMA 3UE0A 1EWIA 3I4MG 1L2FA 5FLMH 2FXQA 3BU2A 4A3IG 4LW1A 5FLMG 4KLKA 4GNXC 3A74A 1PYSB 4B3SL 1MJCA 2KBNA 3CQZH 3I4NG 1X9NA 3F2DA 4DR7Q 3W1BA 2H5XA 5C3EG 1HH2P 1UE1A 4L5TA 3I7FA 3L2PA 4DV6L 2VZAA 1LTLA 2WB1G 1EFWA 2Q2TA 2JE6I 4XIGS 4JYAL 1OXTA 3CMEA 3UE1A 3KOJA 4A3FH 5E7NA 3HKZG 3RLFA 1N9WA 4DV2L 3S1MH 1I5FA 4UP7A 1YJ9A 4YHHQ 1VQPA 3PO3H 1RIPA 3PUWA 4B3SQ 2JA5G 1C0AA 5M5XH 1YJWA 2JK8A 4LF8Q 4NPSA 2UUAL 4JI3L 3HOZH 4J15A 3GTQH 2PMZE 2AWOA 1Q1BA 4IPHA 1S3OA 4GKKL 1Q1EA 1W3SA 1R9TH 1JB7A 3T1HQ 3JAMi 1CKOA 3HKZE 5GAGC 1YHBA 5AJ3Q 3F2BA 4OWTB 1J5EL 3GTPH 1WOCA 2NZHA 3F8TA 2NZOA 3OW2A 3TS0A 5M5YH 4DV4Q 1N32L 4JV5L 2RHQB 5GAHC 1EQRA 4BXXH 1GO3E 3M7NA 2UXCL 4DPGA 1Q82C 5JJLA 2PNHA 3RZOH 3OYYA 4OWXB 2PI2E 1MIUA 2Y0SG 1OXXK 2B63G 4IO9A 1I3QH 1E7ZA 3ZJYC 5IYCG 5GADC 3FHWA 4OX9L 1XMQL 2UUBL 2JA7H 2YV5A 5GAEC 1N34Q 1K3RA 1WCMH 4DR5L 2F4VQ 3AFPA 1G6PA 3PV0A 2A8VA 2B63H 2EIFA 4GOPB 4DR5Q 3IRBA 3CF5A 3PIOA 2R93H 1YITA 2JEAI 4A3GG 1YJNA 1PH7A 1FL0A 4YY3L 1VQLA 1X3EA 1BKBA 2R7FA 2LSSA 1HJPA 4GN5A 2VS1A 4B3TQ 1SN8A 2ZJPA 2IHFA 3ULLA 2IX0A 3FP9A 1VQIA 3W5OA 4A93G 1PH2A 1K8GA 1E3PA 1VQFA 2KCTA 3KDFB 4DAYB 1LYLA 3I4OA 4LF4Q 4A3GH 4R1JA 1CKNA 2Q2IA 4LF7Q 4UPAA 1N36Q 2RHSB 3TEHB 2IY5B 4DR3L 1WJJA 3HOYG 3ULJA 1Z9FA 1VQ4A 1Y1WH 1B70B 4O0AA 4DR2Q 1TXYA 1O7IA 4DR4Q 2VNUD 2V1CC 3GTJH 4HIMA 3U58A 2CWAA 4C3IH 4GLXA 2UUAQ 1PYBA 1Z47A 1QUQB 2N3SA 4A3BG 5C4JH 1XTDA 4BBSH 1Q8KA 1VQ8A 4GN3B 5ELNA 1XJVA 4OX9Q 2ZTCA 2K50A 1XMOQ 1TWFH 2B3GA 3T1YL 1XNRQ 2KHJA 4UP8A 4JBJA 4MNOA 3H0GG 1SMXA 2MQHA 1XNQQ 3RNUA 2K5VA 1VQAA 1YBYA 3H0GH 3ULPA 1VQOA 5BR8Q 4LNQA 3NEMA 1YZ6A 3J81j 1VQKA 3TS2A 4K0KQ 5J3BA 1QUQA 4R4IA 1JJ2A 3CCUA 1NBWA 1KL9A 4GLAC 3PIPA 4BY1H 4P74A 1WFQA 2K5NA 3A0JA 1N36L 5IP9G 5C4XG 2HQLA 1BBWA 1IZ6A 4GKKQ 2BH2A 1CUKA 1NMGA 4A3LG 1MKHA 1JT8A 1VQNA 2AWNA 4R4QA 2VUMH 1PH6A 1I6HH 3TREA 3GTGH 1K83H 1U0LA 5M5WH 3BZKA 2N8NA 1SE8A 2A1AA 3PCOB 3S1RH 1LM0A 4LUOA 1YNXA 4HJ8A 2KENA 1M1KC 3KDFA 1FGUA 4DK6C 2JA8G 1V1QA 3HOVH 5C44H 4A3DG 3PUVA 4HJ5A 4DR1Q 3PF5A 1N34L 1X65A 3KF8B 4IOCA 3H3VH 1Q12A 2BH8A 2PQAA 4QL5A 1Y14B 3J81i 3J80c 2NVQH 3S14H 1TWCH 4LFBL 2ALYB 5M3MH 1S72A 3I2ZA 3PUYA 4IOAA 1A0IA 3M9BA 4P73A 2UXBQ 2IHEA 3ICEA 3E9IA 1OXUA 4BA1I 5IT9c 1QVFA 1E22A 1XNRL 4GS3A 2IT1A 1CSPA 2UXBL 4GNXB 1GKHA 2R7ZH 1YHAA 4BBRH 2HIVA 4IJLA 2VQFQ 4L5RC 1Q86C 4GKJQ 1XPUA 1HZCA 4HJ7A 4Y7NH 2HHHQ 4JI6L 1IBKQ 4DV6Q 2EQSA 3S1NH 1FVIA 2VY3A 2F52A 2OWOA 3KJPA 4DUYQ 4B3RL 5K36G 1A62A 2BA0A 3D0FA 1IBKL 4JI0L 1VQ7A 2KHIA 4JI1Q 2UXDL 3H15A 1W2BA 2MO0A 4DAMA 2E2JH 3HOYH 5IE8A 2QEXA 1L1OB 1OXVA 1X6OA 1BBUA 4R4CA 4GNXA 4YCWA 1XMQQ 1PH3A 2UUBQ 4LFCQ 2E8GA 4BA2I 4BY7G 1HNWQ 3TRZA 5JEAG 1E1TA 1EUJA 4PMWA 3CCRA 3A5UA 4JBMA 2ZM6L 4AYBG 1ASZA 3U4VA 4JYAQ 4BBSG 2NN6I 4QGUA 3I4MH 3M3YH 5GROA 3T1YQ 1DGSA 2HIXA 2YTYA 4DUYL 4B3RQ 1HZAA 4ME3A 4DUZQ 3CP0A 4R4OA 3RLOA 3D31A 3HFZB 1Y1WG 1IBLL 1YVCA 1B8AA 4LFBQ 3CCJA 4IFDG 4HIKA 1C9OA 1HZBA 4IFDI 2B29A 4AYBE 2VQFL 1PA6A 1FJGL 4DNIA 4KHPQ 4P72A 2VL6A 2CCZA 4LUVA 2QGQA 4PZ7A 1KQSA 3U50C 3NENA 1KAWA 1YHQA 1WYDA 3T1HL 2E5LL 3PF4A 2E2IH 2CFMA 5IP7G 3AYHB 3S15H 4PZ6A 4A93H 4YWKA 4JI8Q 3DLLA 3GTMH 2OQ0A 2JQOA 3I56A 1IBML 1EYGA 2ID0A 1G291 3HOXG 3I55A 4DV5L 4A3KH 4A3MG 4DR2L 4DR6L 1NMFA 2WAQE 2HT1A 2RCNA 3RLNA 4JBWA 3NBHB 2I0QA 5C0XI 2ZTDA 5C0XG 4GOPC 3KFUA 3CXCA 2Z0SA 1UEBA 2NVXH 5BR8L 1IXRA 2LXKA 4A4IA 3AQQA 3PSIA 1L1OC 4JI4L 2Y0SE 1KHIA 2L15A 1I94Q 4HJAA 1PH9A 1PH5A 4GKJL 2RF4A 2R93G 3E0EA 5LMNQ 1I50H 4JC0A 1K73C 2F3IA 2VQEQ 4X66L 1OTCA 4JI5L 3AEVA 1SRUA 3BJUA 2VUMG 1KRSA 3MXNB 5M3FH 4X62Q 2K4KA 4WJ3M 2N78A 2OCEA 2JA9A 3CCLA 2Q2HA 4DKAC 4NB3A 5C3EH 1SROA 5IYDH 4DK3C 4APVA 4A3CH 5AJ3L 2MNAA 3HOUG 3UDIA 4EX5A 5C0XJ 4DV3L 3UDGA 4EQ5A 2PQAB 4DR1L 4DR6Q 1JE5A 3CCQA 4ALPA 1K0RA 4OWWB 4JV5Q 1TWAH 1EIYB 1GVPA 1QVCA 4JI6Q 2CKZB 3VDYA 3S1QH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 Q;  3HOU H;  1JJC B;  1PFS A;  3CCE A;  5LMU L;  3CC4 A;  3K7U C;  2I5L X;  3H3V I;  1V43 A;  4A3I H;  2VQE L;  5JJK A;  4DV4 L;  5LMU Q;  5IY0 A;  5LMN L;  2DUD A;  2JA6 G;  3S17 H;  1K9M C;  5JJI A;  5FLX c;  4DV3 Q;  1Q81 C;  1TWH H;  1SFO H;  1HR0 W;  1VS0 A;  2UXC Q;  3PO3 G;  3KLW A;  5IYC H;  2WAQ G;  1VQE A;  2QA4 A;  1PHJ A;  2JA7 G;  4A3L H;  4DV0 L;  5DLQ E;  3K7A H;  1TWG H;  5HY6 A;  4A3J H;  1XPO A;  3J7A 5;  1A63 A;  1CSQ A;  4NXN L;  2WP8 J;  4JG2 A;  1HNZ L;  2BA1 A;  2UU9 L;  1XNQ L;  2DGY A;  3CPW A;  2ES2 A;  1VQB A;  1Y1V G;  3KJO A;  5IP9 H;  4L5Q A;  4X6A H;  1PVO A;  3E9H A;  4AQY Q;  4LFC L;  1EOV A;  2MO1 A;  3JC6 6;  1QZH A;  2XTI A;  3PUX A;  1XPR A;  3FKI G;  4IPC A;  3S16 H;  3PO2 G;  1OXS C;  3FKI H;  1VQ5 A;  3GTK H;  4H02 A;  3HOZ G;  4IJH A;  4JOI A;  4IFD J;  4TQU S;  4BY7 H;  3G48 A;  1VQM A;  1WI5 A;  1X54 A;  5H1S E;  3EBE A;  4HID A;  4MZ9 A;  4YCU A;  3RZD H;  3RN2 A;  2OQK A;  3SGI A;  3L0O A;  1P8L A;  1T9H A;  3EIV A;  4AQY L;  4A3J G;  5FJ8 H;  2PI2 A;  1CKN B;  1KIX A;  5M3F G;  2JA6 H;  3GTO H;  1AE3 A;  3GO5 A;  4DV1 L;  5FJ8 G;  1KXL A;  1VQD A;  4OXP A;  1SR3 A;  2K75 A;  3S2D H;  3CW2 C;  2AMC B;  1VQC A;  2ZTE A;  1IL2 A;  1HNW L;  1PH1 A;  3CPF A;  1QVG A;  1N33 Q;  3F2C A;  4XTC S;  4DR4 L;  1H95 A;  4A76 A;  1SLJ A;  2Z6K C;  3HOW G;  3PO2 H;  2I5M X;  4A3E H;  3M4O H;  3JAM c;  4UY8 C;  1LUZ A;  2N49 A;  3B6Y A;  4JI7 L;  4AH6 A;  3J81 c;  1EIF A;  3GD7 A;  1XMO L;  2D0O A;  3ER0 A;  2JEB I;  1NTG A;  4LF9 Q;  2K52 A;  5IWA L;  2HHH L;  3RN5 A;  4IPG A;  1L1O A;  3TQY A;  3ERS X;  4DV5 Q;  1B7Y B;  1WCM G;  2KCM A;  4FDB A;  4LF9 L;  1KD1 C;  1RL2 A;  1X55 A;  4OON A;  1NE3 A;  4GN4 B;  4PG3 A;  4QY7 A;  4HJ9 A;  4X66 Q;  2YU9 H;  4LF4 L;  1GD7 A;  2OTJ A;  1YEZ A;  3F1Z A;  4BY1 G;  1VQ6 A;  4DV7 Q;  3OTO Q;  2E5L Q;  2A19 A;  1AE2 A;  1X56 A;  4KI0 A;  4RG1 A;  4YWL A;  4NXN Q;  3AFQ A;  4NXM Q;  2R92 H;  4OO1 I;  4JI4 Q;  1GM5 A;  3GTL H;  4YCV A;  3LGJ A;  4PZ8 A;  4JI7 Q;  1PV4 A;  1L0W A;  2AHO B;  1PH8 A;  4JI1 L;  2UXD Q;  2LXJ A;  1UE7 A;  4WJ4 A;  3CCV A;  1N8R C;  5JEA J;  3NEL A;  4X62 L;  1JMC A;  4MTN A;  2CWP A;  2JJQ A;  4P75 A;  1CKM A;  3RR5 A;  4JI3 Q;  4X65 Q;  4A3M H;  2UUC L;  4A3K G;  1QZG A;  4A75 A;  4LF6 L;  5IYD G;  4BXX G;  3OTO L;  4A3E G;  5GQO A;  4A3C G;  4AIM A;  2MFI A;  1UE6 A;  5IWA Q;  3J80 i;  1YI2 A;  4LF6 Q;  4DV2 Q;  1Y1V H;  4LFA L;  4JOI C;  2C35 B;  4JI2 Q;  5C44 G;  4JI5 Q;  3M4Q A;  4YY3 Q;  4POG A;  1AH9 A;  1VCI A;  3G4S A;  3K81 C;  2F4V L;  1HR0 L;  3W1G A;  4DR3 Q;  4JBK A;  4DV7 L;  5IYB H;  4BBR G;  2R7D A;  4R4T A;  2YYZ A;  2VW9 A;  1IBM Q;  3STB D;  1X3G A;  4QIW E;  1VQJ A;  4QJF A;  4LUZ A;  1D8L A;  1ASY A;  4B3T L;  3PUZ A;  4IPD A;  1YIJ A;  1HNX L;  2GVA A;  3CC7 A;  5M3M G;  1VQG A;  2YTV A;  4POF A;  4HIO A;  1HZ9 A;  2Q2U A;  4O2D A;  1U5K A;  3HKS A;  4YWM A;  1J5E Q;  1I94 L;  3UDF A;  1D7Q A;  3BZC A;  2NN6 G;  4DUZ L;  1E1O A;  1Q7Y C;  1IBL Q;  2I5H A;  3WWV A;  3S24 A;  2NVY H;  4B3M Q;  1A8V A;  4Y52 H;  4LFA Q;  1K8A C;  1JJG A;  3A5Z B;  3S2H