4A3JG

Rna polymerase ii initial transcribing complex with a 2nt dna-rna hybrid and soaked with gmpcpp
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3jG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3jG01
3S1RH 3G6EA 5IWAQ 1K73C 3L0OA 5IP9G 4A3FH 1Y1VH 4A93G 2UXDQ 3FP9A 2MO0A 3CF5A 4JI5L 4BBSH 1UWVA 1I94L 2UXCQ 3I4OA 4A3CG 5C44H 2WB1E 5AJ3Q 1WFQA 3GTJH 4AIMA 1NJIC 4JI6L 2VQFL 2I0QA 4B3TQ 4JI4Q 4YWMA 3F2CA 4GKKL 1QVGA 1IBML 1YHBA 2D62A 3KF6A 3J7ZC 2KCMA 1KL9A 1HR0L 3CMEA 2Y0SG 1GO3E 1HNXL 3GTLH 1GD7A 1X3FA 3WWVA 1D8LA 2PQAA 2D0PA 3J80c 4A3KG 1U5KA 2ZTCA 1KC8C 5GROA 4AYBG 2AKWB 2KCTA 2NVQH 4WJ4A 4DV3L 3RN5A 4LNQA 3S1MH 3CCMA 2JEBI 3A0JA 2E5LL 4YHHQ 2YU9H 3RLOA 2OWOA 1WYDA 3K7UC 2QA4A 4PZ7A 3PIPA 4X6AH 4X65Q 2ALYB 4DV5Q 2HIVA 2C35B 4QQBX 3G71A 5IE8A 2F4VL 3HOZH 1Y14B 1RIPA 1K0RA 1X65A 4LF7L 1G6PA 2UU9L 1PH5A 1M90C 1VQPA 3HOWH 2JA7G 4JV5L 4XTCS 3L2PA 4DR2Q 1MIUA 4DV2Q 5ELNA 3FKIG 2BH2A 2YTYA 5JEAG 1KHIA 1NY4A 1PH8A 3MXNB 4A3EH 1QZGA 5HY6A 1WCMG 3KF6B 1C0AA 4BY1G 2E2HH 2ATWA 2JA6G 1UE1A 3MEFA 2NN6I 1C7YA 3ZJYC 4OWWB 3K80C 5LMUQ 2CFMA 2PQAB 4GOPA 2B29A 1VQHA 4GKJQ 4LF5Q 4Y52H 4DUZL 5M3FG 3CCLA 3UDXA 2L15A 2CQOA 2WP8J 1HNZL 3KOJA 2MQHA 4A76A 3M4QA 1XJVA 4O0AA 1FGUA 3KJOA 3ERSX 1Q46A 1CKNA 1K8AC 3M9BA 4X64L 4A3LH 2E2JH 4JC0A 1XMQQ 3RLFA 1W2BA 3PCOB 4KLKA 4OX9Q 3F1ZA 1Z9FA 1IYJB 5M3MG 4QJFA 4XIGS 1E1OA 3BZCA 4IPCA 3CCUA 3HOYG 3K81C 3M7NA 2VNUD 2NZOA 4JCVE 3A74A 1NMGA 1PH2A 2UUCL 1CKMA 3HOXH 3M3YH 1N32L 1JMCA 4OO1I 4A3FG 1NTGA 3GTPH 2UUAL 2A1AA 2YYZA 1FJGL 4KHPQ 1P8LA 2UXBQ 2ZTEA 1OXXK 1VQDA 3K8AA 1XNQL 1X56A 1QZHA 1KXLA 1RL2A 4LF8Q 1E24A 3PUXA 3AFPA 1PYSB 1SLJA 3PUWA 1WI5A 4R4OA 4GOPB 4GOPC 4LF6Q 3RZOH 5DLQE 1H95A 3PSIA 4A3BG 1YNXA 4L5SA 1N36Q 1EYGA 4JI3L 1QVFA 1JJ2A 4OONA 2IX1A 1B8AA 2WFWA 2OQ0A 5HGQA 1UE6A 1V9PA 3CPWA 2ZJQA 4NPSA 1HR0W 2K5VA 1Q82C 3CC2A 2NZHA 1BBUA 1CKNB 3AFQA 4X66L 4HIDA 2R6GA 2JQOA 3NEMA 5IP7H 1N34Q 3PO3G 4R1JA 1B70B 1Y1WH 3S17H 4B3SL 3HKSA 3IRBA 1E1TA 1PH1A 1J5EQ 4DNIA 5IWAL 4YCUA 1VQAA 3DM3A 4DV6L 2Q2TA 1L1OB 3AQQA 4JYAQ 4WJ3M 1L2FA 1UE7A 5J3BA 2N49A 2LXKA 4BXXG 1W3SA 4P74A 3J81i 5AJ3L 1Q8KA 5GAGC 2IHFA 1Q7YC 2OTLA 3S1QH 4B3RL 4LWCA 4B3TL 4JI4L 3I2ZA 5IYDG 3UE1A 1VQ6A 1GVPA 4R4CA 3BZKA 4IFDI 4AYBE 1GM5A 2BA0A 3CXCA 2VQEQ 3RLNA 2K4KA 5M5YH 4JI0Q 4RMFA 1KIXA 2UUBQ 2CWPA 4JG2A 1UEBA 3K7AH 2R93H 5JJIA 4YCWA 4A3IG 2I5LX 2MNAA 5FLMH 1Q12A 1A63A 2F52A 1MKHA 3U50C 2VUMH 4HJ8A 3PO2G 1HZAA 4BY7H 1P16A 1Q1EA 4POFA 1VCIA 1LYLA 2ZJPA 4MTNA 4AQYQ 2KENA 1YJWA 1N33Q 1VQBA 1KD1C 1SRUA 4UP7A 4LFCQ 4DV5L 1SFOH 2LXJA 5E7NA 1XPOA 3BJUA 2Z6KA 3FHWA 1TWAH 1KRTA 1IXRA 2IT1A 4HJ7A 1PHJA 1MJEA 1IBLQ 2B63H 1EWIA 1AE2A 3EN2A 2VW9A 2VL6A 1TWFH 1PH4A 3H3VI 4DR2L 2DUDA 3I56A 5GADC 4DV2L 4A3JG 1JE5A 1S40A 3ICEA 3HOVG 5C3EG 1YIJA 1SROA 4HJ5A 3J81c 3H3VH 3U58A 3CCVA 1XNRQ 3CAMA 4A3DG 3I4NH 3TS2A 1D7QA 1PVOA 4L5TA 4HJ9A 5LMUL 4LW1A 3JAMc 1ASZA 4GKJL 1EIFA 4DV1Q 4LF5L 4K0KL 4HJAA 4YWKA 1SN8A 2MO1A 3F8TA 4JI8Q 2JA5G 2IY5B 4C3IH 1XTDA 2YTVA 5EAYA 5GQOA 3PIOA 4OO1G 4LUOA 4DR3Q 2VZAA 3H0GH 4KI0A 4DR7Q 1BVSA 4ALPA 5IYCG 3HOUH 3J7A5 1YEZA 3E9HA 4LF4Q 3I4MH 3S16H 1YBYA 1VQIA 3L7ZC 1X9NA 4EX5A 2Z6KC 4Y7NH 3CP0A 3RR5A 4NB3A 2R7DA 2K5HA 2PNHA 2R7FA 3TQYA 5FJ8H 2HHHQ 2KHIA 5C0XI 2FXQA 3W1GA 4PZ8A 3HKZG 3CQZH 1VQMA 3OW2A 3S1NH 4JBJA 2XTIA 4IJLA 2RHSB 4LUVA 4JI2Q 4JI1L 4AH6A 4C2MH 4B3MQ 4GKKQ 2R7ZG 4BBRH 4HIMA 3A5ZB 2AMCB 2K14A 4LF9Q 4KHPL 1LM0A 2NVXH 2UXBL 2R92G 2RCNA 5LMNL 3RZDH 1TXYA 3PUYA 1K8GA 4NXMQ 1I50H 2RHQB 3U4ZA 2EIFA 1CSPA 1HJPA 1VQCA 1YVCA 5IY0A 1N36L 4DV7Q 1EFWA 2IHEA 1AH9A 1U0LA 3GTOH 1G51A 2E2IH 5IP9H 1AE3A 5H1SE 3J81j 2E5LQ 4YCVA 4A93H 2HT1A 2EQSA 2PMZE 4QY7A 4IPHA 1L1OA 1OXTA 3U4VA 2JA8G 1V43A 3T1HL 5M5XH 4A3CH 4KHZA 3KDFA 3STBD 1X6OA 4DV4L 3UDIA 1XPUA 4IOCA 5K36G 1J5EL 3CW2C 4LF7Q 1Y1VG 5BR8L 1HH2P 4BBSG 4JV5Q 1Q1BA 5C4XH 3GO5A 2K52A 4DR5Q 1YJNA 2N8NA 4O2DA 4DUYQ 5C44G 3CCSA 1BKBA 1VQJA 1TWGH 1X3EA 3TEHB 1TWCH 1UE5A 3KF8B 1WOCA 2IX0A 3JC66 2HIXA 4LFAQ 1OXSC 2Q2UA 1NMFA 2CWAA 1BBWA 1SR3A 2VS1A 4L5QA 4J15A 3F2BA 3W1BA 3S2DH 1O7IA 4DR6L 4QL5A 4DUZQ 1N9WA 4LFBL 2VQEL 1XMOL 2K50A 2KBNA 4R4TA 1K9MC 3F2DA 4JOIA 4ME3A 3RNUA 1KAWA 1JB7A 3E0EA 1L1OC 4YY3Q 2UXDL 2JA7H 4JBKA 3UDGA 2UXCL 4DR1Q 3KDFB 3FKIH 1KQSA 4IPDA 4AQYL 1VQLA 3TS0A 2VY3A 1KRSA 3HOZG 4LFCL 2ASBA 3GTGH 3GTKH 1I6HH 3HOWG 1WCMH 3H0GG 4BY1H 2ZTDA 4IJHA 3JAMi 5JJLA 2JA6H 3S14H 4DAMA 3CPFA 4LUZA 4A3EG 2OTJA 1NE3A 1B7YB 4P75A 4EQ5A 1K3RA 1V1QA 2UUAQ 1FJGQ 5M3FH 3D0FA 2KHJA 4QIWE 5IYBH 3T1YQ 3AEVA 2Q2HA 2JA9A 4NXNQ 1E22A 4P72A 1IBKQ 3GTMH 4DR4Q 4MNOA 1VQ9A 1YZ6A 4GLXA 4RG1A 2OCEA 5C0XG 4YHHL 4JOIC 3M85A 2GVBA 1DGSA 2NN6G 1Q86C 1HZCA 3HFZB 4X65L 4JI8L 5FLXc 3ULLA 4JI7Q 4IFDJ 1SMXA 5LMNW 1XPRA 4X66Q 3ER0A 4P73A 1JJCB 4GNXB 1I5FA 2I5HA 4OWTB 4YWLA 5M3MH 2A19A 4DR3L 3HOYH 4DR7L 4A3GH 1JT8A 1X54A 1EIYB 4A3LG 2NVYH 4LF4L 4DAYB 1X55A 4UY8C 3HKZE 4DV6Q 1OTCA 4DV0Q 1R9TH 2D0OA 4X62Q 4MZ9A 2HHHL 4A3MH 1X3GA 4GS3A 5M5WH 3OTOQ 1EOVA 2V1CC 4GLVB 2EXDA 3HOXG 2YV5A 4APVA 1A62A 1YHAA 4JBWA 4A3BH 4B3RQ 1LUZA 1CSQA 1LTLA 4JI2L 2K75A 4H02A 1YHQA 4A4IA 4B3ML 1VS0A 2HQLA 5C4XG 3CC4A 4LF9L 4UPAA 3NENA 3SGIA 1HNWQ 3S24A 4NXML 3A5UA 3CMAA 3CCQA 3RN2A 1S3OA 2ZM6Q 3PO3H 4DV7L 3KJPA 4DK6C 4BA2I 2WAQG 2DGYA 2BH8A 3GTQH 1XMQL 4L5RC 4JI5Q 1OXUA 1I94Q 2QEXA 1VQFA 3M4PA 1CUKA 1VQOA 4BA1I 4OX9L 3NELA 5IP7G 5C4JH 2RF4A 4GN3B 1A8VA 1PFSA 1EQRA 1TWHH 2ZJRA 1Y1WG 4BXXH 3K0XA 2YTXA 2VQFQ 1ASYA 4JI6Q 3I55A 1VQ4A 2A8VA 4DK3C 2AHOB 1YITA 2WB1G 1IBMQ 3CD6A 2ES2A 4PG3A 1VQ7A 3CC7A 1HR0Q 3UDFA 4DR5L 5IYDH 4LF8L 4LF6L 4DUYL 1HNXQ 1JJGA 4OXPA 4C3HH 2JJQA 2CCZA 2F3IA 2JEAI 4A75A 1PH6A 1PH9A 5C0XJ 2PI2A 3W5OA 4C3JH 2OQKA 3I7FA 4HIOA 1PH7A 4DKAC 4A3IH 4DV3Q 4LFAL 1E7ZA 2I5MX 3B6YA 3GD7A 4GN5A 1YJ9A 3TRZA 1IZ6A 4TVAB 1VQGA 3PO2H 4K0KQ 3BU2A 3PUVA 4GN4B 1N34L 1G291 2R93G 1IL2A 1Z47A 2ID0A 4P71A 5IYBG 3VDYA 1EUJA 2F4VQ 4IFDG 1QUQA 5FLMG 3CCJA 4PZ6A 2UU9Q 4GLAC 3KYHC 5GAEC 3KFUA 1FL0A 3CCRA 2VUMG 4IPGA 3S15H 3EBEA 4BY7G 3LGJA 5ELOA 1WJJA 4PMWA 4YY3L 4JYAL 2JE6I 3Q8DA 2N3SA 1L0WA 3TREA 4DR1L 1S72A 4A3JH 2Q2IA 1E3PA 2AWOA 3EIVA 3PGZA 3UE0A 4A3KH 3HOVH 2B63G 3KLWA 5C3EH 1FVIA 4IO9A 5IT9c 3PUZA 4A3GG 4A3DH 1HZBA 4TQUS 4JI1Q 4R4IA 3H15A 3PF5A 1HNZQ 4HIKA 3PF4A 4JI0L 2JA5H 2NVTH 2GVAA 2UUBL 4IOAA 4A3MG 2N78A 3OYYA 3T1YL 2AWNA 5LMNQ 1PYBA 3I4NG 4NXNL 1OXVA 1IBKL 4DR4L 1J6QA 1PV4A 2GN5A 3ULJA 1PA6A 4X64Q 4R4QA 1GKHA 2MFIA 4GNXA 5IYCH 4JBMA 1QUQB 1N33L 1Q81C 3D31A 1N8RC 5JJKA 4JI7L 3GDEA 2BA1A 4FDBA 3NBHB 3G48A 1VQEA 1NBWA 1IBLL 3I4MG 1M1KC 3PV0A 3HOUG 3T1HQ 1A0IA 1T9HA 3DLLA 5GAHC 2UUCQ 1N32Q 1MJCA 4OWXB 2E8GA 5JEAJ 4DV4Q 5BR8Q 5FJ8G 4UP9A 1XNQQ 3G4SA 4DPGA 4DV0L 2LSSA 3STBC 2K5NA 4X62L 1PH3A 4POGA 1XNRL 1EQQA 3J80i 2R92H 1I3QH 2JK8A 3ULPA 4QGUA 3OTOL 1YI2A 1VQKA 4JI3Q 3M4OH 2PI2E 2Z0SA 2H5XA 4UP8A 1HZ9A 4BBRG 4DV1L 2Y0SE 2B3GA 1VQ5A 3AYHB 1VQ8A 2XGTA 1QVCA 2QGQA 1C9OA 1CKOA 4GNXC 1VQNA 1SE8A 4DR6Q 1K83H 1HNWL 2R7ZH 2WAQE 4LFBQ 3S2HH 1XMOQ 3CCEA 4B3SQ 2JA8H 2ZM6L 2CKZB 3E9IA
chains in the Genus database with same CATH superfamily
4BY7B 3G6EA 1K73C 3FVQA 1CI3M 3H94A 4JI3H 1RTNA 1Y1VH 2LKVA 1HCZA 1RYRA 2PBZA 2R8KA 1DCZA 2RSOA 4CDFC 4A3CG 1EHIA 5C44H 5AJ3Q 4J9MA 1FGBD 1NJIC 1BQQT 1LT3D 1YHBA 2NBFA 1KAAA 2KCMA 5I2XA 1QB5D 3Q23A 1HR0L 3ND8A 2Y0SG 4C2MA 3GTLH 1TA8A 3WWVA 5KRUA 2D0PA 3EFXD 3J80c 1U5KA 1KLUD 4ECQA 2NWGA 4WRDA 2KCTA 4MV4A 2WACA 4N8X1 3WO1A 1SYCA 4DGZA 2JEBI 2E76C 1R4PB 3CCMA 4YHHQ 2E5LL 3OSNA 4JI4H 3K7UC 3PIPA 2E2IA 4X6AH 2OT2A 2KSWA 3G71A 5IE8A 2EYOA 2CW8A 1K0RA 1VKZA 4LF7L 2UU9L 1PH5A 3NSWA 1WTHA 2SDFA 4FS2A 4XTCS 3L2PA 5JJZA 1MIUA 3HEJA 5ELNA 5L1JA 4BWGB 4IRKA 2EJMA 2K5DA 3J7AF 2QK4A 1GXDC 3CQZB 4HNVA 2PZTA 2W6QA 1B04A 4J9SA 4J9OA 3NQIA 1S5ED 3MEFA 5FD6A 2NN6I 4BBRB 4X65H 4JI8H 3Q8RB 2M9VA 2K28A 3LWBA 5LMUQ 2NVXB 2PQAB 4IRCA 3MEHA 1RJQA 1I50B 3IAYA 1HNZL 2NN6H 3TIGA 2MQHA 2RDFA 3M7GA 1T5XD 3T5HA 1XJVA 3RF2A 4O0AA 1ENFA 3MR2A 2DWCA 2GPSA 2KA7A 1K8AC 2FJ2A 4X64L 4A93B 4UFZA 1S9FA 2F0FA 4K2KA 3Q24A 2EDGA 4O3SA 1G91A 4YAKB 3SDZA 5M5XB 2L11A 1QOHA 4N9TA 3VYUA 3FKIA 5EPJA 3MAQA 3HOYG 5JQWA 2NZOA 3M9MB 1PH2A 1EYCA 3HOXH 4Y8VB 1M7JA 1SBBB 1GUTA 1LACA 4QW9A 3NHHA 2UXBQ 1XNQL 1KXLA 3K59A 3RV3A 1TWCB 1RL2A 3GV8B 3PUXA 4GOPC 4LF6Q 1SLJA 3PUWA 4FYDA 5KFZA 1TR5A 4AYBB 3PSIA 1K8MA 5IYZF 4IUPA 4JI3L 3EPIA 4K6DA 2L55A 1B8AA 2OQ0A 2ZJQA 4IN3A 1GHKA 1B9MA 5D1OB 1KNEA 2ICIA 1CKNB 3G6YA 4HIDA 1E4EA 4HQ6A 1HPCA 4J9PA 3GV3A 3PW4A 1EY6A 4R1JA 4DR5H 1B70B 3S17H 1HQMC 2JA7B 2F0JA 3P75A 4K8JA 5KFIA 4YCUA 1VQAA 4KN7C 1N36H 1STNA 3AQQA 4JVZA 1CQJB 1L2FA 1UE7A 5J3BA 3GTKB 1HUNA 2N49A 4P74A 3SE0A 1Q8KA 4QWBA 1G2TA 5GAGC 3FMAA 1NCVA 4TKOB 3A8IE 1GUGA 4IZOA 2HVSA 4JI4L 1N34H 1HXYD 5M3FB 4R4CA 2OF1A 4IUQA 1GM5A 3RLNA 4JYAH 2EXZA 2CWPA 5I2YA 4IQZA 4B9XA 3K5HA 2I5LX 2MNAA 1MZBA 2RGRA 2IX3A 1EZ6A 2VUMH 4MA0A 4Z9CB 4HJ8A 2FK2A 1P16A 4EFBA 1STHA 1YJWA 4X3KA 1LYLA 3P7JA 4FVMA 4MTNA 2KENA 5KX5F 4IZ8A 1VQBA 3GQBA 5M3MB 1SRUA 4UP7A 3HGBA 2OXPA 2R7ZB 2FINB 4XZ3B 2LXJA 4FS1A 5E7NA 1BGWA 4TUYF 1W93A 3FHWA 1TWAH 4TRDA 2R6FA 1JDEA 1PH4A 5CV7A 2UUBH 1R9TB 2D9UA 2PW5A 1SYFA 4ZQIA 3KAJA 4XQNA 1JE5A 4MIUA 1S40A 3VMMA 5C3EG 3LX0A 1YIJA 4A3BB 1SEIA 4IRDA 3CCVA 4AQYH 3CAMA 3I4NH 4LFCH 1D1KA 1H9KA 3TS2A 1JX4A 3GLKA 3M9NB 4L5TA 4LW1A 3J81L 3RTXA 1DJRD 3NBIA 1LABA 4YWKA 1PZJD 2MO1A 4JI8Q 1D6EC 1ENCA 3G7LA 2YTVA 4CDCC 3JAML 4Q8EA 4LUOA 4CJ2C 5BN3A 1D1IA 4KI0A 1EQTA 4XDXA 1PZID 3HOUH 4I55F 1YEZA 3E9HA 4LF4Q 3OHAA 1XNRH 3L7ZC 4TSSA 3MFHA 3CP0A 1TWHB 3RR5A 4NB3A 5FJ8H 4HMJA 5CB4F 3KHLA 2KHIA 4R8IA 4DL3A 4ZUJA 2FXQA 1M0TA 4DV1H 5ELEA 2MGSA 3NK9A 4O2BF 2XTIA 2O4XA 2XGQA 1HNWH 4AH6A 4C2MH 4TQSA 3CRLC 2AMCB 3A5ZB 3EA6A 5DAUA 4LF9Q 3G6VA 2K33A 3TP6A 5DGAA 1JWSD 2XWBB 5LMNL 4NXMQ 3MVVA 4RUAA 3FEWX 1PRTB 2AU0A 3MR6A 1CSPA 3IFTA 1D2BA 2RGVA 1N36L 1EFWA 2HHHH 3VR5A 3K5LA 2IHEA 5L9XA 3DM1A 3P1HA 1UAPA 2E2IH 3TN2A 5IP9H 1AE3A 1T94A 5KFFA 5A2QL 3J81j 4B3MH 2HT1A 1BUVT 4IPHA 2JN4A 3GTKA 2A6EC 3Q0AA 1V8QA 2R7NA 3STBD 1X6OA 2VR1A 3UDIA 4YR2A 2FLPA 5J2UF 3K0YA 5KFOA 4ZOLF 4G4KA 1VF5C 3HKZA 4DR5Q 4EYHB 3N43B 3GV5B 4HMIA 4J0MA 4E6IA 2YRWA 1KTKA 4YQWA 2N55A 3RGZA 5E3FA 2IX0A 2AGOA 1OXSC 4ZRZA 3KBGA 5D1PA 4FF1A 2VS1A 4L5QA 4J15A 2JA5B 1Q3LA 1M4VA 1S4ZA 4WORA 1U4LA 4JV5H 3SHLA 2W7OA 3IFDA 4QWCA 4J9RA 1K9MC 1EZ8A 1RDPD 3VYSA 3I12A 1FKAH 2R7ZA 3O13A 4RCNA 3GIQA 3GQCA 3G6XA 5J2TF 2UXDL 4F4WA 1V4YA 2YCHA 4JBKA 4OL7A 3UDGA 2UXCL 4HSVA 3MWMA 3FKIH 4EQPA 5HURA 4AQYL 1VQLA 4LFCL 1I6HH 1SMYD 1H9SB 3HOWG 4BY1H 2ZTDA 3GTJA 2JA6H 3S14H 4ED6A 3Q6SA 4O3NA 4HSPA 1B7YB 2R92B 1K3RA 2UUAQ 1X32A 2KHJA 3AEVA 1LTGD 1OO9B 1E22A 1IBKQ 1EIHA 1EY5A 5CORA 3K3VA 5DM63 5JVLA 2B39A 2MHVA 4H13C 4JOIC 1K83B 3HXLA 4RUCA 1A15A 1HZCA 4JV2A 3R5XA 3IL8A 2KEEA 2RVLA 4JI7Q 2JA8B 4IFDJ 1HRJA 1TKWB 3MWEA 1TWHA 1U4PA 4P73A 1FJGH 4YWLA 2I5HA 4BS9A 1B3AA 2A19A 1Y1VB 4ECSA 3T1YH 3IG0A 3H20A 4DR4H 1X55A 4JK1C 5C44B 4RZQA 4X62Q 5EZYF 3MZ5A 3V4SA 4K8IA 2HHHL 3TP8A 4XYLB 4EEYA 3OTOQ 4RKLA 3QJYA 3MR5A 3R93A 4APVA 1YHAA 