4A3JH

Rna polymerase ii initial transcribing complex with a 2nt dna-rna hybrid and soaked with gmpcpp
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3jH00
4A3EH 2ZJPA 4C3HH 3JAMc 1TWGH 4HIOA 4JI4Q 4BA2I 4DR6L 4JBMA 3GTJH 1V9PA 3BZKA 4QL5A 4LF7Q 1FVIA 3AEVA 3GTQH 5IY0A 4AQYL 2PI2A 2CFMA 2R93G 1VQ8A 4R4IA 3T1YL 1VQLA 3I55A 5LMNL 4POFA 3H3VH 4LF6L 2UXCL 4YCUA 4JI0L 4L5TA 4H02A 3GTMH 2PMZE 5FLMH 1YI2A 1IBKL 4JYAL 5GADC 3KDFB 5M3MH 4OO1G 5JJIA 2JA8H 3PO3H 1VQMA 2JJQA 4LF8Q 2RCNA 3M7NA 1N32L 1FJGL 2UXDL 2QEXA 3OTOQ 5JEAG 1EUJA 4XIGS 2Q2HA 1NMGA 3CC2A 2D0OA 4JCVE 2JQOA 3L0OA 1Y1VH 3W5OA 1SE8A 5C0XG 2Z6KC 3I56A 3RZOH 4BY1H 1VQBA 5HGQA 4QGUA 3TRZA 2IHEA 2OQ0A 4OWWB 2VUMG 3UDXA 5GROA 2VQFL 4DR7L 4PZ7A 4A3JG 3FKIG 3GTKH 4TQUS 3PV0A 1YITA 1X3EA 2XGTA 4A3IH 3STBC 1E1TA 4DV1L 1I94L 1EQRA 1VQAA 3K7AH 4BXXG 3PUVA 1N36L 3I4MG 4GLVB 2PI2E 3PO2G 4LF5Q 4OWXB 5IYCH 1VQNA 4JI6L 3AQQA 2A1AA 1E22A 3PGZA 3CXCA 4OX9Q 4B3RL 2ZTEA 2F52A 2KENA 2R7DA 3K80C 4A3JH 4BY7G 1SFOH 2AWNA 4DV5L 4LFCQ 4DR7Q 4DUYL 4X6AH 4X65Q 2K5VA 2Q2UA 1B8AA 4DUZQ 1G51A 2OTJA 2JA9A 1CSPA 1YZ6A 4DV1Q 1VQJA 1HZCA 3EIVA 3UDFA 4DKAC 3HOXG 4APVA 4J15A 4LF4L 1BBWA 4A3CH 2F4VQ 4YWMA 4PZ6A 1A62A 1QZHA 1Q82C 1FL0A 3NENA 1CUKA 1EOVA 3PUXA 1KHIA 1HZ9A 3NELA 2AWOA 4DAMA 1OXSC 3PUWA 1HR0L 4IPGA 4GNXA 1HZBA 4C3IH 1VQ6A 4DUYQ 2IY5B 2I5HA 4A4IA 1WOCA 3K8AA 2CQOA 4JOIC 4LUVA 4C2MH 4DNIA 4MZ9A 4X65L 3J7ZC 4DV7Q 2B63G 4A3DG 1EQQA 1VCIA 4KHPL 2JK8A 4DV0Q 2UU9L 3NBHB 1IL2A 1MJCA 3PIPA 4JBWA 4R4QA 1ASZA 4MNOA 4IJLA 3A0JA 4JI7Q 4RMFA 4A3EG 4GLAC 1AE3A 1MIUA 2Q2IA 1LYLA 4OONA 4P73A 2ZM6Q 3CD6A 4UY8C 4A3GG 2UUBQ 4IFDI 1XMOQ 2YYZA 2PQAB 4QY7A 1G291 2QGQA 4DR3L 1QVGA 4HJ7A 4BY7H 1A63A 1QVFA 4QQBX 4IJHA 4YY3Q 4JI1L 3VDYA 1O7IA 1WI5A 4A3LG 4KHPQ 3UDIA 2NVXH 3CCJA 4LFBQ 4DV4Q 3HFZB 4DR2L 4JG2A 3S1MH 4DR4Q 4L5SA 2MNAA 4B3ML 1NTGA 1WFQA 2LXKA 1M90C 1VQHA 2R92G 3HKZE 4DK3C 2NVTH 1VQDA 2UUBL 1TWAH 1V43A 3LGJA 5IP9G 1XNQL 4YHHL 3ULJA 5ELOA 2EQSA 2HHHL 4DV2L 3G4SA 4K0KQ 3S17H 4GKJQ 4DV3L 3BU2A 2AKWB 5EAYA 1B70B 5IYBG 1JT8A 3K7UC 3J7A5 4PZ8A 1VQ9A 3AYHB 4JI5Q 1UWVA 1SRUA 4NPSA 3PO2H 3HOUG 1E24A 2JA8G 3RNUA 1XNRQ 4JV5L 2KCTA 2MQHA 3T1HQ 1YHBA 4UP9A 2ZTDA 4BXXH 5FLMG 3CCEA 3TS0A 2N49A 4DPGA 4JYAQ 2F3IA 1K73C 2A8VA 3RR5A 5K36G 4YWKA 4HJAA 3HOYH 2R93H 4OWTB 1PA6A 2D0PA 3W1GA 3CCUA 2B29A 2VUMH 5C44G 5JJKA 4LF9Q 4XTCS 1SMXA 4X62L 2HIXA 5BR8Q 3ULLA 4LUZA 2JA6G 2CCZA 2PQAA 4BY1G 1LM0A 5C4JH 4UP7A 4IO9A 2WAQE 1HZAA 1Y1WG 1C0AA 1K8AC 2BH8A 5C0XI 2R92H 3T1HL 2OCEA 3KF6A 3JC66 1N34L 1OXUA 2GVAA 1KIXA 2K50A 3S1NH 1HJPA 5IYDH 2MFIA 2QA4A 4A3BG 3F2BA 3S1QH 2R7FA 3CP0A 2NN6G 3F8TA 3S15H 5BR8L 1AH9A 4GN3B 2JA7G 1PH8A 4BA1I 2WB1E 2K52A 4B3RQ 4JI6Q 1PH2A 1X55A 4JI8L 3M4QA 2XTIA 2MO1A 4LFCL 3J81j 4AIMA 2KHIA 2R6GA 4B3TL 1FJGQ 3RN5A 2E5LQ 3J80i 1PVOA 1I3QH 2BA1A 1QUQA 1WJJA 3SGIA 3WWVA 5DLQE 5M5XH 4R4OA 1RL2A 2JEBI 1HNWL 3IRBA 4DV6Q 4FDBA 3HOWG 3CPWA 1GKHA 3A74A 2I5LX 1VQIA 4KLKA 4L5QA 1PH9A 2R7ZG 1HNXQ 4NXNQ 4AQYQ 1D7QA 2EXDA 4IPCA 4JI2L 2HIVA 1UE5A 2I5MX 1PH3A 3NEMA 5M3FG 4RG1A 4KI0A 2K5NA 4JI0Q 1A8VA 3D0FA 4HIMA 3FHWA 1MKHA 5J3BA 4EQ5A 4DV0L 5GAGC 2UU9Q 2LSSA 4JBJA 3G71A 3RN2A 1ASYA 2ZJQA 1LTLA 3CCMA 1W2BA 1Q8KA 1X65A 3K0XA 3JAMi 4LFAQ 3J80c 2ES2A 4LF8L 1WCMH 1IYJB 1Q12A 3CPFA 4X64Q 1X3GA 3H15A 4DV5Q 1X6OA 4JC0A 1JMCA 1WCMG 2ALYB 4DUZL 2N8NA 3A5ZB 1K3RA 5IP7G 1PYSB 3CF5A 3D31A 1OXTA 3KJOA 4A3IG 1E1OA 1IBML 5GAHC 3UE0A 5M3FH 2KBNA 3KDFA 4IPHA 3FKIH 4B3SL 4LW1A 2UUAQ 4GKKQ 4P75A 5FJ8H 2WAQG 2BH2A 2YU9H 1VQOA 4A76A 5ELNA 4LFAL 2AHOB 4OXPA 1YJ9A 4OO1I 4R4CA 3ICEA 3PSIA 4PMWA 1EFWA 4A93G 4AYBG 1N33L 2AMCB 1Y1VG 2D62A 3E9HA 1HR0W 1DGSA 3S24A 2Z6KA 3PF5A 5M5WH 4HJ9A 3HKZG 2HQLA 1Q7YC 1XPUA 1EIYB 3GTLH 4LF5L 3TS2A 4K0KL 1J5EQ 1E3PA 1KRSA 1X56A 4A3FH 1KQSA 2V1CC 2WP8J 5FLXc 1EIFA 2DUDA 1PV4A 1H95A 4JBKA 2WFWA 4B3SQ 1T9HA 2K75A 3DLLA 3HOZH 1P8LA 1UEBA 1VQGA 3U4ZA 2ZM6L 3KJPA 4YWLA 