H;  2YTX A;  3M4P A;  4A3B H;  3KF6 B;  1HR0 Q;  2ASB A;  1S40 A;  2XGT A;  2CQO A;  1VQH A;  3M85 A;  4X65 L;  2UUC Q;  4LF5 L;  1HNX Q;  4GLV B;  3CCS A;  4RMF A;  2GN5 A;  1E24 A;  2WFW A;  4OO1 G;  4QQB X;  3CMA A;  1IYJ B;  3K0X A;  3J7Z C;  1PH4 A;  3CAM A;  4DV1 Q;  3U4Z A;  1G51 A;  1UWV A;  1Q46 A;  3EN2 A;  3CD6 A;  3STB C;  4TVA B;  4B3M L;  2R7Z G;  4KHP L;  1N32 Q;  4DR7 L;  1BVS A;  4X64 L;  4P71 A;  5EAY A;  2EXD A;  4NXM L;  2K5H A;  3K8A A;  2OTL A;  2IX1 A;  4JI0 Q;  2NVT H;  3CC2 A;  1NY4 A;  2Z6K A;  4K0K L;  4X64 Q;  3I4N H;  1KRT A;  2ZJQ A;  4C3J H;  2D0P A;  4JI2 L;  4JI8 L;  1V9P A;  2GVB A;  1NJI C;  2WB1 E;  3KYH C;  2D62 A;  4LWC A;  4UP9 A;  3DM3 A;  3G71 A;  2ZM6 Q;  4YHH L;  3UDX A;  3HOW H;  4C2M H;  1UE5 A;  1M90 C;  3Q8D A;  4KHZ A;  4LF7 L;  1J6Q A;  5IP7 H;  3HOX H;  4A3F G;  4GOP A;  2ATW A;  4DV0 Q;  2JA8 H;  3HOV G;  4LF5 Q;  1KC8 C;  4A3D H;  1MJE A;  3L7Z C;  4C3H H;  1EQQ A;  5LMN W;  2R92 G;  1HNZ Q;  2R6G A;  5HGQ A;  2ZJR A;  1VQ9 A;  2JA5 H;  4L5S A;  3KF6 A;  3G6E A;  5IYB G;  3GDE A;  1X3F A;  4JCV E;  2E2H H;  1N33 L;  3PGZ A;  1FJG Q;  1C7Y A;  2K14 A;  5ELO A;  4LF8 L;  1P16 A;  3K80 C;  5C4X H;  3MEF A;  2AKW B;  3CCM A;  3UE0 A;  1EWI A;  3I4M G;  1L2F A;  5FLM H;  2FXQ A;  3BU2 A;  4A3I G;  4LW1 A;  5FLM G;  4KLK A;  4GNX C;  3A74 A;  1PYS B;  4B3S L;  1MJC A;  2KBN A;  3CQZ H;  3I4N G;  1X9N A;  3F2D A;  4DR7 Q;  3W1B A;  2H5X A;  5C3E G;  1HH2 P;  1UE1 A;  4L5T A;  3I7F A;  3L2P A;  4DV6 L;  2VZA A;  1LTL A;  2WB1 G;  1EFW A;  2Q2T A;  2JE6 I;  4XIG S;  4JYA L;  1OXT A;  3CME A;  3UE1 A;  3KOJ A;  4A3F H;  5E7N A;  3HKZ G;  3RLF A;  1N9W A;  4DV2 L;  3S1M H;  1I5F A;  4UP7 A;  1YJ9 A;  4YHH Q;  1VQP A;  3PO3 H;  1RIP A;  3PUW A;  4B3S Q;  2JA5 G;  1C0A A;  5M5X H;  1YJW A;  2JK8 A;  4LF8 Q;  4NPS A;  2UUA L;  4JI3 L;  3HOZ H;  4J15 A;  3GTQ H;  2PMZ E;  2AWO A;  1Q1B A;  4IPH A;  1S3O A;  4GKK L;  1Q1E A;  1W3S A;  1R9T H;  1JB7 A;  3T1H Q;  3JAM i;  1CKO A;  3HKZ E;  5GAG C;  1YHB A;  5AJ3 Q;  3F2B A;  4OWT B;  1J5E L;  3GTP H;  1WOC A;  2NZH A;  3F8T A;  2NZO A;  3OW2 A;  3TS0 A;  5M5Y H;  4DV4 Q;  1N32 L;  4JV5 L;  2RHQ B;  5GAH C;  1EQR A;  4BXX H;  1GO3 E;  3M7N A;  2UXC L;  4DPG A;  1Q82 C;  5JJL A;  2PNH A;  3RZO H;  3OYY A;  4OWX B;  2PI2 E;  1MIU A;  2Y0S G;  1OXX K;  2B63 G;  4IO9 A;  1I3Q H;  1E7Z A;  3ZJY C;  5IYC G;  5GAD C;  3FHW A;  4OX9 L;  1XMQ L;  2UUB L;  2JA7 H;  2YV5 A;  5GAE C;  1N34 Q;  1K3R A;  1WCM H;  4DR5 L;  2F4V Q;  3AFP A;  1G6P A;  3PV0 A;  2A8V A;  2B63 H;  2EIF A;  4GOP B;  4DR5 Q;  3IRB A;  3CF5 A;  3PIO A;  2R93 H;  1YIT A;  2JEA I;  4A3G G;  1YJN A;  1PH7 A;  1FL0 A;  4YY3 L;  1VQL A;  1X3E A;  1BKB A;  2R7F A;  2LSS A;  1HJP A;  4GN5 A;  2VS1 A;  4B3T Q;  1SN8 A;  2ZJP A;  2IHF A;  3ULL A;  2IX0 A;  3FP9 A;  1VQI A;  3W5O A;  4A93 G;  1PH2 A;  1K8G A;  1E3P A;  1VQF A;  2KCT A;  3KDF B;  4DAY B;  1LYL A;  3I4O A;  4LF4 Q;  4A3G H;  4R1J A;  1CKN A;  2Q2I A;  4LF7 Q;  4UPA A;  1N36 Q;  2RHS B;  3TEH B;  2IY5 B;  4DR3 L;  1WJJ A;  3HOY G;  3ULJ A;  1Z9F A;  1VQ4 A;  1Y1W H;  1B70 B;  4O0A A;  4DR2 Q;  1TXY A;  1O7I A;  4DR4 Q;  2VNU D;  2V1C C;  3GTJ H;  4HIM A;  3U58 A;  2CWA A;  4C3I H;  4GLX A;  2UUA Q;  1PYB A;  1Z47 A;  1QUQ B;  2N3S A;  4A3B G;  5C4J H;  1XTD A;  4BBS H;  1Q8K A;  1VQ8 A;  4GN3 B;  5ELN A;  1XJV A;  4OX9 Q;  2ZTC A;  2K50 A;  1XMO Q;  1TWF H;  2B3G A;  3T1Y L;  1XNR Q;  2KHJ A;  4UP8 A;  4JBJ A;  4MNO A;  3H0G G;  1SMX A;  2MQH A;  1XNQ Q;  3RNU A;  2K5V A;  1VQA A;  1YBY A;  3H0G H;  3ULP A;  1VQO A;  5BR8 Q;  4LNQ A;  3NEM A;  1YZ6 A;  3J81 j;  1VQK A;  3TS2 A;  4K0K Q;  5J3B A;  1QUQ A;  4R4I A;  1JJ2 A;  3CCU A;  1NBW A;  1KL9 A;  4GLA C;  3PIP A;  4BY1 H;  4P74 A;  1WFQ A;  2K5N A;  3A0J A;  1N36 L;  5IP9 G;  5C4X G;  2HQL A;  1BBW A;  1IZ6 A;  4GKK Q;  2BH2 A;  1CUK A;  1NMG A;  4A3L G;  1MKH A;  1JT8 A;  1VQN A;  2AWN A;  4R4Q A;  2VUM H;  1PH6 A;  1I6H H;  3TRE A;  3GTG H;  1K83 H;  1U0L A;  5M5W H;  3BZK A;  2N8N A;  1SE8 A;  2A1A A;  3PCO B;  3S1R H;  1LM0 A;  4LUO A;  1YNX A;  4HJ8 A;  2KEN A;  1M1K C;  3KDF A;  1FGU A;  4DK6 C;  2JA8 G;  1V1Q A;  3HOV H;  5C44 H;  4A3D G;  3PUV A;  4HJ5 A;  4DR1 Q;  3PF5 A;  1N34 L;  1X65 A;  3KF8 B;  4IOC A;  3H3V H;  1Q12 A;  2BH8 A;  2PQA A;  4QL5 A;  1Y14 B;  3J81 i;  3J80 c;  2NVQ H;  3S14 H;  1TWC H;  4LFB L;  2ALY B;  5M3M H;  1S72 A;  3I2Z A;  3PUY A;  4IOA A;  1A0I A;  3M9B A;  4P73 A;  2UXB Q;  2IHE A;  3ICE A;  3E9I A;  1OXU A;  4BA1 I;  5IT9 c;  1QVF A;  1E22 A;  1XNR L;  4GS3 A;  2IT1 A;  1CSP A;  2UXB L;  4GNX B;  1GKH A;  2R7Z H;  1YHA A;  4BBR H;  2HIV A;  4IJL A;  2VQF Q;  4L5R C;  1Q86 C;  4GKJ Q;  1XPU A;  1HZC A;  4HJ7 A;  4Y7N H;  2HHH Q;  4JI6 L;  1IBK Q;  4DV6 Q;  2EQS A;  3S1N H;  1FVI A;  2VY3 A;  2F52 A;  2OWO A;  3KJP A;  4DUY Q;  4B3R L;  5K36 G;  1A62 A;  2BA0 A;  3D0F A;  1IBK L;  4JI0 L;  1VQ7 A;  2KHI A;  4JI1 Q;  2UXD L;  3H15 A;  1W2B A;  2MO0 A;  4DAM A;  2E2J H;  3HOY H;  5IE8 A;  2QEX A;  1L1O B;  1OXV A;  1X6O A;  1BBU A;  4R4C A;  4GNX A;  4YCW A;  1XMQ Q;  1PH3 A;  2UUB Q;  4LFC Q;  2E8G A;  4BA2 I;  4BY7 G;  1HNW Q;  3TRZ A;  5JEA G;  1E1T A;  1EUJ A;  4PMW A;  3CCR A;  3A5U A;  4JBM A;  2ZM6 L;  4AYB G;  1ASZ A;  3U4V A;  4JYA Q;  4BBS G;  2NN6 I;  4QGU A;  3I4M H;  3M3Y H;  5GRO A;  3T1Y Q;  1DGS A;  2HIX A;  2YTY A;  4DUY L;  4B3R Q;  1HZA A;  4ME3 A;  4DUZ Q;  3CP0 A;  4R4O A;  3RLO A;  3D31 A;  3HFZ B;  1Y1W G;  1IBL L;  1YVC A;  1B8A A;  4LFB Q;  3CCJ A;  4IFD G;  4HIK A;  1C9O A;  1HZB A;  4IFD I;  2B29 A;  4AYB E;  2VQF L;  1PA6 A;  1FJG L;  4DNI A;  4KHP Q;  4P72 A;  2VL6 A;  2CCZ A;  4LUV A;  2QGQ A;  4PZ7 A;  1KQS A;  3U50 C;  3NEN A;  1KAW A;  1YHQ A;  1WYD A;  3T1H L;  2E5L L;  3PF4 A;  2E2I H;  2CFM A;  5IP7 G;  3AYH B;  3S15 H;  4PZ6 A;  4A93 H;  4YWK A;  4JI8 Q;  3DLL A;  3GTM H;  2OQ0 A;  2JQO A;  3I56 A;  1IBM L;  1EYG A;  2ID0 A;  1G29 1;  3HOX G;  3I55 A;  4DV5 L;  4A3K H;  4A3M G;  4DR2 L;  4DR6 L;  1NMF A;  2WAQ E;  2HT1 A;  2RCN A;  3RLN A;  4JBW A;  3NBH B;  2I0Q A;  5C0X I;  2ZTD A;  5C0X G;  4GOP C;  3KFU A;  3CXC A;  2Z0S A;  1UEB A;  2NVX H;  5BR8 L;  1IXR A;  2LXK A;  4A4I A;  3AQQ A;  3PSI A;  1L1O C;  4JI4 L;  2Y0S E;  1KHI A;  2L15 A;  1I94 Q;  4HJA A;  1PH9 A;  1PH5 A;  4GKJ L;  2RF4 A;  2R93 G;  3E0E A;  5LMN Q;  1I50 H;  4JC0 A;  1K73 C;  2F3I A;  2VQE Q;  4X66 L;  1OTC A;  4JI5 L;  3AEV A;  1SRU A;  3BJU A;  2VUM G;  1KRS A;  3MXN B;  5M3F H;  4X62 Q;  2K4K A;  4WJ3 M;  2N78 A;  2OCE A;  2JA9 A;  3CCL A;  2Q2H A;  4DKA C;  4NB3 A;  5C3E H;  1SRO A;  5IYD H;  4DK3 C;  4APV A;  4A3C H;  5AJ3 L;  2MNA A;  3HOU G;  3UDI A;  4EX5 A;  5C0X J;  4DV3 L;  3UDG A;  4EQ5 A;  2PQA B;  4DR1 L;  4DR6 Q;  1JE5 A;  3CCQ A;  4ALP A;  1K0R A;  4OWW B;  4JV5 Q;  1TWA H;  1EIY B;  1GVP A;  1QVC A;  4JI6 Q;  2CKZ B;  3VDY A;  3S1Q H; 
#chains in the Genus database with same CATH topology