4B3RQ 3H09A 1CSQA 2EYLA 3QOJA 4X66H 1YHQA 3HRZC 4B3ML 4UCUA 1VS0A 3GTLB 2DPJA 4ECTA 2HQLA 4UPAA 3Q1KA 3MXGA 1HNWQ 3SGIA 4LMQD 1NR4A 1XWEA 5IWAH 4DV6H 5HGTA 1B44D 1MI2A 3MWYW 4ZKBB 1S3OA 3PO3H 1Z2OX 2ZDGA 3DMUA 3HG9A 1I4XA 3QIAA 5D3IB 4JI5Q 5KFHA 3NELA 5EGTA 5IP7G 5C4JH 2RF4A 2JSOA 1EQRA 1O7LA 4HR7B 2F1MA 1Y1WG 3MR3A 1ASYA 2YTXA 2WYOA 4J9LA 2HGSA 2WB1G 5KT5A 2ASJA 3CD6A 2ES2A 2ZM6H 1VQ7A 1BBXC 5C1OA 4LF8L 5FO9B 1EYAA 5KGUA 2CCZA 2XRQD 5D8DA 1I94H 2QDBA 5C5MA 5C4ZA 2OQKA 1SDFA 4HIOA 2F0VA 4MV1A 4XX0B 4A3IH 1E7ZA 4JI6H 4PMBA 2I5MX 1UNSA 2VOBA 3BDCA 3TRZA 2NYZD 4K0KQ 3F2UA 3PUVA 4MTEA 4YAJB 1Z47A 2ID0A 3VDYA 2F4VQ 1EUJA 1QUQA 2HD3A 5FLMG 3CCJA 3H40A 3OSOA 3KYHC 1PFMA 2ENBA 1FL0A 5CYUA 4BY7G 4UDUC 1F9PA 2XVSA 3NBHA 3Q8DA 2N3SA 3NWTA 1L0WA 1E3PA 2AWOA 3EIVA 3N42B 4DV3H 3KHGA 3PMFA 5KT2A 3SK4A 3HOVH 2R92A 3HOXB 4UCOA 5ELFA 5FK9C 1LLRD 4K5WA 1HZBA 2B2WA 4FXKC 5C4XB 1RF2D 4JI1Q 2FMAA 4DLKA 4R4IA 2XD4A 1ML0D 4I65A 5IIFA 4IOAA 1K83A 2N78A 1CT1D 1KNAA 4R8NA 3T1YL 2J0TD 3NTIA 4NXNL 1OXVA 1MD2D 2PZWA 5FLXE 3K57A 4DR4L 1J6QA 1PV4A 4I7AA 5LL6S 1GKHA 2F0TA 2M05A 4ZI7F 2LS01 4Q43A 1N33L 1C3OA 1Q81C 2WIIB 5KG5A 3D31A 4NW2A 3S17B 1N8RC 1CTMA 1BDOA 2BA1A 2WKCA 2DJFC 4FDBA 5CV4A 1NBWA 1IBLL 3HBLA 5IGBA 1EY7A 1A0IA 1HFGA 1J9OA 1T9HA 3T1HQ 2UUCQ 1SFOA 2R84A 3QR8A 4BWSC 2B63A 4ECVA 4UP9A 1TWFA 3G4SA 3STBC 4APMA 1LTTD 2HDMA 1VQKA 2PI2E 1DOLA 1SNQA 2A69C 2O2LD 4BBRG 5LA6F 5F9LA 2ICEC 4X3UA 2IA6A 4Q8FA 1N32H 2QGQA 3NE5B 2W6OA 4GNXC 4DR6Q 2OEOA 2R7ZH 2WAQE 2ZT9C 3S2HH 4K5XA 5EWFA 2W57A 2VUMB 2ZM6L 2Q8RE 3E9IA 1VBGA 4DXGA 3RUPA 2QEJC 1PLFA 5IWAQ 4ED3A 3L0OA 4A93G 1H9RA 4BBSH 3KTMA 3T5LA 1I94L 5T1GA 1F2LA 2YW2A 3SEBA 4L8JA 3VPBA 2P5ZX 1WFQA 1K0SA 3GTJH 2HJWA 3PN1A 4AIMA 2PZUA 4JI6L 1EUDB 4GKKL 2NVYB 4LFBH 1XMOH 1SEBD 2EYHA 2FFKB 3AMUA 3H3VC 5LL6b 2QILA 1SMYC 3KXYT 2BDOA 2L0CA 1X3FA 3I4NB 1D8LA 2H4OA 5L1LA 4ZCKA 2ZTCA 4ZAIA 4AYBG 2B2UA 1I7NA 1T5EA 3EJIA 2IBKA 4DV3L 3RN5A 4LNQA 3S1MH 4EGJA 2X6GA 3HB9A 2OWOA 3RAXA 5FO7B 4DV5Q 4ZLTF 3GIPA 2SEBD 2NTTA 4QQBX 3HOUB 3X3MA 1Y14B 1JOQA 1X65A 3KLSX 1ICFB 2FJZA 1BCPC 3SK5A 2GLTA 3ETHA 4O3OA 5I6YA 5KFEA 1LTBD 2JA7G 1SJHD 4RNOA 4DR2Q 1TS3A 5IT9E 3PVXA 2YTYA 5JEAG 2JP1A 4B9WA 3MXNB 4A3EH 4DNRB 4FXGC 3QFFA 3C0FB 4YHHH 1A6XA 4C2MB 1WSCA 2ATWA 1UE1A 3LWEA 4OWWB 3K80C 1JWMD 3C3LA 2CFMA 4YR3A 1AEXA 2F3VA 4GOPA 2XCLA 4LF5Q 2VA2A 4DUZL 5M3FG 3UDXA 4L1KA 4EG0A 2IJ0A 2PVPA 3M4QA 4FNFA 4UCTA 1A3VA 5HV6A 1FGUA 1SJED 2LMCB 3ERSX 5ISRA 3M4YA 5KIXA 2E2IB 1Q46A 2MUYA 4FP5D 1JWUD 3M9BA 4V190 1JC7A 4A3LH 2EY5A 3V96A 1XMQQ 2F03A 2XSCA 3PCOB 5KFJA 5DG8A 4OX9Q 2C22A 2R7ZG 5M3MG 3CCUA 2VNUD 3K5IA 3KAKA 2NUCA 4ZHQF 1NMGA 3GTGA 2A68C 1N32L 1WCMA 4O4LF 3J7YW 1PDQA 4OO1I 1FR3A 2A1AA 4KHPQ 1P8LA 1W6JA 1VQDA 3GIIA 1X56A 1QZHA 1CQIB 1PYSB 4A3KB 2R8JA 1H95A 4OO1H 2C2EA 1Q8IA 4A3BG 4RNMA 1JJ2A 2DPIA 1C48A 4XYMB 5T1IA 3J7AK 2HUGA 4R8UA 1Q82C 3CC2A 2NZHA 4FO2A 2NVTB 4C1NI 4FF2A 1EYZA 1SYDA 3RAQA 2UXBH 2B2YC 4LF6H 3IRBA 1PH1A 1E1TA 1J5EQ 3GIJA 1SE4A 3FKIB 3BDLA 3DM3A 2FKLA 3J80W 2Q2TA 4RH6A 4Q0FA 4XQJA 2B2WC 2W6NA 2NVYA 3VR3A 3MTSA 3UI2A 3FPPA 2KVMA 2LXKA 2YS7A 4BY1B 5L1KA 1WTWA 1XDNA 5AJ3L 2JA6B 4J6HA 4UCSA 2JYOA 3S1QH 1Q7YC 2OTLA 2DY8A 3Q8QB 2FMMA 4LWCA 1K1QA 3U9TA 5IYDG 2F0QA 2WKDA 3E0JA 2VQEQ 4CDEC 2K4KA 4YY3H 4JI0Q 1KIXA 2R8HA 1TVXA 4FBTA 5JJIA 4DR1H 1SYBA 3K58A 2DNEA 1Q12A 1E4EB 1A63A 3TMEA 3KLRA 4POFA 2BQUA 3GILA 5BN4A 1KD1C 4G7ZC 2I8CA 1SFOH 5BMVF 1KJJA 3MXNA 1RD9D 5CC4A 1KRTA 2Q8TA 2B63H 1PHJA 3WNZA 3H4BA 2VW9A 2VL6A 1TWFH 2XIWA 3CHBD 3KHHA 2DUDA 1CQFA 3MHBA 1G6ZA 1KJ9A 2FPPB 3OPOA 4P2CB 1EWCA 3U9SA 4CC5A 1SROA 2ZXOA 4HJ5A 2VPSA 3U58A 2E75C 1JLLB 3V2TA 5KKNB 2A6ED 1BXTA 1CK1A 2O03A 5LMUL 2ATLA 1A3UA 1EIFA 2F4IA 4HEDA 1SN8A 3F8TA 2JA5G 4HTHA 3C2PA 2PQEA 3A7AB 3V6KA 3PO3B 1KJ8A 5GQOA 2V4QA 2BE5D 3D6WA 2IP4A 4IHJF 4OIKA 4OO1G 3BZDB 5EKKA 5EWEA 4DR3Q 4DR7Q 2F0MA 5IYCG 3J7A5 3I4MH 3S16H 3BA9A 4PNYA 1X9NA 2XGPA 1W96A 5C4JB 3PW5A 4RGTA 4O3RA 2R7DA 1C8CA 1B9NA 2PNHA 3TQYA 5FPOA 4G57A 1HFNA 4M1UB 4N9PA 5IOCA 4IJLA 2RHSB 4C5CA 4ECWA 4JI2Q 1AUVA 2B2UC 3N41B 2B8FA 4HIMA 2PCFB 3RD4A 4LF4H 2XRSD 2UXBL 2R92G 2RCNA 1KJQA 5DNFA 2NU9B 2C2RA 1TXYA 5DEHA 1AFPA 2KCCA 4A3IB 2RHQB 3U4ZA 2EIFA 1HJPA 1VQCA 1YVCA 1B6SA 1B2TA 4K6LA 4RB3C 1G51A 4O1NA 5H1SE 2E5LQ 5KFQA 4YCVA 5KFDA 2EQSA 1TAEA 2PMZE 1OXTA 4LF9H 2JA8G 1M6VA 4Q45A 3KDFA 2UVRA 4DV4L 1XPUA 4IOCA 2Q8IB 4NXMH 1NAPA 3CW2C 4LF7Q 1Y1VG 5BR8L 2JA6A 1HH2P 4TV9F 5BPFA 5C4XH 3RGXA 3GO5A 3PR4A 1YJNA 2N8NA 4IUNA 3HOVB 5C44G 3CCSA 1JICA 2YRXA 1BKBA 4L63B 5IGDA 3ERQA 1UE5A 4QIWB 4O42A 2FB9A 1I3QA 1WOCA 3BJYA 2Q2UA 5LHY1 1YNJD 2CWAA 3GTPB 2X6LA 1JORA 3ORQA 2VB2X 3W1BA 3A54A 2K50A 2Z4IA 3F2DA 4JOIA 4FF4A 5KT3A 4XYOA 2DLNA 3KALA 1KAWA 5LL6X 3E0EA 1L1OC 5C8YF 4QB4A 4XT1B 3DWPA 4YY3Q 2J9GA 1CZWA 4DR1Q 1RK5A 1TS5A 1KQSA 3PIP3 2CZGA 2PPBC 2HVRA 2VY3A 1KRSA 3HKZB 2A5HA 3GTGH 4DK1A 5J22A 1WCMH 4RCOA 1IOVA 3TP7A 3J81E 1TY2A 4I4TF 5T14A 2R3ZA 1RHPA 3T51B 2OTJA 1NE3A 1V1QA 4RAUC 3D0FA 3JAME 2IPKD 5KFGA 2IMWP 1DV2A 1JKJB 3V4ZA 2WTFA 4F87A 4DF7A 2KEDA 4ME5A 4MNOA 1EY8A 1K28A 2HCIA 4QUCA 2GVBA 5I4DA 1DGSA 2NN6G 4M8AA 2VUGA 3HFZB 4X65L 4JI8L 3S2HB 5FLXc 4HNUA 3GV7B 2C2DA 1F9QA 2YU9A 5EJWA 4XXEA 2R82A 3CU7A 1XTCD 2UUAH 4GNXB 2A74C 1QE6A 4BBSB 2FK1A 1CHQD 2NVYH 4LF4L 2L9HA 1IBKH 2EE1A 5D65A 4LH6A 1OTCA 1GJXA 4DV0Q 3GTJB 1JXLA 4MZ9A 4KK7A 1X3GA 2F0SA 4CGYB 5M5WH 1EOVA 1D5XC 4GLVB 2UVVA 2EXDA 5JAVA 3HOXG 2YV5A 4JI7H 1VDZA 5C3XA 2EZVA 2F0KA 1LTLA 2YYAA 2N88A 5C4XG 3NUCA 5A2QE 3CC4A 4LF9L 2ASLA 3NENA 1DIKA 2XNAC 2Z9HA 4EYIB 4NXML 3CMAA 3RN2A 4MV9A 4X62H 3Q8PB 2FMCA 3S1MB 4U6PA 1CZGA 3C46A 1F2ZA 3D4RA 2R85A 4XYQA 4DK6C 3D6CA 4IALA 2KOLA 3OTOH 4CBVA 2R86A 2R8GA 1SE3A 4U7CA 1OXUA 2QEXA 1VQFA 4B3RH 1VQOA 2K04A 1ILPA 2FLNA 1A8VA 4K5VA 5CGKA 3RB4A 1H9JA 3H0GB 4BXXH 2VQFQ 2A8VA 5CBAE 1SNOA 4KY5A 1HTPA 4DK3C 2AHOB 1YITA 3CKIB 1WR2A 1IBMQ 3TQ1A 2F0UA 4A3EB 4QIWA 5DG7A 4PG3A 3CC7A 4JUZA 1E2VA 4DR5L 4MTDA 3I90A 1HNXQ 3GTPA 2F3IA 4OEMB 1Q90A 3FDSA 1SYXB 2NB0A 1PH6A 3SE7A 2J6SA 4JI5H 5C0XJ 2PI2A 1G8ZD 4C3JH 1DZ1A 1PH7A 1JB3A 4DA2A 1DOKA 2A73B 4KKTA 4DNTB 4PMCA 4RKBA 1VQGA 3PO2H 3PZPA 3RZDB 3BU2A 1N34L 1TY0A 1IL2A 3RFCA 3SVMA 3R23A 3DXJC 4ZKCB 3TZDA 5KFKA 2D2CC 3DUZA 3VYRA 1Y8NB 1OWTA 2VUMG 2BQRA 4IPGA 4JYAL 4U673 2A69D 2JE6I 2ZXRA 3H91A 4RHRA 1ZYRD 2BE5C 1S68A 4A3JH 1HA6A 3UE0A 4LH7A 3WDNA 1B53A 1ET9A 2GA4B 2KCNA 4KY6A 3OHXC 3OUUA 3N44B 5CA1F 4F50A 4A3KH 3OMCA 3NPPA 3KLWA 1FVIA 5IT9c 4K0KH 2ZXPA 3PUZA 5F9NA 4C5AA 4A3DH 1FNWA 2F4VH 1K8OA 1BJTA 4HYKA 3QWNA 1R4QB 2X0SA 3H15A 1RODA 1NNXA 3PF4A 2EJGC 5KG7A 2NVTH 2UUBL 2GPWA 3OYYA 2IL8A 5LMNQ 3I4NG 4O3QA 2JEIA 1B33N 3NWSA 1IBKL 2R93A 3D3RA 1PA6A 4R4QA 4GNXA 4JBMA 1QUQB 2FHTA 5KYLA 1HHVA 3ZYYX 4JI1H 4JI7L 4CJ1B 3NBHB 1BNCA 4F4XA 1VQEA 3M4IA 5A35A 3HOUG 4GC7A 3T56B 3DLLA 5GAHC 4ED8A 3NXWA 5JEAJ 3JRWA 4Q0YA 3OIQA 4EFEA 5FJ8G 1S0OA 3T5KA 5KFYA 4X62L 1PH3A 3S1QB 1XNRL 1I3QH 2JK8A 3NQTA 3OTOL 1YI2A 3RB0A 4B08A 2Z0SA 4UP8A 1BCPD 1GYFA 3GV6A 4H7BA 4DV1L 2B3GA 4RGNA 2V58A 3T1HH 1LO5D 1QVCA 2UUCH 4LK1C 3NTHA 3E5NA 2F0NA 1HNWL 4IUVA 1VQNA 1EUCB 2F3WA 2MP1A 5I6WA 4HN7A 1YNJC 3CCEA 4B3SQ 3H4DA 2K5WA 3H0GA 5K36H 5IP9G 2OH2A 2L12A 1WTXA 2F0OA 2UXDQ 3FP9A 2MO0A 3CF5A 4JI5L 2UXCQ 1SFOB 4ECYA 1GGOA 5BN5A 2B63B 2WB1E 5KFUA 2F0DA 5L37A 1TT2A 1TWFB 4DR6H 1DM0B 4B3TQ 5KFLA 4YWMA 3F2CA 1QVGA 1I4RA 2D62A 5C3WA 3BVGA 3KF6A 5HBRB 2FPGB 4CHTB 4ULLA 2G9HD 1B50A 4A3KG 2DNCA 1X3PA 5GROA 1K3BC 1UUPA 2NVQH 2BQ3A 2A68D 3J80L 4PDBA 1XYIA 2YU9H 3OW7A 1STYA 3GTOA 4RGOS 3TSSA 3I3CA 2ALYB 3EVQA 2W9BB 1SXTA 5I9PA 3I4MB 2RCFA 2CH4A 2F4VL 3HOZH 3S16B 5CA0F 2SOBA 4JV5L 3GTQB 4DV2Q 2BH2A 3FKIG 2VA3A 3I70A 1KHIA 1NY4A 1ZEQX 1PH8A 5C1PA 2EYFA 1QZGA 1EU4A 2Z8LA 5HY6A 5TSSA 4BY1G 2Y0SA 1PK8A 1SNPA 4DXFA 3TZUA 2JA6G 1C7YA 4DV5H 5KG1A 3I72A 2I80A 3PW0A 2CW7A 2B29A 4GKJQ 4Y52H 4CDDC 2L15A 1D5ZC 2WP8J 2NUAB 4DR2H 4A76A 1L0YB 4YB8B 2XIGA 3ETJA 3KJOA 5KNCA 1B4OA 3PQIA 1NSNS 1ICWA 3KBXA 2LY7A 2FE3A 4RZRA 1S5DD 2EYPA 2B2YA 3L4JA 4LF5H 3JZIA 3F1ZA 2C28A 3N6XA 1FNUA 1E1OA 4IPCA 1BO0A 3L9AX 1HA5A 3ONAB 2UUCL 4V0BA 3M3YH 1JMCA 1O78A 1UC8A 5EOYA 2E2DC 3GTPH 1FJGL 2YYZA 1EY9A 2QYZA 1STAA 1OXXK 1DONA 3QO2A 4LF8Q 1E24A 2W71A 2Z4HA 4R4OA 3RZOH 1WI5A 4GOPB 1XMQH 3BA8A 1YNXA 3OUZA 4L5SA 4FXDA 1A9XA 4OX9H 1QVFA 2UVUA 4OONA 2IX1A 2RQXA 5HGQA 1UE6A 1EWHA 1V9PA 4CC6A 1MSHA 4NPSA 1CQVA 3VR6A 1PX2A 5KFWA 2K5VA 1C30A 2QCPX 4EQNA 4X66L 1EQVA 3BVMA 1Z7TA 4KHPH 3PO3G 3HKSA 3NP8A 1GHJA 2JXMB 5CR3A 5IWAL 5E4XA 4DV6L 1L1OB 2HDLA 3GTGB 1WCMB 3AU7A 1W3SA 3J81i 2G5DA 5E1FA 2IHFA 5BPHA 2UVWA 1ZYRC 5FOBB 2P0AA 2M2LA 1VQ6A 1GVPA 4KV6A 1J5EH 4IFDI 4AYBE 2RDHA 2BA0A 3AB9A 1WTPA 3RIZA 4RMFA 2R93H 4R8UB 2CVRA 4YCWA 4A3IG 2MPMA 4IFDH 2NU6B 2W9BA 1TQOA 4GC6A 1G2SA 2F52A 1MKHA 3U50C 2J6TA 3JSNA 1HZAA 2PMZA 4ODGA 3MFYA 1VCIA 3GTQA 1N33Q 4DAVA 4IURA 2AUJD 2FK3A 4DV5L 1DOMA 4K14A 1XPOA 3BJUA 3BABA 1IXRA 2IT1A 3S1RB 2VQEH 1IBLQ 2EY2A 2RDIA 1EWIA 1O7ZA 2RA4A 3EN2A 1N48A 4A3FB 3DEOA 4JI0H 1O80A 5D3DA 3H3VI 2W70A 1FD7D 2CHBD 3TDQA 3I56A 4DR2L 1ILQA 5M5WB 3ICEA 3HOVG 1BR9A 4NMZA 3BQ2A 3H3VH 3J81c 1GSAA 3TIIA 1U9RA 3T16A 1LTSD 1PVOA 1PFBA 3LP8A 4DL5A 1DV1A 3JAMc 4RWSC 4DFAA 4LF5L 4HJAA 3RV4A 4G7OC 4C3IH 2IWHA 5JVH3 3PIOA 1JR0D 1SAPA 4KJOA 3H6MA 2VZAA 3H0GH 3KLSA 2WINB 4MV6A 4YP3A 1BVSA 1PXUA 4ALPA 4Y7NH 2Z6KC 3MFGA 4YJ3F 2HQEA 5KT4A 2K5HA 2R7FA 1JOKA 2VPQA 4HAEA 1STGA 3W1GA 1GSOA 3HKZG 1VQMA 3S1NH 3TQTA 4RFBA 2AGQA 4LUVA 1ONLA 1EFID 1LTAD 4GKKQ 5KG2A 4DR3H 1V1PB 4DR7H 1ENAA 1CHPD 5KFCA 4KHPL 1LM0A 4C3JB 3RZDH 1K8GA 4LMYA 3PUYA 4LJZC 2KUMA 3EQLC 4Q5VA 4DV7Q 1AH9A 3PO2B 1E4GT 1U0LA 1YNND 3GTOH 3OHBA 5I9OA 1BNZA 4JI2H 1L1OA 4ABNA 3U4VA 3RJ0A 5K2MA 4A3CH 1QNUA 1IHZA 1J5EL 4A3JB 1F9RA 5EDWA 4BBSG 1Q1BA 2I46A 1H9MA 4EVOA 4O2DA 4DUYQ 1CA5A 3WOEA 4J9KA 1VQJA 1I7LA 1PTOD 3FDTA 2NZ1D 4A3DB 1MGSA 1TS4A 3TEHB 2E5LH 1Z6HA 3G8CA 5DLFA 3KF8B 4CJ0B 4O4IF 3JC66 1CS0A 2HIXA 5AFWA 4LFAQ 5K5PA 2K1BA 3I4LA 1NMFA 2W9AA 1SR3A 3F2BA 5KG6A 3S2DH 1F2YA 1UEAB 4LF7H 4QL5A 4DUZQ 4CKCA 3MFIA 4LFBL 2VQEL 1XMOL 4C1NK 4ZYSA 1ESFA 1WTQA 2KBNA 4R4TA 4ME3A 5FD5A 1T36A 3RNUA 1IKMA 3N40P 4G3IA 3K5OA 5ELCA 1V51A 4O3PA 4QWEA 2KHSA 3KDFB 2ZDHA 3CRKC 3FRPB 2BDNA 4KD4A 4IPDA 1I4GA 1BF4A 4DAYA 1N56A 3R8BA 1PMRA 1X3QA 3H0GG 4IJHA 5JJLA 4O2AF 1BCPF 1STEA 5EKLA 4DAMA 4LUZA 4A3EG 2J6UA 4P75A 4EQ5A 4ECZA 3W3AA 5ELDA 1I3QB 4ZUIA 1F2MA 2EOTA 4DL6A 4NKLA 1JE4A 5IYBH 1NR2A 2Q2HA 1RCVD 2JA9A 1B1ZA 2R7KA 1AP0A 5KT7A 4DL7A 2J7ZA 1VQ9A 5CV5A 3PW2A 4RG1A 4YHHL 3M85A 2KQ3A 1CFMA 5M5YB 1SMXA 1J8IA 5C5LA 2C00A 1XPRA 4N8FA 3ER0A 3E6ZX 1WD0A 2YZNA 2AQ3B 1JJCB 2YL2A 4RAZA 2FLLA 3HOYH 4DR3L 4OWTB 1XNQH 4DR7L 3OIPA 1UC9A 4MV7A 1X54A 4A3LG 4JV1A 3PW7A 4YIJA 4UY8C 5KFRA 1TIID 4J8QA 1DXMA 1ZXTA 1A3TA 1VMCA 1PFNA 3A8KE 3FMCA 1V1PA 4UCRA 4ME6A 4ED1A 3A56A 4CKEA 2PNRC 2V1CC 3S9WA 3JRXA 2F0EA 1GSHA 1A62A 1I6VC 4JBWA 2E2HA 1LUZA 4JV0A 4KN4C 4JI2L 2K75A 4H02A 4UCVA 5KFTA 1RK6A 4MHEA 1VF7A 2WDTA 1EEFD 1IW7C 1WTVA 2NVQB 3A5UA 3CCQA 2ZDQA 5IGCA 4DV0H 