3FP9A 3GDEA 3I4NH 4JI5L 3H0GG 4Y7NH 2VW9A 4DR1L 1GM5A 4BBRG 1V1QA 1YJNA 3PUZA 3ULPA 3F2DA 4ME3A 1YHAA 1Q81C 1VQ7A 1SR3A 2NZHA 2NN6I 4A75A 1C7YA 3S16H 3U50C 4BBSG 2VZAA 3GD7A 4P74A 3Q8DA 4A3DH 4A3BH 1D8LA 4BBRH 1VQPA 1HR0Q 4POGA 1YEZA 2E2JH 4JI4L 2JEAI 3PUYA 3UDGA 4DR6Q 4B3MQ 2OTLA 1PH4A 4NB3A 3CCQA 1TWFH 4LF7L 1UE6A 4GN4B 3CMEA 2JA5G 3RZDH 2JA5H 1Z9FA 4GKJL 4L5RC 5C3EG 4A3MH 4YHHQ 3RLNA 3KLWA 4A3FG 3HKSA 2IT1A 3HOVG 4JI3L 4LUOA 1IXRA 3HOXH 2WB1G 4DR5L 1SN8A 2YTYA 1KRTA 1NY4A 4HIKA 1HNZQ 4NXML 3OYYA 1JB7A 1XMOL 3W1BA 5C4XH 3KFUA 4AYBE 2L15A 1K83H 2VY3A 2Y0SE 3HOYG 4JOIA 1G6PA 5FJ8G 4JI1Q 3M4PA 1JE5A 1A0IA 4WJ3M 1PH5A 2NVQH 3CCLA 3UE1A 3HOZG 4IOAA 4EX5A 5IYDG 1XMQQ 1RIPA 4DR4L 3GTGH 3I4MH 2KCMA 2HT1A 3E0EA 1TXYA 3TQYA 4HJ8A 1IZ6A 4DR5Q 1L1OA 1NBWA 2DGYA 1K8GA 1CSQA 3T1YQ 1IBLL 3H3VI 5IT9c 5LMNQ 1QUQB 4B3TQ 4LF6Q 4LF9L 2UXCQ 1LUZA 4HIDA 4DV2Q 1N9WA 5JJLA 3F2CA 3AFQA 3CAMA 4PG3A 4GS3A 2E2IH 3MEFA 2VNUD 1VQCA 2ASBA 4GOPA 3RLFA 1I6HH 1N32Q 5HY6A 3STBD 3CCVA 2UXDQ 1OXVA 3OTOL 1XPRA 4QIWE 2N3SA 1N34Q 4UP8A 2LXJA 2PNHA 4LNQA 3I7FA 2R7ZH 5IP7H 4HJ5A 2C35B 2VL6A 4X66Q 4GN5A 4JI2Q 3CCRA 3GTOH 1Q46A 3B6YA 1Q1EA 3HOUH 1Y14B 2BA0A 4MTNA 1L0WA 2VQFQ 4KHZA 4A3LH 3GTPH 1GVPA 4DK6C 2EIFA 2OQKA 4GNXB 3M4OH 4QJFA 1B7YB 4ALPA 2CKZB 3U58A 4IFDG 2Y0SG 5E7NA 1I94Q 4JI8Q 1GD7A 2E2HH 1L1OC 4GOPB 2H5XA 2GVBA 1BVSA 3RLOA 1YHQA 3CC4A 3E9IA 3EBEA 3S1RH 1MJEA 1IBKQ 3ERSX 2Z0SA 3BZCA 4UPAA 5IE8A 1K0RA 2YTVA 2I0QA 1QVCA 2NZOA 2CWPA 1CKOA 4IOCA 1FGUA 2B63H 2FXQA 3I4NG 1HNWQ 2N78A 4DV6L 1SLJA 1X9NA 1S3OA 4P71A 4A3KH 2UXBQ 1NJIC 1UE1A 1PH6A 4DR3Q 2A19A 2RHQB 1N33Q 3DM3A 1C9OA 1SROA 5M5YH 4LF4Q 4A3CG 5IWAL 4YY3L 4DAYB 2F4VL 1AE2A 1E7ZA 4AH6A 3S2DH 1R9TH 4IFDJ 1J5EL 1Y1WH 3EN2A 4DV4L 4DR2Q 1EWIA 1XJVA 3BJUA 1VQEA 2OWOA 4A93H 1YJWA 2Q2TA 2RF4A 2K14A 1BBUA 4BBSH 2JA7H 4DV7L 4X64L 1JJGA 2IX1A 2UXBL 1YBYA 1N36Q 3L7ZC 4R1JA 5IYCG 1PYBA 2ZJRA 3ER0A 1XPOA 3H0GH 1PFSA 3CC7A 1PHJA 2HHHQ 3CCSA 4OX9L 5IWAQ 1Z47A 2VS1A 3F1ZA 1IBMQ 5AJ3Q 1VQ5A 1U0LA 4WJ4A 4GNXC 2UUAL 4GKKL 1CKNB 1I5FA 3KF8B 2YV5A 4NXNL 3M85A 1YIJA 1HNXL 1N8RC 1NE3A 2JA6H 5H1SE 2MO0A 3MXNB 4C3JH 1L1OB 1BKBA 1Q1BA 1TWCH 2IHFA 5C44H 3CMAA 2UUCQ 1X54A 3I4OA 2ID0A 2RHSB 4JI3Q 4Y52H 4O0AA 1Q86C 1CKMA 3G48A 1UE7A 5IP9H 4NXMQ 3M9BA 1HH2P 3J81c 1YNXA 4R4TA 5AJ3L 5LMUL 2NVYH 1J6QA 1S40A 1KC8C 1XNQQ 3PO3G 3L2PA 3HOWH 3AFPA 2IX0A 3S14H 2KHJA 3CW2C 5M3MG 3GO5A 3KF6B 1TWHH 1VS0A 1P16A 4JI7L 4TVAB 2VQEL 2UUCL 1EYGA 1XMQL 5IYBH 1VQFA 3KYHC 1PH7A 1NMFA 1W3SA 3TEHB 3PIOA 1XTDA 4GOPC 1YVCA 3PF4A 1JJCB 1GO3E 5LMNW 1XNRL 4JV5Q 2K5HA 4LWCA 1IBLQ 1L2FA 2B3GA 1OTCA 5LMUQ 1CKNA 1VQ4A 4GLXA 2JE6I 1I50H 4O2DA 1KD1C 3TREA 1KXLA 2YTXA 3PCOB 3A5UA 5C4XG 1KAWA 2K4KA 3OW2A 4LFBL 4YCVA 3I2ZA 1VQKA 2ATWA 1X3FA 1K9MC 3S2HH 4YCWA 4P72A 4IPDA 2CWAA 1KL9A 2VQEQ 1JJ2A 1HNZL 3HOVH 4X62Q 5GQOA 4A3KG 3J81i 4A3MG 5C3EH 1WYDA 3ZJYC 3U4VA 4DR1Q 1PH1A 2ZTCA 2E8GA 2GN5A 3CQZH 1S72A 2E5LL 3KOJA 4X66L 1U5KA 5JEAJ 3G6EA 1QZGA 3M3YH 3K81C 5C0XJ 5GAEC 4DV3Q 1M1KC 4A3GH 1OXXK
chains in the Genus database with same CATH superfamily
4A3EH 4DR6L 3GTJH 1V9PA 1SYEA 1LV9A 1FVIA 1IKLA 2QILA 2MJ8A 5IY0A 3GTQH 4R4IA 4DNRB 1HTPA 4JI0L 3GTMH 3J81L 2PMZE 5FLMH 1YI2A 1IBKL 1RDPD 4JYAL 5GADC 3N52A 2QW7A 5JJIA 3MVVA 2JA8H 1VQMA 2NWGA 2QEXA 4XIGS 1STNA 3CC2A 2D0OA 2QEJC 4FF4A 1BF4A 1SE8A 3RZOH 1HPCA 1VQBA 5E1FA 2IHEA 3P20A 2OQ0A 4OWWB 1LT6D 5FO7B 3FKIG 1ILPA 1HRJA 4TQUS 4KY6A 1CA5A 2VB3X 3BVZA 3STBC 4F8MA 4BXXG 1EY9A 1N36L 1TY0A 2F0KA 5IYCH 2E2HB 1STHA 2M2LA 1B1ZA 2ZTEA 2KENA 5T1GA 1SFOH 2AWNA 4DV5L 3A7AB 4DUYL 4X6AH 4X65Q 1LT5D 1G51A 1S5DD 4OELB 1YZ6A 3DWQA 2X6GA 1VQJA 1HZCA 3EIVA 3MWYW 4YIJA 4A3CH 3ONAB 3NENA 1BCPD 1KHIA 1LTSD 2AWOA 1OXSC 3VR3A 4GNXA 5LL6S 1VQ6A 3HOYB 3GTKB 1LT4D 2B63G 1SYCA 2RDFA 1EQQA 2QCPX 4DV0Q 1U4PA 4JBWA 2O2LD 5KEEA 3A0JA 4RMFA 4KKTA 1AE3A 1MIUA 2Q2IA 2ZM6Q 3FVQA 2UUBQ 4IFDI 1EZ6A 1XMOQ 1VF5C 2YYZA 