 2UU9 Q;  1CE8 A;  3CCE A;  1PFS A;  5LMU L;  1IYV A;  2D9U A;  2R7N A;  4A3I H;  3OWE B;  1VF5 C;  5LMU Q;  5IY0 A;  2JA6 G;  1K9M C;  2SNS A;  5JJI A;  1Q81 C;  1TWH H;  4PMB A;  1SFO H;  3PO3 G;  1BCP F;  1TWG B;  1V1O A;  1PHJ A;  4A3L H;  3N8D A;  3MXN A;  3WOE A;  4DV0 L;  4A3J H;  2UVV A;  1QCB D;  3DEO A;  5KT4 A;  1JIC A;  3MTS A;  4NXN L;  1WTR A;  1RTN A;  2DGY A;  1TR5 A;  1TAE A;  4G7H C;  2XVS A;  5L37 A;  2MO1 A;  5KFX A;  1XPR A;  2YYA A;  4FBU A;  3FKI G;  2Z4H A;  3PO2 G;  3N42 B;  4I7H A;  3GTK H;  5I6W A;  4H02 A;  3K0Y A;  2E74 C;  1EY9 A;  2VQE H;  1HUM A;  3HOZ G;  4TQU S;  3E5N A;  1A3V A;  3G48 A;  5LL6 S;  3NTI A;  1X54 A;  5IWA H;  2F03 A;  2G5D A;  1AFP A;  1FJG H;  2JN4 A;  1PTO H;  4QW8 A;  2YU9 B;  3QFF A;  1KIX A;  5M3F G;  4J9M A;  5ELF A;  3G7L A;  4X64 H;  5FJ8 G;  4DAY A;  4DL2 A;  2CW0 D;  2K75 A;  3HOY B;  2PW7 A;  5KFK A;  2AMC B;  5LA6 F;  1SYB A;  3JSL A;  1QVG A;  4RB3 C;  3F2C A;  1H95 A;  2R7M A;  4JI7 H;  3RBD A;  2I5M X;  3G6X A;  1FNV A;  3M4O H;  4ZAI A;  2DJG C;  3GQC A;  3VYR A;  1CM9 A;  1EIF A;  5KGU A;  5DG8 A;  2PCF B;  3W3A A;  3NUC A;  3GTL A;  3DXJ C;  1L1O A;  1X3P A;  3TQY A;  3ERS X;  4DV5 Q;  1RF2 D;  5KG5 A;  4FDB A;  2R6F A;  1RKN A;  4QF4 A;  2OTJ A;  4X66 Q;  2YU9 H;  3L3O C;  3F1Z A;  1UNS A;  2A19 A;  1AE2 A;  1X56 A;  2K5Q A;  2AQ2 B;  3AFQ A;  4TRD A;  1KJJ A;  4JI7 Q;  3ETH A;  3H4B A;  3G8C A;  3FMA A;  1U4M A;  2SOB A;  3GTL B;  4FF4 A;  3PO3 B;  4I4T F;  2AHO B;  4JI1 L;  1EY6 A;  2LXJ A;  4DR7 H;  1N8R C;  3MEH A;  5JEA J;  3MWY W;  2NU7 B;  1JMC A;  2VPQ A;  1H9M A;  4JI3 Q;  4C3J G;  2DPJ A;  1N32 H;  1QG7 A;  3EPI A;  4XDX A;  1ET9 A;  4A3M H;  4BXX G;  5IYD G;  4AIM A;  2L0C A;  1LLR D;  5C0X H;  4JOI C;  2C35 B;  3M4Q A;  4QB4 A;  4POG A;  1CTM A;  3SE0 A;  5I6Y A;  3S16 B;  2WTF A;  4DR3 Q;  4JBK A;  4DFA A;  3HOZ B;  2EY1 A;  4BBR G;  2F1M A;  2W8L A;  3J80 E;  4RKL A;  1D5X C;  4B3T L;  4Y7N B;  2FLL A;  1YIJ A;  3C46 A;  2GVA A;  4NP5 A;  1VQG A;  1JWU D;  2JYO A;  4POF A;  5FO9 B;  2R86 A;  2GA4 B;  5EKI A;  1K1Q A;  1RJQ A;  3VPB A;  2W9C B;  4O2D A;  1J5E Q;  4YWM A;  1SCU B;  1D7Q A;  2XC9 A;  1Z2N X;  1E2W A;  1Q7Y C;  1IBL Q;  5C4H A;  2NVY H;  1SYG A;  2E2D C;  4DAV A;  2AQ1 B;  3I90 A;  4K2L A;  3NTK A;  1LT3 D;  1VMC A;  2FMA A;  2EE1 A;  3KF6 B;  2F0K A;  2ASB A;  2JA6 A;  5COY A;  2CQO A;  4LF5 L;  5LOV F;  4RMF A;  3GTK B;  2GN5 A;  1E24 A;  4LSX A;  2B8F A;  4WJW A;  4FS2 A;  2X6G A;  1NR4 A;  3CAM A;  1WTW A;  1CQF A;  3DMU A;  1CHQ D;  1G51 A;  2ZXP A;  1DM0 B;  4S3S A;  5LL6 X;  3CD6 A;  3STB C;  3RIZ A;  4B3M L;  3BG3 A;  2EYP A;  4GC6 A;  4N8F A;  4KY6 A;  5EAY A;  3ZYY X;  1S0O A;  2OTL A;  2NVT H;  4ILW A;  2BCO A;  1J8I A;  3CC2 A;  1K8M A;  2EYF A;  4ED0 A;  5KFC A;  1NJI C;  5C4X B;  4LWC A;  3G71 A;  3KLS X;  3R2I A;  3HOW H;  4J9L A;  4JPB W;  3GIK A;  3M9M B;  4IWY A;  3Q8D A;  4KHZ A;  1EL0 A;  2N88 A;  4A3F G;  3HOV G;  4DV0 Q;  1MJE A;  3R23 A;  1EQQ A;  2R92 G;  2B63 A;  4JW0 A;  3VR3 A;  1JB3 A;  3RMH A;  2E2H H;  1N33 L;  3NSW A;  1STH A;  2K01 A;  2WKC A;  1C7Y A;  1P16 A;  3PR5 B;  2JA7 A;  3MR5 A;  4HCS A;  4F4Y A;  1W93 A;  2Q8I B;  1STG A;  3BU2 A;  4E4T A;  5ELD A;  3RAX A;  3FEW X;  4HED A;  2YL2 A;  4GNX C;  1I50 B;  3A74 A;  1VF7 A;  1PYS B;  2F0E A;  3VYT A;  4FS1 A;  4Y8V B;  2KBN A;  3CQZ H;  5F2D A;  1Q8I A;  2RCF A;  3I4N G;  4DR7 Q;  5BPF A;  4H0L C;  2VR1 A;  1C4Q A;  5C3E G;  1HH2 P;  1RDP D;  3MWM A;  2VB3 X;  4Q0F A;  2H4O A;  2R82 A;  4A2B A;  2YZM A;  1HPC A;  1V1P B;  1MI2 A;  3X3N A;  4TSS A;  2VQD A;  2Q8R E;  3JAM W;  3LWU A;  2WB1 B;  3S1M H;  1FGB D;  4UP7 A;  2NUC A;  3S1R B;  2E2H A;  1VQP A;  1RIP A;  1TS5 A;  3QWN A;  5FLX E;  3K5M A;  2F0U A;  3LP8 A;  2K7V A;  1PTO C;  4NPS A;  2W9A A;  4JI3 L;  4MN3 A;  3J7A F;  4Z9C B;  3GTQ H;  2AWO A;  1S3O A;  1Q1E A;  3TP8 A;  5AJ3 Q;  1JKJ B;  2JEJ A;  4OWT B;  1WOC A;  3F8T A;  2NZO A;  4N9P A;  3TS0 A;  1N32 L;  2W7O A;  4GKJ H;  2QF7 A;  4JV5 L;  2RHQ B;  5GAH C;  4ZHQ F;  4BXX H;  4C5C A;  1GO3 E;  2UXC L;  4ZQI A;  3BAB A;  3EJI A;  5BPH A;  1Q82 C;  2PNH A;  3R5F A;  4FNF A;  3RZO H;  3OYY A;  1SMY D;  2XRQ D;  1O7L A;  4HNT A;  2IBK A;  2W7P A;  3VA7 A;  5GAD C;  3FHW A;  2FLN A;  2UUB L;  2FPP B;  2F0N A;  4O2B F;  2DY8 A;  3M7G A;  3EYY A;  3AFP A;  2EJF C;  2NN6 H;  3PV0 A;  5KRU A;  2A8V A;  4ED7 A;  4RGM A;  4DR5 Q;  2A73 B;  4ECR A;  1S5E D;  1M7J A;  2R93 H;  2HQE A;  4KKT A;  3E0J A;  3K6O A;  4YY3 L;  1VQL A;  5JQW A;  1ZET A;  5IYZ F;  1X3E A;  1I4P A;  1HJP A;  2ZJP A;  3GV7 B;  3ULL A;  3FP9 A;  5KFH A;  4RKB A;  3RD4 A;  3J7Y W;  3KDF B;  4DAY B;  1WTO A;  4LF4 Q;  4IAJ A;  4LF7 Q;  2B2W C;  4UPA A;  1N36 Q;  2F0H A;  1N56 A;  3RGX A;  1TS2 A;  4A93 B;  5EKK A;  5C5J A;  4JI4 H;  1WJJ A;  2RGV A;  1CHP D;  3D4W A;  4CKB A;  4DR2 Q;  4C56 C;  4Q0Y A;  3GTJ H;  4HIM A;  3U58 A;  4U6P A;  3NWS A;  1IW7 D;  1PYB A;  1NAP A;  1O78 A;  4L1K A;  1GUN A;  1Z47 A;  2DNE A;  1QUQ B;  2K04 A;  1U4R A;  1B9N A;  1XMO Q;  4ODG A;  3KLR A;  2B3G A;  1BCP D;  1XNR Q;  2C2D A;  4RUA A;  4JBJ A;  5KFW A;  1R4Q B;  3V4S A;  4DXG A;  5BR8 Q;  2QDB A;  2EYJ A;  3NEM A;  4XQN A;  4LNQ A;  2V9W A;  3TS2 A;  4K0K Q;  1QUQ A;  5FOB B;  3R8B A;  2VPS A;  1NBW A;  3OUZ A;  4F4X A;  1PK8 A;  4P74 A;  2K5N A;  2DPI A;  1N36 L;  5IP9 G;  1IZ6 A;  4DV0 H;  4DV6 H;  5HV6 A;  5EPL A;  1MKH A;  1KTK A;  3CQZ B;  2KCC A;  2RKS A;  4R4Q A;  2J9G A;  2VB2 X;  1LTT D;  1K8O A;  1RK5 A;  4DXF A;  3S1R H;  4K14 A;  2DJF C;  3DEP A;  2KEN A;  2HCC A;  3FPU B;  5IOC A;  3HOV H;  1DZ1 A;  1XNR H;  5C44 H;  1STE A;  2ZXR A;  4RA8 A;  5A2Q E;  3MHB A;  1HRJ A;  1RCV D;  3J81 i;  3URY A;  3S14 H;  1Y14 B;  1TWC H;  5IT9 E;  3I2Z A;  4IOA A;  1PTO D;  3M9B A;  3UFX B;  3SK8 A;  4UCR A;  4P73 A;  5IGE A;  1CA5 A;  2V4D A;  4HSV A;  5C1P A;  4CDE C;  5EQ0 A;  1E22 A;  1CSP A;  2K5D A;  3BS1 A;  1YHA A;  3OMC A;  4BBR H;  1HHV A;  1SEI A;  3C1F A;  2VQF Q;  1GHJ A;  3MR2 A;  2E75 C;  1STA A;  4DV6 Q;  4ZOL F;  2EQS A;  2OWO A;  2BQU A;  2F52 A;  4B3R L;  2QCP X;  1A62 A;  3BG5 A;  1PZK D;  2NUA B;  5JVL A;  4ED2 A;  1F9Q A;  4KJN A;  2UXD L;  2TMP A;  2MO0 A;  2D5D A;  3U9O A;  5HGT A;  5IE8 A;  1W2B A;  3HOY H;  1G91 A;  3S14 B;  4LAA A;  4LFC Q;  4BA2 I;  1JOK A;  2EOT A;  3PIP 3;  4XYQ A;  1EUJ A;  3CCR A;  4MIU A;  1KJI A;  3I3C A;  4AYB G;  1WH2 A;  2UUC H;  3PQI A;  1H9S A;  4IUT A;  4IUU A;  4QGU A;  4BBS G;  2QKI C;  5GRO A;  5EBC A;  4HSP A;  2HIX A;  4F7X A;  4MHE A;  1SNP A;  2NZ1 D;  4ME3 A;  4OL7 A;  4DUZ Q;  3D31 A;  2CQY A;  1B9M A;  1B8A A;  4ME6 A;  3CCJ A;  1C9O A;  2PQE A;  2RSN A;  1HZB A;  1PTO F;  2VQF L;  1B04 A;  3E3X A;  1FJG L;  4KHP Q;  1UC8 A;  2ASL A;  4LUV A;  1EIH A;  2DZD A;  3NEN A;  4IUR A;  3PF4 A;  4NXM H;  3SK4 A;  2CFM A;  2FLP A;  1K1S A;  4ZKB B;  4ECY A;  4F4Z A;  4A93 H;  4YWK A;  3BVM A;  4JI8 Q;  1EYG A;  4O3P A;  