2W8LA 4J1MA 5I47A 1S0NA 1HTLD 2YU9B 1KDCA 3KJPA 2BH8A 3GTQH 5GONF 4L5RC 4UAIA 2DJGC 2W6ZA 5JVDF 3HOZB 1SNCA 4MN3A 4I7HA 5KFAA 1PFSA 1Z2NX 2ALZA 4F88A 1M8AA 3K0XA 2W6PA 1AZPA 1L2ZA 5M9OA 1PZKD 1FYCA 2DZDA 3KF8A 4EBEA 1HR0Q 4NDXA 3KHRA 3UDFA 4LF6L 1JJGA 4ZQ3A 4OXPA 2JEAI 3RB3A 1PH9A 4LSXA 3HP3A 5COYA 3E3XA 4DKAC 2YZGA 2K01A 2A6HD 2VQFH 5KFSA 3VPDA 4GN5A 3GD7A 4TVAB 5EWGA 3QG1A 1IBMH 4ED7A 4GN4B 1G291 1Y69U 2L1BA 4P71A 5E4WC 5IYBG 2AUKA 3BQ0A 1MHWC 1CE8A 2PN1A 3J7AV 2BCOA 2UU9Q 3L4KA 3RBEA 1HNXH 5EQ0A 5CV9A 1S5CD 3S15H 1Y1WA 3EBEA 5KFBA 2QKIC 4PMWA 1WJJA 4YY3L 1S72A 4DR1L 5LYJF 3OOCA 1EOTA 3PGZA 2WB1A 4M9UA 3T13A 2B63G 3M3YB 4IO9A 5C3EH 3R5FA 4KD3A 3W2DA 5FLXW 2CW0D 4L6TB 4KJNA 3RZOB 2NU7B 1D5MC 1HNZQ 1AUXA 5KG0A 4HIKA 5L1IA 1TWGB 1W6KA 2GVAA 3V6HA 3MXPA 5KG4A 2JEFA 1EYDA 1LTID 1SYEA 5KNBA 2WAQB 4X64Q 2O5IC 2V5AA 1KC7A 2XN9C 5CV6A 1QNKA 5JJKA 5G3LD 3GDEA 3K3PA 3OWEB 1RJRA 3T5JA 3I4MG 1M1KC 3PV0A 1YNNC 1XX8A 4IWYA 4KKUA 4DV4Q 5LMNH 2B2TC 1JDBB 4ID6A 5BR8Q 2C9OA 3D4WA 3MA2B 1XNQQ 1QILA 4DPGA 4C5BA 1F9SA 2I07B 2LSSA 4DV0L 4R7RA 3Q8SB 4F4YA 3ULPA 2AQ1B 4QGUA 2EVBA 4JI3Q 3M4OH 2W9CB 4WJWA 1HZ9A 4FM9A 1VQ5A 2KJXA 3AYHB 1VQ8A 2XGTA 1PTOC 2AQ2B 2W6MA 3D8GA 2R93B 1SE8A 5KEEA 4DN4M 4ECXA 4IR9A 3GTMB 4M7EA 2R87A 1PTOH 2CKZB 5GAEC 3S1RH 2XWJB 5FKAC 1KEEA 2K32A 1EIGA 1KDAA 1GUNA 4A3FH 4PWQA 2V4RA 1UWVA 4RU9A 2QDLA 3I4OA 3BS1A 5DGBA 1SNMA 4ILWA 1CM9A 2RDGA 4A3GB 3GIKA 4TQRA 2VQFL 4EGQA 3EROA 2I0QA 4JI4Q 3CQZA 4MV8A 1LTRD 3D4DA 5ELBA 1IBML 4OELB 4B3SH 2B2VA 3J7ZC 5KFNA 1KL9A 3CMEA 5EBCA 4U68A 2FPIB 4OGQC 1GO3E 1HNXL 4O4HF 4A3MB 1GD7A 3DEPA 2O5JC 2UXDH 2NVXA 2PQAA 2UXCH 5LP6F 3MJFA 1KC8C 1HQRD 4KKSA 2AKWB 1L0XB 4A2AA 1KABA 1I50A 4ED0A 4TV8F 1S03G 4WJ4A 4QUFA 4C3IB 3ND9A 3A0JA 3QZ7A 5IT9W 1SSOA 4B3TH 3RLOA 3TBIB 1WYDA 2QA4A 3M9OB 4PZ7A 4X65Q 2HIVA 2C35B 2TSSA 3I91A 4KTAA 4PQXA 3I8ZA 1RIPA 4Y7NB 1G6PA 1M90C 1VQPA 1BCPB 3HOWH 5KFVA 3EYYA 3S1NB 1B6RA 4JW0A 3T4AC 1WCMG 3KF6B 2RSNA 4QF4A 1C0AA 2E2HH 1EZ1A 1TWGA 3A8JE 4NP5A 1E0BA 2K7VA 3ZJYC 1WH2A 1TWCA 1LT5D 1AZQA 2VXWA 1VQHA 4AYBA 2WAQA 3CCLA 3R3OA 2CQOA 4C3HB 3KOJA 4ED2A 3R2IA 4DV2H 2ASDA 5J1ZA 3RMHA 3GTOB 5D1OA 2RDJA 1CKNA 1RTOA 4HNTA 2E2JH 3LMLA 4JC0A 3TINA 2JA7A 3RLFA 1W2BA 4GKJH 4DL2A 4KLKA 3K5MA 2NU8B 4WD3A 5IGEA 1PTOF 3ITPA 1Z9FA 1IYJB 5NUCA 4QJFA 2KECA 1IL8A 3BZCA 4XIGS 4DU9A 3M7NA 3K81C 3V6JA 4YBZB 4JCVE 3A74A 1DD2A 5D14A 2LFNA 1CKMA 1DYQA 1RYSA 1AN7A 4A3FG 1NTGA 2Y0SB 5DQGA 2UUAL 2W9CA 2W8KA 2G9DA 3DWAA 3OWFA 2ZTEA 3K8AA 3Q22A 3AFPA 2CQAA 5DLQE 2X69A 5KG3A 2YS6A 1N36Q 1EYGA 1EEID 3C1FA 4QCLA 5H80A 2CH4W 1ZETA 1TU2B 4R9WA 3S2DB 2M00A 2WFWA 3GTMA 3BDOA 3RBDA 3CPWA 1HR0W 4EGVA 2CQYA 1GOZA 4ECUA 1BBUA 3AFQA 1A2UA 5F2DA 2R6GA 2JQOA 3NEMA 5IP7H 3BYTB 1N34Q 4GZYC 2MJ8A 2A6HC 1Y1WH 4B3SL 4LF8H 2WE6A 1IKLA 2RBMA 4DNIA 3U9OA 4WJ3M 4JYAQ 2VB3X 1SYGA 4BXXG 5JVG3 5KFPA 2R61A 1R9TA 2EY1A 3F8NA 4F7XA 3VPCA 4B3RL 2FP4B 2EYMA 5JPMC 4B3TL 3I2ZA 3J80E 2SCUB 1S10A 2L4NA 1QWYA 3UE1A 3HS0C 3VR2A 3MWDA 3BZKA 1VBHA 3VA5A 3IKJA 1A2TA 2V9WA 3CXCA 3VR4A 5M5YH 4JPBW 2CW0C 4PV1C 4C3JG 3NGDA 2UUBQ 4JG2A 1UEBA 3K7AH 1Z2PX 2DN8A 5FLMH 4OIJA 1JCKB 4HCEA 1CA6A 3PO2G 1JOOA 4BY7H 1Q1EA 3MXUA 4AQYQ 2ZJPA 2EJFC 1ZHSA 3HOYB 4X3SA 5IGGA 4LFCQ 1ZQ7A 4Q44A 1PRTD 2Z6KA 3LNNA 5EBDA 4HJ7A 1MJEA 4RGMA 1AE2A 1I4PA 3BQ1A 2RKSA 4A3JG 3GIDA 1GUSA 5GADC 4DV2L 2JEGA 2HVQA 2E74C 3SI8A 4NXNH 3WO0A 4FF3A 3Q2OA 3A7LA 5C5JA 1IYUA 3UFXB 1V1OA 5CAEB 1XNRQ 1N33H 4A3DG 3BVZA 3EPGA 1QG7A 2WV6D 1D7QA 2L5TA 4HJ9A 1ASZA 1KDBA 4OHJA 4DV1Q 3DWQA 4GKJL 4K0KL 1IBLH 2IY5B 4LSAA 1XTDA 3N52A 5EAYA 4DK0A 3ORRA 3E5SA 4ETSA 3OMGA 1I4HA 2PMZB 2PW7A 5CBEE 4EQOA 3QZ8A 1RKNA 5JPNC 2W7PA 5KFXA 1YBYA 1VQIA 2I87A 4EX5A 4I50F 4EEQA 2ZJTA 5JOBA 2B2VC 5DQIA 4XT3B 3FPUB 4S3SA 5C6AA 1ULZA 2HHHQ 5C0XI 4PZ8A 1S0MA 3CQZH 3OW2A 4JBJA 3T53B 3WOFA 4JI1L 5C0XH 4B3MQ 1RJTA 4IR1A 5IODA 1LT6D 4BBRH 3N8DA 3KUPA 5DG9A 2K14A 2NVXH 4YR0A 4ZK9B 3PR5B 1WTOA 2J4XA 4DL4A 1I50H 2JA5A 5IY0A 2PO4A 3QB3A 5JH7F 4A93H 1IOWA 4GKKH 1EY0A 4QY7A 2OLSA 2F0IA 1V43A 3T1HL 4NLGA 3S15B 5M5XH 1F77A 4KHZA 2BR0A 4IAJA 5K36G 1QJOA 2SNMA 1QCBD 2DY7A 2SNSA 4JV5Q 1JQYD 2IW3A 2K52A 4DV7H 1H9SA 5C3EB 5FO8B 1T3NA 4KY7A 1TWGH 1X3EA 1TWCH 1C4QA 3GP7A 4EBDA 1LV9A 1BBWA 5EPKA 4RHSA 1KBLA 4UHVA 4J9NA 1S97A 1O7IA 4DR6L 4EBCA 1N9WA 5G3LF 3MC0B 2BOSA 2VQDA 2V4DA 2F0LA 4DUYH 4RA8A 1KLGD 2YZMA 1JB7A 1BOSA 2JA7H 3J81W 3CVZA 4RB0A 4LFAH 3VA7A 3NTKA 5JEAH 1Y1VA 3TS0A 1IW7D 4MTKA 3HOZG 3JAMW 2ASBA 3GTKH 1JIHA 2H1EA 3P20A 4DUZH 5IGFA 5EKIA 3JAMi 2B8GA 5EPLA 3LWUA 3CPFA 3N6RA 3RUZA 1PYWD 1FJGQ 5M3FH 4QIWE 4CKBA 3M4OB 1M0WA 3T1YQ 3GTLA 2R7MA 4NXNQ 2Z1CA 4P72A 3GTMH 4DR4Q 3SR1A 4KMUC 3G6JB 1IYVA 2F0HA 4FU0A 4MV3A 1YZ6A 5CMDA 4GLXA 2OCEA 5C0XG 1VMPA 5KYIA 5KFMA 1Q86C 1KJIA 1EY4A 3TP5A 1ZHQA 3BG5A 3ULLA 2F0PA 1PTOB 4F8MA 5LMNW 1Y8OB 4X66Q 1GUWA 1BXRA 2R8IA 1I5FA 4H0LC 5M3MH 4A3GH 3A55A 1JT8A 5FLXL 1EIYB 3OSPA 4RB1A 5JUMA 4DAYB 4HR7A 4K2LA 3HKZE 4DV6Q 2EY6A 5A2QW 1R9TH 5DLGA 2D0OA 1E4FT 2XC9A 4A3MH 4GS3A 1TWAB 3GIMA 1TS2A 2AQ4A 4A3BH 2XCAA 4A4IA 1MSGA 3R5HA 2D5DA 3X3NA 3DHQA 3URYA 3S24A 4MAMA 4IUTA 1AN8A 5DM73 1EU3A 2ZM6Q 2K03A 1WD1A 3SXHA 4DV7L 4BA2I 2DGYA 2WAQG 4LAAA 4XQQA 2AGPA 1XMQL 1I94Q 3M4PA 1CUKA 4H44C 4BA1I 4OX9L 1WTRA 4GN3B 2ZJRA 2K05A 5LXTF 1FNVA 1TWHH 4C56C 3HOWB 2PYKA 3VYTA 3RB6A 5FPRA 4JI6Q 3I55A 1VQ4A 1STBA 2Z6BA 2EPBA 2QF7A 2EYJA 2F0GA 2NTSA 5IYDH 1U4MA 4FBUA 1UNNC 1ESRA 4DUYL 1PRTC 2E2HB 4C3HH 2JJQA 4A75A 3V05A 1XXGA 3W5OA 2R7LA 3I7FA 4IUUA 1RJPA 4DAPA 4DV3Q 4LFAL 4IWXA 2F0WA 2QW7A 1EL0A 3B6YA 1YJ9A 1IZ6A 1O75A 4ECRA 4MA5A 3SK8A 2R93G 3BYYB 1HR0H 1GLVA 1ZKOA 2HCCA 3QOLA 5C4HA 5LOVF 4IFDG 4PZ6A 4GLAC 4HCSA 1GUOA 3KFUA 4J9QA 3CCRA 2E2JB 1E2ZA 5DQHA 2K6AA 3LGJA 5ELOA 4RAYA 3I73A 3UQ8A 3TREA 2Q2IA 5LMUH 2B2TA 3L3OC 4F4ZA 4A3GG 4KHVA 1K1SA 4QWDA 3KK7A 5KNDA 5KT6A 4TQUS 2UU9H 5IT9L 3HZXA 4QMGA 1I4QA 3PF5A 3K6OA 3C1EA 4JI0L 4RNNA 4I7ZC 2JA5H 4A2BA 4A3MG 1MBYA 2AWNA 1PYBA 2DIKA 1SNDA 4QWAA 2GN5A 3ULJA 2MFIA 1U4RA 5IYCH 4QW8A 4C3IG 4WBNF 2VUMA 3BG3A 3PIO3 3K5NA 2K5QA 4G7HC 1Y1WB 1NUCA 3G48A 1HNZH 3DF7A 4X3TA 2WB1B 1N32Q 1MJCA 4OWXB 2E8GA 1TWAA 1LT4D 1S5FD 1HUMA 1S5BD 5CV8A 1ET6A 4RB2C 3JSLA 1Y8PB 2C5CA 3SK6A 4X64H 2K5NA 4POGA 5J39A 1WVLA 1I6HB 1EQQA 2XCPA 3J80i 2R92H 2V59A 2JEJA 1E2WA 1II3A 3S14B 2H5XA 1SCUB 1B3QA 2Y0SE 2TMPA 1AW7A 1O7YA 4YJ2F 3IN5A 4DV4H 1C9OA 3BAAA 1CKOA 4WFN3 1I6UA 3K7AB 3R2TA 1K83H 4C3HG 5BR8H 1SE2A 4LFBQ 1XMOQ 1PRTF 2MCTA 4E4TA 2JA8H 1VAJA
chains in the Genus database with same CATH topology
3S1RH 3G6EA 5IWAQ 1K73C 3L0OA 5IP9G 4A3FH 1Y1VH 4A93G 2UXDQ 3FP9A 2MO0A 3CF5A 4JI5L 4BBSH 1UWVA 1I94L 2UXCQ 3I4OA 4A3CG 5C44H 2WB1E 5AJ3Q 1WFQA 3GTJH 4AIMA 1NJIC 4JI6L 2VQFL 2I0QA 4B3TQ 4JI4Q 4YWMA 3F2CA 4GKKL 1QVGA 1IBML 1YHBA 2D62A 3KF6A 3J7ZC 2KCMA 1KL9A 1HR0L 3CMEA 2Y0SG 1GO3E 1HNXL 3GTLH 1GD7A 1X3FA 3WWVA 1D8LA 2PQAA 2D0PA 3J80c 4A3KG 1U5KA 2ZTCA 1KC8C 5GROA 4AYBG 2AKWB 2KCTA 2NVQH 4WJ4A 4DV3L 3RN5A 4LNQA 3S1MH 3CCMA 2JEBI 3A0JA 2E5LL 4YHHQ 2YU9H 3RLOA 2OWOA 1WYDA 3K7UC 2QA4A 4PZ7A 3PIPA 4X6AH 4X65Q 2ALYB 4DV5Q 2HIVA 2C35B 4QQBX 3G71A 5IE8A 2F4VL 3HOZH 1Y14B 1RIPA 1K0RA 1X65A 4LF7L 1G6PA 2UU9L 1PH5A 1M90C 1VQPA 3HOWH 2JA7G 4JV5L 4XTCS 3L2PA 4DR2Q 1MIUA 4DV2Q 5ELNA 3FKIG 2BH2A 2YTYA 5JEAG 1KHIA 1NY4A 1PH8A 3MXNB 4A3EH 1QZGA 5HY6A 1WCMG 3KF6B 1C0AA 4BY1G 2E2HH 2ATWA 2JA6G 1UE1A 3MEFA 2NN6I 1C7YA 3ZJYC 4OWWB 3K80C 5LMUQ 2CFMA 2PQAB 4GOPA 2B29A 1VQHA 4GKJQ 4LF5Q 4Y52H 4DUZL 5M3FG 3CCLA 3UDXA 2L15A 2CQOA 2WP8J 1HNZL 3KOJA 2MQHA 4A76A 3M4QA 1XJVA 4O0AA 1FGUA 3KJOA 3ERSX 1Q46A 1CKNA 1K8AC 3M9BA 4X64L 4A3LH 2E2JH 4JC0A 1XMQQ 3RLFA 1W2BA 3PCOB 4KLKA 4OX9Q 3F1ZA 1Z9FA 1IYJB 5M3MG 4QJFA 4XIGS 1E1OA 3BZCA 4IPCA 3CCUA 3HOYG 3K81C 3M7NA 2VNUD 2NZOA 4JCVE 3A74A 1NMGA 1PH2A 2UUCL 1CKMA 3HOXH 3M3YH 1N32L 1JMCA 4OO1I 4A3FG 1NTGA 3GTPH 2UUAL 2A1AA 2YYZA 1FJGL 4KHPQ 1P8LA 2UXBQ 2ZTEA 1OXXK 1VQDA 3K8AA 1XNQL 1X56A 1QZHA 1KXLA 1RL2A 4LF8Q 1E24A 3PUXA 3AFPA 1PYSB 1SLJA 3PUWA 1WI5A 4R4OA 4GOPB 4GOPC 4LF6Q 3RZOH 5DLQE 1H95A 3PSIA 4A3BG 1YNXA 4L5SA 1N36Q 1EYGA 4JI3L 1QVFA 1JJ2A 4OONA 2IX1A 1B8AA 2WFWA 2OQ0A 5HGQA 1UE6A 1V9PA 3CPWA 2ZJQA 4NPSA 1HR0W 2K5VA 1Q82C 3CC2A 2NZHA 1BBUA 1CKNB 3AFQA 4X66L 4HIDA 2R6GA 2JQOA 3NEMA 5IP7H 1N34Q 3PO3G 4R1JA 1B70B 1Y1WH 3S17H 4B3SL 3HKSA 3IRBA 1E1TA 1PH1A 1J5EQ 4DNIA 5IWAL 4YCUA 1VQAA 3DM3A 4DV6L 2Q2TA 1L1OB 3AQQA 4JYAQ 4WJ3M 1L2FA 1UE7A 5J3BA 2N49A 2LXKA 4BXXG 1W3SA 4P74A 3J81i 5AJ3L 1Q8KA 5GAGC 2IHFA 1Q7YC 2OTLA 3S1QH 4B3RL 4LWCA 4B3TL 4JI4L 3I2ZA 5IYDG 3UE1A 1VQ6A 1GVPA 4R4CA 3BZKA 4IFDI 4AYBE 1GM5A 2BA0A 3CXCA 2VQEQ 3RLNA 2K4KA 5M5YH 4JI0Q 4RMFA 1KIXA 2UUBQ 2CWPA 4JG2A 1UEBA 3K7AH 2R93H 5JJIA 4YCWA 4A3IG 2I5LX 2MNAA 5FLMH 1Q12A 1A63A 2F52A 1MKHA 3U50C 2VUMH 4HJ8A 3PO2G 1HZAA 4BY7H 1P16A 1Q1EA 4POFA 1VCIA 1LYLA 2ZJPA 4MTNA 4AQYQ 2KENA 1YJWA 1N33Q 1VQBA 1KD1C 1SRUA 4UP7A 4LFCQ 4DV5L 1SFOH 2LXJA 5E7NA 1XPOA 3BJUA 2Z6KA 3FHWA 1TWAH 1KRTA 1IXRA 2IT1A 4HJ7A 1PHJA 1MJEA 1IBLQ 2B63H 1EWIA 1AE2A 3EN2A 2VW9A 2VL6A 1TWFH 1PH4A 3H3VI 4DR2L 2DUDA 3I56A 5GADC 4DV2L 4A3JG 1JE5A 1S40A 3ICEA 3HOVG 5C3EG 1YIJA 1SROA 4HJ5A 3J81c 3H3VH 3U58A 3CCVA 1XNRQ 3CAMA 4A3DG 3I4NH 3TS2A 1D7QA 1PVOA 4L5TA 4HJ9A 5LMUL 4LW1A 3JAMc 1ASZA 4GKJL 1EIFA 4DV1Q 4LF5L 4K0KL 4HJAA 4YWKA 1SN8A 2MO1A 3F8TA 4JI8Q 2JA5G 2IY5B 4C3IH 1XTDA 2YTVA 5EAYA 5GQOA 3PIOA 4OO1G 4LUOA 4DR3Q 2VZAA 3H0GH 4KI0A 4DR7Q 1BVSA 4ALPA 5IYCG 3HOUH 3J7A5 1YEZA 3E9HA 4LF4Q 3I4MH 3S16H 1YBYA 1VQIA 3L7ZC 1X9NA 4EX5A 2Z6KC 4Y7NH 3CP0A 3RR5A 4NB3A 2R7DA 2K5HA 2PNHA 2R7FA 3TQYA 5FJ8H 2HHHQ 2KHIA 5C0XI 2FXQA 3W1GA 4PZ8A 3HKZG 3CQZH 1VQMA 3OW2A 3S1NH 4JBJA 2XTIA 4IJLA 2RHSB 4LUVA 4JI2Q 4JI1L 4AH6A 4C2MH 4B3MQ 4GKKQ 2R7ZG 4BBRH 4HIMA 3A5ZB 2AMCB 2K14A 4LF9Q 4KHPL 1LM0A 2NVXH 2UXBL 2R92G 2RCNA 5LMNL 3RZDH 1TXYA 3PUYA 1K8GA 4NXMQ 1I50H 2RHQB 3U4ZA 2EIFA 1CSPA 1HJPA 1VQCA 1YVCA 5IY0A 1N36L 4DV7Q 1EFWA 2IHEA 1AH9A 1U0LA 3GTOH 1G51A 2E2IH 5IP9H 1AE3A 5H1SE 3J81j 2E5LQ 4YCVA 4A93H 2HT1A 2EQSA 2PMZE 4QY7A 4IPHA 1L1OA 1OXTA 3U4VA 2JA8G 1V43A 3T1HL 5M5XH 4A3CH 4KHZA 3KDFA 3STBD 1X6OA 4DV4L 3UDIA 1XPUA 4IOCA 5K36G 1J5EL 3CW2C 4LF7Q 1Y1VG 5BR8L 1HH2P 4BBSG 4JV5Q 1Q1BA 5C4XH 3GO5A 2K52A 4DR5Q 1YJNA 2N8NA 4O2DA 4DUYQ 5C44G 3CCSA 1BKBA 1VQJA 1TWGH 1X3EA 3TEHB 1TWCH 1UE5A 3KF8B 1WOCA 2IX0A 3JC66 2HIXA 4LFAQ 1OXSC 2Q2UA 1NMFA 2CWAA 1BBWA 1SR3A 2VS1A 4L5QA 4J15A 3F2BA 3W1BA 3S2DH 1O7IA 4DR6L 4QL5A 4DUZQ 1N9WA 4LFBL 2VQEL 1XMOL 2K50A 2KBNA 4R4TA 1K9MC 3F2DA 4JOIA 4ME3A 3RNUA 1KAWA 1JB7A 3E0EA 1L1OC 4YY3Q 2UXDL 2JA7H 4JBKA 3UDGA 2UXCL 4DR1Q 3KDFB 3FKIH 1KQSA 4IPDA 4AQYL 1VQLA 3TS0A 2VY3A 1KRSA 3HOZG 4LFCL 2ASBA 3GTGH 3GTKH 1I6HH 3HOWG 1WCMH 3H0GG 4BY1H 2ZTDA 4IJHA 3JAMi 5JJLA 2JA6H 3S14H 4DAMA 3CPFA 4LUZA 4A3EG 2OTJA 1NE3A 1B7YB 4P75A 4EQ5A 1K3RA 1V1QA 2UUAQ 1FJGQ 5M3FH 3D0FA 2KHJA 4QIWE 5IYBH 3T1YQ 3AEVA 2Q2HA 2JA9A 4NXNQ 1E22A 4P72A 1IBKQ 3GTMH 4DR4Q 4MNOA 1VQ9A 1YZ6A 4GLXA 4RG1A 2OCEA 5C0XG 4YHHL 4JOIC 3M85A 2GVBA 1DGSA 2NN6G 1Q86C 1HZCA 3HFZB 4X65L 4JI8L 