2Y0SB 2PQAB 1A3UA 2QGQA 1QVGA 1ESRA 1A63A 2FJ2A 4IJHA 5CBEE 3VDYA 1KNEA 1O7IA 3T13A 4KHPQ 3J7AF 3CCJA 3HFZB 2Q8RE 4JG2A 4L5SA 2MNAA 1VQHA 5G3LF 4DK3C 1VQDA 4CKCA 1V43A 3LGJA 5CV9A 1RCVD 1S5CD 2MUYA 2F3WA 3E3XA 4K0KQ 3K5NA 1EY8A 5ELBA 5EAYA 5IYBG 4C3JG 3J7A5 1ET6A 3EQLC 4PZ8A 1VQ9A 3AYHB 1IKMA 1UWVA 2LY7A 4RCNA 4JV5L 2KCTA 3T1HQ 4EGVA 2F0SA 5K36G 4YWKA 4HJAA 3HOYH 4OWTB 1HCZA 2O5JC 5IODA 3W1GA 2B29A 2VUMH 4RWSC 4X62L 4LUZA 4ZQ3A 3D4WA 3VR4A 1G2SA 1SFOB 2WIIB 1SNQA 3J7YW 1C0AA 1JC7A 4NKLA 5BN4A 2R92H 3KF6A 1LTGD 5M3MB 1KIXA 1TY2A 5IYDH 3NTIA 3X3MA 4A3BG 4K8JA 5DM73 3S1QH 2NN6G 3QB3A 2FINB 1EWCA 3OMGA 1JQYD 2EYMA 1I4RA 3P7JA 3M4QA 4LFCL 2R6GA 1FJGQ 3RN5A 1JCKB 4V190 4PNYA 3SVMA 4A3KB 1O78A 1HNWL 3IRBA 4DV6Q 1DXMA 2I5LX 2TMPA 1HNXQ 2EXDA 2G9HD 3D8GA 1WD0A 1JE4A 2F0FA 2HIVA 2I5MX 3NEMA 1PH3A 3S1MB 2K5NA 3QR8A 2XWBB 1LTLA 2NZ1D 5JJZA 1PRTC 2BDOA 4LF8L 1WCMH 1NUCA 1X6OA 4JC0A 5CBAE 1ICFB 4ZUJA 2CHBD 2PCFB 5F2DA 3CF5A 2K01A 1OXTA 3KJOA 3JAME 2KBNA 3KDFA 3FKIH 1W6KA 4P75A 2WAQG 1XXGA 3DWPA 4A76A 5ELNA 2AHOB 1YJ9A 4OO1I 4A93G 1LABA 2CH4W 1BR9A 2LS01 4AYBG 2AMCB 1DGSA 3S24A 4HJ9A 1Q7YC 4K0KL 1J5EQ 1X56A 1ZYRC 1XTCD 4CGYB 1PV4A 2DUDA 2B2WC 2WFWA 1B2TA 4B3SQ 1DJRD 3HOZH 1P8LA 1UEBA 3KJPA 4JI5L 4Y7NH 1MI2A 1EY6A 4RGTA 4DR1L 1GM5A 3PUZA 2L0CA 4I7AA 4CDCC 1D1KA 1I3QB 2NN6I 5C6AA 5CMDA 3H91A 4K2LA 2F0GA 4K14A 3M7GA 1D8LA 3K5OA 1HR0Q 2JEAI 4DR6Q 3UDGA 4Q0FA 1JORA 1B53A 2K5WA 4GN4B 3CMEA 2JA5G 3EA6A 2JSOA 1ZYRD 1YNND 2DNEA 4YHHQ 3RLNA 3KLWA 4A3FG 1JOKA 2F0QA 3SHLA 2IT1A 3HOVG 3HOZB 4RKLA 2WB1G 2B39A 1B9NA 1KRTA 3AU7A 1II3A 4NXML 1JB7A 3ITPA 2L15A 1K83H 2NB0A 2EPBA 2VY3A 4JOIA 2IX3A 5C4JB 1H9SB 4RKBA 1A0IA 1PH5A 1GJXA 4EX5A 3NUCA 4B9XA 4DR4L 2KA7A 3E0EA 3TMEA 1TXYA 2JA7B 1NBWA 2DGYA 1O7LA 3LWEA 4OEMB 5CC4A 5ELFA 1LUZA 1TWFB 3SDZA 3AFQA 4GS3A 5I6YA 2VNUD 2X69A 1I4HA 1N32Q 3MTSA 3STBD 1N34Q 1G6ZA 3QOLA 1MSGA 1A3TA 1H9SA 2LXJA 4LNQA 1FNWA 2R7ZH 2XIWA 4MIUA 2VL6A 2LMCB 3CCRA 3CKIB 2RSOA 1LTBD 3I73A 3IAYA 1GVPA 4DK6C 2OQKA 4GNXB 1B7YB 4IFDG 5E7NA 5KNBA 4N8X1 4JI8Q 3OSOA 2E2HH 2JP1A 1YHQA 1BVSA 3RLOA 5EKLA 2WKDA 3NWTA 5CGKA 3E9IA 5D3DA 3EBEA 3BZCA 1QVCA 3KK7A 5CV7A 4C3HB 1FGUA 1HTLD 1SNDA 2FXQA 2N78A 1SLJA 3K58A 1S3OA 4P71A 1FNUA 5EBDA 4G7HC 5M5XB 2XVSA 1B9MA 1E0BA 1SROA 5TSSA 5KGUA 4X3TA 1STAA 1AE2A 4AH6A 4Y7NB 4G57A 4CDFC 1R9TH 4IFDJ 5I4DA 1J5EL 1Y1WH 1EWIA 3BJUA 1SXTA 1AEXA 4A93H 2Q2TA 2K14A 5G3LD 3P75A 2JA7H 4DV7L 1MSHA 4DA2A 4ABNA 3BG3A 4QB4A 3ER0A 3H0GH 1PFSA 5J22A 5IIFA 1GXDC 2PQEA 2QF7A 1K83B 4C3IG 4OX9L 1K0SA 2EDGA 5AJ3Q 5EPKA 1D6EC 4NXNL 2YV5A 3TBIB 2VUMB 1EYDA 1S5FD 3R2IA 1NE3A 1S4ZA 2JA6H 1E2VA 5M9OA 1BKBA 2IHFA 2Z6BA 2DJGC 1X54A 3J80E 2F03A 3G48A 5IP9H 1DZ1A 3J81c 1YNXA 2F4IA 1WTHA 4R4TA 4XDXA 2NVYH 1J6QA 1S40A 1XNQQ 3PO3G 3L2PA 2L9HA 3AFPA 5M3MG 1KDBA 2A5HA 3E5SA 1LTAD 3GO5A 2F0OA 3BDOA 2RDGA 1P16A 4JI7L 4TVAB 2UUCL 1YNJD 3KYHC 4E6IA 3CHBD 3EJIA 1SMYD 1JJCB 5DEHA 1XNRL 4TKOB 4LWCA 1EEID 3DHQA 2BCOA 5IGEA 1VQ4A 2NTSA 2L5TA 1KXLA 4LFBL 4YCVA 4L63B 3I2ZA 1K9MC 4YCWA 1HNZL 5C5MA 4X62Q 4KHVA 3HOVH 1EY0A 4RHRA 1EY7A 2K1BA 4A3KG 4DAPA 5C3EH 3ZJYC 2ZTCA 2GN5A 4K2KA 3M3YH 1TIID 1NSNS 3K81C 4HMJA 1IW7D 4DV3Q 4C3HH 1C4QA 4HIOA 4BA2I 1FD7D 4O1NA 1ZKOA 1YNNC 3BZKA 4LF7Q 1PYWD 2CFMA 2R93G 5KYLA 2K32A 5LMNL 2EZVA 4YCUA 4H02A 5EPLA 1I4QA 2WKCA 3E6ZX 4K6DA 4OO1G 2JJQA 2MHVA 3MC0B 3M7NA 4EQOA 1FJGL 3OTOQ 4XQQA 5JPNC 1NMGA 5LL6X 2JQOA 1Y1VH 4ULLA 1JR0D 4BY1H 2XRQD 5HGQA 3EROA 1EIHA 3Q22A 1AN8A 5GROA 4R8IA 4PZ7A 3PV0A 3C1FA 1X3EA 2NYZD 4L6TB 3MEHA 4A3IH 1E1TA 4DV1L 4KJOA 3K7AH 4N8FA 2K03A 1I6VC 3I4MG 3VYTA 2PI2E 1D5XC 2ZT9C 1CA6A 4LF5Q 4JI6L 3PGZA 4OX9Q 4Z9CB 3CXCA 4CJ0B 1O80A 2F52A 2BDNA 4BY7G 4KKSA 4H13C 1I4PA 5FOBB 2EY5A 2NVXB 4DKAC 4J15A 2SOBA 3K6OA 3C2PA 3J80L 1F77A 4PZ6A 1Q82C 1FL0A 4DAMA 1WTRA 1HZ9A 3H6MA 1HR0L 4IPGA 1HZBA 3QJYA 2IY5B 1I4XA 4A4IA 4X65L 3K8AA 2CQOA 3J7ZC 4DNIA 4A3DG 1JWMD 1VCIA 4KHPL 