2XCA A;  4A3K H;  2V58 A;  1I50 A;  2BE5 C;  4WRD A;  3RLN A;  2I0Q A;  5KFF A;  3KLS A;  2ZTD A;  4GOP C;  3KFU A;  3I4M B;  1UEB A;  4MV7 A;  2WE6 A;  2LXK A;  2PW5 A;  4LH6 A;  2NWG A;  4K8I A;  4FXG C;  3SEB A;  1STY A;  2RF4 A;  1PH9 A;  3J81 W;  3M4I A;  2F3I A;  2LS0 1;  3DWA A;  5CV8 A;  5IGC A;  1N36 H;  4ETS A;  1KRS A;  3NQT A;  2JP1 A;  5C6A A;  5FO8 B;  4X62 Q;  3PIO 3;  2B2U C;  4EQO A;  2QYZ A;  3GIM A;  1M4V A;  2N78 A;  3CCL A;  5KFM A;  1LT4 D;  4DKA C;  5C5L A;  3PN1 A;  1SRO A;  5IYD H;  1KAB A;  5KFU A;  1M8A A;  4DK3 C;  3T5J A;  3MC0 B;  4EX5 A;  1CZW A;  4EQ5 A;  1EIG A;  2PQA B;  1LTB D;  3BDL A;  4OWW B;  1EIY B;  4IUV A;  2XCP A;  1GVP A;  1BQQ T;  4CKC A;  3CC4 A;  2I5L X;  3H3V I;  1ET6 A;  3HKZ B;  2FIN B;  2DUD A;  1PFM A;  5DM6 3;  5FLX c;  2KUM A;  2UXC Q;  4LMY A;  4DN4 M;  3N6X A;  1A3T A;  2L11 A;  2WAQ G;  5IYC H;  2JA7 G;  3Q8P B;  5DLQ E;  3TME A;  1TWG H;  3J7A 5;  4OHJ A;  1PRT C;  4ED6 A;  2EY5 A;  4JG2 A;  1HNZ L;  2BA1 A;  3DHQ A;  2UU9 L;  1XNQ H;  1ILQ A;  1E4E B;  3KJO A;  4DLK A;  1E4F T;  5COR A;  3V4Z A;  3E9H A;  1JC7 A;  4AQY Q;  3CU7 A;  1EOV A;  2XTI A;  5KG6 A;  3S16 H;  2IP4 A;  5E4X A;  2ASJ A;  3FKI H;  1SE3 A;  4IUP A;  2HDM A;  3X3M A;  4XT3 B;  2L12 A;  5JEA H;  3N40 P;  4UFZ A;  4JOI A;  4ECT A;  4QW9 A;  3CVZ A;  1VQM A;  5CV9 A;  3ETJ A;  1L2Z A;  1WI5 A;  5H1S E;  3EBE A;  4X3S A;  5KFT A;  3Q8S B;  3L0O A;  3S1N B;  1P8L A;  3EIV A;  4A3J G;  1I4X A;  2K03 A;  2PI2 A;  1AE3 A;  3GO5 A;  4DV1 L;  3V6H A;  2ICE C;  3J81 L;  4TUY F;  3KAL A;  4FBT A;  2NB0 A;  3CW2 C;  1T36 A;  4DR4 H;  3H94 A;  3LWE A;  1DJR D;  4ECX A;  4DR4 L;  3E5S A;  4QUC A;  5CV7 A;  1OO9 B;  1SLJ A;  4ZUI A;  1X3Q A;  2Z6K C;  2VXW A;  3PO2 H;  3S2H B;  2HJW A;  1D5Z C;  2JEG A;  4UY8 C;  4PNY A;  2N49 A;  3B6Y A;  4JI7 L;  1JDE A;  4AH6 A;  4XZ3 B;  2IPK D;  4EQN A;  1F2M A;  3A54 A;  4QIW B;  5EGT A;  1KBL A;  3J7A K;  3WNZ A;  4RZR A;  2BE5 D;  1B7Y B;  4XXE A;  4MV9 A;  1F2Y A;  4ULL A;  4KJO A;  1S68 A;  1X55 A;  1NE3 A;  4GN4 B;  4KMU C;  4PG3 A;  4YHH H;  2C2R A;  2V4R A;  3GII A;  1GD7 A;  4ECV A;  1YEZ A;  3BYT B;  4BY1 G;  1VQ6 A;  5IT9 W;  4DV7 Q;  2W70 A;  2E5L Q;  3WO0 A;  4RG1 A;  4YWL A;  4NXN Q;  5DQH A;  1LT5 D;  4NXM Q;  4RNM A;  3S15 B;  4JI4 Q;  4OO1 I;  1CS0 A;  4IR1 A;  2KVM A;  1MBY A;  1N48 A;  2O4X A;  3SK6 A;  1L0W A;  2XCL A;  3Q23 A;  4WJ4 A;  1GOZ A;  3T1H H;  2R7Z A;  2MCT A;  4MTN A;  3A8J E;  3P7J A;  2F0M A;  1CKM A;  4IUN A;  4P75 A;  5D14 A;  3RR5 A;  2YRW A;  2B2V C;  1I4R A;  4A3K G;  4J8Q A;  1QZG A;  4LF6 L;  1J5E H;  4R9W A;  1GSA A;  4K0K H;  3OTO L;  2OXP A;  4A3E G;  1IOW A;  3RV4 A;  2B2Y C;  2ZT9 C;  5IWA Q;  2AQ3 B;  4LF6 Q;  4LFA L;  2FPG B;  1NCV A;  1FD7 D;  5KFS A;  2E2H B;  1AH9 A;  4ECS A;  3VMM A;  4X3K A;  3RZO B;  5I9P A;  2AQ4 A;  4TKO B;  1TA8 A;  4R8U A;  3HBL A;  2NU6 B;  5C44 B;  1EYA A;  2CQA A;  1HTL D;  3E6Z X;  4DK0 A;  5K2M A;  4LF8 H;  3I72 A;  2WYO A;  2VW9 A;  2C00 A;  4GKK H;  5J1Z A;  4F88 A;  2BQR A;  4QJF A;  4LUZ A;  3Q1K A;  4ED3 A;  3FPP A;  5LYJ F;  3MVV A;  2F0L A;  5BN5 A;  4ZYS A;  4O3R A;  4C5B A;  1TKW B;  3GIP A;  2MUY A;  1JWS D;  1D2B A;  2EYM A;  3OOC A;  2Q2U A;  1EYC A;  2P5Z X;  5JH7 F;  1I94 H;  1B6R A;  4KV6 A;  2E2J B;  2M05 A;  3RV3 A;  4B3M Q;  4G4K A;  5EPJ A;  4Y52 H;  4LFA Q;  3PZP A;  2K05 A;  3A5Z B;  2YTX A;  1TVX A;  4A3B H;  3QR8 A;  2EZV A;  1S40 A;  4A2A A;  1IKM A;  4RU9 A;  3GTM A;  1VQH A;  3M85 A;  5D3D A;  4LF5 H;  2M00 A;  3CCS A;  3LWB A;  3R3O A;  3I70 A;  1NSN S;  2R8J A;  4JI5 H;  1WCM A;  5DNF A;  1AZQ A;  1IYJ B;  3K0X A;  2IL8 A;  2HCI A;  2PPB C;  4TV8 F;  1HNW H;  1H9K A;  3HKZ A;  2I46 A;  3EFX D;  3GTJ B;  3D8G A;  5IGD A;  4KHP L;  3J80 W;  2ASD A;  5LXT F;  3D6C A;  2EXD A;  4NXM L;  2K5H A;  5DQG A;  1SEB D;  4CDD C;  1NY4 A;  2Z6K A;  1ZHQ A;  4X64 Q;  2CH4 A;  2NBF A;  3I4N H;  3TZD A;  1KRT A;  3VR6 A;  1PZI D;  4JI8 L;  1Y1W B;  1DOK A;  2FK3 A;  3GTJ A;  4UP9 A;  1T5X D;  2NVX A;  4YHH L;  3UDX A;  1CFM A;  3PO2 B;  5IP7 H;  3HOX H;  1ZQ7 A;  4YR3 A;  4GOP A;  1JOQ A;  1KC8 C;  2EXZ A;  5C4J B;  2EY2 A;  4JK1 C;  2BR0 A;  4OX9 H;  2WIN B;  1HNZ Q;  5HGQ A;  1VQ9 A;  2JA5 H;  4XYL B;  4M7E A;  3PVX A;  3KF6 A;  1KEE A;  4FVM A;  4JCV E;  3OHA A;  1EZ1 A;  2PYK A;  4EEY A;  2LMC B;  4EBE A;  3MEF A;  3LX0 A;  1D1K A;  5M5X B;  5JAV A;  3UE0 A;  1EZ8 A;  5FLM H;  3I4N B;  1NR2 A;  2NTS A;  2OT2 A;  3DM1 A;  2N55 A;  4JI1 H;  2OLS A;  1MJC A;  4KD3 A;  1ML0 D;  3F2D A;  4EFE A;  3H40 A;  3W1B A;  4L5T A;  3J7A V;  4C3I B;  4DV6 L;  2WB1 G;  3MJF A;  1ZHS A;  1BXT A;  4JI6 H;  2J4X A;  3P1H A;  4V0B A;  4DR5 H;  2NVY B;  3KOJ A;  3UE1 A;  2WB1 A;  3C2P A;  1N9W A;  4B08 A;  4DV2 L;  1I5F A;  1BXR A;  2XGQ A;  2NYZ D;  4YHH Q;  4OEM B;  3PUW A;  4K2K A;  4O3N A;  3S1M B;  1MD2 D;  1YJW A;  2JK8 A;  2PZW A;  2L1B A;  1PX2 A;  4ZI7 F;  3JAM E;  2W6M A;  3OIP A;  1SXT A;  4GKK L;  1Q1B A;  2R61 A;  2UU9 H;  1W3S A;  3FDS A;  3T1H Q;  1B6S A;  3GTP H;  4Q5V A;  3T5K A;  3BYY B;  1Y1V B;  5M5Y H;  2Q8T A;  2K6A A;  1TS4 A;  1EQR A;  1EWH A;  4C1N I;  2NU8 B;  1EOT A;  2DN8 A;  4C1N K;  1TWA A;  3RB0 A;  2A6H C;  4OWX B;  4WFN 3;  1OXX K;  2DNC A;  2F4I A;  5KFG A;  5IYC G;  3ZJY C;  2JA7 H;  3U9T A;  1XMQ L;  1KJ8 A;  4YBZ B;  2YV5 A;  1ESR A;  2EDG A;  3NP8 A;  3MFG A;  2WAC A;  1SYD A;  2F4V Q;  2B63 B;  2DLN A;  4DGZ A;  4LSA A;  4KHV A;  2J0T D;  1XDN A;  5HUR A;  4GOP B;  3HGB A;  2ZJT A;  3FKI B;  5FPO A;  4IN3 A;  3CF5 A;  3BQ1 A;  1CZG A;  1YIT A;  3GTO B;  2KOL A;  1PH7 A;  3DWP A;  3TIG A;  5KIX A;  1XMO H;  2DWC A;  1GYF A;  1XTC D;  4RH6 A;  3DUZ A;  3N6R A;  1BKB A;  2LSS A;  4GN5 A;  2F0G A;  2VS1 A;  4B3T Q;  2IX0 A;  3K5I A;  2R7K A;  1H9J A;  4A93 G;  1E4G T;  1B3Q A;  1LYL A;  2UVR A;  4ZK9 B;  1GSO A;  1B3A A;  3T5L A;  2A74 C;  1IOV A;  3HOY G;  5KFN A;  1Z9F A;  3F8N A;  3HZX A;  2VNU D;  1TXY A;  1WCM B;  4C3I G;  4DNR B;  1CK1 A;  3MFH A;  5L9X A;  1IL8 A;  2M9V A;  2N3S A;  3M4Y A;  4A3B G;  4DL6 A;  4V19 0;  4BBS H;  1Q8K A;  4MV4 A;  4OX9 Q;  2K50 A;  2ZTC A;  1WD1 A;  1B53 A;  1TWF H;  4XQQ A;  1SMY C;  4UP8 A;  4MNO A;  3K5O A;  2YRX A;  5C5M A;  2W71 A;  5I47 A;  1XNQ Q;  2F0S A;  2NVQ B;  4JI2 H;  1VQA A;  2PBZ A;  1IHZ A;  1ENF A;  2JSO A;  2KA7 A;  4WD3 A;  2AUJ D;  1JJ2 A;  1STB A;  1F2L A;  2F3W A;  4BY1 H;  4JUZ A;  5C4X G;  3A0J A;  4NMZ A;  1U4P A;  4J1M A;  4EEQ A;  5BN4 A;  1CUK A;  1GUT A;  1NMG A;  4A3L G;  1TWF B;  1VQN A;  4ID6 A;  4OIJ A;  1G2T A;  2AWN A;  1PH6 A;  5KFQ A;  3GTG H;  2A1A A;  4DL5 A;  1LM0 A;  4LUO A;  4G57 A;  3M9N B;  4A3D G;  1B1Z A;  5ISR A;  1WVL A;  4EBC A;  2WDT A;  4DR1 Q;  2PO4 A;  1X65 A;  3KF8 B;  4YQW A;  2PQA A;  4LFB L;  2NVQ H;  1JR0 D;  2EYO A;  4DUZ H;  2Z1C A;  1EY0 A;  2KSW A;  1I6U A;  2L5T A;  2UXB Q;  1C3O A;  5DLF A;  2RGR A;  5KT3 A;  5JPM C;  4EBD A;  2C22 A;  5FD6 A;  1TY2 