5FLXc 3ULLA 4JI7Q 4IFDJ 1SMXA 5LMNW 1XPRA 4X66Q 3ER0A 4P73A 1JJCB 4GNXB 1I5FA 2I5HA 4OWTB 4YWLA 5M3MH 2A19A 4DR3L 3HOYH 4DR7L 4A3GH 1JT8A 1X54A 1EIYB 4A3LG 2NVYH 4LF4L 4DAYB 1X55A 4UY8C 3HKZE 4DV6Q 1OTCA 4DV0Q 1R9TH 2D0OA 4X62Q 4MZ9A 2HHHL 4A3MH 1X3GA 4GS3A 5M5WH 3OTOQ 1EOVA 2V1CC 4GLVB 2EXDA 3HOXG 2YV5A 4APVA 1A62A 1YHAA 4JBWA 4A3BH 4B3RQ 1LUZA 1CSQA 1LTLA 4JI2L 2K75A 4H02A 1YHQA 4A4IA 4B3ML 1VS0A 2HQLA 5C4XG 3CC4A 4LF9L 4UPAA 3NENA 3SGIA 1HNWQ 3S24A 4NXML 3A5UA 3CMAA 3CCQA 3RN2A 1S3OA 2ZM6Q 3PO3H 4DV7L 3KJPA 4DK6C 4BA2I 2WAQG 2DGYA 2BH8A 3GTQH 1XMQL 4L5RC 4JI5Q 1OXUA 1I94Q 2QEXA 1VQFA 3M4PA 1CUKA 1VQOA 4BA1I 4OX9L 3NELA 5IP7G 5C4JH 2RF4A 4GN3B 1A8VA 1PFSA 1EQRA 1TWHH 2ZJRA 1Y1WG 4BXXH 3K0XA 2YTXA 2VQFQ 1ASYA 4JI6Q 3I55A 1VQ4A 2A8VA 4DK3C 2AHOB 1YITA 2WB1G 1IBMQ 3CD6A 2ES2A 4PG3A 1VQ7A 3CC7A 1HR0Q 3UDFA 4DR5L 5IYDH 4LF8L 4LF6L 4DUYL 1HNXQ 1JJGA 4OXPA 4C3HH 2JJQA 2CCZA 2F3IA 2JEAI 4A75A 1PH6A 1PH9A 5C0XJ 2PI2A 3W5OA 4C3JH 2OQKA 3I7FA 4HIOA 1PH7A 4DKAC 4A3IH 4DV3Q 4LFAL 1E7ZA 2I5MX 3B6YA 3GD7A 4GN5A 1YJ9A 3TRZA 1IZ6A 4TVAB 1VQGA 3PO2H 4K0KQ 3BU2A 3PUVA 4GN4B 1N34L 1G291 2R93G 1IL2A 1Z47A 2ID0A 4P71A 5IYBG 3VDYA 1EUJA 2F4VQ 4IFDG 1QUQA 5FLMG 3CCJA 4PZ6A 2UU9Q 4GLAC 3KYHC 5GAEC 3KFUA 1FL0A 3CCRA 2VUMG 4IPGA 3S15H 3EBEA 4BY7G 3LGJA 5ELOA 1WJJA 4PMWA 4YY3L 4JYAL 2JE6I 3Q8DA 2N3SA 1L0WA 3TREA 4DR1L 1S72A 4A3JH 2Q2IA 1E3PA 2AWOA 3EIVA 3PGZA 3UE0A 4A3KH 3HOVH 2B63G 3KLWA 5C3EH 1FVIA 4IO9A 5IT9c 3PUZA 4A3GG 4A3DH 1HZBA 4TQUS 4JI1Q 4R4IA 3H15A 3PF5A 1HNZQ 4HIKA 3PF4A 4JI0L 2JA5H 2NVTH 2GVAA 2UUBL 4IOAA 4A3MG 2N78A 3OYYA 3T1YL 2AWNA 5LMNQ 1PYBA 3I4NG 4NXNL 1OXVA 1IBKL 4DR4L 1J6QA 1PV4A 2GN5A 3ULJA 1PA6A 4X64Q 4R4QA 1GKHA 2MFIA 4GNXA 5IYCH 4JBMA 1QUQB 1N33L 1Q81C 3D31A 1N8RC 5JJKA 4JI7L 3GDEA 2BA1A 4FDBA 3NBHB 3G48A 1VQEA 1NBWA 1IBLL 3I4MG 1M1KC 3PV0A 3HOUG 3T1HQ 1A0IA 1T9HA 3DLLA 5GAHC 2UUCQ 1N32Q 1MJCA 4OWXB 2E8GA 5JEAJ 4DV4Q 5BR8Q 5FJ8G 4UP9A 1XNQQ 3G4SA 4DPGA 4DV0L 2LSSA 3STBC 2K5NA 4X62L 1PH3A 4POGA 1XNRL 1EQQA 3J80i 2R92H 1I3QH 2JK8A 3ULPA 4QGUA 3OTOL 1YI2A 1VQKA 4JI3Q 3M4OH 2PI2E 2Z0SA 2H5XA 4UP8A 1HZ9A 4BBRG 4DV1L 2Y0SE 2B3GA 1VQ5A 3AYHB 1VQ8A 2XGTA 1QVCA 2QGQA 1C9OA 1CKOA 4GNXC 1VQNA 1SE8A 4DR6Q 1K83H 1HNWL 2R7ZH 2WAQE 4LFBQ 3S2HH 1XMOQ 3CCEA 4B3SQ 2JA8H 2ZM6L 2CKZB 3E9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1R H;  3G6E A;  5IWA Q;  1K73 C;  3L0O A;  5IP9 G;  4A3F H;  1Y1V H;  4A93 G;  2UXD Q;  3FP9 A;  2MO0 A;  3CF5 A;  4JI5 L;  4BBS H;  1UWV A;  1I94 L;  2UXC Q;  3I4O A;  4A3C G;  5C44 H;  2WB1 E;  5AJ3 Q;  1WFQ A;  3GTJ H;  4AIM A;  1NJI C;  4JI6 L;  2VQF L;  2I0Q A;  4B3T Q;  4JI4 Q;  4YWM A;  3F2C A;  4GKK L;  1QVG A;  1IBM L;  1YHB A;  2D62 A;  3KF6 A;  3J7Z C;  2KCM A;  1KL9 A;  1HR0 L;  3CME A;  2Y0S G;  1GO3 E;  1HNX L;  3GTL H;  1GD7 A;  1X3F A;  3WWV A;  1D8L A;  2PQA A;  2D0P A;  3J80 c;  4A3K G;  1U5K A;  2ZTC A;  1KC8 C;  5GRO A;  4AYB G;  2AKW B;  2KCT A;  2NVQ H;  4WJ4 A;  4DV3 L;  3RN5 A;  4LNQ A;  3S1M H;  3CCM A;  2JEB I;  3A0J A;  2E5L L;  4YHH Q;  2YU9 H;  3RLO A;  2OWO A;  1WYD A;  3K7U C;  2QA4 A;  4PZ7 A;  3PIP A;  4X6A H;  4X65 Q;  2ALY B;  4DV5 Q;  2HIV A;  2C35 B;  4QQB X;  3G71 A;  5IE8 A;  2F4V L;  3HOZ H;  1Y14 B;  1RIP A;  1K0R A;  1X65 A;  4LF7 L;  1G6P A;  2UU9 L;  1PH5 A;  1M90 C;  1VQP A;  3HOW H;  2JA7 G;  4JV5 L;  4XTC S;  3L2P A;  4DR2 Q;  1MIU A;  4DV2 Q;  5ELN A;  3FKI G;  2BH2 A;  2YTY A;  5JEA G;  1KHI A;  1NY4 A;  1PH8 A;  3MXN B;  4A3E H;  1QZG A;  5HY6 A;  1WCM G;  3KF6 B;  1C0A A;  4BY1 G;  2E2H H;  2ATW A;  2JA6 G;  1UE1 A;  3MEF A;  2NN6 I;  1C7Y A;  3ZJY C;  4OWW B;  3K80 C;  5LMU Q;  2CFM A;  2PQA B;  4GOP A;  2B29 A;  1VQH A;  4GKJ Q;  4LF5 Q;  4Y52 H;  4DUZ L;  5M3F G;  3CCL A;  3UDX A;  2L15 A;  2CQO A;  2WP8 J;  1HNZ L;  3KOJ A;  2MQH A;  4A76 A;  3M4Q A;  1XJV A;  4O0A A;  1FGU A;  3KJO A;  3ERS X;  1Q46 A;  1CKN A;  1K8A C;  3M9B A;  4X64 L;  4A3L H;  2E2J H;  4JC0 A;  1XMQ Q;  3RLF A;  1W2B A;  3PCO B;  4KLK A;  4OX9 Q;  3F1Z A;  1Z9F A;  1IYJ B;  5M3M G;  4QJF A;  4XIG S;  1E1O A;  3BZC A;  4IPC A;  3CCU A;  3HOY G;  3K81 C;  3M7N A;  2VNU D;  2NZO A;  4JCV E;  3A74 A;  1NMG A;  1PH2 A;  2UUC L;  1CKM A;  3HOX H;  3M3Y H;  1N32 L;  1JMC A;  4OO1 I;  4A3F G;  1NTG A;  3GTP H;  2UUA L;  2A1A A;  2YYZ A;  1FJG L;  4KHP Q;  1P8L A;  2UXB Q;  2ZTE A;  1OXX K;  1VQD A;  3K8A A;  1XNQ L;  1X56 A;  1QZH A;  1KXL A;  1RL2 A;  4LF8 Q;  1E24 A;  3PUX A;  3AFP A;  1PYS B;  1SLJ A;  3PUW A;  1WI5 A;  4R4O A;  4GOP B;  4GOP C;  4LF6 Q;  3RZO H;  5DLQ E;  1H95 A;  3PSI A;  4A3B G;  1YNX A;  4L5S A;  1N36 Q;  1EYG A;  4JI3 L;  1QVF A;  1JJ2 A;  4OON A;  2IX1 A;  1B8A A;  2WFW A;  2OQ0 A;  5HGQ A;  1UE6 A;  1V9P A;  3CPW A;  2ZJQ A;  4NPS A;  1HR0 W;  2K5V A;  1Q82 C;  3CC2 A;  2NZH A;  1BBU A;  1CKN B;  3AFQ A;  4X66 L;  4HID A;  2R6G A;  2JQO A;  3NEM A;  5IP7 H;  1N34 Q;  3PO3 G;  4R1J A;  1B70 B;  1Y1W H;  3S17 H;  4B3S L;  3HKS A;  3IRB A;  1E1T A;  1PH1 A;  1J5E Q;  4DNI A;  5IWA L;  4YCU A;  1VQA A;  3DM3 A;  4DV6 L;  2Q2T A;  1L1O B;  3AQQ A;  4JYA Q;  4WJ3 M;  1L2F A;  1UE7 A;  5J3B A;  2N49 A;  2LXK A;  4BXX G;  1W3S A;  4P74 A;  3J81 i;  5AJ3 L;  1Q8K A;  5GAG C;  2IHF A;  1Q7Y C;  2OTL A;  3S1Q H;  4B3R L;  4LWC A;  4B3T L;  4JI4 L;  3I2Z A;  5IYD G;  3UE1 A;  1VQ6 A;  1GVP A;  4R4C A;  3BZK A;  4IFD I;  4AYB E;  1GM5 A;  2BA0 A;  3CXC A;  2VQE Q;  3RLN A;  2K4K A;  5M5Y H;  4JI0 Q;  4RMF A;  1KIX A;  2UUB Q;  2CWP A;  4JG2 A;  1UEB A;  3K7A H;  2R93 H;  5JJI A;  4YCW A;  4A3I G;  2I5L X;  2MNA A;  5FLM H;  1Q12 A;  1A63 A;  2F52 A;  1MKH A;  3U50 C;  2VUM H;  4HJ8 A;  3PO2 G;  1HZA A;  4BY7 H;  1P16 A;  1Q1E A;  4POF A;  1VCI A;  1LYL A;  2ZJP A;  4MTN A;  4AQY Q;  2KEN A;  1YJW A;  1N33 Q;  1VQB A;  1KD1 C;  1SRU A;  4UP7 A;  4LFC Q;  4DV5 L;  1SFO H;  2LXJ A;  5E7N A;  1XPO A;  3BJU A;  2Z6K A;  3FHW A;  1TWA H;  1KRT A;  1IXR A;  2IT1 A;  4HJ7 A;  1PHJ A;  1MJE A;  1IBL Q;  2B63 H;  1EWI A;  1AE2 A;  3EN2 A;  2VW9 A;  2VL6 A;  1TWF H;  1PH4 A;  3H3V I;  4DR2 L;  2DUD A;  3I56 A;  5GAD C;  4DV2 L;  4A3J G;  1JE5 A;  1S40 A;  3ICE A;  3HOV G;  5C3E G;  1YIJ A;  1SRO A;  4HJ5 A;  3J81 c;  3H3V H;  3U58 A;  3CCV A;  1XNR Q;  3CAM A;  4A3D G;  3I4N H;  3TS2 A;  1D7Q A;  1PVO A;  4L5T A;  4HJ9 A;  5LMU L;  4LW1 A;  3JAM c;  1ASZ A;  4GKJ L;  1EIF A;  4DV1 Q;  4LF5 L;  4K0K L;  4HJA A;  4YWK A;  1SN8 A;  2MO1 A;  3F8T A;  4JI8 Q;  2JA5 G;  2IY5 B;  4C3I H;  1XTD A;  2YTV A;  5EAY A;  5GQO A;  3PIO A;  4OO1 G;  4LUO A;  4DR3 Q;  2VZA A;  3H0G H;  4KI0 A;  4DR7 Q;  1BVS A;  4ALP A;  5IYC G;  3HOU H;  3J7A 5;  1YEZ A;  3E9H A;  4LF4 Q;  3I4M H;  3S16 H;  1YBY A;  1VQI A;  3L7Z C;  1X9N A;  4EX5 A;  2Z6K C;  4Y7N H;  3CP0 A;  3RR5 A;  4NB3 A;  2R7D A;  2K5H A;  2PNH A;  2R7F A;  3TQY A;  5FJ8 H;  2HHH Q;  2KHI A;  5C0X I;  2FXQ A;  3W1G A;  4PZ8 A;  3HKZ G;  3CQZ H;  1VQM A;  3OW2 A;  3S1N H;  4JBJ A;  2XTI A;  4IJL A;  2RHS B;  4LUV A;  4JI2 Q;  4JI1 L;  4AH6 A;  4C2M H;  4B3M Q;  4GKK Q;  2R7Z G;  4BBR H;  4HIM A;  3A5Z B;  2AMC B;  2K14 A;  4LF9 Q;  4KHP L;  1LM0 A;  2NVX H;  2UXB L;  2R92 G;  2RCN A;  5LMN L;  3RZD H;  1TXY A;  3PUY A;  1K8G A;  4NXM Q;  1I50 H;  2RHQ B;  3U4Z A;  2EIF A;  1CSP A;  1HJP A;  1VQC A;  1YVC A;  5IY0 A;  1N36 L;  4DV7 Q;  1EFW A;  2IHE A;  1AH9 A;  1U0L A;  3GTO H;  1G51 A;  2E2I H;  5IP9 H;  1AE3 A;  5H1S E;  3J81 j;  2E5L Q;  4YCV A;  4A93 H;  2HT1 A;  2EQS A;  2PMZ E;  4QY7 A;  4IPH A;  1L1O A;  1OXT A;  3U4V A;  2JA8 G;  1V43 A;  3T1H L;  5M5X H;  4A3C H;  4KHZ A;  3KDF A;  3STB D;  1X6O A;  4DV4 L;  3UDI A;  1XPU A;  4IOC A;  5K36 G;  1J5E L;  3CW2 C;  4LF7 Q;  1Y1V G;  5BR8 L;  1HH2 P;  4BBS G;  4JV5 Q;  1Q1B A;  5C4X H;  3GO5 A;  2K52 A;  4DR5 Q;  1YJN A;  2N8N A;  4O2D A;  4DUY Q;  5C44 G;  3CCS A;  1BKB A;  1VQJ A;  1TWG H;  1X3E A;  3TEH B;  1TWC H;  1UE5 A;  3KF8 B;  1WOC A;  2IX0 A;  3JC6 6;  2HIX A;  4LFA Q;  1OXS C;  2Q2U A;  1NMF A;  2CWA A;  1BBW A;  1SR3 A;  2VS1 A;  4L5Q A;  4J15 A;  3F2B A;  3W1B A;  3S2D H;  1O7I A;  4DR6 L;  4QL5 A;  4DUZ Q;  1N9W A;  4LFB L;  2VQE L;  1XMO L;  2K50 A;  2KBN A;  4R4T A;  1K9M C;  3F2D A;  4JOI A;  4ME3 A;  3RNU A;  1KAW A;  1JB7 A;  3E0E A;  1L1O C;  4YY3 Q;  2UXD L;  2JA7 H;  4JBK A;  3UDG A;  2UXC L;  4DR1 Q;  3KDF B;  3FKI H;  1KQS A;  4IPD A;  4AQY L;  1VQL A;  3TS0 A;  2VY3 A;  1KRS A;  3HOZ G;  4LFC L;  2ASB A;  3GTG H;  3GTK H;  1I6H H;  3HOW G;  1WCM H;  3H0G G;  4BY1 H;  2ZTD A;  4IJH A;  3JAM i;  5JJL A;  2JA6 H;  3S14 H;  4DAM A;  3CPF A;  4LUZ A;  4A3E G;  2OTJ A;  1NE3 A;  1B7Y B;  4P75 A;  4EQ5 A;  1K3R A;  1V1Q A;  2UUA Q;  1FJG Q;  5M3F H;  3D0F A;  2KHJ A;  4QIW E;  5IYB H;  3T1Y Q;  3AEV A;  2Q2H A;  2JA9 A;  4NXN Q;  1E22 A;  4P72 A;  1IBK Q;  3GTM H;  4DR4 Q;  4MNO A;  1VQ9 A;  1YZ6 A;  4GLX A;  4RG1 A;  2OCE A;  5C0X G;  4YHH L;  4JOI C;  3M85 A;  2GVB A;  1DGS A;  2NN6 G;  1Q86 C;  1HZC A;  3HFZ B;  4X65 L;  4JI8 L;  5FLX c;  3ULL A;  4JI7 Q;  4IFD J;  1SMX A;  5LMN W;  1XPR A;  4X66 Q;  3ER0 A;  4P73 A;  1JJC B;  4GNX B;  1I5F A;  2I5H A;  4OWT B;  4YWL A;  5M3M H;  2A19 A;  4DR3 L;  3HOY H;  4DR7 L;  4A3G H;  1JT8 A;  1X54 A;  1EIY B;  4A3L G;  2NVY H;  4LF4 L;  4DAY B;  1X55 A;  4UY8 C;  3HKZ E;  4DV6 Q;  1OTC A;  4DV0 Q;  1R9T H;  2D0O A;  4X62 Q;  4MZ9 A;  2HHH L;  4A3M H;  1X3G A;  4GS3 A;  5M5W H;  3OTO Q;  1EOV A;  2V1C C;  4GLV B;  2EXD A;  3HOX G;  2YV5 A;  4APV A;  1A62 A;  1YHA A;  4JBW A;  4A3B H;  4B3R Q;  1LUZ A;  1CSQ A;  1LTL A;  4JI2 L;  2K75 A;  4H02 A;  1YHQ A;  4A4I A;  4B3M L;  1VS0 A;  2HQL A;  5C4X G;  3CC4 A;  4LF9 L;  4UPA A;  3NEN A;  3SGI A;  1HNW Q;  3S24 A;  4NXM L;  3A5U A;  3CMA A;  3CCQ A;  3RN2 A;  1S3O A;  2ZM6 Q;  3PO3 H;  4DV7 L;  3KJP A;  4DK6 C;  4BA2 I;  2WAQ G;  2DGY A;  2BH8 A;  3GTQ H;  1XMQ L;  4L5R C;  4JI5 Q;  1OXU A;  1I94 Q;  2QEX A;  1VQF A;  3M4P A;  1CUK A;  1VQO A;  4BA1 I;  4OX9 L;  3NEL A;  5IP7 G;  5C4J H;  2RF4 A;  4GN3 B;  1A8V A;  1PFS A;  1EQR A;  1TWH H;  2ZJR A;  1Y1W G;  4BXX H;  3K0X A;  2YTX A;  2VQF Q;  1ASY A;  4JI6 Q;  3I55 A;  1VQ4 A;  2A8V A;  4DK3 C;  2AHO B;  1YIT A;  2WB1 G;  1IBM Q;  3CD6 A;  2ES2 A;  4PG3 A;  1VQ7 A;  3CC7 A;  1HR0 Q;  3UDF A;  4DR5 L;  5IYD H;  4LF8 L;  4LF6 L;  4DUY L;  1HNX Q;  1JJG A;  4OXP A;  4C3H H;  2JJQ A;  2CCZ A;  2F3I A;  2JEA I;  4A75 A;  1PH6 A;  1PH9 A;  5C0X J;  2PI2 A;  3W5O A;  4C3J H;  2OQK A;  3I7F A;  4HIO A;  1PH7 A;  4DKA C;  4A3I H;  4DV3 Q;  4LFA L;  1E7Z A;  2I5M X;  3B6Y A;  3GD7 A;  4GN5 A;  1YJ9 A;  3TRZ A;  1IZ6 A;  4TVA B;  1VQG A;  3PO2 H;  4K0K Q;  3BU2 A;  3PUV A;  4GN4 B;  1N34 L;  1G29 1;  2R93 G;  1IL2 A;  1Z47 A;  2ID0 A;  4P71 A;  5IYB G;  3VDY A;  1EUJ A;  2F4V Q;  4IFD G;  1QUQ A;  5FLM G;  3CCJ A;  4PZ6 A;  2UU9 Q;  4GLA C;  3KYH C;  5GAE C;  3KFU A;  1FL0 A;  3CCR A;  2VUM G;  4IPG A;  3S15 H;  3EBE A;  4BY7 G;  3LGJ A;  5ELO A;  1WJJ A;  4PMW A;  4YY3 L;  4JYA L;  2JE6 I;  3Q8D A;  2N3S A;  1L0W A;  3TRE A;  4DR1 L;  1S72 A;  4A3J H;  2Q2I A;  1E3P A;  2AWO A;  3EIV A;  3PGZ A;  3UE0 A;  4A3K H;  3HOV H;  2B63 G;  3KLW A;  5C3E H;  1FVI A;  4IO9 A;  5IT9 c;  3PUZ A;  4A3G G;  4A3D H;  1HZB A;  4TQU S;  4JI1 Q;  4R4I A;  3H15 A;  3PF5 A;  1HNZ Q;  4HIK A;  3PF4 A;  4JI0 L;  2JA5 H;  2NVT H;  2GVA A;  2UUB L;  4IOA A;  4A3M G;  2N78 A;  3OYY A;  3T1Y L;  2AWN A;  5LMN Q;  1PYB A;  3I4N G;  4NXN L;  1OXV A;  1IBK L;  4DR4 L;  1J6Q A;  1PV4 A;  2GN5 A;  3ULJ A;  1PA6 A;  4X64 Q;  4R4Q A;  1GKH A;  2MFI A;  4GNX A;  5IYC H;  4JBM A;  1QUQ B;  1N33 L;  1Q81 C;  3D31 A;  1N8R C;  5JJK A;  4JI7 L;  3GDE A;  2BA1 A;  4FDB A;  3NBH B;  3G48 A;  1VQE A;  1NBW A;  1IBL L;  3I4M G;  1M1K C;  3PV0 A;  3HOU G;  3T1H Q;  1A0I A;  1T9H A;  3DLL A;  5GAH C;  2UUC Q;  1N32 Q;  1MJC A;  4OWX B;  2E8G A;  5JEA J;  4DV4 Q;  5BR8 Q;  5FJ8 G;  4UP9 A;  1XNQ Q;  3G4S A;  4DPG A;  4DV0 L;  2LSS A;  3STB C;  2K5N A;  4X62 L;  1PH3 A;  4POG A;  1XNR L;  1EQQ A;  3J80 i;  2R92 H;  1I3Q H;  2JK8 A;  3ULP A;  4QGU A;  3OTO L;  1YI2 A;  1VQK A;  4JI3 Q;  3M4O H;  2PI2 E;  2Z0S A;  2H5X A;  4UP8 A;  1HZ9 A;  4BBR G;  4DV1 L;  2Y0S E;  2B3G A;  1VQ5 A;  3AYH B;  1VQ8 A;  2XGT A;  1QVC A;  2QGQ A;  1C9O A;  1CKO A;  4GNX C;  1VQN A;  1SE8 A;  4DR6 Q;  1K83 H;  1HNW L;  2R7Z H;  2WAQ E;  4LFB Q;  3S2H H;  1XMO Q;  3CCE A;  4B3S Q;  2JA8 H;  2ZM6 L;  2CKZ B;  3E9I A; 