4OGQC 2JK8A 2UU9L 4LK1C 1IL2A 5KNCA 1ASZA 2F0DA 4IUVA 4A3EG 3S2HB 1LYLA 3CD6A 1GUOA 5JAVA 3MFGA 2RQXA 4BY7H 1QCBD 2KCNA 3MXUA 4QQBX 4YY3Q 4JI1L 1WI5A 3UDIA 2K5DA 4DV4Q 5E4XA 2A74C 1NTGA 2LXKA 2F0LA 2R92G 1TWAH 3WDNA 5M5YB 1E2WA 1A3VA 4QUFA 2EQSA 1DONA 3KBXA 4GKJQ 3S2DB 4ZYSA 1SJED 2HD3A 4C56C 3RMHA 1U4RA 2PZUA 1SRUA 3PO2H 1C8CA 1E24A 4MN3A 2JA8G 3RNUA 4K5WA 4BY1B 5FLMG 5I6WA 3MXPA 3OOCA 2N49A 2F3VA 2A8VA 4KTAA 5DM63 1WTQA 2R93H 4IURA 3NXWA 1HFGA 3LNNA 5C44G 1GUSA 4LF9Q 4A3FB 2ZXOA 2VXWA 1QNKA 2HIXA 1T5EA 4OHJA 2JA6G 4C3HG 5D3IB 2OCEA 5IT9E 1N34L 1OXUA 1HJPA 3R8BA 1LTRD 4IALA 4C1NK 4BBSB 2QA4A 2JYOA 3KBGA 3BZDB 4OIKA 1STBA 2JA7G 1PH8A 3CQZB 3QWNA 1DYQA 1U9RA 3T56B 4BA1I 2WB1E 1EWHA 4A3EB 1ZEQX 2IJ0A 3TN2A 4JI8L 2K5QA 2XTIA 2MO1A 1MGSA 4AIMA 3NWSA 2PW5A 1SSOA 1XYIA 3S16B 1QUQA 2A69D 3W3AA 3NTKA 4U673 1H9JA 1R4QB 3IL8A 4DNTB 1XX8A 1HUMA 4KLKA 4L5QA 3BS1A 4NXNQ 5JOBA 1LT3D 1QG7A 5M3FG 5BN5A 1V8QA 4EQNA 4JI0Q 1A8VA 3D0FA 1SDFA 4GZYC 2J7ZA 1STGA 5E4WC 5J3BA 2UU9Q 4KD4A 1CZWA 1PTOB 1W2BA 4PMCA 1Q8KA 1I6HB 3GTJB 1JMCA 3H15A 1X3GA 2IWHA 2RKSA 5JVG3 4KN4C 4X3UA 3MXNA 4ILWA 5A2QL 3A5ZB 1PYSB 3FRPB 2Z9HA 4KMUC 4DXFA 3UE0A 1TS3A 3KLRA 5M3FH 4IPHA 5FJ8H 2BH2A 1VQOA 1U4LA 4LFAL 3A7LA 5AFWA 2L11A 1KAAA 3E9HA 4CKEA 1HR0W 5M5WH 3HKZG 2HQLA 5IGDA 1ENCA 1ONLA 1EIYB 4GKJL 2V1CC 5J1ZA 2FFKB 1Z6HA 2K75A 3DLLA 2ZM6L 2A6HD 2X6LA 1CHQD 4AYBB 3UI2A 3FP9A 3H0GG 3GQBA 1PTOD 3ULPA 3F2DA 1VQ7A 3CU7A 3S16H 1TS4A 3GD7A 1Y1VB 1GOZA 3Q8DA 4A3BH 1YEZA 1EU4A 4QUCA 2TSSA 2EYLA 3KLSX 2OTLA 4NB3A 3R93A 3CCQA 4IFDH 4LF7L 3OHXC 2HCCA 2PO4A 2JA5H 1Z9FA 3ND9A 1SAPA 2BE5D 2EYHA 1F2ZA 4LUOA 4DR5L 1HNZQ 3NBHA 1RODA 3QO2A 4FO2A 4DK0A 1XMOL 2B2VC 3KFUA 1SNPA 3EFXD 5I2YA 3TP6A 3HOYG 1G6PA 3U9SA 2NVTB 2D9UA 3M4PA 2DJFC 3E0JA 4WJ3M 3HOZG 2R7ZB 1XMQQ 2YU9B 1RIPA 4XQJA 2HT1A 4HJ8A 1IZ6A 5C3EB 1JB3A 5IGFA 5IT9c 5M5WB 5LMNQ 1QUQB 1KDCA 4B3TQ 4LF6Q 2K04A 1N9WA 4ZCKA 3F2CA 1VMPA 2Z4HA 3CAMA 4PG3A 4FP5D 3S9WA 4F88A 5HURA 5I2XA 1VQCA 4GOPA 3RLFA 3CRLC 2UXDQ 3OTOL 1XPRA 2EYOA 4QIWE 5FLXL 3TP7A 4UP8A 2PNHA 1SMYC 5KIXA 1NR2A 3ND8A 3LX0A 1Q46A 2MGSA 2SNSA 1Q1EA 4MTNA 2BA0A 3MHBA 4KHZA 3K5MA 3M4OH 2E2DC 1RJTA 2CKZB 3U58A 1LO5D 1I94Q 2H5XA 1CT1D 3H0GB 4DN4M 4UPAA 2RVLA 5IE8A 2DN8A 1K0RA 2NBFA 5EQ0A 1SE2A 1CKOA 1BBXC 3HG9A 1HNWQ 4DV6L 2UXBQ 2A19A 2C9OA 2RHQB 3PQIA 1C9OA 1CHPD 5M5YH 4LF4Q 1CZGA 4A3CG 4IUPA 4DAYB 2F4VL 1RD9D 1E7ZA 1B3QA 2PMZB 4DR2Q 1VQEA 2OWOA 2RF4A 3GTGB 3I4MB 5CV5A 2VB2X 1KNAA 2L1BA 4A93B 4X64L 2AQ2B 1TR5A 2IX1A 2GA4B 4J8QA 2G5DA 2K05A 4R1JA 1PYBA 4IN3A 5IWAQ 1Z47A 4OIJA 4WJ4A 4GNXC 3M85A 3KF8B 1HNXL 1AP0A 1BQQT 4N9PA 3FKIB 3NTHA 1L1OB 5DAUA 1S5ED 1JWSD 3L3OC 3NSWA 1SYGA 2E75C 4Y52H 1UE7A 2ZXPA 1EOTA 1HXYD 1RF2D 4A3DB 3M9BA 1HH2P 3S17B 3VR2A 2NUCA 3SR1A 4LMQD 2IX0A 2KHJA 4OO1H 3V96A 3KF6B 1GUGA 1OO9B 1VS0A 1FR3A 1VDZA 3I90A 4CJ2C 1EYGA 1XMQL 5IYBH 1NMFA 3G7LA 3TEHB 1A2UA 3D4RA 1QILA 5LMNW 2IW3A 1CKNA 4GLXA 3DWAA 1EY5A 1JOOA 3TREA 3A5UA 1KAWA 2K4KA 3H94A 4DF7A 1VQKA 2NN6H 4KJNA 2VQEQ 4P72A 4IPDA 1JJ2A 2PZWA 1UNSA 4A3MG 1H9KA 1WYDA 3U4VA 4DR1Q 1WTWA 1PH1A 2DY8A 3HGBA 2E5LL 5FK9C 4X66L 1U5KA 3M4YA 2P5ZX 2K28A 4C1NI 5C0XJ 5GAEC 2EY2A 4A3GH 2F0UA 2ZJPA 4JI4Q 4KK7A 2EYFA 4WORA 4QL5A 2ICEC 2PI2A 1TKWB 1VQ8A 1DD2A 2B2UC 2UXCL 3QIAA 4L5TA 1L0YB 5M3MH 3PO3H 4I65A 1G8ZD 1N32L 2L4NA 5JEAG 1XWEA 2Q2HA 5C0XG 1CI3M 4JCVE 3I56A 4RHSA 1TWGB 2Z6KC 4QGUA 3Q6SA 1WVLA 1GUTA 2NTTA 4XQNA 4IUNA 3NHHA 1RTOA 2WB1B 4K6LA 1YITA 2MPMA 2XGTA 1AZPA 1BO0A 1SYBA 5E3FA 5JEAH 1HHVA 4XYQA 1EQRA 1CK1A 2AQ3B 2XRSD 1A6XA 5A35A 3DXJC 3PO2G 2JN4A 1VQNA 3OIQA 3LWUA 1E22A 3K80C 4KV6A 1MBYA 5LHY1 4LFCQ 4DR7Q 2K7VA 1SE3A 3X3NA 2K5VA 2Q2UA 4KN7C 2OTJA 3SK4A 1CSPA 3I8ZA 2RBMA 1ZXTA 4DV1Q 3HOXG 3SK8A 1F2LA 2D2CC 4APVA 4U68A 1CFMA 4IUUA 4EVOA 3EVQA 4BY7B 4XXEA 1EOVA 1ILQA 3PUXA 1CTMA 3NELA 3PUWA 5KNDA 2SNMA 4C3IH 2EJGC 2HUGA 2I5HA 3T4AC 4LUVA 4JOIC 3SK6A 5A2QE 4DV7Q 