A;  3HS0 C;  4BBR B;  3E9I A;  4O2A F;  1GXD C;  2SDF A;  2IT1 A;  5LP6 F;  1II3 A;  2R7Z H;  5IIF A;  4AYB A;  1KNA A;  1Q86 C;  4ZLT F;  4GKJ Q;  4HJ7 A;  2F0Q A;  4KHP H;  2B2T C;  3S1N H;  2HVR A;  4DUY Q;  5K36 G;  1DXM A;  2A6E D;  2FJ2 A;  3MWE A;  3H15 A;  1MSH A;  4DAM A;  2E2J H;  4AYB B;  4MTD A;  2FK1 A;  1L1O B;  3W2D A;  3RJ0 A;  4R4C A;  2KED A;  2FJZ A;  1XXG A;  4BY7 G;  2E8G A;  2AGQ A;  5DLG A;  4UCU A;  3TRZ A;  1GSH A;  4A3B B;  4JBM A;  3OW7 A;  1JLL B;  2FK2 A;  3H6M A;  4B9W A;  3H0G A;  2YTY A;  2ENB A;  5DEH A;  3CP0 A;  3RLO A;  4FYD A;  1YVC A;  5L1L A;  1UEA B;  1G6Z A;  3UQ8 A;  1GHK A;  3OSP A;  4IFD G;  1IKL A;  4IFD I;  2B29 A;  1CQV A;  1EY7 A;  2VA2 A;  2AUK A;  2QGQ A;  5KFR A;  3U50 C;  2YZN A;  1MGS A;  4MV3 A;  3T1H L;  1UC9 A;  3CQZ A;  2CW8 A;  3S15 H;  2FE3 A;  5KG7 A;  3DLL A;  4O1N A;  3GTM H;  3JSN A;  2JQO A;  4WOR A;  5EPK A;  2ID0 A;  1G29 1;  1PZJ D;  3HOX G;  2RDG A;  4DR2 L;  1NMF A;  3GV6 A;  4B3T H;  4IRK A;  2RCN A;  1DD2 A;  2KEE A;  3NBH B;  4QWD A;  4A3D B;  5F9N A;  1IW7 C;  3G6J B;  5ELE A;  3HOV B;  3T1Y H;  2A68 D;  4HN7 A;  1KNE A;  2C28 A;  3AQQ A;  4JI4 L;  2R92 B;  1D1I A;  1DOL A;  1SE2 A;  3JAM L;  1KHI A;  2CH4 W;  4UCT A;  1AZP A;  4HJA A;  1BF4 A;  1PH5 A;  3E0E A;  1I50 H;  4JC0 A;  1QE6 A;  2RDH A;  3N52 A;  3J80 L;  2VQE Q;  5KG4 A;  4Q45 A;  1OTC A;  2VUM G;  5KNC A;  3EPG A;  4RB0 A;  3A56 A;  2SNM A;  2X0S A;  2HVS A;  1V8Q A;  4H44 C;  2EYL A;  2OCE A;  1TWG A;  4AQY H;  2Z6B A;  1RD9 D;  2R8H A;  4IRD A;  3A8K E;  4O4H F;  1SNQ A;  5AJ3 L;  5EKL A;  4RZQ A;  3KF8 A;  4DR6 Q;  1JE5 A;  3CCQ A;  4JV5 Q;  1K0R A;  3OUU A;  4HQ6 A;  5FLX W;  3T13 A;  2XN9 C;  2BDN A;  3HOU B;  1PRT F;  1QVC A;  3QJY A;  3T4A C;  3VDY A;  1SE4 A;  1EYD A;  2RBM A;  1U4L A;  3K7U C;  1S0M A;  4FF3 A;  1V43 A;  3KAK A;  1FNW A;  5JJK A;  3J81 E;  2W6N A;  5KFO A;  3KTM A;  4DV3 Q;  1HR0 W;  3S17 B;  2L55 A;  1SSO A;  3KLW A;  3NQI A;  2AGP A;  1XPO A;  1PFN A;  1CSQ A;  4J9R A;  4KKU A;  2WP8 J;  1I3Q B;  1XNQ L;  3Q8Q B;  2B2Y A;  5KFJ A;  3CPW A;  2ES2 A;  1VQB A;  3MXP A;  4X3U A;  2EJM A;  2GPW A;  1TWC B;  4X6A H;  4XYM B;  1A15 A;  1PVO A;  2ALZ A;  3IL8 A;  4PWQ A;  4LFC L;  2B8G A;  3JC6 6;  5CV4 A;  5CR3 A;  4DV5 H;  3NBH A;  1OXS C;  1AN7 A;  1VQ5 A;  1AEX A;  4BWS C;  1HXY D;  3Q6S A;  4HMI A;  1MSG A;  3K58 A;  5C1O A;  4HID A;  4IWX A;  2UXB H;  5C3X A;  2K33 A;  3ONA B;  4CDC C;  2KCN A;  2OQK A;  1TWH A;  5TSS A;  2KQ3 A;  1MHW C;  4AQY L;  4CJ1 B;  1TQO A;  2GPS A;  2W8K A;  3GTO H;  5NUC A;  4LF4 H;  2HGS A;  4ZRZ A;  1HNZ H;  3CHB D;  3TSS A;  1S5F D;  1KXL A;  4OXP A;  4DR3 H;  5CBA E;  1TU2 B;  2FMC A;  4G3I A;  4YB8 B;  3IN5 A;  1BR9 A;  3TBI B;  1IL2 A;  3RGZ A;  1HNW L;  3I8Z A;  1N33 Q;  3A55 A;  3SK5 A;  4XTC S;  5L1K A;  2ZM6 H;  1GJX A;  4R8N A;  4A3E H;  5KNB A;  3JAM c;  1LUZ A;  4CC5 A;  3IG0 A;  2OF1 A;  1S0N A;  3GD7 A;  2D0O A;  3ER0 A;  2JEB I;  4LF9 Q;  2K52 A;  2FMM A;  3HOW B;  5IWA L;  3Q2O A;  5I9O A;  2F0T A;  4LF9 L;  1EY4 A;  1RL2 A;  3VR4 A;  3I91 A;  3C1E A;  4QY7 A;  4HJ9 A;  2VA3 A;  1AW7 A;  5EJW A;  3OIQ A;  2PZT A;  5FK9 C;  3OTO Q;  4K8J A;  3G6Y A;  1BOS A;  4F4W A;  2R92 H;  2FHT A;  1GM5 A;  1JDB B;  4PZ8 A;  1PV4 A;  4LH7 A;  3GTP A;  4A3K B;  1PH8 A;  2A5H A;  5JOB A;  4A3E B;  4B3M H;  4X62 L;  1K3B C;  5KFA A;  4C2M B;  2JJQ A;  5KG1 A;  3TQ1 A;  3MWD A;  4A75 A;  1FR3 A;  1GUO A;  4I55 F;  3BQ0 A;  5GQO A;  4A3C G;  2MFI A;  1UE6 A;  1YI2 A;  4DV2 Q;  1Y1V H;  4R7R A;  2RSO A;  3D4D A;  1W6J A;  5C44 G;  4JI5 Q;  4YY3 Q;  3OTO H;  3HXL A;  4JV5 H;  1SJE D;  2RDF A;  3K81 C;  3W1G A;  2F4V L;  2R7L A;  1DCZ A;  4LK1 C;  4F87 A;  4DV7 L;  3KBX A;  3WO1 A;  5IYB H;  4LJZ C;  1EEI D;  1IYU A;  1TWH B;  1VMP A;  1IBM Q;  4UCO A;  3STB D;  5G3L D;  1T5E A;  4A3I B;  4J9K A;  1I7N A;  1M0W A;  1D8L A;  2FKL A;  4IZO A;  2UXD H;  1ASY A;  4ECW A;  4ECZ A;  5A35 A;  4DR6 H;  2B2V A;  4J6H A;  2BQ3 A;  3NPP A;  2AU0 A;  3TP7 A;  2EVB A;  5BMV F;  3K3V A;  3O13 A;  2F0W A;  2NVT B;  3HKS A;  4UAI A;  4HAE A;  5JJZ A;  4O4I F;  3UDF A;  3QOL A;  1C48 A;  1ICF B;  3BZC A;  4I7Z C;  1B33 N;  2XGP A;  3SI8 A;  4NLG A;  4DUZ L;  3IFD A;  2I5H A;  3WWV A;  3S24 A;  1WR2 A;  4LFB H;  2IA6 A;  1A8V A;  1JJG A;  3S2H H;  1HR0 Q;  1JWM D;  1JIH A;  3OSN A;  5BR8 H;  3Q24 A;  5J2T F;  5EWF A;  4DU9 A;  1HNX Q;  5IOD A;  3GIL A;  1EEF D;  5ELB A;  2WFW A;  4OO1 G;  4QQB X;  3CMA A;  3SE7 A;  3VYS A;  5KFL A;  2NTT A;  3QG1 A;  4DV1 Q;  4YR0 A;  1W96 A;  5JUM A;  1UWV A;  1G8Z D;  1Q46 A;  1IBM H;  3A7L A;  1Y1W A;  2FFK B;  4G7Z C;  1N32 Q;  4DR7 L;  5C8Y F;  1BVS A;  3MXG A;  3L4K A;  2UUA H;  5CC4 A;  4JI0 Q;  2IX1 A;  1QWY A;  4BBS B;  2WV6 D;  3QIA A;  3QB3 A;  2D0P A;  1L0X B;  4C3J H;  3M4O B;  4UDU C;  4JI2 L;  3K3P A;  2WB1 E;  3KYH C;  1BCP B;  2D62 A;  3GV5 B;  3DM3 A;  1I7L A;  4MTK A;  1PYW D;  2L9H A;  1J6Q A;  3QO2 A;  4RFB A;  2JA8 H;  4ME5 A;  3ITP A;  2PMZ B;  3L7Z C;  2G9D A;  3DF7 A;  2XWB B;  3TII A;  2IMW P;  1HR0 H;  2R6G A;  2R84 A;  2F0J A;  3G6E A;  3S2D B;  5E3F A;  1ENC A;  4IAL A;  5IYB G;  1EUD B;  3PGZ A;  2WII B;  1F9P A;  1Q3L A;  5ELC A;  4LF8 L;  3BDO A;  3K80 C;  5C4X H;  4FXK C;  2AKW B;  3CCM A;  3SVM A;  2EY6 A;  4KN7 C;  3I4M G;  2R85 A;  2W9C A;  2CHB D;  3TZU A;  1B4O A;  3HB9 A;  4A3I G;  4LW1 A;  5FLM G;  5D1P A;  2B39 A;  4KLK A;  4PMC A;  2XIG A;  1DOM A;  1Y1V A;  4LFA H;  4B3S L;  2CW0 C;  4TV9 F;  4EQP A;  4DA2 A;  2O5J C;  2IW3 A;  4DAP A;  4K5V A;  4KD4 A;  5KFP A;  4YAK B;  2J7Z A;  3I7F A;  3L2P A;  1RJR A;  2Q2T A;  3MR3 A;  3KHR A;  1B44 D;  4JYA L;  3KAJ A;  4RAU C;  1XYI A;  1OXT A;  4L6T B;  4PQX A;  3CME A;  4I7A A;  4FO2 A;  3KK7 A;  5E7N A;  4N9T A;  2QW7 A;  1F2Z A;  4KTA A;  3S9W A;  2ATL A;  1YJ9 A;  1S5C D;  5J2U F;  1XMQ H;  4LMQ D;  2JA5 G;  3SDZ A;  4LF8 Q;  5DG9 A;  2QDL A;  1YNN D;  1VDZ A;  4J15 A;  3HOZ H;  3QZ8 A;  2PMZ E;  4IPH A;  4RGT A;  3TQT A;  1R9T H;  4C2M A;  3K7A B;  1S9F A;  1CKO A;  1E2Z A;  3HKZ E;  3F2B A;  4MTE A;  1DV2 A;  4DV4 Q;  4RAZ A;  4RCO A;  2R8G A;  4IZ8 A;  5CYU A;  3VPD A;  4DPG A;  4F50 A;  4X65 H;  4MAM A;  3GTG B;  3BDC A;  2EYH A;  2UXC H;  2JA7 B;  3NGD A;  1MIU A;  2Y0S G;  2B63 G;  4UCV A;  1PRT B;  1E7Z A;  1I3Q H;  2O2L D;  3GTQ B;  5KX5 F;  3ND9 A;  1M0T A;  1WTQ A;  1RJP A;  5CA0 F;  4U7C A;  5GAE C;  1N34 Q;  1HQR D;  4DR5 L;  3KBG A;  3ORQ A;  1PRT D;  3V96 A;  5DGB A;  1G6P A;  5J22 A;  1GUW A;  2B63 H;  1SDF A;  2F3V A;  5CV6 A;  1K28 A;  2CVR A;  3IRB A;  4QWA A;  1HNX H;  3PIO A;  1R9T B;  3D6W A;  1FL0 A;  2FPI B;  4QCL A;  4IHJ F;  2R7F A;  2PNR C;  4XYO A;  2SCU B;  5CB4 F;  1SN8 A;  3PR4 A;  2IHF A;  4BS9 A;  3W5O A;  4A3G B;  1K8G A;  1E3P A;  1VQF A;  2KCT A;  1AUV A;  4YJ3 F;  3I4O A;  5KFD A;  2XNA C;  4R1J A;  3Q8R B;  1CKN A;  2Q2I A;  2R93 A;  4J0M A;  3TEH B;  2IY5 B;  4DR3 L;  1VQ4 A;  5LMN H;  