#chains in the Genus database with same CATH topology
 4BY7 B;  3G6E A;  1K73 C;  3FVQ A;  1CI3 M;  3H94 A;  4JI3 H;  1RTN A;  1Y1V H;  2LKV A;  1HCZ A;  1RYR A;  2PBZ A;  2R8K A;  1DCZ A;  2RSO A;  4CDF C;  4A3C G;  1EHI A;  5C44 H;  5AJ3 Q;  4J9M A;  1FGB D;  1NJI C;  1BQQ T;  1LT3 D;  1YHB A;  2NBF A;  1KAA A;  2KCM A;  5I2X A;  1QB5 D;  3Q23 A;  1HR0 L;  3ND8 A;  2Y0S G;  4C2M A;  3GTL H;  1TA8 A;  3WWV A;  5KRU A;  2D0P A;  3EFX D;  3J80 c;  1U5K A;  1KLU D;  4ECQ A;  2NWG A;  4WRD A;  2KCT A;  4MV4 A;  2WAC A;  4N8X 1;  3WO1 A;  1SYC A;  4DGZ A;  2JEB I;  2E76 C;  1R4P B;  3CCM A;  4YHH Q;  2E5L L;  3OSN A;  4JI4 H;  3K7U C;  3PIP A;  2E2I A;  4X6A H;  2OT2 A;  2KSW A;  3G71 A;  5IE8 A;  2EYO A;  2CW8 A;  1K0R A;  1VKZ A;  4LF7 L;  2UU9 L;  1PH5 A;  3NSW A;  1WTH A;  2SDF A;  4FS2 A;  4XTC S;  3L2P A;  5JJZ A;  1MIU A;  3HEJ A;  5ELN A;  5L1J A;  4BWG B;  4IRK A;  2EJM A;  2K5D A;  3J7A F;  2QK4 A;  1GXD C;  3CQZ B;  4HNV A;  2PZT A;  2W6Q A;  1B04 A;  4J9S A;  4J9O A;  3NQI A;  1S5E D;  3MEF A;  5FD6 A;  2NN6 I;  4BBR B;  4X65 H;  4JI8 H;  3Q8R B;  2M9V A;  2K28 A;  3LWB A;  5LMU Q;  2NVX B;  2PQA B;  4IRC A;  3MEH A;  1RJQ A;  1I50 B;  3IAY A;  1HNZ L;  2NN6 H;  3TIG A;  2MQH A;  2RDF A;  3M7G A;  1T5X D;  3T5H A;  1XJV A;  3RF2 A;  4O0A A;  1ENF A;  3MR2 A;  2DWC A;  2GPS A;  2KA7 A;  1K8A C;  2FJ2 A;  4X64 L;  4A93 B;  4UFZ A;  1S9F A;  2F0F A;  4K2K A;  3Q24 A;  2EDG A;  4O3S A;  1G91 A;  4YAK B;  3SDZ A;  5M5X B;  2L11 A;  1QOH A;  4N9T A;  3VYU A;  3FKI A;  5EPJ A;  3MAQ A;  3HOY G;  5JQW A;  2NZO A;  3M9M B;  1PH2 A;  1EYC A;  3HOX H;  4Y8V B;  1M7J A;  1SBB B;  1GUT A;  1LAC A;  4QW9 A;  3NHH A;  2UXB Q;  1XNQ L;  1KXL A;  3K59 A;  3RV3 A;  1TWC B;  1RL2 A;  3GV8 B;  3PUX A;  4GOP C;  4LF6 Q;  1SLJ A;  3PUW A;  4FYD A;  5KFZ A;  1TR5 A;  4AYB B;  3PSI A;  1K8M A;  5IYZ F;  4IUP A;  4JI3 L;  3EPI A;  4K6D A;  2L55 A;  1B8A A;  2OQ0 A;  2ZJQ A;  4IN3 A;  1GHK A;  1B9M A;  5D1O B;  1KNE A;  2ICI A;  1CKN B;  3G6Y A;  4HID A;  1E4E A;  4HQ6 A;  1HPC A;  4J9P A;  3GV3 A;  3PW4 A;  1EY6 A;  4R1J A;  4DR5 H;  1B70 B;  3S17 H;  1HQM C;  2JA7 B;  2F0J A;  3P75 A;  4K8J A;  5KFI A;  4YCU A;  1VQA A;  4KN7 C;  1N36 H;  1STN A;  3AQQ A;  4JVZ A;  1CQJ B;  1L2F A;  1UE7 A;  5J3B A;  3GTK B;  1HUN A;  2N49 A;  4P74 A;  3SE0 A;  1Q8K A;  4QWB A;  1G2T A;  5GAG C;  3FMA A;  1NCV A;  4TKO B;  3A8I E;  1GUG A;  4IZO A;  2HVS A;  4JI4 L;  1N34 H;  1HXY D;  5M3F B;  4R4C A;  2OF1 A;  4IUQ A;  1GM5 A;  3RLN A;  4JYA H;  2EXZ A;  2CWP A;  5I2Y A;  4IQZ A;  4B9X A;  3K5H A;  2I5L X;  2MNA A;  1MZB A;  2RGR A;  2IX3 A;  1EZ6 A;  2VUM H;  4MA0 A;  4Z9C B;  4HJ8 A;  2FK2 A;  1P16 A;  4EFB A;  1STH A;  1YJW A;  4X3K A;  1LYL A;  3P7J A;  4FVM A;  4MTN A;  2KEN A;  5KX5 F;  4IZ8 A;  1VQB A;  3GQB A;  5M3M B;  1SRU A;  4UP7 A;  3HGB A;  2OXP A;  2R7Z B;  2FIN B;  4XZ3 B;  2LXJ A;  4FS1 A;  5E7N A;  1BGW A;  4TUY F;  1W93 A;  3FHW A;  1TWA H;  4TRD A;  2R6F A;  1JDE A;  1PH4 A;  5CV7 A;  2UUB H;  1R9T B;  2D9U A;  2PW5 A;  1SYF A;  4ZQI A;  3KAJ A;  4XQN A;  1JE5 A;  4MIU A;  1S40 A;  3VMM A;  5C3E G;  3LX0 A;  1YIJ A;  4A3B B;  1SEI A;  4IRD A;  3CCV A;  4AQY H;  3CAM A;  3I4N H;  4LFC H;  1D1K A;  1H9K A;  3TS2 A;  1JX4 A;  3GLK A;  3M9N B;  4L5T A;  4LW1 A;  3J81 L;  3RTX A;  1DJR D;  3NBI A;  1LAB A;  4YWK A;  1PZJ D;  2MO1 A;  4JI8 Q;  1D6E C;  1ENC A;  3G7L A;  2YTV A;  4CDC C;  3JAM L;  4Q8E A;  4LUO A;  4CJ2 C;  5BN3 A;  1D1I A;  4KI0 A;  1EQT A;  4XDX A;  1PZI D;  3HOU H;  4I55 F;  1YEZ A;  3E9H A;  4LF4 Q;  3OHA A;  1XNR H;  3L7Z C;  4TSS A;  3MFH A;  3CP0 A;  1TWH B;  3RR5 A;  4NB3 A;  5FJ8 H;  4HMJ A;  5CB4 F;  3KHL A;  2KHI A;  4R8I A;  4DL3 A;  4ZUJ A;  2FXQ A;  1M0T A;  4DV1 H;  5ELE A;  2MGS A;  3NK9 A;  4O2B F;  2XTI A;  2O4X A;  2XGQ A;  1HNW H;  4AH6 A;  4C2M H;  4TQS A;  3CRL C;  2AMC B;  3A5Z B;  3EA6 A;  5DAU A;  4LF9 Q;  3G6V A;  2K33 A;  3TP6 A;  5DGA A;  1JWS D;  2XWB B;  5LMN L;  4NXM Q;  3MVV A;  4RUA A;  3FEW X;  1PRT B;  2AU0 A;  3MR6 A;  1CSP A;  3IFT A;  1D2B A;  2RGV A;  1N36 L;  1EFW A;  2HHH H;  3VR5 A;  3K5L A;  2IHE A;  5L9X A;  3DM1 A;  3P1H A;  1UAP A;  2E2I H;  3TN2 A;  5IP9 H;  1AE3 A;  1T94 A;  5KFF A;  5A2Q L;  3J81 j;  4B3M H;  2HT1 A;  1BUV T;  4IPH A;  2JN4 A;  3GTK A;  2A6E C;  3Q0A A;  1V8Q A;  2R7N A;  3STB D;  1X6O A;  2VR1 A;  3UDI A;  4YR2 A;  2FLP A;  5J2U F;  3K0Y A;  5KFO A;  4ZOL F;  4G4K A;  1VF5 C;  3HKZ A;  4DR5 Q;  4EYH B;  3N43 B;  3GV5 B;  4HMI A;  4J0M A;  4E6I A;  2YRW A;  1KTK A;  4YQW A;  2N55 A;  3RGZ A;  5E3F A;  2IX0 A;  2AGO A;  1OXS C;  4ZRZ A;  3KBG A;  5D1P A;  4FF1 A;  2VS1 A;  4L5Q A;  4J15 A;  2JA5 B;  1Q3L A;  1M4V A;  1S4Z A;  4WOR A;  1U4L A;  4JV5 H;  3SHL A;  2W7O A;  3IFD A;  4QWC A;  4J9R A;  1K9M C;  1EZ8 A;  1RDP D;  3VYS A;  3I12 A;  1FKA H;  2R7Z A;  3O13 A;  4RCN A;  3GIQ A;  3GQC A;  3G6X A;  5J2T F;  2UXD L;  4F4W A;  1V4Y A;  2YCH A;  4JBK A;  4OL7 A;  3UDG A;  2UXC L;  4HSV A;  3MWM A;  3FKI H;  4EQP A;  5HUR A;  4AQY L;  1VQL A;  4LFC L;  1I6H H;  1SMY D;  1H9S B;  3HOW G;  4BY1 H;  2ZTD A;  3GTJ A;  2JA6 H;  3S14 H;  4ED6 A;  3Q6S A;  4O3N A;  4HSP A;  1B7Y B;  2R92 B;  1K3R A;  2UUA Q;  1X32 A;  2KHJ A;  3AEV A;  1LTG D;  1OO9 B;  1E22 A;  1IBK Q;  1EIH A;  1EY5 A;  5COR A;  3K3V A;  5DM6 3;  5JVL A;  2B39 A;  2MHV A;  4H13 C;  4JOI C;  1K83 B;  3HXL A;  4RUC A;  1A15 A;  1HZC A;  4JV2 A;  3R5X A;  3IL8 A;  2KEE A;  2RVL A;  4JI7 Q;  2JA8 B;  4IFD J;  1HRJ A;  1TKW B;  3MWE A;  1TWH A;  1U4P A;  4P73 A;  1FJG H;  4YWL A;  2I5H A;  4BS9 A;  1B3A A;  2A19 A;  1Y1V B;  4ECS A;  3T1Y H;  3IG0 A;  3H20 A;  4DR4 H;  1X55 A;  4JK1 C;  5C44 B;  4RZQ A;  4X62 Q;  5EZY F;  3MZ5 A;  3V4S A;  4K8I A;  2HHH L;  3TP8 A;  4XYL B;  4EEY A;  3OTO Q;  4RKL A;  3QJY A;  3MR5 A;  3R93 A;  4APV A;  1YHA A;  4B3R Q;  3H09 A;  1CSQ A;  2EYL A;  3QOJ A;  4X66 H;  1YHQ A;  3HRZ C;  4B3M L;  4UCU A;  1VS0 A;  3GTL B;  2DPJ A;  4ECT A;  2HQL A;  4UPA A;  3Q1K A;  3MXG A;  1HNW Q;  3SGI A;  4LMQ D;  1NR4 A;  1XWE A;  5IWA H;  4DV6 H;  5HGT A;  1B44 D;  1MI2 A;  3MWY W;  4ZKB B;  1S3O A;  3PO3 H;  1Z2O X;  2ZDG A;  3DMU A;  3HG9 A;  1I4X A;  3QIA A;  5D3I B;  4JI5 Q;  5KFH A;  3NEL A;  5EGT A;  5IP7 G;  5C4J H;  2RF4 A;  2JSO A;  1EQR A;  1O7L A;  4HR7 B;  2F1M A;  1Y1W G;  3MR3 A;  1ASY A;  2YTX A;  2WYO A;  4J9L A;  2HGS A;  2WB1 G;  5KT5 A;  2ASJ A;  3CD6 A;  2ES2 A;  2ZM6 H;  1VQ7 A;  1BBX C;  5C1O A;  4LF8 L;  5FO9 B;  1EYA A;  5KGU A;  2CCZ A;  2XRQ D;  5D8D A;  1I94 H;  2QDB A;  5C5M A;  5C4Z A;  2OQK A;  1SDF A;  4HIO A;  2F0V A;  4MV1 A;  4XX0 B;  4A3I H;  1E7Z A;  4JI6 H;  4PMB A;  2I5M X;  1UNS A;  2VOB A;  3BDC A;  3TRZ A;  2NYZ D;  4K0K Q;  3F2U A;  3PUV A;  4MTE A;  4YAJ B;  1Z47 A;  2ID0 A;  3VDY A;  2F4V Q;  1EUJ A;  1QUQ A;  2HD3 A;  5FLM G;  3CCJ A;  3H40 A;  3OSO A;  3KYH C;  1PFM A;  2ENB A;  1FL0 A;  5CYU A;  4BY7 G;  4UDU C;  1F9P A;  2XVS A;  3NBH A;  3Q8D A;  2N3S A;  3NWT A;  1L0W A;  1E3P A;  2AWO A;  3EIV A;  3N42 B;  4DV3 H;  3KHG A;  3PMF A;  5KT2 A;  3SK4 A;  3HOV H;  2R92 A;  3HOX B;  4UCO A;  5ELF A;  5FK9 C;  1LLR D;  4K5W A;  1HZB A;  2B2W A;  4FXK C;  5C4X B;  1RF2 D;  4JI1 Q;  2FMA A;  4DLK A;  4R4I A;  2XD4 A;  1ML0 D;  4I65 A;  5IIF A;  4IOA A;  1K83 A;  2N78 A;  1CT1 D;  1KNA A;  4R8N A;  3T1Y L;  2J0T D;  3NTI A;  4NXN L;  1OXV A;  1MD2 D;  2PZW A;  5FLX E;  3K57 A;  4DR4 L;  1J6Q A;  1PV4 A;  4I7A A;  5LL6 S;  1GKH A;  2F0T A;  2M05 A;  4ZI7 F;  2LS0 1;  4Q43 A;  1N33 L;  1C3O A;  1Q81 C;  2WII B;  5KG5 A;  3D31 A;  4NW2 A;  3S17 B;  1N8R C;  1CTM A;  1BDO A;  2BA1 A;  2WKC A;  2DJF C;  4FDB A;  5CV4 A;  1NBW A;  1IBL L;  3HBL A;  5IGB A;  1EY7 A;  1A0I A;  1HFG A;  1J9O A;  1T9H A;  3T1H Q;  2UUC Q;  1SFO A;  2R84 A;  3QR8 A;  4BWS C;  2B63 A;  4ECV A;  4UP9 A;  1TWF A;  3G4S A;  3STB C;  4APM A;  1LTT D;  2HDM A;  1VQK A;  2PI2 E;  1DOL A;  1SNQ A;  2A69 C;  2O2L D;  4BBR G;  5LA6 F;  5F9L A;  2ICE C;  4X3U A;  2IA6 A;  4Q8F A;  1N32 H;  2QGQ A;  3NE5 B;  2W6O A;  4GNX C;  4DR6 Q;  2OEO A;  2R7Z H;  2WAQ E;  2ZT9 C;  3S2H H;  4K5X A;  5EWF A;  2W57 A;  2VUM B;  2ZM6 L;  2Q8R E;  3E9I A;  1VBG A;  4DXG A;  3RUP A;  2QEJ C;  1PLF A;  5IWA Q;  4ED3 A;  3L0O A;  4A93 G;  1H9R A;  4BBS H;  3KTM A;  3T5L A;  1I94 L;  5T1G A;  1F2L A;  2YW2 A;  3SEB A;  4L8J A;  3VPB A;  2P5Z X;  1WFQ A;  1K0S A;  3GTJ H;  2HJW A;  3PN1 A;  4AIM A;  2PZU A;  4JI6 L;  1EUD B;  4GKK L;  2NVY B;  4LFB H;  1XMO H;  1SEB D;  2EYH A;  2FFK B;  3AMU A;  3H3V C;  5LL6 b;  2QIL A;  1SMY C;  3KXY T;  2BDO A;  2L0C A;  1X3F A;  3I4N B;  1D8L A;  2H4O A;  5L1L A;  4ZCK A;  2ZTC A;  4ZAI A;  4AYB G;  2B2U A;  1I7N A;  1T5E A;  3EJI A;  2IBK A;  4DV3 L;  3RN5 A;  4LNQ A;  3S1M H;  4EGJ A;  2X6G A;  3HB9 A;  2OWO A;  3RAX A;  5FO7 B;  4DV5 Q;  4ZLT F;  3GIP A;  2SEB D;  2NTT A;  4QQB X;  3HOU B;  3X3M A;  1Y14 B;  1JOQ A;  1X65 A;  3KLS X;  1ICF B;  2FJZ A;  1BCP C;  3SK5 A;  2GLT A;  3ETH A;  4O3O A;  5I6Y A;  5KFE A;  1LTB D;  2JA7 G;  1SJH D;  4RNO A;  4DR2 Q;  1TS3 A;  5IT9 E;  3PVX A;  2YTY A;  5JEA G;  2JP1 A;  4B9W A;  3MXN B;  4A3E H;  4DNR B;  4FXG C;  3QFF A;  3C0F B;  4YHH H;  1A6X A;  4C2M B;  1WSC A;  2ATW A;  1UE1 A;  3LWE A;  4OWW B;  3K80 C;  1JWM D;  3C3L A;  2CFM A;  