1Y69U 1Q3LA 2I07B 3NBHB 1SNMA 1G2TA 1PDQA 1MJCA 3NQIA 3PIPA 2KUMA 1Z7TA 4R4QA 4IJLA 2A68D 4MTKA 1HA6A 1QE6A 3O13A 4GLAC 4P73A 2WV6D 4OONA 2XNAC 4UY8C 1SJHD 1BCPC 4QY7A 4DR3L 1Q90A 5EGTA 1PZJD 1QVFA 1IYUA 1M4VA 4A3LG 5JPMC 2NVXH 4WJWA 1ENAA 3S1MH 4ODGA 4B3ML 1WFQA 3TDQA 3PMFA 3GV3A 2NVTH 3ERQA 4B08A 3PIP3 1XNQL 3ULJA 5ELOA 2HHHL 3L9AX 4IZ8A 4RFBA 3OWEB 4ID6A 3GP7A 3OPOA 2RDHA 3OMCA 1JT8A 3K7UC 4HN7A 2OXPA 4CKBA 4JI5Q 5L37A 1XNRQ 3HP3A 5C3XA 4H7BA 4XYOA 1YHBA 3CCEA 3TS0A 2B2WA 1QB5D 4JYAQ 4S3SA 1ENFA 1PA6A 3JAML 4EQPA 3CCUA 1EEFD 1VF7A 1SMXA 2F0TA 5BR8Q 3ULLA 4N9TA 4BY1G 1TS2A 2A6HC 5C4JH 4UP7A 2WAQE 1HZAA 4ZAIA 1Y1WG 1K8AC 3T51B 1CQVA 5C0XI 1X32A 2GVAA 2D5DA 3S1NH 2SDFA 3VA7A 2MFIA 3K5LA 5EJWA 5CV4A 1BOSA 3F2BA 1KTKA 2R7FA 3CP0A 3F8TA 2EJFC 2EOTA 1AH9A 1LACA 2XN9C 3A55A 1RTNA 2MP1A 3K0YA 4RAUC 4HMIA 4UHVA 5EBCA 2F0NA 4ZRZA 2KHIA 2E74C 3J80i 1PVOA 1I3QH 2BA1A 3SGIA 1B44D 5DLQE 2QDLA 4DXGA 3J7AV 1EU3A 3BVGA 4KD3A 5J39A 4BWGB 3HOWG 2EY6A 2L12A 2AUKA 3A74A 1F2MA 4AQYQ 3SK5A 4IPCA 4RG1A 1SEBD 2WAQB 2LKVA 4HIMA 3FHWA 4EQ5A 4DV0L 5GAGC 4CJ1B 4A3IB 1ASYA 2ZJQA 3G71A 4XT3B 3CCMA 3JAMi 4LFAQ 5IGBA 1HQRD 1IYJB 1Q12A 1F9SA 3CPFA 4X64Q 4F87A 5I9PA 2F0HA 1WCMG 2ALYB 3QOJA 4DUZL 2EE1A 1HFNA 3NE5B 1HA5A 5IP7G 1UEAB 5CV8A 4C3JB 1SBBB 4UAIA 3V2TA 3J81E 4LW1A 2UUAQ 1X3QA 1EYCA 2CQAA 1PRTD 3U9OA 4OXPA 4R4CA 1PLFA 2AQ1B 3ICEA 4PMWA 4LAAA 1C48A 1YNJC 1SYDA 2OEOA 3PF5A 1XPUA 3GTLH 2R3ZA 4LF5L 1V1PB 4IUQA 1KRSA 1KQSA 5CYUA 2WP8J 5FLXc 1WTXA 1F2YA 4JBKA 2ZXRA 1IHZA 1WTVA 1T9HA 2LFNA 5IGGA 4JW0A 4FYDA 1VQGA 1TU2B 2DNCA 3U4ZA 4YWLA 2HDLA 4K8IA 2VW9A 1V1QA 1R9TB 3IKJA 3TZUA 1Q81C 1YHAA 2EYPA 3NQTA 2NZHA 5ISRA 4A75A 1C7YA 1PXUA 4QCLA 1LTTD 3WOFA 3VA5A 3TP8A 4POGA 4JI4L 2E2JH 3RUZA 1UE6A 2A68C 3RZDH 3RZOB 1GHKA 3DMUA 4L5RC 3S1QB 1QJOA 3HKSA 4LJZC 1GHJA 4JI3L 5FKAC 4BS9A 3HOXH 1SN8A 4HIKA 3MAQA 2KVMA 3OWFA 1V1OA 5C4XH 4AYBE 3T53B 1TS5A 2KOLA 1TWAB 5K36H 5FJ8G 2KECA 4JI1Q 3SXHA 4HSVA 4DAYA 3GTMB 4IOAA 5IYDG 1K28A 2JA5B 3TQYA 4DR5Q 2F0EA 2NVYB 1IBLL 3NP8A 2UXCQ 4LF9L 4HIDA 1O7YA 3BVMA 3FEWX 3DM1A 4DV2Q 2KJXA 3AMUA 2ASBA 3CRKC 2F0WA 3CCVA 2N3SA 3A54A 1WTPA 1EIGA 2B63B 2PPBC 3I7FA 5IP7H 2C35B 3B6YA 3M4OB 1F9PA 5KYIA 3GTPH 2EIFA 4HCSA 4HSPA 1EZ8A 1BUVT 2Y0SG 3NK9A 1GD7A 1L1OC 4GOPB 2EJMA 1PFMA 1NCVA 2GVBA 2B8GA 2V4DA 2O5IC 1MJEA 4TSSA 3RZDB 3ERSX 4R8NA 4Q5VA 2CWPA 2B2YA 4QF4A 2B63H 3I4NG 1O7ZA 4RGMA 1X9NA 1NJIC 5C44B 4DR3Q 3K7AB 4X3KA 1MHWC 5IWAL 2PW7A 1G91A 5C3WA 4I7ZC 2AUJD 3EN2A 1B3AA 3N6RA 3NBIA 1EQTA 3FPPA 2J4XA 3I3CA 3IFTA 1B4OA 3G6JB 1BBUA 4BBSH 1JJGA 3SEBA 1H9RA 1YBYA 2UXBL 3A8KE 1FNVA 5IYCG 1XPOA 2HHHQ 2BOSA 1PHJA 3D4DA 2VS1A 1IBMQ 2F1MA 4NP5A 1PFBA 2B2YC 2G9DA 3HOXB 4GKKL 4M1UB 1Y8NB 1YIJA 1X3PA 2N55A 1N8RC 3VR5A 5H1SE 3CMAA 1Q1BA 2M9VA 1TWCB 2RHSB 4JI3Q 1STYA 4CHTB 1Q86C 3DUZA 5D14A 4NXMQ 2E2JB 5LMUL 4A3BB 3ZYYX 4G7OC 1KC8C 3HOWH 3CW2C 1BDOA 4HR7B 1JWUD 4UDUC 2VQEL 2XSCA 1M8AA 3Q23A 1VQFA 3K57A 1PH7A 1W3SA 1L0XB 5D65A 3PF4A 4NMZA 4JV5Q 1KABA 1IBLQ 2B3GA 1EL0A 4CDEC 4RCOA 1OTCA 5BN3A 2JE6I 1I50H 1KD1C 4G7ZC 3PCOB 5C4XG 1DOMA 4X3SA 1EFID 3OW2A 1DOLA 3PIO3 2ATWA 1X3FA 3S2HH 1BCPF 1KL9A 4V0BA 1AW7A 2A69C 2WACA 3J81i 3W2DA 2RA4A 2B8FA 3K59A 1S72A 3KOJA 1QZGA 4RA8A 2OT2A 1QWYA 4ZUIA 1FYCA 3HEJA 4ZK9B 1OXXK 1F9QA 3JAMc 1TWGH 5IGCA 4DK1A 4JBMA 1A2TA 4RGOS 2CH4A 3AEVA 2NVQB 4AQYL 5ELCA 3T1YL 1VQLA 3I55A 4POFA 3H3VH 2R92B 4LF6L 1PZID 2QKIC 5JVH3 3S1NB 3KDFB 2FHTA 4KKUA 4WFN3 1K3BC 4LF8Q 2RCNA 4JK1C 1Y1WB 4KY7A 2UXDL 1EUJA 3L0OA 3W5OA 4DAVA 4FF1A 1NR4A 2BE5C 5CORA 5IOCA 3TRZA 1TQOA 2ENBA 4HTHA 2VUMG 3UDXA 2VQFL 4DR7L 2R61A 1ET9A 4A3JG 4OL7A 3GTKH 1SYFA 4H44C 4FXKC 3D3RA 2FMCA 2KQ3A 1VQAA 1I94L 3PUVA 3BDLA 4GLVB 3A56A 4OWXB 4B3RL 3AQQA 2A1AA 3RD4A 4A3JH 2R7DA 3QG1A 1MD2D 3TP5A 5I9OA 1PFNA 1B8AA 5C4HA 4DUZQ 1NAPA 2JA9A 3FDTA 2Z4IA 3MFYA 2KEEA 4B9WA 3UDFA 1BXTA 3HOWB 4LF4L 5C4XB 1BBWA 2F0VA 4J6HA 4ZLTF 2B2TC 2F4VQ 