1TWF A;  3PW7 A;  1B70 B;  1O7I A;  3R93 A;  4DR4 Q;  2V1C C;  2B2W A;  4C3I H;  2UUA Q;  1SND A;  3GTK A;  3JZI A;  5M9O A;  1GGO A;  3T51 B;  3M9O B;  5L1I A;  4L63 B;  3GP7 A;  5ELN A;  3T1Y L;  4DR1 H;  3NWT A;  5KKN B;  5J39 A;  1I6H B;  3TP6 A;  3RNU A;  2K5V A;  3H0G H;  3H20 A;  3ULP A;  1SAP A;  1T94 A;  3ERO A;  4LFC H;  2ICI A;  2ZXO A;  1YZ6 A;  3J81 j;  5A2Q L;  1VQK A;  4BY1 B;  5J3B A;  1SFO A;  4QMG A;  4UCS A;  3EA6 A;  1QIL A;  5D65 A;  4GLA C;  3PIP A;  2V5A A;  4DNT B;  5IGG A;  1BNZ A;  1F9R A;  1BBW A;  3P75 A;  2BH2 A;  4EYI B;  5K36 H;  1WD0 A;  2SEB D;  1EWC A;  1I6H H;  1SNM A;  3KHG A;  5M5W H;  3BZK A;  4OEL B;  1SE8 A;  3SHL A;  2NU9 B;  1YNX A;  4HJ8 A;  4NXN H;  3KDF A;  1FGU A;  2JA8 G;  1V1Q A;  4KY7 A;  4EYH B;  4HJ5 A;  2W9B B;  5EWE A;  1N34 L;  4Q44 A;  3H3V H;  1Q12 A;  4QL5 A;  5KYI A;  2W6O A;  5M3M H;  4IRC A;  2LY7 A;  2IWH A;  4MV1 A;  2X69 A;  3OWF A;  2D2C C;  1KDA A;  4OGQ C;  5H80 A;  2X6L A;  5D3I B;  4BA1 I;  1OXU A;  5IT9 c;  1XNR L;  2O5I C;  4GS3 A;  4APM A;  1YNJ C;  3TN2 A;  1EQT A;  4L5R C;  2JEF A;  1HZC A;  1ZYR C;  2HHH Q;  4Y7N H;  3ORR A;  4MV6 A;  3GTQ A;  4O3S A;  1IBK Q;  1DYQ A;  3LNN A;  3V6K A;  2VY3 A;  3K5L A;  1A9X A;  1TWA B;  3GTG A;  5LHY 1;  3D0F A;  1IBK L;  1VQ7 A;  3KUP A;  1HTP A;  1E2V A;  2G9H D;  5JVD F;  1QB5 D;  1X6O A;  1XMQ Q;  1E0B A;  4B3S H;  4YCW A;  4ZCK A;  5FO7 B;  3GQB A;  5IGB A;  3T16 A;  5JEA G;  3L4J A;  3HEJ A;  4QWB A;  3IFT A;  3A5U A;  2ZM6 L;  1KJ9 A;  3U4V A;  4UHV A;  4JYA Q;  4RUC A;  3I4M H;  3VPC A;  3T1Y Q;  2K32 A;  1DGS A;  2A69 C;  4DUY L;  1HZA A;  3A7A B;  1IBL L;  2OH2 A;  4R4O A;  1SYE A;  3HFZ B;  2W9B A;  1ZEQ X;  3QOJ A;  4OO1 H;  4HIK A;  5I2Y A;  4N8X 1;  4Q8E A;  4AYB E;  3TP5 A;  2A69 D;  3Q0A A;  4ED1 A;  1BO0 A;  4P72 A;  5L1J A;  2BDO A;  5CMD A;  5LL6 b;  3HOX B;  2R3Z A;  1KAW A;  1YHQ A;  1WYD A;  2E5L L;  4TQR A;  2K5W A;  4C3J B;  1A2U A;  3AYH B;  5IP7 G;  5KG3 A;  2VUM A;  2W57 A;  4XX0 B;  4DV3 H;  3RFC A;  4QWE A;  1QOH A;  1LTG D;  4DV5 L;  2WAQ E;  1KJQ A;  4JBW A;  2CZG A;  2J6S A;  5C0X I;  2JA8 B;  5G3L F;  1CI3 M;  2Z0S A;  3ND8 A;  5E4W C;  2NVX H;  4A3M B;  3A8I E;  4A4I A;  3VR2 A;  2F0O A;  1TWC A;  2Y0S E;  1BJT A;  1I94 Q;  2R93 G;  4GKJ L;  5LMN Q;  1K73 C;  4FU0 A;  1I3Q A;  3K5H A;  4X66 L;  3U9S A;  1NUC A;  3AEV A;  4WJ3 M;  3HG9 A;  1S97 A;  4NW2 A;  2VOB A;  2PMZ A;  2JA9 A;  3K5N A;  4JI3 H;  1D5M C;  4M9U A;  3N43 B;  4NB3 A;  2NVX B;  1AN8 A;  4A3C H;  2MNA A;  3BVZ A;  3HOU G;  1ZYR D;  3UDI A;  4DV3 L;  4DR1 L;  1TII D;  2MGS A;  1O7Y A;  1ONL A;  4ALP A;  4ZKC B;  1LO5 D;  4QUF A;  4CGY B;  1K83 A;  4IUQ A;  2CKZ B;  1PDQ A;  3S1Q H;  4GZY C;  2YW2 A;  2YS7 A;  3HOU H;  1JJC B;  1V4Y A;  2CW7 A;  2FB9 A;  2VQE L;  2UVW A;  4DV4 L;  1KDB A;  4KN4 C;  5LMN L;  3OSO A;  3S17 H;  1IBL H;  4MA5 A;  1LAB A;  4YJ2 F;  1JOO A;  1VS0 A;  4HR7 B;  5EWG A;  2KJX A;  4ABN A;  2P0A A;  2QA4 A;  1PFB A;  1VQE A;  1SFO B;  1A63 A;  2JA6 B;  3K7A H;  5HY6 A;  1CQI B;  5T1I A;  3R5H A;  2ZDQ A;  1KC7 A;  4O3Q A;  4J9O A;  1O75 A;  1I4Q A;  2VUG A;  1Y8O B;  1JCK B;  1ENA A;  1Y1V G;  1BCP C;  5IP9 H;  4L5Q A;  3BA8 A;  4RB2 C;  1EHI A;  3MFY A;  1QZH A;  1IBK H;  2YZG A;  3PUX A;  5D1O A;  1RK6 A;  5CV5 A;  4IPC A;  2RVL A;  3I73 A;  5JVG 3;  2YS6 A;  4FM9 A;  1LTI D;  1C8C A;  3V6J A;  1QNK A;  4IJH A;  1ESF A;  4IFD J;  4BY7 H;  2PZU A;  4G7O C;  2QEJ C;  1WTP A;  3P20 A;  2MP1 A;  4MZ9 A;  4YCU A;  3RZD H;  3RN2 A;  2V4Q A;  3SGI A;  1T9H A;  1S10 A;  2I8C A;  2LFN A;  4RCN A;  1LTS D;  1YNN C;  1CKN B;  5FJ8 H;  2JA6 H;  3AMU A;  2R93 B;  4R8U B;  1VAJ A;  4B9X A;  1VQD A;  1PMR A;  1SR3 A;  1LV9 A;  3S2D H;  1Z6H A;  3FMC A;  1VQC A;  2ZTE A;  2NVY A;  1V51 A;  1V1P A;  1PH1 A;  3CPF A;  5M3F B;  2JA5 A;  4EVO A;  5KG0 A;  1MZB A;  3LML A;  4U68 A;  4A76 A;  3HOW G;  2H1E A;  4FP5 D;  4I65 A;  4O3O A;  3D4R A;  5C3E B;  1VBG A;  1Y69 U;  3CRL C;  3GIQ A;  5KFY A;  1W6K A;  3FKI A;  3J81 c;  1XMO L;  5EZY F;  1NTG A;  5KYL A;  4BY7 B;  5KT7 A;  2K1B A;  2HHH L;  2UVU A;  3RN5 A;  4IPG A;  1WSC A;  1WCM G;  2KCM A;  4HNV A;  3RZD B;  1KD1 C;  5AFW A;  4OON A;  4LF4 L;  2EJG C;  1TT2 A;  4KI0 A;  3I12 A;  4JV1 A;  5DG7 A;  2E2I B;  3GTL H;  4YCV A;  3LGJ A;  4RNO A;  1SNO A;  3RF2 A;  4KK7 A;  4K5W A;  2EPB A;  1JE4 A;  1A2T A;  2UXD Q;  4QIW A;  1KDC A;  1UE7 A;  4NDX A;  2WKD A;  3CCV A;  3AB9 A;  4P2C B;  3NEL A;  2CWP A;  3H91 A;  3VR5 A;  5FLX L;  3MZ5 A;  1Z2O X;  3PW2 A;  4NKL A;  3SXH A;  4X65 Q;  2UUC L;  1O80 A;  1VKZ A;  1RYS A;  1C0A A;  5KT2 A;  1F9S A;  3J80 i;  1ILP A;  4DV4 H;  5GON F;  4JI2 Q;  3S1Q B;  2PN1 A;  5CAE B;  1TY0 A;  2I07 B;  2Z9H A;  1VCI A;  3G4S A;  4X66 H;  4ZQ3 A;  1HR0 L;  4CJ0 B;  2R8I A;  4OIK A;  4CBV A;  1HFN A;  1UAP A;  2YU9 A;  3QZ7 A;  2R7D A;  4R4T A;  2YYZ A;  1ICW A;  4Q8F A;  1Y8N B;  4XT1 B;  1X3G A;  4QIW E;  1VQJ A;  1Y8P B;  2XIW A;  3PUZ A;  4IPD A;  1LT6 D;  2OEO A;  1HNX L;  4GC7 A;  3CC7 A;  5M3M G;  2YTV A;  2W6Z A;  2B2T A;  4HIO A;  1HZ9 A;  1U5K A;  1I94 L;  5D1O B;  3PW0 A;  3FDT A;  2Z4I A;  4KKS A;  4M1U B;  1HA6 A;  2A68 C;  2NN6 G;  1U9R A;  1E1O A;  4CHT B;  3SR1 A;  1K8A C;  1D6E C;  4DL7 A;  1DON A;  3M4P A;  3NXW A;  5KFB A;  4JV0 A;  4RB1 A;  2XGT A;  4WBN F;  4ZUJ A;  3BVG A;  3T5H A;  4X65 L;  2UUC Q;  2XD4 A;  2R87 A;  3RAQ A;  4GLV B;  4KY5 A;  2RDI A;  4HR7 A;  4IFD H;  1DIK A;  2BOS A;  3J7Z C;  1PH4 A;  5HBR B;  3U4Z A;  5KFE A;  3EN2 A;  4TVA B;  2R7Z G;  5A2Q W;  1PLF A;  3RTX A;  2K28 A;  4P71 A;  4X64 L;  3DWQ A;  4K6L A;  3K8A A;  2B2U A;  3IAY A;  3NBI A;  1RYR A;  4K0K L;  4JI8 H;  2ZJQ A;  2RDJ A;  1V9P A;  5FKA C;  2GVB A;  1M6V A;  3RB3 A;  1ZKO A;  2ZM6 Q;  2I80 A;  3GTO A;  4C2M H;  1R9T A;  1UE5 A;  1M90 C;  4LF7 L;  1AP0 A;  4RHS A;  2ATW A;  4A3D H;  2GLT A;  4LF5 Q;  1FNU A;  4J9S A;  4C3H H;  5LMN W;  3MA2 B;  1FYC A;  2JXM B;  2ZJR A;  5IGF A;  4L5S A;  2F0P A;  4A3F B;  3GDE A;  1O7Z A;  1X3F A;  1QJO A;  2E2I A;  1FJG Q;  4M8A A;  2K14 A;  3EQL C;  5ELO A;  5JPN C;  1YNJ D;  1EWI A;  1L2F A;  4R8I A;  1LAC A;  2FXQ A;  4L8J A;  1CQJ B;  4RHR A;  4ECU A;  3PW4 A;  2Y0S A;  1K0S A;  5K5P A;  2ZDG A;  3I4L A;  5M3M B;  1BGW A;  2KEC A;  3H4D A;  1X32 A;  1X9N A;  5LMU H;  2VUM B;  3L9A X;  3H3V C;  2H5X A;  1UE1 A;  2AGO A;  1S4Z A;  3OMG A;  2WAQ A;  3GV3 A;  2VZA A;  1LTL A;  1EFW A;  2JE6 I;  4XIG S;  4H13 C;  3VA5 A;  2JA5 B;  1A6X A;  5KFI A;  4DV1 H;  3MR6 A;  4A3F H;  3T56 B;  3HKZ G;  3RLF A;  4K5X A;  5CGK A;  3T53 B;  2IX3 A;  4YAJ B;  3TIN A;  3PO3 H;  2UUB H;  4B3S Q;  1N34 H;  1PXU A;  3TDQ A;  5M5X H;  3H0G B;  2JEI A;  2F0D A;  1KLU D;  2UUA L;  2MJ8 A;  2WAQ B;  4IQZ A;  1H9S B;  5FD5 A;  4PV1 C;  2IJ0 A;  2QK4 A;  2A6H D;  3C3L A;  1JB7 A;  1FKA H;  4J9P A;  3JAM i;  2W6P A;  5GAG C;  1HFG A;  1EY5 A;  1YHB A;  1J5E L;  2R7Z B;  3JRW A;  4J9N A;  2NZH A;  1EQV