4YR3 A;  1AEX A;  2F3V A;  4GOP A;  2XCL A;  4LF5 Q;  2VA2 A;  4DUZ L;  5M3F G;  3UDX A;  4L1K A;  4EG0 A;  2IJ0 A;  2PVP A;  3M4Q A;  4FNF A;  4UCT A;  1A3V A;  5HV6 A;  1FGU A;  1SJE D;  2LMC B;  3ERS X;  5ISR A;  3M4Y A;  5KIX A;  2E2I B;  1Q46 A;  2MUY A;  4FP5 D;  1JWU D;  3M9B A;  4V19 0;  1JC7 A;  4A3L H;  2EY5 A;  3V96 A;  1XMQ Q;  2F03 A;  2XSC A;  3PCO B;  5KFJ A;  5DG8 A;  4OX9 Q;  2C22 A;  2R7Z G;  5M3M G;  3CCU A;  2VNU D;  3K5I A;  3KAK A;  2NUC A;  4ZHQ F;  1NMG A;  3GTG A;  2A68 C;  1N32 L;  1WCM A;  4O4L F;  3J7Y W;  1PDQ A;  4OO1 I;  1FR3 A;  2A1A A;  4KHP Q;  1P8L A;  1W6J A;  1VQD A;  3GII A;  1X56 A;  1QZH A;  1CQI B;  1PYS B;  4A3K B;  2R8J A;  1H95 A;  4OO1 H;  2C2E A;  1Q8I A;  4A3B G;  4RNM A;  1JJ2 A;  2DPI A;  1C48 A;  4XYM B;  5T1I A;  3J7A K;  2HUG A;  4R8U A;  1Q82 C;  3CC2 A;  2NZH A;  4FO2 A;  2NVT B;  4C1N I;  4FF2 A;  1EYZ A;  1SYD A;  3RAQ A;  2UXB H;  2B2Y C;  4LF6 H;  3IRB A;  1PH1 A;  1E1T A;  1J5E Q;  3GIJ A;  1SE4 A;  3FKI B;  3BDL A;  3DM3 A;  2FKL A;  3J80 W;  2Q2T A;  4RH6 A;  4Q0F A;  4XQJ A;  2B2W C;  2W6N A;  2NVY A;  3VR3 A;  3MTS A;  3UI2 A;  3FPP A;  2KVM A;  2LXK A;  2YS7 A;  4BY1 B;  5L1K A;  1WTW A;  1XDN A;  5AJ3 L;  2JA6 B;  4J6H A;  4UCS A;  2JYO A;  3S1Q H;  1Q7Y C;  2OTL A;  2DY8 A;  3Q8Q B;  2FMM A;  4LWC A;  1K1Q A;  3U9T A;  5IYD G;  2F0Q A;  2WKD A;  3E0J A;  2VQE Q;  4CDE C;  2K4K A;  4YY3 H;  4JI0 Q;  1KIX A;  2R8H A;  1TVX A;  4FBT A;  5JJI A;  4DR1 H;  1SYB A;  3K58 A;  2DNE A;  1Q12 A;  1E4E B;  1A63 A;  3TME A;  3KLR A;  4POF A;  2BQU A;  3GIL A;  5BN4 A;  1KD1 C;  4G7Z C;  2I8C A;  1SFO H;  5BMV F;  1KJJ A;  3MXN A;  1RD9 D;  5CC4 A;  1KRT A;  2Q8T A;  2B63 H;  1PHJ A;  3WNZ A;  3H4B A;  2VW9 A;  2VL6 A;  1TWF H;  2XIW A;  3CHB D;  3KHH A;  2DUD A;  1CQF A;  3MHB A;  1G6Z A;  1KJ9 A;  2FPP B;  3OPO A;  4P2C B;  1EWC A;  3U9S A;  4CC5 A;  1SRO A;  2ZXO A;  4HJ5 A;  2VPS A;  3U58 A;  2E75 C;  1JLL B;  3V2T A;  5KKN B;  2A6E D;  1BXT A;  1CK1 A;  2O03 A;  5LMU L;  2ATL A;  1A3U A;  1EIF A;  2F4I A;  4HED A;  1SN8 A;  3F8T A;  2JA5 G;  4HTH A;  3C2P A;  2PQE A;  3A7A B;  3V6K A;  3PO3 B;  1KJ8 A;  5GQO A;  2V4Q A;  2BE5 D;  3D6W A;  2IP4 A;  4IHJ F;  4OIK A;  4OO1 G;  3BZD B;  5EKK A;  5EWE A;  4DR3 Q;  4DR7 Q;  2F0M A;  5IYC G;  3J7A 5;  3I4M H;  3S16 H;  3BA9 A;  4PNY A;  1X9N A;  2XGP A;  1W96 A;  5C4J B;  3PW5 A;  4RGT A;  4O3R A;  2R7D A;  1C8C A;  1B9N A;  2PNH A;  3TQY A;  5FPO A;  4G57 A;  1HFN A;  4M1U B;  4N9P A;  5IOC A;  4IJL A;  2RHS B;  4C5C A;  4ECW A;  4JI2 Q;  1AUV A;  2B2U C;  3N41 B;  2B8F A;  4HIM A;  2PCF B;  3RD4 A;  4LF4 H;  2XRS D;  2UXB L;  2R92 G;  2RCN A;  1KJQ A;  5DNF A;  2NU9 B;  2C2R A;  1TXY A;  5DEH A;  1AFP A;  2KCC A;  4A3I B;  2RHQ B;  3U4Z A;  2EIF A;  1HJP A;  1VQC A;  1YVC A;  1B6S A;  1B2T A;  4K6L A;  4RB3 C;  1G51 A;  4O1N A;  5H1S E;  2E5L Q;  5KFQ A;  4YCV A;  5KFD A;  2EQS A;  1TAE A;  2PMZ E;  1OXT A;  4LF9 H;  2JA8 G;  1M6V A;  4Q45 A;  3KDF A;  2UVR A;  4DV4 L;  1XPU A;  4IOC A;  2Q8I B;  4NXM H;  1NAP A;  3CW2 C;  4LF7 Q;  1Y1V G;  5BR8 L;  2JA6 A;  1HH2 P;  4TV9 F;  5BPF A;  5C4X H;  3RGX A;  3GO5 A;  3PR4 A;  1YJN A;  2N8N A;  4IUN A;  3HOV B;  5C44 G;  3CCS A;  1JIC A;  2YRX A;  1BKB A;  4L63 B;  5IGD A;  3ERQ A;  1UE5 A;  4QIW B;  4O42 A;  2FB9 A;  1I3Q A;  1WOC A;  3BJY A;  2Q2U A;  5LHY 1;  1YNJ D;  2CWA A;  3GTP B;  2X6L A;  1JOR A;  3ORQ A;  2VB2 X;  3W1B A;  3A54 A;  2K50 A;  2Z4I A;  3F2D A;  4JOI A;  4FF4 A;  5KT3 A;  4XYO A;  2DLN A;  3KAL A;  1KAW A;  5LL6 X;  3E0E A;  1L1O C;  5C8Y F;  4QB4 A;  4XT1 B;  3DWP A;  4YY3 Q;  2J9G A;  1CZW A;  4DR1 Q;  1RK5 A;  1TS5 A;  1KQS A;  3PIP 3;  2CZG A;  2PPB C;  2HVR A;  2VY3 A;  1KRS A;  3HKZ B;  2A5H A;  3GTG H;  4DK1 A;  5J22 A;  1WCM H;  4RCO A;  1IOV A;  3TP7 A;  3J81 E;  1TY2 A;  4I4T F;  5T14 A;  2R3Z A;  1RHP A;  3T51 B;  2OTJ A;  1NE3 A;  1V1Q A;  4RAU C;  3D0F A;  3JAM E;  2IPK D;  5KFG A;  2IMW P;  1DV2 A;  1JKJ B;  3V4Z A;  2WTF A;  4F87 A;  4DF7 A;  2KED A;  4ME5 A;  4MNO A;  1EY8 A;  1K28 A;  2HCI A;  4QUC A;  2GVB A;  5I4D A;  1DGS A;  2NN6 G;  4M8A A;  2VUG A;  3HFZ B;  4X65 L;  4JI8 L;  3S2H B;  5FLX c;  4HNU A;  3GV7 B;  2C2D A;  1F9Q A;  2YU9 A;  5EJW A;  4XXE A;  2R82 A;  3CU7 A;  1XTC D;  2UUA H;  4GNX B;  2A74 C;  1QE6 A;  4BBS B;  2FK1 A;  1CHQ D;  2NVY H;  4LF4 L;  2L9H A;  1IBK H;  2EE1 A;  5D65 A;  4LH6 A;  1OTC A;  1GJX A;  4DV0 Q;  3GTJ B;  1JXL A;  4MZ9 A;  4KK7 A;  1X3G A;  2F0S A;  4CGY B;  5M5W H;  1EOV A;  1D5X C;  4GLV B;  2UVV A;  2EXD A;  5JAV A;  3HOX G;  2YV5 A;  4JI7 H;  1VDZ A;  5C3X A;  2EZV A;  2F0K A;  1LTL A;  2YYA A;  2N88 A;  5C4X G;  3NUC A;  5A2Q E;  3CC4 A;  4LF9 L;  2ASL A;  3NEN A;  1DIK A;  2XNA C;  2Z9H A;  4EYI B;  4NXM L;  3CMA A;  3RN2 A;  4MV9 A;  4X62 H;  3Q8P B;  2FMC A;  3S1M B;  4U6P A;  1CZG A;  3C46 A;  1F2Z A;  3D4R A;  2R85 A;  4XYQ A;  4DK6 C;  3D6C A;  4IAL A;  2KOL A;  3OTO H;  4CBV A;  2R86 A;  2R8G A;  1SE3 A;  4U7C A;  1OXU A;  2QEX A;  1VQF A;  4B3R H;  1VQO A;  2K04 A;  1ILP A;  2FLN A;  1A8V A;  4K5V A;  5CGK A;  3RB4 A;  1H9J A;  3H0G B;  4BXX H;  2VQF Q;  2A8V A;  5CBA E;  1SNO A;  4KY5 A;  1HTP A;  4DK3 C;  2AHO B;  1YIT A;  3CKI B;  1WR2 A;  1IBM Q;  3TQ1 A;  2F0U A;  4A3E B;  4QIW A;  5DG7 A;  4PG3 A;  3CC7 A;  4JUZ A;  1E2V A;  4DR5 L;  4MTD A;  3I90 A;  1HNX Q;  3GTP A;  2F3I A;  4OEM B;  1Q90 A;  3FDS A;  1SYX B;  2NB0 A;  1PH6 A;  3SE7 A;  2J6S A;  4JI5 H;  5C0X J;  2PI2 A;  1G8Z D;  4C3J H;  1DZ1 A;  1PH7 A;  1JB3 A;  4DA2 A;  1DOK A;  2A73 B;  4KKT A;  4DNT B;  4PMC A;  4RKB A;  1VQG A;  3PO2 H;  3PZP A;  3RZD B;  3BU2 A;  1N34 L;  1TY0 A;  1IL2 A;  3RFC A;  3SVM A;  3R23 A;  3DXJ C;  4ZKC B;  3TZD A;  5KFK A;  2D2C C;  3DUZ A;  3VYR A;  1Y8N B;  1OWT A;  2VUM G;  2BQR A;  4IPG A;  4JYA L;  4U67 3;  2A69 D;  2JE6 I;  2ZXR A;  3H91 A;  4RHR A;  1ZYR D;  2BE5 C;  1S68 A;  4A3J H;  1HA6 A;  3UE0 A;  4LH7 A;  3WDN A;  1B53 A;  1ET9 A;  2GA4 B;  2KCN A;  4KY6 A;  3OHX C;  3OUU A;  3N44 B;  5CA1 F;  4F50 A;  4A3K H;  3OMC A;  3NPP A;  3KLW A;  1FVI A;  5IT9 c;  4K0K H;  2ZXP A;  3PUZ A;  5F9N A;  4C5A A;  4A3D H;  1FNW A;  2F4V H;  1K8O A;  1BJT A;  4HYK A;  3QWN A;  1R4Q B;  2X0S A;  3H15 A;  1ROD A;  1NNX A;  3PF4 A;  2EJG C;  5KG7 A;  2NVT H;  2UUB L;  2GPW A;  3OYY A;  2IL8 A;  5LMN Q;  3I4N G;  4O3Q A;  2JEI A;  1B33 N;  3NWS A;  1IBK L;  2R93 A;  3D3R A;  1PA6 A;  4R4Q A;  4GNX A;  4JBM A;  1QUQ B;  2FHT A;  5KYL A;  1HHV A;  3ZYY X;  4JI1 H;  4JI7 L;  4CJ1 B;  3NBH B;  1BNC A;  4F4X A;  1VQE A;  3M4I A;  5A35 A;  3HOU G;  4GC7 A;  3T56 B;  3DLL A;  5GAH C;  4ED8 A;  3NXW A;  5JEA J;  3JRW A;  4Q0Y A;  3OIQ A;  4EFE A;  5FJ8 G;  1S0O A;  3T5K A;  5KFY A;  4X62 L;  1PH3 A;  3S1Q B;  1XNR L;  1I3Q H;  2JK8 A;  3NQT A;  3OTO L;  1YI2 A;  3RB0 A;  4B08 A;  2Z0S A;  4UP8 A;  1BCP D;  1GYF A;  3GV6 A;  4H7B A;  4DV1 L;  2B3G A;  4RGN A;  2V58 A;  3T1H H;  1LO5 D;  1QVC A;  2UUC H;  4LK1 C;  3NTH A;  3E5N A;  2F0N A;  1HNW L;  4IUV A;  1VQN A;  1EUC B;  2F3W A;  2MP1 A;  5I6W A;  4HN7 A;  1YNJ C;  3CCE A;  4B3S Q;  3H4D A;  2K5W A;  3H0G A;  5K36 H;  5IP9 G;  2OH2 A;  2L12 A;  1WTX A;  2F0O A;  2UXD Q;  3FP9 A;  2MO0 A;  3CF5 A;  4JI5 L;  2UXC Q;  1SFO B;  4ECY A;  1GGO A;  5BN5 A;  2B63 B;  2WB1 E;  5KFU A;  2F0D A;  5L37 A;  1TT2 A;  1TWF B;  4DR6 H;  1DM0 B;  4B3T Q;  5KFL A;  4YWM A;  3F2C A;  1QVG A;  1I4R A;  2D62 A;  5C3W A;  3BVG A;  3KF6 A;  5HBR B;  2FPG B;  4CHT B;  4ULL A;  2G9H D;  1B50 A;  4A3K G;  2DNC A;  1X3P A;  5GRO A;  1K3B C;  1UUP A;  2NVQ H;  2BQ3 A;  2A68 D;  3J80 L;  4PDB A;  1XYI A;  2YU9 H;  3OW7 A;  1STY A;  3GTO A;  4RGO S;  3TSS A;  3I3C A;  2ALY B;  3EVQ A;  2W9B B;  1SXT A;  5I9P A;  3I4M B;  2RCF A;  2CH4 A;  2F4V L;  3HOZ H;  3S16 B;  5CA0 F;  2SOB A;  4JV5 L;  3GTQ B;  4DV2 Q;  2BH2 A;  3FKI G;  2VA3 A;  3I70 A;  1KHI A;  1NY4 A;  1ZEQ X;  1PH8 A;  5C1P A;  2EYF A;  1QZG A;  1EU4 A;  2Z8L A;  5HY6 A;  5TSS A;  4BY1 G;  2Y0S A;  1PK8 A;  1SNP A;  4DXF A;  3TZU A;  2JA6 G;  1C7Y A;  4DV5 H;  5KG1 A;  3I72 A;  2I80 A;  3PW0 A;  2CW7 A;  2B29 A;  4GKJ Q;  4Y52 H;  4CDD C;  2L15 A;  1D5Z C;  2WP8 J;  2NUA B;  4DR2 H;  4A76 A;  1L0Y B;  4YB8 B;  2XIG A;  3ETJ A;  3KJO A;  5KNC A;  1B4O A;  3PQI A;  1NSN S;  1ICW A;  3KBX A;  2LY7 A;  2FE3 A;  4RZR A;  1S5D D;  2EYP A;  2B2Y A;  3L4J A;  4LF5 H;  3JZI A;  3F1Z A;  2C28 A;  3N6X A;  1FNU A;  1E1O A;  4IPC A;  1BO0 A;  3L9A X;  1HA5 A;  3ONA B;  2UUC L;  4V0B A;  3M3Y H;  1JMC A;  1O78 A;  1UC8 A;  5EOY A;  2E2D C;  3GTP H;  1FJG L;  2YYZ A;  1EY9 A;  2QYZ A;  1STA A;  1OXX K;  1DON A;  3QO2 A;  4LF8 Q;  1E24 A;  2W71 A;  2Z4H A;  4R4O A;  3RZO H;  1WI5 A;  4GOP B;  1XMQ H;  3BA8 A;  1YNX A;  3OUZ A;  4L5S A;  4FXD A;  1A9X A;  4OX9 H;  1QVF A;  2UVU A;  4OON A;  2IX1 A;  2RQX A;  5HGQ A;  1UE6 A;  1EWH A;  1V9P A;  4CC6 A;  1MSH A;  4NPS A;  1CQV A;  3VR6 A;  1PX2 A;  5KFW A;  2K5V A;  1C30 A;  2QCP X;  4EQN A;  4X66 L;  1EQV A;  3BVM A;  1Z7T A;  4KHP H;  3PO3 G;  3HKS A;  3NP8 A;  1GHJ A;  2JXM B;  5CR3 A;  5IWA L;  5E4X A;  4DV6 L;  1L1O B;  2HDL A;  3GTG B;  1WCM B;  3AU7 A;  1W3S A;  3J81 i;  2G5D A;  5E1F A;  2IHF A;  5BPH A;  2UVW A;  1ZYR C;  5FOB B;  2P0A A;  2M2L A;  1VQ6 A;  1GVP A;  4KV6 A;  1J5E H;  4IFD I;  4AYB E;  2RDH A;  2BA0 A;  3AB9 A;  1WTP A;  3RIZ A;  4RMF A;  2R93 H;  4R8U B;  2CVR A;  4YCW A;  4A3I G;  2MPM A;  4IFD H;  2NU6 B;  2W9B A;  1TQO A;  4GC6 A;  1G2S A;  2F52 A;  1MKH A;  3U50 C;  2J6T A;  3JSN A;  1HZA A;  2PMZ A;  4ODG A;  3MFY A;  1VCI A;  3GTQ A;  1N33 Q;  4DAV A;  4IUR A;  2AUJ D;  2FK3 A;  4DV5 L;  1DOM A;  4K14 A;  1XPO A;  3BJU A;  3BAB A;  1IXR A;  2IT1 A;  3S1R B;  2VQE H;  1IBL Q;  2EY2 A;  2RDI A;  1EWI A;  1O7Z A;  2RA4 A;  3EN2 A;  1N48 A;  4A3F B;  3DEO A;  4JI0 H;  1O80 A;  5D3D A;  3H3V I;  2W70 A;  1FD7 D;  2CHB D;  3TDQ A;  3I56 A;  4DR2 L;  1ILQ A;  5M5W B;  3ICE A;  3HOV G;  1BR9 A;  4NMZ A;  3BQ2 A;  3H3V H;  3J81 c;  1GSA A;  3TII A;  1U9R A;  3T16 A;  1LTS D;  1PVO A;  1PFB A;  3LP8 A;  4DL5 A;  1DV1 A;  3JAM c;  4RWS C;  4DFA A;  4LF5 L;  4HJA A;  3RV4 A;  4G7O C;  4C3I H;  2IWH A;  5JVH 3;  3PIO A;  1JR0 D;  1SAP A;  4KJO A;  3H6M A;  2VZA A;  3H0G H;  3KLS A;  2WIN B;  4MV6 A;  4YP3 A;  1BVS A;  1PXU A;  4ALP A;  4Y7N H;  2Z6K C;  3MFG A;  4YJ3 F;  2HQE A;  5KT4 A;  2K5H A;  2R7F A;  1JOK A;  2VPQ A;  4HAE A;  1STG A;  3W1G A;  1GSO A;  3HKZ G;  1VQM A;  3S1N H;  3TQT A;  4RFB A;  2AGQ A;  4LUV A;  1ONL A;  1EFI D;  1LTA D;  4GKK Q;  5KG2 A;  4DR3 H;  1V1P B;  4DR7 H;  1ENA A;  1CHP D;  5KFC A;  4KHP L;  1LM0 A;  4C3J B;  3RZD H;  1K8G A;  4LMY A;  3PUY A;  4LJZ C;  2KUM A;  3EQL C;  4Q5V A;  4DV7 Q;  1AH9 A;  3PO2 B;  1E4G T;  1U0L A;  1YNN D;  3GTO H;  3OHB A;  5I9O A;  1BNZ A;  4JI2 H;  1L1O A;  4ABN A;  3U4V