4YWMA 1A62A 1LTID 1QZHA 2SEBD 1PRTB 1CUKA 4R9WA 5DNFA 4DUYQ 1WOCA 1R4PB 4C2MH 4MZ9A 4H0LC 1T5XD 3MA2B 3I91A 4MNOA 4JI7Q 4G4KA 3M3YB 4A3GG 2RCFA 4O42A 1G291 1PTOF 4HJ7A 3H09A 2IPKD 3MZ5A 2K6AA 1TVXA 4LFBQ 4DR2L 4FXDA 4DR4Q 3TSSA 3C3LA 1M90C 1SNOA 3HKZE 2UUBL 1PZKD 2OF1A 1FGBD 5IP9G 4YHHL 5EKIA 2A6ED 4DV2L 3G4SA 1QOHA 3S17H 1HQMC 4DV3L 3BU2A 4XT1B 2AKWB 4CBVA 1B70B 4KY5A 4JVZA 1CQFA 3I72A 5HGTA 4NPSA 5ELEA 1CM9A 3HOUG 1K8MA 2MQHA 5FO8B 1AFPA 3I70A 2ZTDA 4UP9A 4ZKCB 4BXXH 4DPGA 2F3IA 1K73C 3RR5A 2D0PA 5JJKA 4XTCS 4IQZA 2KEDA 2CCZA 2PQAA 1LM0A 4IO9A 1D1IA 1Q8IA 2BH8A 3GTPB 3T1HL 3JC66 1GUNA 2K50A 3MXGA 3S15H 4BBRB 5BR8L 4GN3B 2KHSA 2WINB 3WOEA 3V05A 4RGNA 2K52A 4B3RQ 4DU9A 4JI6Q 2JA6B 3S14B 1PH2A 1ESFA 4QIWB 4F7XA 1X55A 3H3VC 3J81j 2I46A 4B3TL 2E5LQ 1Y8PB 1HUNA 3IFDA 1WJJA 3WWVA 5M5XH 1EY4A 4R4OA 1RL2A 2JEBI 1SNCA 1STEA 4FDBA 4FVMA 3CPWA 1GKHA 4CDDC 1VQIA 2R7ZG 1PH9A 1D7QA 3R3OA 3PO3B 1I4GA 2PNRC 4JI2L 4A3MB 3GTLB 1UE5A 3I4LA 2PZTA 4KI0A 2DY7A 1MKHA 2LSSA 4JBJA 5KRUA 3RN2A 4K5VA 4WRDA 3T16A 2CW0D 1X65A 3K0XA 3J80c 2ES2A 1D5MC 3HKZB 4DV5Q 3HOUB 2N8NA 1K3RA 1LLRD 3D31A 3I4NB 4A3IG 1E1OA 1IBML 5GAHC 1DM0B 3OIPA 1KLUD 4B3SL 4GKKQ 2JA8B 2YU9H 4NW2A 5NUCA 2CW0C 1BCPB 1F9RA 3PSIA 1EFWA 3P1HA 1N33L 1Y1VG 2D62A 2A73B 3F2UA 3KLSA 2Z6KA 2F0PA 4C3IB 3TS2A 1E3PA 3BYYB 4A3FH 4PQXA 4P2CB 1EIFA 4FF2A 5EPJA 4FXGC 2EXZA 1H95A 4FF3A 3AB9A 4PV1C 2XWJB 2R93B 3GDEA 3I4NH 1B50A 1EQVA 4BBRG 1GUWA 2B2UA 1YJNA 3C46A 4ME3A 1D2BA 1SR3A 3U50C 4BBSG 2VZAA 1H9MA 4PMBA 3HOVB 4HCEA 4P74A 4A3DH 4BBRH 1VQPA 3NPPA 3PUYA 4B3MQ 5CV6A 1PH4A 1TWFH 2O4XA 2H4OA 2CVRA 1S5BD 5C3EG 4A3MH 1PTOH 4HEDA 1ICWA 3S15B 1D5ZC 1IXRA 3URYA 2YTYA 1NY4A 3OYYA 2F0JA 4QMGA 1W6JA 3W1BA 3R2TA 2Y0SE 1I50B 5C4ZA 4A3JB 1DCZA 1JE5A 2J0TD 2NVQH 4JPBW 3UE1A 3CCLA 3GTGH 3I4MH 2FMMA 2KCMA 5M3FB 2A6EC 1L1OA 1K8GA 1CSQA 3T1YQ 3H3VI 1J8IA 5C5LA 2KCCA 4TRDA 2HDMA 3KF8A 5JJLA 1J9OA 4FNFA 2K33A 2E2IH 2C5CA 3MEFA 3HS0C 1IL8A 3GV6A 3Q24A 5HY6A 1I6HH 1OXVA 1ML0D 1PRTF 2L55A 2HCIA 2B2VA 2EVBA 1IYVA 4HJ5A 4X66Q 4GN5A 4JI2Q 3GTOH 3HOUH 1Y14B 1L0WA 4A3LH 2VQFQ 1V1PA 5CR3A 3DEOA 2Q8TA 3Q0AA 4QJFA 1UUPA 4ALPA 3A8IE 3BDCA 5COYA 1AZQA 2N88A 1TWHB 3CC4A 4A3GB 3VR6A 3S1RH 2RSNA 1IBKQ 2Z0SA 2I0QA 2YTVA 2NZOA 3HZXA 1TT2A 2F0MA 2IL8A 4IOCA 1NNXA 2JXMB 1UAPA 4C2MB 2EYJA 3SE0A 4A3KH 3VYSA 1UE1A 1WCMB 4L8JA 5EKKA 1WTOA 1PH6A 1JOQA 1N33Q 3DM3A 1E2ZA 4YY3L 1KLGD 3S2DH 4DV4L 1XJVA 2Z1CA 1WD1A 1YJWA 2ICIA 3FPUB 1A15A 2F0IA 3D6CA 1BNZA 1PMRA 3FMCA 4RH6A 3S1RB 1Y8OB 1N36Q 3L7ZC 1RKNA 3BYTB 1EYAA 2ZJRA 3CC7A 4HAEA 3CCSA 3F1ZA 1VQ5A 3GTQB 1U0LA 2UUAL 1CKNB 1I5FA 2M00A 1RHPA 5ELDA 2EY1A 5K5PA 2MO0A 3MXNB 2QDBA 4C3JH 4IUTA 1SE4A 1TWCH 5C44H 2UUCQ 1K8OA 5FO9B 4ZKBB 2Z8LA 3DEPA 3I4OA 2ID0A 5C0XH 4O0AA 1KDAA 3A8JE 1CKMA 1IW7C 3D6WA 3VYUA 4M8AA 3PO2B 2HQEA 5AJ3L 2E2IB 2H1EA 1U4MA 3S14H 1TWHH 2B2TA 4NDXA 3OW7A 4J1MA 1VMCA 2Q8IB 5T1IA 3PIOA 1XTDA 4GOPC 1YVCA 1GO3E 4ME5A 3VYRA 1DOKA 2K5HA 1L2FA 3KUPA 2PYKA 5LMUQ 3GTOB 3C1EA 4O2DA 2YTXA 5FLXE 1QNUA 1JICA 5IT9L 4K5XA 4DFAA 3HRZC 2CWAA 1PTOC 2E76C 3TZDA 5GQOA 4MHEA 2E8GA 3CQZH 3G6EA 5JEAJ 4DGZA 1M1KC
chains in the Genus database with same CATH topology
4A3EH 2ZJPA 4C3HH 3JAMc 1TWGH 4HIOA 4JI4Q 4BA2I 4DR6L 4JBMA 3GTJH 1V9PA 3BZKA 4QL5A 4LF7Q 1FVIA 3AEVA 3GTQH 5IY0A 4AQYL 2PI2A 2CFMA 2R93G 1VQ8A 4R4IA 3T1YL 1VQLA 3I55A 5LMNL 4POFA 3H3VH 4LF6L 2UXCL 4YCUA 4JI0L 4L5TA 4H02A 3GTMH 2PMZE 5FLMH 1YI2A 1IBKL 4JYAL 5GADC 3KDFB 5M3MH 4OO1G 5JJIA 2JA8H 3PO3H 1VQMA 2JJQA 4LF8Q 2RCNA 3M7NA 1N32L 1FJGL 2UXDL 2QEXA 3OTOQ 5JEAG 1EUJA 4XIGS 2Q2HA 1NMGA 3CC2A 2D0OA 4JCVE 2JQOA 3L0OA 1Y1VH 3W5OA 1SE8A 5C0XG 2Z6KC 3I56A 3RZOH 4BY1H 1VQBA 5HGQA 4QGUA 3TRZA 2IHEA 2OQ0A 4OWWB 2VUMG 3UDXA 5GROA 2VQFL 4DR7L 4PZ7A 4A3JG 3FKIG 3GTKH 4TQUS 3PV0A 1YITA 1X3EA 2XGTA 4A3IH 3STBC 1E1TA 4DV1L 1I94L 1EQRA 1VQAA 3K7AH 4BXXG 3PUVA 1N36L 3I4MG 4GLVB 2PI2E 3PO2G 4LF5Q 4OWXB 