A;  3OW2 A;  4IR9 A;  2Y0S B;  1EY8 A;  5KT6 A;  3M7N A;  5DQI A;  3GIJ A;  1S03 G;  1JX4 A;  5JJL A;  4RGN A;  2LKV A;  3NE5 B;  3C0F B;  1SJH D;  3NHH A;  2PI2 E;  5M5W B;  1Z2P X;  4IO9 A;  4OX9 L;  1LTR D;  2TSS A;  5C3W A;  2Z8L A;  4B3R H;  1S5B D;  3BAA A;  2L4N A;  4BWG B;  1K3R A;  1WCM H;  5F9L A;  4DK1 A;  1UNN C;  3KHH A;  1JXL A;  2E76 C;  5M5Y B;  2DY7 A;  1CA6 A;  1R4P B;  2EIF A;  1SBB B;  4RWS C;  1LTA D;  2KHS A;  1WTV A;  2JEA I;  1YJN A;  4A3G G;  3MFI A;  1L0Y B;  5DGA A;  5E1F A;  3OHB A;  3FRP B;  1BBX C;  4RAY A;  4XQJ A;  1VBH A;  1SNC A;  1H9R A;  1VQI A;  2PVP A;  5EBD A;  3K57 A;  1PH2 A;  1Z7T A;  3V2T A;  3MAQ A;  4A3G H;  4EGJ A;  4ED8 A;  4DF7 A;  2ZDH A;  5JVH 3;  2O03 A;  1ULZ A;  4HNU A;  2XSC A;  1HCZ A;  2RHS B;  2W6Q A;  3H09 A;  1WTH A;  1ZXT A;  5I2X A;  3ULJ A;  1Y1W H;  3RUZ A;  4U67 3;  1HUN A;  4RNN A;  1N33 H;  1Q90 A;  1B2T A;  5IT9 L;  4O0A A;  4HTH A;  5KFZ A;  3HP3 A;  5KND A;  2CWA A;  3UI2 A;  4GLX A;  4F8M A;  4JI0 H;  4EGQ A;  1XX8 A;  2C2E A;  3GTM B;  5C4J H;  1XTD A;  4X62 H;  3ERQ A;  1VQ8 A;  2HD3 A;  4GN3 B;  1ROD A;  1B50 A;  4RGO S;  1UUP A;  1XJV A;  2HVQ A;  1OWT A;  2KHJ A;  3AU7 A;  2FP4 B;  3H0G G;  1SMX A;  2MQH A;  4CKE A;  1KAA A;  1EFI D;  1SYX B;  3KHL A;  1YBY A;  1I6V C;  1VQO A;  1EU3 A;  2MPM A;  4JV2 A;  4O42 A;  1RTO A;  4LF7 H;  4R4I A;  3CCU A;  5KG2 A;  1KL9 A;  2HDL A;  4LF9 H;  3HRZ C;  4DUY H;  1WFQ A;  3JRX A;  1HA5 A;  2HQL A;  4GKK Q;  3PW5 A;  5CBE E;  4I50 F;  1JT8 A;  3BZD B;  1RHP A;  2RQX A;  2VUM H;  4TQS A;  5D8D A;  3GV8 B;  3TRE A;  3OPO A;  1BDO A;  1K83 H;  1U0L A;  2N8N A;  3PCO B;  1M1K C;  4ECQ A;  3CRK C;  2C5C A;  4JVZ A;  4DK6 C;  3Q22 A;  2XWJ B;  3PUV A;  4K6D A;  4C3H G;  4LF6 H;  3PF5 A;  5T14 A;  4IOC A;  5DM7 3;  2YCH A;  2DIK A;  2BH8 A;  3BJY A;  3J80 c;  5I4D A;  3BQ2 A;  2ALY B;  1S72 A;  3RB6 A;  3PUY A;  3IKJ A;  1EUC B;  1I4H A;  1A0I A;  2IHE A;  1JOR A;  3N41 B;  4JYA H;  1BNC A;  4A3J B;  3ICE A;  3RB4 A;  1QVF A;  2UXB L;  1F77 A;  4EG0 A;  1C30 A;  4GNX B;  1GKH A;  3GTP B;  4DV2 H;  1QNU A;  4YR2 A;  2HIV A;  3EVQ A;  4IJL A;  1XPU A;  3RUP A;  1TS3 A;  3GID A;  5T1G A;  4JI6 L;  3CKI B;  1WTX A;  1GLV A;  3D3R A;  1FVI A;  3NK9 A;  2A6E C;  3KJP A;  2R92 A;  2RA4 A;  4J9Q A;  2BA0 A;  4FF1 A;  1XWE A;  4JI0 L;  4Q43 A;  2KHI A;  4JI1 Q;  5KFV A;  5EOY A;  3PMF A;  4MV8 A;  1CT1 D;  4FXD A;  2QEX A;  1OXV A;  2F0I A;  1BBU A;  4GNX A;  1PH3 A;  1SYF A;  1GUG A;  2UUB Q;  2J6T A;  1BUV T;  1HNW Q;  4HCE A;  1E1T A;  4PMW A;  1PTO B;  3R2T A;  1ASZ A;  5EDW A;  2NN6 I;  3M3Y H;  1SYC A;  3NTH A;  3N44 B;  2V59 A;  4B3R Q;  2J6U A;  3KXY T;  1T3N A;  5FPR A;  1Y1W G;  4LFB Q;  4YP3 A;  4CDF C;  3R5X A;  1EZ6 A;  1PA6 A;  4DNI A;  1G2S A;  3GLK A;  2VL6 A;  1A3U A;  2CCZ A;  1EYZ A;  2QIL A;  1AUX A;  4PZ7 A;  2VQF H;  1KQS A;  4QWC A;  1S5D D;  2MHV A;  3F2U A;  5DAU A;  4FF2 A;  3FVQ A;  2E2I H;  2C9O A;  4PZ6 A;  2E5L H;  2OQ0 A;  4X3T A;  3I56 A;  1IBM L;  2F0F A;  3I55 A;  4A3M G;  4DR6 L;  1J9O A;  5BN3 A;  2HT1 A;  4O4L F;  4MA0 A;  3WDN A;  1DV1 A;  2M2L A;  2R8K A;  5C0X G;  5KT5 A;  3K59 A;  5KEE A;  4HMJ A;  3CXC A;  4C3H B;  3M3Y B;  3G6V A;  5BR8 L;  5CA1 F;  1IXR A;  1I4G A;  3PSI A;  1HQM C;  1L1O C;  3V05 A;  2L15 A;  3OHX C;  4DV7 H;  2HHH H;  1E4E A;  4CJ2 C;  4C5A A;  5C4Z A;  2F4V H;  1NNX A;  4JI5 L;  4H7B A;  1STN A;  1GUS A;  1SRU A;  3BJU A;  2I87 A;  3MXN B;  5M3F H;  2K4K A;  3BA9 A;  3RBE A;  1RJT A;  2Q2H A;  2XRS D;  4DL3 A;  4EGV A;  5C3E H;  4PDB A;  4CC6 A;  2HUG A;  4DR2 H;  4APV A;  3MXU A;  2F0V A;  3UDG A;  1KLG D;  5C0X J;  4E6I A;  4EFB A;  4HYK A;  3VYU A;  1TWA H;  1K83 B;  4YY3 H;  3WOF A;  4DL4 A;  1JQY D;  4JI6 Q;  1EU4 A;  4YIJ A; 
#chains in the Genus database with same CATH homology
 2UU9 Q;  3HOU H;  1JJC B;  1PFS A;  3CCE A;  5LMU L;  3CC4 A;  3K7U C;  2I5L X;  3H3V I;  1V43 A;  4A3I H;  2VQE L;  5JJK A;  4DV4 L;  5LMU Q;  5IY0 A;  5LMN L;  2DUD A;  2JA6 G;  3S17 H;  1K9M C;  5JJI A;  5FLX c;  4DV3 Q;  1Q81 C;  1TWH H;  1SFO H;  1HR0 W;  1VS0 A;  2UXC Q;  3PO3 G;  3KLW A;  5IYC H;  2WAQ G;  1VQE A;  2QA4 A;  1PHJ A;  2JA7 G;  4A3L H;  4DV0 L;  5DLQ E;  3K7A H;  1TWG H;  5HY6 A;  4A3J H;  1XPO A;  3J7A 5;  1A63 A;  1CSQ A;  4NXN L;  2WP8 J;  4JG2 A;  1HNZ L;  2BA1 A;  2UU9 L;  1XNQ L;  2DGY A;  3CPW A;  2ES2 A;  1VQB A;  1Y1V G;  3KJO A;  5IP9 H;  4L5Q A;  4X6A H;  1PVO A;  3E9H A;  4AQY Q;  4LFC L;  1EOV A;  2MO1 A;  3JC6 6;  1QZH A;  2XTI A;  3PUX A;  1XPR A;  3FKI G;  4IPC A;  3S16 H;  3PO2 G;  1OXS C;  3FKI H;  1VQ5 A;  3GTK H;  4H02 A;  3HOZ G;  4IJH A;  4JOI A;  4IFD J;  4TQU S;  4BY7 H;  3G48 A;  1VQM A;  1WI5 A;  1X54 A;  5H1S E;  3EBE A;  4HID A;  4MZ9 A;  4YCU A;  3RZD H;  3RN2 A;  2OQK A;  3SGI A;  3L0O A;  1P8L A;  1T9H A;  3EIV A;  4AQY L;  4A3J G;  5FJ8 H;  2PI2 A;  1CKN B;  1KIX A;  5M3F G;  2JA6 H;  3GTO H;  1AE3 A;  3GO5 A;  4DV1 L;  5FJ8 G;  1KXL A;  1VQD A;  4OXP A;  1SR3 A;  2K75 A;  3S2D H;  3CW2 C;  2AMC B;  1VQC A;  2ZTE A;  1IL2 A;  1HNW L;  1PH1 A;  3CPF A;  1QVG A;  1N33 Q;  3F2C A;  4XTC S;  4DR4 L;  1H95 A;  4A76 A;  1SLJ A;  2Z6K C;  3HOW G;  3PO2 H;  2I5M X;  4A3E H;  3M4O H;  3JAM c;  4UY8 C;  1LUZ A;  2N49 A;  3B6Y A;  4JI7 L;  4AH6 A;  3J81 c;  1EIF A;  3GD7 A;  1XMO L;  2D0O A;  3ER0 A;  2JEB I;  1NTG A;  4LF9 Q;  2K52 A;  5IWA L;  2HHH L;  3RN5 A;  4IPG A;  1L1O A;  3TQY A;  3ERS X;  4DV5 Q;  1B7Y B;  1WCM G;  2KCM A;  4FDB A;  4LF9 L;  1KD1 C;  1RL2 A;  1X55 A;  4OON A;  1NE3 A;  4GN4 B;  4PG3 A;  4QY7 A;  4HJ9 A;  4X66 Q;  2YU9 H;  4LF4 L;  1GD7 A;  2OTJ A;  1YEZ A;  3F1Z A;  4BY1 G;  1VQ6 A;  4DV7 Q;  3OTO Q;  2E5L Q;  2A19 A;  1AE2 A;  1X56 A;  4KI0 A;  4RG1 A;  4YWL A;  4NXN Q;  3AFQ A;  4NXM Q;  2R92 H;  4OO1 I;  4JI4 Q;  1GM5 A;  3GTL H;  4YCV A;  3LGJ A;  4PZ8 A;  4JI7 Q;  1PV4 A;  1L0W A;  2AHO B;  1PH8 A;  4JI1 L;  2UXD Q;  2LXJ A;  1UE7 A;  4WJ4 A;  3CCV A;  1N8R C;  5JEA J;  3NEL A;  4X62 L;  1JMC A;  4MTN A;  2CWP A;  2JJQ A;  4P75 A;  1CKM A;  3RR5 A;  4JI3 Q;  4X65 Q;  4A3M H;  2UUC L;  4A3K G;  1QZG A;  4A75 A;  4LF6 L;  5IYD G;  4BXX G;  3OTO L;  4A3E G;  5GQO A;  4A3C G;  4AIM A;  2MFI A;  1UE6 A;  5IWA Q;  3J80 i;  1YI2 A;  4LF6 Q;  4DV2 Q;  1Y1V H;  4LFA L;  4JOI C;  2C35 B;  4JI2 Q;  5C44 G;  4JI5 Q;  3M4Q A;  4YY3 Q;  4POG A;  1AH9 A;  1VCI A;  3G4S A;  3K81 C;  2F4V L;  1HR0 L;  3W1G A;  4DR3 Q;  4JBK A;  4DV7 L;  5IYB H;  4BBR G;  2R7D A;  4R4T A;  2YYZ A;  2VW9 A;  1IBM Q;  3STB D;  1X3G A;  4QIW E;  1VQJ A;  4QJF A;  4LUZ A;  1D8L A;  1ASY A;  4B3T L;  3PUZ A;  4IPD A;  1YIJ A;  1HNX L;  2GVA A;  3CC7 A;  5M3M G;  1VQG A;  2YTV A;  4POF A;  4HIO A;  1HZ9 A;  2Q2U A;  4O2D A;  1U5K A;  3HKS A;  4YWM A;  1J5E Q;  1I94 L;  3UDF A;  1D7Q A;  3BZC A;  2NN6 G;  4DUZ L;  1E1O A;  1Q7Y C;  1IBL Q;  2I5H A;  3WWV A;  3S24 A;  2NVY H;  4B3M Q;  1A8V A;  4Y52 H;  4LFA Q;  1K8A C;  1JJG A;  3A5Z