A;  3RJ0 A;  5K2M A;  4A3C H;  1QNU A;  1IHZ A;  1J5E L;  4A3J B;  1F9R A;  5EDW A;  4BBS G;  1Q1B A;  2I46 A;  1H9M A;  4EVO A;  4O2D A;  4DUY Q;  1CA5 A;  3WOE A;  4J9K A;  1VQJ A;  1I7L A;  1PTO D;  3FDT A;  2NZ1 D;  4A3D B;  1MGS A;  1TS4 A;  3TEH B;  2E5L H;  1Z6H A;  3G8C A;  5DLF A;  3KF8 B;  4CJ0 B;  4O4I F;  3JC6 6;  1CS0 A;  2HIX A;  5AFW A;  4LFA Q;  5K5P A;  2K1B A;  3I4L A;  1NMF A;  2W9A A;  1SR3 A;  3F2B A;  5KG6 A;  3S2D H;  1F2Y A;  1UEA B;  4LF7 H;  4QL5 A;  4DUZ Q;  4CKC A;  3MFI A;  4LFB L;  2VQE L;  1XMO L;  4C1N K;  4ZYS A;  1ESF A;  1WTQ A;  2KBN A;  4R4T A;  4ME3 A;  5FD5 A;  1T36 A;  3RNU A;  1IKM A;  3N40 P;  4G3I A;  3K5O A;  5ELC A;  1V51 A;  4O3P A;  4QWE A;  2KHS A;  3KDF B;  2ZDH A;  3CRK C;  3FRP B;  2BDN A;  4KD4 A;  4IPD A;  1I4G A;  1BF4 A;  4DAY A;  1N56 A;  3R8B A;  1PMR A;  1X3Q A;  3H0G G;  4IJH A;  5JJL A;  4O2A F;  1BCP F;  1STE A;  5EKL A;  4DAM A;  4LUZ A;  4A3E G;  2J6U A;  4P75 A;  4EQ5 A;  4ECZ A;  3W3A A;  5ELD A;  1I3Q B;  4ZUI A;  1F2M A;  2EOT A;  4DL6 A;  4NKL A;  1JE4 A;  5IYB H;  1NR2 A;  2Q2H A;  1RCV D;  2JA9 A;  1B1Z A;  2R7K A;  1AP0 A;  5KT7 A;  4DL7 A;  2J7Z A;  1VQ9 A;  5CV5 A;  3PW2 A;  4RG1 A;  4YHH L;  3M85 A;  2KQ3 A;  1CFM A;  5M5Y B;  1SMX A;  1J8I A;  5C5L A;  2C00 A;  1XPR A;  4N8F A;  3ER0 A;  3E6Z X;  1WD0 A;  2YZN A;  2AQ3 B;  1JJC B;  2YL2 A;  4RAZ A;  2FLL A;  3HOY H;  4DR3 L;  4OWT B;  1XNQ H;  4DR7 L;  3OIP A;  1UC9 A;  4MV7 A;  1X54 A;  4A3L G;  4JV1 A;  3PW7 A;  4YIJ A;  4UY8 C;  5KFR A;  1TII D;  4J8Q A;  1DXM A;  1ZXT A;  1A3T A;  1VMC A;  1PFN A;  3A8K E;  3FMC A;  1V1P A;  4UCR A;  4ME6 A;  4ED1 A;  3A56 A;  4CKE A;  2PNR C;  2V1C C;  3S9W A;  3JRX A;  2F0E A;  1GSH A;  1A62 A;  1I6V C;  4JBW A;  2E2H A;  1LUZ A;  4JV0 A;  4KN4 C;  4JI2 L;  2K75 A;  4H02 A;  4UCV A;  5KFT A;  1RK6 A;  4MHE A;  1VF7 A;  2WDT A;  1EEF D;  1IW7 C;  1WTV A;  2NVQ B;  3A5U A;  3CCQ A;  2ZDQ A;  5IGC A;  4DV0 H;  2W8L A;  4J1M A;  5I47 A;  1S0N A;  1HTL D;  2YU9 B;  1KDC A;  3KJP A;  2BH8 A;  3GTQ H;  5GON F;  4L5R C;  4UAI A;  2DJG C;  2W6Z A;  5JVD F;  3HOZ B;  1SNC A;  4MN3 A;  4I7H A;  5KFA A;  1PFS A;  1Z2N X;  2ALZ A;  4F88 A;  1M8A A;  3K0X A;  2W6P A;  1AZP A;  1L2Z A;  5M9O A;  1PZK D;  1FYC A;  2DZD A;  3KF8 A;  4EBE A;  1HR0 Q;  4NDX A;  3KHR A;  3UDF A;  4LF6 L;  1JJG A;  4ZQ3 A;  4OXP A;  2JEA I;  3RB3 A;  1PH9 A;  4LSX A;  3HP3 A;  5COY A;  3E3X A;  4DKA C;  2YZG A;  2K01 A;  2A6H D;  2VQF H;  5KFS A;  3VPD A;  4GN5 A;  3GD7 A;  4TVA B;  5EWG A;  3QG1 A;  1IBM H;  4ED7 A;  4GN4 B;  1G29 1;  1Y69 U;  2L1B A;  4P71 A;  5E4W C;  5IYB G;  2AUK A;  3BQ0 A;  1MHW C;  1CE8 A;  2PN1 A;  3J7A V;  2BCO A;  2UU9 Q;  3L4K A;  3RBE A;  1HNX H;  5EQ0 A;  5CV9 A;  1S5C D;  3S15 H;  1Y1W A;  3EBE A;  5KFB A;  2QKI C;  4PMW A;  1WJJ A;  4YY3 L;  1S72 A;  4DR1 L;  5LYJ F;  3OOC A;  1EOT A;  3PGZ A;  2WB1 A;  4M9U A;  3T13 A;  2B63 G;  3M3Y B;  4IO9 A;  5C3E H;  3R5F A;  4KD3 A;  3W2D A;  5FLX W;  2CW0 D;  4L6T B;  4KJN A;  3RZO B;  2NU7 B;  1D5M C;  1HNZ Q;  1AUX A;  5KG0 A;  4HIK A;  5L1I A;  1TWG B;  1W6K A;  2GVA A;  3V6H A;  3MXP A;  5KG4 A;  2JEF A;  1EYD A;  1LTI D;  1SYE A;  5KNB A;  2WAQ B;  4X64 Q;  2O5I C;  2V5A A;  1KC7 A;  2XN9 C;  5CV6 A;  1QNK A;  5JJK A;  5G3L D;  3GDE A;  3K3P A;  3OWE B;  1RJR A;  3T5J A;  3I4M G;  1M1K C;  3PV0 A;  1YNN C;  1XX8 A;  4IWY A;  4KKU A;  4DV4 Q;  5LMN H;  2B2T C;  1JDB B;  4ID6 A;  5BR8 Q;  2C9O A;  3D4W A;  3MA2 B;  1XNQ Q;  1QIL A;  4DPG A;  4C5B A;  1F9S A;  2I07 B;  2LSS A;  4DV0 L;  4R7R A;  3Q8S B;  4F4Y A;  3ULP A;  2AQ1 B;  4QGU A;  2EVB A;  4JI3 Q;  3M4O H;  2W9C B;  4WJW A;  1HZ9 A;  4FM9 A;  1VQ5 A;  2KJX A;  3AYH B;  1VQ8 A;  2XGT A;  1PTO C;  2AQ2 B;  2W6M A;  3D8G A;  2R93 B;  1SE8 A;  5KEE A;  4DN4 M;  4ECX A;  4IR9 A;  3GTM B;  4M7E A;  2R87 A;  1PTO H;  2CKZ B;  5GAE C;  3S1R H;  2XWJ B;  5FKA C;  1KEE A;  2K32 A;  1EIG A;  1KDA A;  1GUN A;  4A3F H;  4PWQ A;  2V4R A;  1UWV A;  4RU9 A;  2QDL A;  3I4O A;  3BS1 A;  5DGB A;  1SNM A;  4ILW A;  1CM9 A;  2RDG A;  4A3G B;  3GIK A;  4TQR A;  2VQF L;  4EGQ A;  3ERO A;  2I0Q A;  4JI4 Q;  3CQZ A;  4MV8 A;  1LTR D;  3D4D A;  5ELB A;  1IBM L;  4OEL B;  4B3S H;  2B2V A;  3J7Z C;  5KFN A;  1KL9 A;  3CME A;  5EBC A;  4U68 A;  2FPI B;  4OGQ C;  1GO3 E;  1HNX L;  4O4H F;  4A3M B;  1GD7 A;  3DEP A;  2O5J C;  2UXD H;  2NVX A;  2PQA A;  2UXC H;  5LP6 F;  3MJF A;  1KC8 C;  1HQR D;  4KKS A;  2AKW B;  1L0X B;  4A2A A;  1KAB A;  1I50 A;  4ED0 A;  4TV8 F;  1S03 G;  4WJ4 A;  4QUF A;  4C3I B;  3ND9 A;  3A0J A;  3QZ7 A;  5IT9 W;  1SSO A;  4B3T H;  3RLO A;  3TBI B;  1WYD A;  2QA4 A;  3M9O B;  4PZ7 A;  4X65 Q;  2HIV A;  2C35 B;  2TSS A;  3I91 A;  4KTA A;  4PQX A;  3I8Z A;  1RIP A;  4Y7N B;  1G6P A;  1M90 C;  1VQP A;  1BCP B;  3HOW H;  5KFV A;  3EYY A;  3S1N B;  1B6R A;  4JW0 A;  3T4A C;  1WCM G;  3KF6 B;  2RSN A;  4QF4 A;  1C0A A;  2E2H H;  1EZ1 A;  1TWG A;  3A8J E;  4NP5 A;  1E0B A;  2K7V A;  3ZJY C;  1WH2 A;  1TWC A;  1LT5 D;  1AZQ A;  2VXW A;  1VQH A;  4AYB A;  2WAQ A;  3CCL A;  3R3O A;  2CQO A;  4C3H B;  3KOJ A;  4ED2 A;  3R2I A;  4DV2 H;  2ASD A;  5J1Z A;  3RMH A;  3GTO B;  5D1O A;  2RDJ A;  1CKN A;  1RTO A;  4HNT A;  2E2J H;  3LML A;  4JC0 A;  3TIN A;  2JA7 A;  3RLF A;  1W2B A;  4GKJ H;  4DL2 A;  4KLK A;  3K5M A;  2NU8 B;  4WD3 A;  5IGE A;  1PTO F;  3ITP A;  1Z9F A;  1IYJ B;  5NUC A;  4QJF A;  2KEC A;  1IL8 A;  3BZC A;  4XIG S;  4DU9 A;  3M7N A;  3K81 C;  3V6J A;  4YBZ B;  4JCV E;  3A74 A;  1DD2 A;  5D14 A;  2LFN A;  1CKM A;  1DYQ A;  1RYS A;  1AN7 A;  4A3F G;  1NTG A;  2Y0S B;  5DQG A;  2UUA L;  2W9C A;  2W8K A;  2G9D A;  3DWA A;  3OWF A;  2ZTE A;  3K8A A;  3Q22 A;  3AFP A;  2CQA A;  5DLQ E;  2X69 A;  5KG3 A;  2YS6 A;  1N36 Q;  1EYG A;  1EEI D;  3C1F A;  4QCL A;  5H80 A;  2CH4 W;  1ZET A;  1TU2 B;  4R9W A;  3S2D B;  2M00 A;  2WFW A;  3GTM A;  3BDO A;  3RBD A;  3CPW A;  1HR0 W;  4EGV A;  2CQY A;  1GOZ A;  4ECU A;  1BBU A;  3AFQ A;  1A2U A;  5F2D A;  2R6G A;  2JQO A;  3NEM A;  5IP7 H;  3BYT B;  1N34 Q;  4GZY C;  2MJ8 A;  2A6H C;  1Y1W H;  4B3S L;  4LF8 H;  2WE6 A;  1IKL A;  2RBM A;  4DNI A;  3U9O A;  4WJ3 M;  4JYA Q;  2VB3 X;  1SYG A;  4BXX G;  5JVG 3;  5KFP A;  2R61 A;  1R9T A;  2EY1 A;  3F8N A;  4F7X A;  3VPC A;  4B3R L;  2FP4 B;  2EYM A;  5JPM C;  4B3T L;  3I2Z A;  3J80 E;  2SCU B;  1S10 A;  2L4N A;  1QWY A;  3UE1 A;  3HS0 C;  3VR2 A;  3MWD A;  3BZK A;  1VBH A;  3VA5 A;  3IKJ A;  1A2T A;  2V9W A;  3CXC A;  3VR4 A;  5M5Y H;  4JPB W;  2CW0 C;  4PV1 C;  4C3J G;  3NGD A;  2UUB Q;  4JG2 A;  1UEB A;  3K7A H;  1Z2P X;  2DN8 A;  5FLM H;  4OIJ A;  1JCK B;  4HCE A;  1CA6 A;  3PO2 G;  1JOO A;  4BY7 H;  1Q1E A;  3MXU A;  4AQY Q;  2ZJP A;  2EJF C;  1ZHS A;  3HOY B;  4X3S A;  5IGG A;  4LFC Q;  1ZQ7 A;  4Q44 A;  1PRT D;  2Z6K A;  3LNN A;  5EBD A;  4HJ7 A;  1MJE A;  4RGM A;  1AE2 A;  1I4P A;  3BQ1 A;  2RKS A;  4A3J G;  3GID A;  1GUS A;  5GAD C;  4DV2 L;  2JEG A;  2HVQ A;  2E74 C;  3SI8 A;  4NXN H;  3WO0 A;  4FF3 A;  3Q2O A;  3A7L A;  5C5J A;  1IYU A;  3UFX B;  1V1O A;  5CAE B;  1XNR Q;  1N33 H;  4A3D G;  3BVZ A;  3EPG A;  1QG7 A;  2WV6 D;  1D7Q A;  2L5T A;  4HJ9 A;  1ASZ A;  1KDB A;  4OHJ A;  4DV1 Q;  3DWQ A;  4GKJ L;  4K0K L;  1IBL H;  2IY5 B;  4LSA A;  1XTD A;  3N52 A;  5EAY A;  4DK0 A;  3ORR A;  3E5S A;  4ETS A;  3OMG A;  1I4H A;  2PMZ B;  2PW7 A;  5CBE E;  4EQO A;  3QZ8 A;  1RKN A;  5JPN C;  2W7P A;  5KFX A;  1YBY A;  1VQI A;  2I87 A;  4EX5 A;  4I50 F;  4EEQ A;  2ZJT A;  5JOB A;  2B2V C;  5DQI A;  4XT3 B;  3FPU B;  4S3S A;  5C6A A;  1ULZ A;  2HHH Q;  5C0X I;  4PZ8 A;  1S0M A;  3CQZ H;  3OW2 A;  4JBJ A;  3T53 B;  3WOF A;  4JI1 L;  5C0X H;  4B3M Q;  1RJT A;  4IR1 A;  5IOD A;  1LT6 D;  4BBR H;  3N8D A;  3KUP A;  5DG9 A;  2K14 A;  2NVX H;  4YR0 A;  4ZK9 B;  3PR5 B;  1WTO A;  2J4X A;  4DL4 A;  1I50 H;  2JA5 A;  5IY0 A;  2PO4 A;  3QB3 A;  5JH7 F;  4A93 H;  1IOW A;  4GKK H;  1EY0 A;  4QY7 A;  2OLS A;  2F0I A;  1V43 A;  3T1H L;  4NLG A;  3S15 B;  5M5X H;  1F77 A;  4KHZ A;  2BR0 A;  4IAJ A;  5K36 G;  1QJO A;  2SNM A;  1QCB D;  2DY7 A;  2SNS A;  4JV5 Q;  1JQY D;  2IW3 A;  2K52 A;  4DV7 H;  1H9S A;  5C3E B;  5FO8 B;  1T3N A;  4KY7 A;  1TWG H;  1X3E A;  1TWC H;  1C4Q A;  3GP7 A;  4EBD A;  1LV9 A;  1BBW A;  5EPK A;  4RHS A;  1KBL A;  4UHV A;  4J9N A;  1S97 A;  1O7I A;  4DR6 L;  4EBC A;  1N9W A;  5G3L F;  3MC0 B;  2BOS A;  2VQD A;  2V4D A;  2F0L A;  4DUY H;  4RA8 A;  1KLG D;  2YZM A;  1JB7 A;  1BOS A;  2JA7 H;  3J81 W;  3CVZ A;  4RB0 A;  4LFA H;  3VA7 A;  3NTK A;  5JEA H;  1Y1V A;  3TS0 A;  1IW7 D;  4MTK A;  3HOZ G;  3JAM W;  2ASB A;  3GTK H;  1JIH A;  2H1E A;  3P20 A;  4DUZ H;  5IGF A;  5EKI A;  3JAM i;  2B8G A;  5EPL A;  3LWU A;  3CPF A;  3N6R A;  3RUZ A;  1PYW D;  1FJG Q;  5M3F H;  4QIW E;  4CKB A;  3M4O B;  1M0W A;  3T1Y Q;  3GTL A;  2R7M A;  4NXN Q;  2Z1C A;  4P72 A;  3GTM H;  4DR4 Q;  3SR1 A;  4KMU C;  3G6J B;  1IYV A;  2F0H A;  4FU0 A;  4MV3 A;  1YZ6 A;  5CMD A;  4GLX A;  2OCE A;  5C0X G;  1VMP A;  5KYI A;  5KFM A;  1Q86 C;  1KJI A;  1EY4 A;  3TP5 A;  1ZHQ A;  3BG5 A;  3ULL A;  2F0P A;  1PTO B;  4F8M A;  5LMN W;  1Y8O B;  4X66 Q;  1GUW A;  1BXR A;  2R8I A;  1I5F A;  4H0L C;  5M3M H;  4A3G H;  3A55 A;  1JT8 A;  5FLX L;  1EIY B;  3OSP A;  4RB1 A;  5JUM A;  4DAY B;  4HR7 A;  4K2L A;  3HKZ E;  4DV6 Q;  2EY6 A;  5A2Q W;  1R9T H;  5DLG A;  2D0O A;  1E4F T;  2XC9 A;  4A3M H;  4GS3 A;  1TWA B;  3GIM A;  1TS2 A;  2AQ4 A;  4A3B H;  2XCA A;  4A4I A;  1MSG A;  3R5H A;  2D5D A;  3X3N A;  3DHQ A;  3URY A;  3S24 A;  4MAM A;  4IUT A;  1AN8 A;  5DM7 3;  1EU3 A;  2ZM6 Q;  2K03 A;  1WD1 A;  3SXH A;  4DV7 L;  4BA2 I;  2DGY A;  2WAQ G;  4LAA A;  4XQQ A;  2AGP A;  1XMQ L;  1I94 Q;  3M4P A;  1CUK A;  4H44 C;  4BA1 I;  4OX9 L;  1WTR A;  4GN3 B;  2ZJR A;  2K05 A;  5LXT F;  1FNV A;  1TWH H;  4C56 C;  3HOW B;  2PYK A;  3VYT A;  3RB6 A;  5FPR A;  4JI6 Q;  3I55 A;  1VQ4 A;  1STB A;  2Z6B A;  2EPB A;  2QF7 A;  2EYJ A;  2F0G A;  2NTS A;  5IYD H;  1U4M A;  4FBU A;  1UNN C;  1ESR A;  4DUY L;  1PRT C;  2E2H B;  4C3H H;  2JJQ A;  4A75 A;  3V05 A;  1XXG A;  3W5O A;  2R7L A;  3I7F A;  4IUU A;  1RJP A;  4DAP A;  4DV3 Q;  4LFA L;  4IWX A;  2F0W A;  2QW7 A;  1EL0 A;  3B6Y A;  1YJ9 A;  1IZ6 A;  1O75 A;  4ECR A;  4MA5 A;  3SK8 A;  2R93 G;  3BYY B;  1HR0 H;  1GLV A;  1ZKO A;  2HCC A;  3QOL A;  5C4H A;  5LOV F;  4IFD G;  4PZ6 A;  4GLA C;  4HCS A;  1GUO A;  3KFU A;  4J9Q A;  3CCR A;  2E2J B;  1E2Z A;  5DQH A;  2K6A A;  3LGJ A;  5ELO A;  4RAY A;  3I73 A;  3UQ8 A;  3TRE A;  2Q2I A;  5LMU H;  2B2T A;  3L3O C;  4F4Z A;  4A3G G;  4KHV A;  1K1S A;  4QWD A;  3KK7 A;  5KND A;  5KT6 A;  4TQU S;  2UU9 H;  5IT9 L;  3HZX A;  4QMG A;  1I4Q A;  3PF5 A;  3K6O A;  3C1E A;  4JI0 L;  4RNN A;  4I7Z C;  2JA5 H;  4A2B A;  4A3M G;  1MBY A;  2AWN A;  1PYB A;  2DIK A;  1SND A;  4QWA A;  2GN5 A;  3ULJ A;  2MFI A;  1U4R A;  5IYC H;  4QW8 A;  4C3I G;  4WBN F;  2VUM A;  3BG3 A;  3PIO 3;  3K5N A;  2K5Q A;  4G7H C;  1Y1W B;  1NUC A;  3G48 A;  1HNZ H;  3DF7 A;  4X3T A;  2WB1 B;  1N32 Q;  1MJC A;  4OWX B;  2E8G A;  1TWA A;  1LT4 D;  1S5F D;  1HUM A;  1S5B D;  5CV8 A;  1ET6 A;  4RB2 C;  3JSL A;  1Y8P B;  2C5C A;  3SK6 A;  4X64 H;  2K5N A;  4POG A;  5J39 A;  1WVL A;  1I6H B;  1EQQ A;  2XCP A;  3J80 i;  2R92 H;  2V59 A;  2JEJ A;  1E2W A;  1II3 A;  3S14 B;  2H5X A;  1SCU B;  1B3Q A;  2Y0S E;  2TMP A;  1AW7 A;  1O7Y A;  4YJ2 F;  3IN5 A;  4DV4 H;  1C9O A;  3BAA A;  1CKO A;  4WFN 3;  1I6U A;  3K7A B;  3R2T A;  1K83 H;  4C3H G;  5BR8 H;  1SE2 A;  4LFB Q;  1XMO Q;  1PRT F;  2MCT A;  4E4T A;  2JA8 H;  1VAJ A; 