5IYCH 1VQNA 4JI6L 3AQQA 2A1AA 1E22A 3PGZA 3CXCA 4OX9Q 4B3RL 2ZTEA 2F52A 2KENA 2R7DA 3K80C 4A3JH 4BY7G 1SFOH 2AWNA 4DV5L 4LFCQ 4DR7Q 4DUYL 4X6AH 4X65Q 2K5VA 2Q2UA 1B8AA 4DUZQ 1G51A 2OTJA 2JA9A 1CSPA 1YZ6A 4DV1Q 1VQJA 1HZCA 3EIVA 3UDFA 4DKAC 3HOXG 4APVA 4J15A 4LF4L 1BBWA 4A3CH 2F4VQ 4YWMA 4PZ6A 1A62A 1QZHA 1Q82C 1FL0A 3NENA 1CUKA 1EOVA 3PUXA 1KHIA 1HZ9A 3NELA 2AWOA 4DAMA 1OXSC 3PUWA 1HR0L 4IPGA 4GNXA 1HZBA 4C3IH 1VQ6A 4DUYQ 2IY5B 2I5HA 4A4IA 1WOCA 3K8AA 2CQOA 4JOIC 4LUVA 4C2MH 4DNIA 4MZ9A 4X65L 3J7ZC 4DV7Q 2B63G 4A3DG 1EQQA 1VCIA 4KHPL 2JK8A 4DV0Q 2UU9L 3NBHB 1IL2A 1MJCA 3PIPA 4JBWA 4R4QA 1ASZA 4MNOA 4IJLA 3A0JA 4JI7Q 4RMFA 4A3EG 4GLAC 1AE3A 1MIUA 2Q2IA 1LYLA 4OONA 4P73A 2ZM6Q 3CD6A 4UY8C 4A3GG 2UUBQ 4IFDI 1XMOQ 2YYZA 2PQAB 4QY7A 1G291 2QGQA 4DR3L 1QVGA 4HJ7A 4BY7H 1A63A 1QVFA 4QQBX 4IJHA 4YY3Q 4JI1L 3VDYA 1O7IA 1WI5A 4A3LG 4KHPQ 3UDIA 2NVXH 3CCJA 4LFBQ 4DV4Q 3HFZB 4DR2L 4JG2A 3S1MH 4DR4Q 4L5SA 2MNAA 4B3ML 1NTGA 1WFQA 2LXKA 1M90C 1VQHA 2R92G 3HKZE 4DK3C 2NVTH 1VQDA 2UUBL 1TWAH 1V43A 3LGJA 5IP9G 1XNQL 4YHHL 3ULJA 5ELOA 2EQSA 2HHHL 4DV2L 3G4SA 4K0KQ 3S17H 4GKJQ 4DV3L 3BU2A 2AKWB 5EAYA 1B70B 5IYBG 1JT8A 3K7UC 3J7A5 4PZ8A 1VQ9A 3AYHB 4JI5Q 1UWVA 1SRUA 4NPSA 3PO2H 3HOUG 1E24A 2JA8G 3RNUA 1XNRQ 4JV5L 2KCTA 2MQHA 3T1HQ 1YHBA 4UP9A 2ZTDA 4BXXH 5FLMG 3CCEA 3TS0A 2N49A 4DPGA 4JYAQ 2F3IA 1K73C 2A8VA 3RR5A 5K36G 4YWKA 4HJAA 3HOYH 2R93H 4OWTB 1PA6A 2D0PA 3W1GA 3CCUA 2B29A 2VUMH 5C44G 5JJKA 4LF9Q 4XTCS 1SMXA 4X62L 2HIXA 5BR8Q 3ULLA 4LUZA 2JA6G 2CCZA 2PQAA 4BY1G 1LM0A 5C4JH 4UP7A 4IO9A 2WAQE 1HZAA 1Y1WG 1C0AA 1K8AC 2BH8A 5C0XI 2R92H 3T1HL 2OCEA 3KF6A 3JC66 1N34L 1OXUA 2GVAA 1KIXA 2K50A 3S1NH 1HJPA 5IYDH 2MFIA 2QA4A 4A3BG 3F2BA 3S1QH 2R7FA 3CP0A 2NN6G 3F8TA 3S15H 5BR8L 1AH9A 4GN3B 2JA7G 1PH8A 4BA1I 2WB1E 2K52A 4B3RQ 4JI6Q 1PH2A 1X55A 4JI8L 3M4QA 2XTIA 2MO1A 4LFCL 3J81j 4AIMA 2KHIA 2R6GA 4B3TL 1FJGQ 3RN5A 2E5LQ 3J80i 1PVOA 1I3QH 2BA1A 1QUQA 1WJJA 3SGIA 3WWVA 5DLQE 5M5XH 4R4OA 1RL2A 2JEBI 1HNWL 3IRBA 4DV6Q 4FDBA 3HOWG 3CPWA 1GKHA 3A74A 2I5LX 1VQIA 4KLKA 4L5QA 1PH9A 2R7ZG 1HNXQ 4NXNQ 4AQYQ 1D7QA 2EXDA 4IPCA 4JI2L 2HIVA 1UE5A 2I5MX 1PH3A 3NEMA 5M3FG 4RG1A 4KI0A 2K5NA 4JI0Q 1A8VA 3D0FA 4HIMA 3FHWA 1MKHA 5J3BA 4EQ5A 4DV0L 5GAGC 2UU9Q 2LSSA 4JBJA 3G71A 3RN2A 1ASYA 2ZJQA 1LTLA 3CCMA 1W2BA 1Q8KA 1X65A 3K0XA 3JAMi 4LFAQ 3J80c 2ES2A 4LF8L 1WCMH 1IYJB 1Q12A 3CPFA 4X64Q 1X3GA 3H15A 4DV5Q 1X6OA 4JC0A 1JMCA 1WCMG 2ALYB 4DUZL 2N8NA 3A5ZB 1K3RA 5IP7G 1PYSB 3CF5A 3D31A 1OXTA 3KJOA 4A3IG 1E1OA 1IBML 5GAHC 3UE0A 5M3FH 2KBNA 3KDFA 4IPHA 3FKIH 4B3SL 4LW1A 2UUAQ 4GKKQ 4P75A 5FJ8H 2WAQG 2BH2A 2YU9H 1VQOA 4A76A 5ELNA 4LFAL 2AHOB 4OXPA 1YJ9A 4OO1I 4R4CA 3ICEA 3PSIA 4PMWA 1EFWA 4A93G 4AYBG 1N33L 2AMCB 1Y1VG 2D62A 3E9HA 1HR0W 1DGSA 3S24A 2Z6KA 3PF5A 5M5WH 4HJ9A 3HKZG 2HQLA 1Q7YC 1XPUA 1EIYB 3GTLH 4LF5L 3TS2A 4K0KL 1J5EQ 1E3PA 1KRSA 1X56A 4A3FH 1KQSA 2V1CC 2WP8J 5FLXc 1EIFA 2DUDA 1PV4A 1H95A 4JBKA 2WFWA 4B3SQ 1T9HA 2K75A 3DLLA 3HOZH 1P8LA 1UEBA 1VQGA 3U4ZA 2ZM6L 3KJPA 4YWLA 3FP9A 3GDEA 3I4NH 4JI5L 3H0GG 4Y7NH 2VW9A 4DR1L 1GM5A 4BBRG 1V1QA 1YJNA 3PUZA 3ULPA 3F2DA 4ME3A 1YHAA 1Q81C 1VQ7A 1SR3A 2NZHA 2NN6I 4A75A 1C7YA 3S16H 3U50C 4BBSG 2VZAA 3GD7A 4P74A 3Q8DA 4A3DH 4A3BH 1D8LA 4BBRH 1VQPA 1HR0Q 4POGA 1YEZA 2E2JH 4JI4L 2JEAI 3PUYA 3UDGA 4DR6Q 4B3MQ 2OTLA 1PH4A 4NB3A 3CCQA 1TWFH 4LF7L 1UE6A 4GN4B 3CMEA 2JA5G 3RZDH 2JA5H 1Z9FA 4GKJL 4L5RC 5C3EG 4A3MH 4YHHQ 3RLNA 3KLWA 4A3FG 3HKSA 2IT1A 3HOVG 4JI3L 4LUOA 1IXRA 3HOXH 2WB1G 4DR5L 1SN8A 2YTYA 1KRTA 1NY4A 4HIKA 1HNZQ 4NXML 3OYYA 1JB7A 1XMOL 3W1BA 5C4XH 3KFUA 4AYBE 2L15A 1K83H 2VY3A 2Y0SE 3HOYG 4JOIA 1G6PA 5FJ8G 4JI1Q 3M4PA 1JE5A 1A0IA 4WJ3M 1PH5A 2NVQH 3CCLA 3UE1A 3HOZG 4IOAA 4EX5A 5IYDG 1XMQQ 1RIPA 4DR4L 3GTGH 3I4MH 2KCMA 2HT1A 3E0EA 1TXYA 3TQYA 4HJ8A 1IZ6A 4DR5Q 1L1OA 1NBWA 2DGYA 1K8GA 1CSQA 3T1YQ 1IBLL 3H3VI 5IT9c 5LMNQ 1QUQB 4B3TQ 4LF6Q 4LF9L 2UXCQ 1LUZA 4HIDA 4DV2Q 1N9WA 