B;  3S2H H;  2YTX A;  3M4P A;  4A3B H;  3KF6 B;  1HR0 Q;  2ASB A;  1S40 A;  2XGT A;  2CQO A;  1VQH A;  3M85 A;  4X65 L;  2UUC Q;  4LF5 L;  1HNX Q;  4GLV B;  3CCS A;  4RMF A;  2GN5 A;  1E24 A;  2WFW A;  4OO1 G;  4QQB X;  3CMA A;  1IYJ B;  3K0X A;  3J7Z C;  1PH4 A;  3CAM A;  4DV1 Q;  3U4Z A;  1G51 A;  1UWV A;  1Q46 A;  3EN2 A;  3CD6 A;  3STB C;  4TVA B;  4B3M L;  2R7Z G;  4KHP L;  1N32 Q;  4DR7 L;  1BVS A;  4X64 L;  4P71 A;  5EAY A;  2EXD A;  4NXM L;  2K5H A;  3K8A A;  2OTL A;  2IX1 A;  4JI0 Q;  2NVT H;  3CC2 A;  1NY4 A;  2Z6K A;  4K0K L;  4X64 Q;  3I4N H;  1KRT A;  2ZJQ A;  4C3J H;  2D0P A;  4JI2 L;  4JI8 L;  1V9P A;  2GVB A;  1NJI C;  2WB1 E;  3KYH C;  2D62 A;  4LWC A;  4UP9 A;  3DM3 A;  3G71 A;  2ZM6 Q;  4YHH L;  3UDX A;  3HOW H;  4C2M H;  1UE5 A;  1M90 C;  3Q8D A;  4KHZ A;  4LF7 L;  1J6Q A;  5IP7 H;  3HOX H;  4A3F G;  4GOP A;  2ATW A;  4DV0 Q;  2JA8 H;  3HOV G;  4LF5 Q;  1KC8 C;  4A3D H;  1MJE A;  3L7Z C;  4C3H H;  1EQQ A;  5LMN W;  2R92 G;  1HNZ Q;  2R6G A;  5HGQ A;  2ZJR A;  1VQ9 A;  2JA5 H;  4L5S A;  3KF6 A;  3G6E A;  5IYB G;  3GDE A;  1X3F A;  4JCV E;  2E2H H;  1N33 L;  3PGZ A;  1FJG Q;  1C7Y A;  2K14 A;  5ELO A;  4LF8 L;  1P16 A;  3K80 C;  5C4X H;  3MEF A;  2AKW B;  3CCM A;  3UE0 A;  1EWI A;  3I4M G;  1L2F A;  5FLM H;  2FXQ A;  3BU2 A;  4A3I G;  4LW1 A;  5FLM G;  4KLK A;  4GNX C;  3A74 A;  1PYS B;  4B3S L;  1MJC A;  2KBN A;  3CQZ H;  3I4N G;  1X9N A;  3F2D A;  4DR7 Q;  3W1B A;  2H5X A;  5C3E G;  1HH2 P;  1UE1 A;  4L5T A;  3I7F A;  3L2P A;  4DV6 L;  2VZA A;  1LTL A;  2WB1 G;  1EFW A;  2Q2T A;  2JE6 I;  4XIG S;  4JYA L;  1OXT A;  3CME A;  3UE1 A;  3KOJ A;  4A3F H;  5E7N A;  3HKZ G;  3RLF A;  1N9W A;  4DV2 L;  3S1M H;  1I5F A;  4UP7 A;  1YJ9 A;  4YHH Q;  1VQP A;  3PO3 H;  1RIP A;  3PUW A;  4B3S Q;  2JA5 G;  1C0A A;  5M5X H;  1YJW A;  2JK8 A;  4LF8 Q;  4NPS A;  2UUA L;  4JI3 L;  3HOZ H;  4J15 A;  3GTQ H;  2PMZ E;  2AWO A;  1Q1B A;  4IPH A;  1S3O A;  4GKK L;  1Q1E A;  1W3S A;  1R9T H;  1JB7 A;  3T1H Q;  3JAM i;  1CKO A;  3HKZ E;  5GAG C;  1YHB A;  5AJ3 Q;  3F2B A;  4OWT B;  1J5E L;  3GTP H;  1WOC A;  2NZH A;  3F8T A;  2NZO A;  3OW2 A;  3TS0 A;  5M5Y H;  4DV4 Q;  1N32 L;  4JV5 L;  2RHQ B;  5GAH C;  1EQR A;  4BXX H;  1GO3 E;  3M7N A;  2UXC L;  4DPG A;  1Q82 C;  5JJL A;  2PNH A;  3RZO H;  3OYY A;  4OWX B;  2PI2 E;  1MIU A;  2Y0S G;  1OXX K;  2B63 G;  4IO9 A;  1I3Q H;  1E7Z A;  3ZJY C;  5IYC G;  5GAD C;  3FHW A;  4OX9 L;  1XMQ L;  2UUB L;  2JA7 H;  2YV5 A;  5GAE C;  1N34 Q;  1K3R A;  1WCM H;  4DR5 L;  2F4V Q;  3AFP A;  1G6P A;  3PV0 A;  2A8V A;  2B63 H;  2EIF A;  4GOP B;  4DR5 Q;  3IRB A;  3CF5 A;  3PIO A;  2R93 H;  1YIT A;  2JEA I;  4A3G G;  1YJN A;  1PH7 A;  1FL0 A;  4YY3 L;  1VQL A;  1X3E A;  1BKB A;  2R7F A;  2LSS A;  1HJP A;  4GN5 A;  2VS1 A;  4B3T Q;  1SN8 A;  2ZJP A;  2IHF A;  3ULL A;  2IX0 A;  3FP9 A;  1VQI A;  3W5O A;  4A93 G;  1PH2 A;  1K8G A;  1E3P A;  1VQF A;  2KCT A;  3KDF B;  4DAY B;  1LYL A;  3I4O A;  4LF4 Q;  4A3G H;  4R1J A;  1CKN A;  2Q2I A;  4LF7 Q;  4UPA A;  1N36 Q;  2RHS B;  3TEH B;  2IY5 B;  4DR3 L;  1WJJ A;  3HOY G;  3ULJ A;  1Z9F A;  1VQ4 A;  1Y1W H;  1B70 B;  4O0A A;  4DR2 Q;  1TXY A;  1O7I A;  4DR4 Q;  2VNU D;  2V1C C;  3GTJ H;  4HIM A;  3U58 A;  2CWA A;  4C3I H;  4GLX A;  2UUA Q;  1PYB A;  1Z47 A;  1QUQ B;  2N3S A;  4A3B G;  5C4J H;  1XTD A;  4BBS H;  1Q8K A;  1VQ8 A;  4GN3 B;  5ELN A;  1XJV A;  4OX9 Q;  2ZTC A;  2K50 A;  1XMO Q;  1TWF H;  2B3G A;  3T1Y L;  1XNR Q;  2KHJ A;  4UP8 A;  4JBJ A;  4MNO A;  3H0G G;  1SMX A;  2MQH A;  1XNQ Q;  3RNU A;  2K5V A;  1VQA A;  1YBY A;  3H0G H;  3ULP A;  1VQO A;  5BR8 Q;  4LNQ A;  3NEM A;  1YZ6 A;  3J81 j;  1VQK A;  3TS2 A;  4K0K Q;  5J3B A;  1QUQ A;  4R4I A;  1JJ2 A;  3CCU A;  1NBW A;  1KL9 A;  4GLA C;  3PIP A;  4BY1 H;  4P74 A;  1WFQ A;  2K5N A;  3A0J A;  1N36 L;  5IP9 G;  5C4X G;  2HQL A;  1BBW A;  1IZ6 A;  4GKK Q;  2BH2 A;  1CUK A;  1NMG A;  4A3L G;  1MKH A;  1JT8 A;  1VQN A;  2AWN A;  4R4Q A;  2VUM H;  1PH6 A;  1I6H H;  3TRE A;  3GTG H;  1K83 H;  1U0L A;  5M5W H;  3BZK A;  2N8N A;  1SE8 A;  2A1A A;  3PCO B;  3S1R H;  1LM0 A;  4LUO A;  1YNX A;  4HJ8 A;  2KEN A;  1M1K C;  3KDF A;  1FGU A;  4DK6 C;  2JA8 G;  1V1Q A;  3HOV H;  5C44 H;  4A3D G;  3PUV A;  4HJ5 A;  4DR1 Q;  3PF5 A;  1N34 L;  1X65 A;  3KF8 B;  4IOC A;  3H3V H;  1Q12 A;  2BH8 A;  2PQA A;  4QL5 A;  1Y14 B;  3J81 i;  3J80 c;  2NVQ H;  3S14 H;  1TWC H;  4LFB L;  2ALY B;  5M3M H;  1S72 A;  3I2Z A;  3PUY A;  4IOA A;  1A0I A;  3M9B A;  4P73 A;  2UXB Q;  2IHE A;  3ICE A;  3E9I A;  1OXU A;  4BA1 I;  5IT9 c;  1QVF A;  1E22 A;  1XNR L;  4GS3 A;  2IT1 A;  1CSP A;  2UXB L;  4GNX B;  1GKH A;  2R7Z H;  1YHA A;  4BBR H;  2HIV A;  4IJL A;  2VQF Q;  4L5R C;  1Q86 C;  4GKJ Q;  1XPU A;  1HZC A;  4HJ7 A;  4Y7N H;  2HHH Q;  4JI6 L;  1IBK Q;  4DV6 Q;  2EQS A;  3S1N H;  1FVI A;  2VY3 A;  2F52 A;  2OWO A;  3KJP A;  4DUY Q;  4B3R L;  5K36 G;  1A62 A;  2BA0 A;  3D0F A;  1IBK L;  4JI0 L;  1VQ7 A;  2KHI A;  4JI1 Q;  2UXD L;  3H15 A;  1W2B A;  2MO0 A;  4DAM A;  2E2J H;  3HOY H;  5IE8 A;  2QEX A;  1L1O B;  1OXV A;  1X6O A;  1BBU A;  4R4C A;  4GNX A;  4YCW A;  1XMQ Q;  1PH3 A;  2UUB Q;  4LFC Q;  2E8G A;  4BA2 I;  4BY7 G;  1HNW Q;  3TRZ A;  5JEA G;  1E1T A;  1EUJ A;  4PMW A;  3CCR A;  3A5U A;  4JBM A;  2ZM6 L;  4AYB G;  1ASZ A;  3U4V A;  4JYA Q;  4BBS G;  2NN6 I;  4QGU A;  3I4M H;  3M3Y H;  5GRO A;  3T1Y Q;  1DGS A;  2HIX A;  2YTY A;  4DUY L;  4B3R Q;  1HZA A;  4ME3 A;  4DUZ Q;  3CP0 A;  4R4O A;  3RLO A;  3D31 A;  3HFZ B;  1Y1W G;  1IBL L;  1YVC A;  1B8A A;  4LFB Q;  3CCJ A;  4IFD G;  4HIK A;  1C9O A;  1HZB A;  4IFD I;  2B29 A;  4AYB E;  2VQF L;  1PA6 A;  1FJG L;  4DNI A;  4KHP Q;  4P72 A;  2VL6 A;  2CCZ A;  4LUV A;  2QGQ A;  4PZ7 A;  1KQS A;  3U50 C;  3NEN A;  1KAW A;  1YHQ A;  1WYD A;  3T1H L;  2E5L L;  3PF4 A;  2E2I H;  2CFM A;  5IP7 G;  3AYH B;  3S15 H;  4PZ6 A;  4A93 H;  4YWK A;  4JI8 Q;  3DLL A;  3GTM H;  2OQ0 A;  2JQO A;  3I56 A;  1IBM L;  1EYG A;  2ID0 A;  1G29 1;  3HOX G;  3I55 A;  4DV5 L;  4A3K H;  4A3M G;  4DR2 L;  4DR6 L;  1NMF A;  2WAQ E;  2HT1 A;  2RCN A;  3RLN A;  4JBW A;  3NBH B;  2I0Q A;  5C0X I;  2ZTD A;  5C0X G;  4GOP C;  3KFU A;  3CXC A;  2Z0S A;  1UEB A;  2NVX H;  5BR8 L;  1IXR A;  2LXK A;  4A4I A;  3AQQ A;  3PSI A;  1L1O C;  4JI4 L;  2Y0S E;  1KHI A;  2L15 A;  1I94 Q;  4HJA A;  1PH9 A;  1PH5 A;  4GKJ L;  2RF4 A;  2R93 G;  3E0E A;  5LMN Q;  1I50 H;  4JC0 A;  1K73 C;  2F3I A;  2VQE Q;  4X66 L;  1OTC A;  4JI5 L;  3AEV A;  1SRU A;  3BJU A;  2VUM G;  1KRS A;  3MXN B;  5M3F H;  4X62 Q;  2K4K A;  4WJ3 M;  2N78 A;  2OCE A;  2JA9 A;  3CCL A;  2Q2H A;  4DKA C;  4NB3 A;  5C3E H;  1SRO A;  5IYD H;  4DK3 C;  4APV A;  4A3C H;  5AJ3 L;  2MNA A;  3HOU G;  3UDI A;  4EX5 A;  5C0X J;  4DV3 L;  3UDG A;  4EQ5 A;  2PQA B;  4DR1 L;  4DR6 Q;  1JE5 A;  3CCQ A;  4ALP A;  1K0R A;  4OWW B;  4JV5 Q;  1TWA H;  1EIY B;  1GVP A;  1QVC A;  4JI6 Q;  2CKZ B;  3VDY A;  3S1Q H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...