#chains in the Genus database with same CATH homology
 3S1R H;  3G6E A;  5IWA Q;  1K73 C;  3L0O A;  5IP9 G;  4A3F H;  1Y1V H;  4A93 G;  2UXD Q;  3FP9 A;  2MO0 A;  3CF5 A;  4JI5 L;  4BBS H;  1UWV A;  1I94 L;  2UXC Q;  3I4O A;  4A3C G;  5C44 H;  2WB1 E;  5AJ3 Q;  1WFQ A;  3GTJ H;  4AIM A;  1NJI C;  4JI6 L;  2VQF L;  2I0Q A;  4B3T Q;  4JI4 Q;  4YWM A;  3F2C A;  4GKK L;  1QVG A;  1IBM L;  1YHB A;  2D62 A;  3KF6 A;  3J7Z C;  2KCM A;  1KL9 A;  1HR0 L;  3CME A;  2Y0S G;  1GO3 E;  1HNX L;  3GTL H;  1GD7 A;  1X3F A;  3WWV A;  1D8L A;  2PQA A;  2D0P A;  3J80 c;  4A3K G;  1U5K A;  2ZTC A;  1KC8 C;  5GRO A;  4AYB G;  2AKW B;  2KCT A;  2NVQ H;  4WJ4 A;  4DV3 L;  3RN5 A;  4LNQ A;  3S1M H;  3CCM A;  2JEB I;  3A0J A;  2E5L L;  4YHH Q;  2YU9 H;  3RLO A;  2OWO A;  1WYD A;  3K7U C;  2QA4 A;  4PZ7 A;  3PIP A;  4X6A H;  4X65 Q;  2ALY B;  4DV5 Q;  2HIV A;  2C35 B;  4QQB X;  3G71 A;  5IE8 A;  2F4V L;  3HOZ H;  1Y14 B;  1RIP A;  1K0R A;  1X65 A;  4LF7 L;  1G6P A;  2UU9 L;  1PH5 A;  1M90 C;  1VQP A;  3HOW H;  2JA7 G;  4JV5 L;  4XTC S;  3L2P A;  4DR2 Q;  1MIU A;  4DV2 Q;  5ELN A;  3FKI G;  2BH2 A;  2YTY A;  5JEA G;  1KHI A;  1NY4 A;  1PH8 A;  3MXN B;  4A3E H;  1QZG A;  5HY6 A;  1WCM G;  3KF6 B;  1C0A A;  4BY1 G;  2E2H H;  2ATW A;  2JA6 G;  1UE1 A;  3MEF A;  2NN6 I;  1C7Y A;  3ZJY C;  4OWW B;  3K80 C;  5LMU Q;  2CFM A;  2PQA B;  4GOP A;  2B29 A;  1VQH A;  4GKJ Q;  4LF5 Q;  4Y52 H;  4DUZ L;  5M3F G;  3CCL A;  3UDX A;  2L15 A;  2CQO A;  2WP8 J;  1HNZ L;  3KOJ A;  2MQH A;  4A76 A;  3M4Q A;  1XJV A;  4O0A A;  1FGU A;  3KJO A;  3ERS X;  1Q46 A;  1CKN A;  1K8A C;  3M9B A;  4X64 L;  4A3L H;  2E2J H;  4JC0 A;  1XMQ Q;  3RLF A;  1W2B A;  3PCO B;  4KLK A;  4OX9 Q;  3F1Z A;  1Z9F A;  1IYJ B;  5M3M G;  4QJF A;  4XIG S;  1E1O A;  3BZC A;  4IPC A;  3CCU A;  3HOY G;  3K81 C;  3M7N A;  2VNU D;  2NZO A;  4JCV E;  3A74 A;  1NMG A;  1PH2 A;  2UUC L;  1CKM A;  3HOX H;  3M3Y H;  1N32 L;  1JMC A;  4OO1 I;  4A3F G;  1NTG A;  3GTP H;  2UUA L;  2A1A A;  2YYZ A;  1FJG L;  4KHP Q;  1P8L A;  2UXB Q;  2ZTE A;  1OXX K;  1VQD A;  3K8A A;  1XNQ L;  1X56 A;  1QZH A;  1KXL A;  1RL2 A;  4LF8 Q;  1E24 A;  3PUX A;  3AFP A;  1PYS B;  1SLJ A;  3PUW A;  1WI5 A;  4R4O A;  4GOP B;  4GOP C;  4LF6 Q;  3RZO H;  5DLQ E;  1H95 A;  3PSI A;  4A3B G;  1YNX A;  4L5S A;  1N36 Q;  1EYG A;  4JI3 L;  1QVF A;  1JJ2 A;  4OON A;  2IX1 A;  1B8A A;  2WFW A;  2OQ0 A;  5HGQ A;  1UE6 A;  1V9P A;  3CPW A;  2ZJQ A;  4NPS A;  1HR0 W;  2K5V A;  1Q82 C;  3CC2 A;  2NZH A;  1BBU A;  1CKN B;  3AFQ A;  4X66 L;  4HID A;  2R6G A;  2JQO A;  3NEM A;  5IP7 H;  1N34 Q;  3PO3 G;  4R1J A;  1B70 B;  1Y1W H;  3S17 H;  4B3S L;  3HKS A;  3IRB A;  1E1T A;  1PH1 A;  1J5E Q;  4DNI A;  5IWA L;  4YCU A;  1VQA A;  3DM3 A;  4DV6 L;  2Q2T A;  1L1O B;  3AQQ A;  4JYA Q;  4WJ3 M;  1L2F A;  1UE7 A;  5J3B A;  2N49 A;  2LXK A;  4BXX G;  1W3S A;  4P74 A;  3J81 i;  5AJ3 L;  1Q8K A;  5GAG C;  2IHF A;  1Q7Y C;  2OTL A;  3S1Q H;  4B3R L;  4LWC A;  4B3T L;  4JI4 L;  3I2Z A;  5IYD G;  3UE1 A;  1VQ6 A;  1GVP A;  4R4C A;  3BZK A;  4IFD I;  4AYB E;  1GM5 A;  2BA0 A;  3CXC A;  2VQE Q;  3RLN A;  2K4K A;  5M5Y H;  4JI0 Q;  4RMF A;  1KIX A;  2UUB Q;  2CWP A;  4JG2 A;  1UEB A;  3K7A H;  2R93 H;  5JJI A;  4YCW A;  4A3I G;  2I5L X;  2MNA A;  5FLM H;  1Q12 A;  1A63 A;  2F52 A;  1MKH A;  3U50 C;  2VUM H;  4HJ8 A;  3PO2 G;  1HZA A;  4BY7 H;  1P16 A;  1Q1E A;  4POF A;  1VCI A;  1LYL A;  2ZJP A;  4MTN A;  4AQY Q;  2KEN A;  1YJW A;  1N33 Q;  1VQB A;  1KD1 C;  1SRU A;  4UP7 A;  4LFC Q;  4DV5 L;  1SFO H;  2LXJ A;  5E7N A;  1XPO A;  3BJU A;  2Z6K A;  3FHW A;  1TWA H;  1KRT A;  1IXR A;  2IT1 A;  4HJ7 A;  1PHJ A;  1MJE A;  1IBL Q;  2B63 H;  1EWI A;  1AE2 A;  3EN2 A;  2VW9 A;  2VL6 A;  1TWF H;  1PH4 A;  3H3V I;  4DR2 L;  2DUD A;  3I56 A;  5GAD C;  4DV2 L;  4A3J G;  1JE5 A;  1S40 A;  3ICE A;  3HOV G;  5C3E G;  1YIJ A;  1SRO A;  4HJ5 A;  3J81 c;  3H3V H;  3U58 A;  3CCV A;  1XNR Q;  3CAM A;  4A3D G;  3I4N H;  3TS2 A;  1D7Q A;  1PVO A;  4L5T A;  4HJ9 A;  5LMU L;  4LW1 A;  3JAM c;  1ASZ A;  4GKJ L;  1EIF A;  4DV1 Q;  4LF5 L;  4K0K L;  4HJA A;  4YWK A;  1SN8 A;  2MO1 A;  3F8T A;  4JI8 Q;  2JA5 G;  2IY5 B;  4C3I H;  1XTD A;  2YTV A;  5EAY A;  5GQO A;  3PIO A;  4OO1 G;  4LUO A;  4DR3 Q;  2VZA A;  3H0G H;  4KI0 A;  4DR7 Q;  1BVS A;  4ALP A;  5IYC G;  3HOU H;  3J7A 5;  1YEZ A;  3E9H A;  4LF4 Q;  3I4M H;  3S16 H;  1YBY A;  1VQI A;  3L7Z C;  1X9N A;  4EX5 A;  2Z6K C;  4Y7N H;  3CP0 A;  3RR5 A;  4NB3 A;  2R7D A;  2K5H A;  2PNH A;  2R7F A;  3TQY A;  5FJ8 H;  2HHH Q;  2KHI A;  5C0X I;  2FXQ A;  3W1G A;  4PZ8 A;  3HKZ G;  3CQZ H;  1VQM A;  3OW2 A;  3S1N H;  4JBJ A;  2XTI A;  4IJL A;  2RHS B;  4LUV A;  4JI2 Q;  4JI1 L;  4AH6 A;  4C2M H;  4B3M Q;  4GKK Q;  2R7Z G;  4BBR H;  4HIM A;  3A5Z B;  2AMC B;  2K14 A;  4LF9 Q;  4KHP L;  1LM0 A;  2NVX H;  2UXB L;  2R92 G;  2RCN A;  5LMN L;  3RZD H;  1TXY A;  3PUY A;  1K8G A;  4NXM Q;  1I50 H;  2RHQ B;  3U4Z A;  2EIF A;  1CSP A;  1HJP A;  1VQC A;  1YVC A;  5IY0 A;  1N36 L;  4DV7 Q;  1EFW A;  2IHE A;  1AH9 A;  1U0L A;  3GTO H;  1G51 A;  2E2I H;  5IP9 H;  1AE3 A;  5H1S E;  3J81 j;  2E5L Q;  4YCV A;  4A93 H;  2HT1 A;  2EQS A;  2PMZ E;  4QY7 A;  4IPH A;  1L1O A;  1OXT A;  3U4V A;  2JA8 G;  1V43 A;  3T1H L;  5M5X H;  4A3C H;  4KHZ A;  3KDF A;  3STB D;  1X6O A;  4DV4 L;  3UDI A;  1XPU A;  4IOC A;  5K36 G;  1J5E L;  3CW2 C;  4LF7 Q;  1Y1V G;  5BR8 L;  1HH2 P;  4BBS G;  4JV5 Q;  1Q1B A;  5C4X H;  3GO5 A;  2K52 A;  4DR5 Q;  1YJN A;  2N8N A;  4O2D A;  4DUY Q;  5C44 G;  3CCS A;  1BKB A;  1VQJ A;  1TWG H;  1X3E A;  3TEH B;  1TWC H;  1UE5 A;  3KF8 B;  1WOC A;  2IX0 A;  3JC6 6;  2HIX A;  4LFA Q;  1OXS C;  2Q2U A;  1NMF A;  2CWA A;  1BBW A;  1SR3 A;  2VS1 A;  4L5Q A;  4J15 A;  3F2B A;  3W1B A;  3S2D H;  1O7I A;  4DR6 L;  4QL5 A;  4DUZ Q;  1N9W A;  4LFB L;  2VQE L;  1XMO L;  2K50 A;  2KBN A;  4R4T A;  1K9M C;  3F2D A;  4JOI A;  4ME3 A;  3RNU A;  1KAW A;  1JB7 A;  3E0E A;  1L1O C;  4YY3 Q;  2UXD L;  2JA7 H;  4JBK A;  3UDG A;  2UXC L;  4DR1 Q;  3KDF B;  3FKI H;  1KQS A;  4IPD A;  4AQY L;  1VQL A;  3TS0 A;  2VY3 A;  1KRS A;  3HOZ G;  4LFC L;  2ASB A;  3GTG H;  3GTK H;  1I6H H;  3HOW G;  1WCM H;  3H0G G;  4BY1 H;  2ZTD A;  4IJH A;  3JAM i;  5JJL A;  2JA6 H;  3S14 H;  4DAM A;  3CPF A;  4LUZ A;  4A3E G;  2OTJ A;  1NE3 A;  1B7Y B;  4P75 A;  4EQ5 A;  1K3R A;  1V1Q A;  2UUA Q;  1FJG Q;  5M3F H;  3D0F A;  2KHJ A;  4QIW E;  5IYB H;  3T1Y Q;  3AEV A;  2Q2H A;  2JA9 A;  4NXN Q;  1E22 A;  4P72 A;  1IBK Q;  3GTM H;  4DR4 Q;  4MNO A;  1VQ9 A;  1YZ6 A;  4GLX A;  4RG1 A;  2OCE A;  5C0X G;  4YHH L;  4JOI C;  3M85 A;  2GVB A;  1DGS A;  2NN6 G;  1Q86 C;  1HZC A;  3HFZ B;  4X65 L;  4JI8 L;  5FLX c;  3ULL A;  4JI7 Q;  4IFD J;  1SMX A;  5LMN W;  1XPR A;  4X66 Q;  3ER0 A;  4P73 A;  1JJC B;  4GNX B;  1I5F A;  2I5H A;  4OWT B;  4YWL A;  5M3M H;  2A19 A;  4DR3 L;  3HOY H;  4DR7 L;  4A3G H;  1JT8 A;  1X54 A;  1EIY B;  4A3L G;  2NVY H;  4LF4 L;  4DAY B;  1X55 A;  4UY8 C;  3HKZ E;  4DV6 Q;  1OTC A;  4DV0 Q;  1R9T H;  2D0O A;  4X62 Q;  4MZ9 A;  2HHH L;  4A3M H;  1X3G A;  4GS3 A;  5M5W H;  3OTO Q;  1EOV A;  2V1C C;  4GLV B;  2EXD A;  3HOX G;  2YV5 A;  4APV A;  1A62 A;  1YHA A;  4JBW A;  4A3B H;  4B3R Q;  1LUZ A;  1CSQ A;  1LTL A;  4JI2 L;  2K75 A;  4H02 A;  1YHQ A;  4A4I A;  4B3M L;  1VS0 A;  2HQL A;  5C4X G;  3CC4 A;  4LF9 L;  4UPA A;  3NEN A;  3SGI A;  1HNW Q;  3S24 A;  4NXM L;  3A5U A;  3CMA A;  3CCQ A;  3RN2 A;  1S3O A;  2ZM6 Q;  3PO3 H;  4DV7 L;  3KJP A;  4DK6 C;  4BA2 I;  2WAQ G;  2DGY A;  2BH8 A;  3GTQ H;  1XMQ L;  4L5R C;  4JI5 Q;  1OXU A;  1I94 Q;  2QEX A;  1VQF A;  3M4P A;  1CUK A;  1VQO A;  4BA1 I;  4OX9 L;  3NEL A;  5IP7 G;  5C4J H;  2RF4 A;  4GN3 B;  1A8V A;  1PFS A;  1EQR A;  1TWH H;  2ZJR A;  1Y1W G;  4BXX H;  3K0X A;  2YTX A;  2VQF Q;  1ASY A;  4JI6 Q;  3I55 A;  1VQ4 A;  2A8V A;  4DK3 C;  2AHO B;  1YIT A;  2WB1 G;  1IBM Q;  3CD6 A;  2ES2 A;  4PG3 A;  1VQ7 A;  3CC7 A;  1HR0 Q;  3UDF A;  4DR5 L;  5IYD H;  4LF8 L;  4LF6 L;  4DUY L;  1HNX Q;  1JJG A;  4OXP A;  4C3H H;  2JJQ A;  2CCZ A;  2F3I A;  2JEA I;  4A75 A;  1PH6 A;  1PH9 A;  5C0X J;  2PI2 A;  3W5O A;  4C3J H;  2OQK A;  3I7F A;  4HIO A;  1PH7 A;  4DKA C;  4A3I H;  4DV3 Q;  4LFA L;  1E7Z A;  2I5M X;  3B6Y A;  3GD7 A;  4GN5 A;  1YJ9 A;  3TRZ A;  1IZ6 A;  4TVA B;  1VQG A;  3PO2 H;  4K0K Q;  3BU2 A;  3PUV A;  4GN4 B;  1N34 L;  1G29 1;  2R93 G;  1IL2 A;  1Z47 A;  2ID0 A;  4P71 A;  5IYB G;  3VDY A;  1EUJ A;  2F4V Q;  4IFD G;  1QUQ A;  5FLM G;  3CCJ A;  4PZ6 A;  2UU9 Q;  4GLA C;  3KYH C;  5GAE C;  3KFU A;  1FL0 A;  3CCR A;  2VUM G;  4IPG A;  3S15 H;  3EBE A;  4BY7 G;  3LGJ A;  5ELO A;  1WJJ A;  4PMW A;  4YY3 L;  4JYA L;  2JE6 I;  3Q8D A;  2N3S A;  1L0W A;  3TRE A;  4DR1 L;  1S72 A;  4A3J H;  2Q2I A;  1E3P A;  2AWO A;  3EIV A;  3PGZ A;  3UE0 A;  4A3K H;  3HOV H;  2B63 G;  3KLW A;  5C3E H;  1FVI A;  4IO9 A;  5IT9 c;  3PUZ A;  4A3G G;  4A3D H;  1HZB A;  4TQU S;  4JI1 Q;  4R4I A;  3H15 A;  3PF5 A;  1HNZ Q;  4HIK A;  3PF4 A;  4JI0 L;  2JA5 H;  2NVT H;  2GVA A;  2UUB L;  4IOA A;  4A3M G;  2N78 A;  3OYY A;  3T1Y L;  2AWN A;  5LMN Q;  1PYB A;  3I4N G;  4NXN L;  1OXV A;  1IBK L;  4DR4 L;  1J6Q A;  1PV4 A;  2GN5 A;  3ULJ A;  1PA6 A;  4X64 Q;  4R4Q A;  1GKH A;  2MFI A;  4GNX A;  5IYC H;  4JBM A;  1QUQ B;  1N33 L;  1Q81 C;  3D31 A;  1N8R C;  5JJK A;  4JI7 L;  3GDE A;  2BA1 A;  4FDB A;  3NBH B;  3G48 A;  1VQE A;  1NBW A;  1IBL L;  3I4M G;  1M1K C;  3PV0 A;  3HOU G;  3T1H Q;  1A0I A;  1T9H A;  3DLL A;  5GAH C;  2UUC Q;  1N32 Q;  1MJC A;  4OWX B;  2E8G A;  5JEA J;  4DV4 Q;  5BR8 Q;  5FJ8 G;  4UP9 A;  1XNQ Q;  3G4S A;  4DPG A;  4DV0 L;  2LSS A;  3STB C;  2K5N A;  4X62 L;  1PH3 A;  4POG A;  1XNR L;  1EQQ A;  3J80 i;  2R92 H;  1I3Q H;  2JK8 A;  3ULP A;  4QGU A;  3OTO L;  1YI2 A;  1VQK A;  4JI3 Q;  3M4O H;  2PI2 E;  2Z0S A;  2H5X A;  4UP8 A;  1HZ9 A;  4BBR G;  4DV1 L;  2Y0S E;  2B3G A;  1VQ5 A;  3AYH B;  1VQ8 A;  2XGT A;  1QVC A;  2QGQ A;  1C9O A;  1CKO A;  4GNX C;  1VQN A;  1SE8 A;  4DR6 Q;  1K83 H;  1HNW L;  2R7Z H;  2WAQ E;  4LFB Q;  3S2H H;  1XMO Q;  3CCE A;  4B3S Q;  2JA8 H;  2ZM6 L;  2CKZ B;  3E9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...