5JJLA 3F2CA 3AFQA 3CAMA 4PG3A 4GS3A 2E2IH 3MEFA 2VNUD 1VQCA 2ASBA 4GOPA 3RLFA 1I6HH 1N32Q 5HY6A 3STBD 3CCVA 2UXDQ 1OXVA 3OTOL 1XPRA 4QIWE 2N3SA 1N34Q 4UP8A 2LXJA 2PNHA 4LNQA 3I7FA 2R7ZH 5IP7H 4HJ5A 2C35B 2VL6A 4X66Q 4GN5A 4JI2Q 3CCRA 3GTOH 1Q46A 3B6YA 1Q1EA 3HOUH 1Y14B 2BA0A 4MTNA 1L0WA 2VQFQ 4KHZA 4A3LH 3GTPH 1GVPA 4DK6C 2EIFA 2OQKA 4GNXB 3M4OH 4QJFA 1B7YB 4ALPA 2CKZB 3U58A 4IFDG 2Y0SG 5E7NA 1I94Q 4JI8Q 1GD7A 2E2HH 1L1OC 4GOPB 2H5XA 2GVBA 1BVSA 3RLOA 1YHQA 3CC4A 3E9IA 3EBEA 3S1RH 1MJEA 1IBKQ 3ERSX 2Z0SA 3BZCA 4UPAA 5IE8A 1K0RA 2YTVA 2I0QA 1QVCA 2NZOA 2CWPA 1CKOA 4IOCA 1FGUA 2B63H 2FXQA 3I4NG 1HNWQ 2N78A 4DV6L 1SLJA 1X9NA 1S3OA 4P71A 4A3KH 2UXBQ 1NJIC 1UE1A 1PH6A 4DR3Q 2A19A 2RHQB 1N33Q 3DM3A 1C9OA 1SROA 5M5YH 4LF4Q 4A3CG 5IWAL 4YY3L 4DAYB 2F4VL 1AE2A 1E7ZA 4AH6A 3S2DH 1R9TH 4IFDJ 1J5EL 1Y1WH 3EN2A 4DV4L 4DR2Q 1EWIA 1XJVA 3BJUA 1VQEA 2OWOA 4A93H 1YJWA 2Q2TA 2RF4A 2K14A 1BBUA 4BBSH 2JA7H 4DV7L 4X64L 1JJGA 2IX1A 2UXBL 1YBYA 1N36Q 3L7ZC 4R1JA 5IYCG 1PYBA 2ZJRA 3ER0A 1XPOA 3H0GH 1PFSA 3CC7A 1PHJA 2HHHQ 3CCSA 4OX9L 5IWAQ 1Z47A 2VS1A 3F1ZA 1IBMQ 5AJ3Q 1VQ5A 1U0LA 4WJ4A 4GNXC 2UUAL 4GKKL 1CKNB 1I5FA 3KF8B 2YV5A 4NXNL 3M85A 1YIJA 1HNXL 1N8RC 1NE3A 2JA6H 5H1SE 2MO0A 3MXNB 4C3JH 1L1OB 1BKBA 1Q1BA 1TWCH 2IHFA 5C44H 3CMAA 2UUCQ 1X54A 3I4OA 2ID0A 2RHSB 4JI3Q 4Y52H 4O0AA 1Q86C 1CKMA 3G48A 1UE7A 5IP9H 4NXMQ 3M9BA 1HH2P 3J81c 1YNXA 4R4TA 5AJ3L 5LMUL 2NVYH 1J6QA 1S40A 1KC8C 1XNQQ 3PO3G 3L2PA 3HOWH 3AFPA 2IX0A 3S14H 2KHJA 3CW2C 5M3MG 3GO5A 3KF6B 1TWHH 1VS0A 1P16A 4JI7L 4TVAB 2VQEL 2UUCL 1EYGA 1XMQL 5IYBH 1VQFA 3KYHC 1PH7A 1NMFA 1W3SA 3TEHB 3PIOA 1XTDA 4GOPC 1YVCA 3PF4A 1JJCB 1GO3E 5LMNW 1XNRL 4JV5Q 2K5HA 4LWCA 1IBLQ 1L2FA 2B3GA 1OTCA 5LMUQ 1CKNA 1VQ4A 4GLXA 2JE6I 1I50H 4O2DA 1KD1C 3TREA 1KXLA 2YTXA 3PCOB 3A5UA 5C4XG 1KAWA 2K4KA 3OW2A 4LFBL 4YCVA 3I2ZA 1VQKA 2ATWA 1X3FA 1K9MC 3S2HH 4YCWA 4P72A 4IPDA 2CWAA 1KL9A 2VQEQ 1JJ2A 1HNZL 3HOVH 4X62Q 5GQOA 4A3KG 3J81i 4A3MG 5C3EH 1WYDA 3ZJYC 3U4VA 4DR1Q 1PH1A 2ZTCA 2E8GA 2GN5A 3CQZH 1S72A 2E5LL 3KOJA 4X66L 1U5KA 5JEAJ 3G6EA 1QZGA 3M3YH 3K81C 5C0XJ 5GAEC 4DV3Q 1M1KC 4A3GH 1OXXK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3E H;  2ZJP A;  4C3H H;  3JAM c;  1TWG H;  4HIO A;  4JI4 Q;  4BA2 I;  4DR6 L;  4JBM A;  3GTJ H;  1V9P A;  3BZK A;  4QL5 A;  4LF7 Q;  1FVI A;  3AEV A;  3GTQ H;  5IY0 A;  4AQY L;  2PI2 A;  2CFM A;  2R93 G;  1VQ8 A;  4R4I A;  3T1Y L;  1VQL A;  3I55 A;  5LMN L;  4POF A;  3H3V H;  4LF6 L;  2UXC L;  4YCU A;  4JI0 L;  4L5T A;  4H02 A;  3GTM H;  2PMZ E;  5FLM H;  1YI2 A;  1IBK L;  4JYA L;  5GAD C;  3KDF B;  5M3M H;  4OO1 G;  5JJI A;  2JA8 H;  3PO3 H;  1VQM A;  2JJQ A;  4LF8 Q;  2RCN A;  3M7N A;  1N32 L;  1FJG L;  2UXD L;  2QEX A;  3OTO Q;  5JEA G;  1EUJ A;  4XIG S;  2Q2H A;  1NMG A;  3CC2 A;  2D0O A;  4JCV E;  2JQO A;  3L0O A;  1Y1V H;  3W5O A;  1SE8 A;  5C0X G;  2Z6K C;  3I56 A;  3RZO H;  4BY1 H;  1VQB A;  5HGQ A;  4QGU A;  3TRZ A;  2IHE A;  2OQ0 A;  4OWW B;  2VUM G;  3UDX A;  5GRO A;  2VQF L;  4DR7 L;  4PZ7 A;  4A3J G;  3FKI G;  3GTK H;  4TQU S;  3PV0 A;  1YIT A;  1X3E A;  2XGT A;  4A3I H;  3STB C;  1E1T A;  4DV1 L;  1I94 L;  1EQR A;  1VQA A;  3K7A H;  4BXX G;  3PUV A;  1N36 L;  3I4M G;  4GLV B;  2PI2 E;  3PO2 G;  4LF5 Q;  4OWX B;  5IYC H;  1VQN A;  4JI6 L;  3AQQ A;  2A1A A;  1E22 A;  3PGZ A;  3CXC A;  4OX9 Q;  4B3R L;  2ZTE A;  2F52 A;  2KEN A;  2R7D A;  3K80 C;  4A3J H;  4BY7 G;  1SFO H;  2AWN A;  4DV5 L;  4LFC Q;  4DR7 Q;  4DUY L;  4X6A H;  4X65 Q;  2K5V A;  2Q2U A;  1B8A A;  4DUZ Q;  1G51 A;  2OTJ A;  2JA9 A;  1CSP A;  1YZ6 A;  4DV1 Q;  1VQJ A;  1HZC A;  3EIV A;  3UDF A;  4DKA C;  3HOX G;  4APV A;  4J15 A;  4LF4 L;  1BBW A;  4A3C H;  2F4V Q;  4YWM A;  4PZ6 A;  1A62 A;  1QZH A;  1Q82 C;  1FL0 A;  3NEN A;  1CUK A;  1EOV A;  3PUX A;  1KHI A;  1HZ9 A;  3NEL A;  2AWO A;  4DAM A;  1OXS C;  3PUW A;  1HR0 L;  4IPG A;  4GNX A;  1HZB A;  4C3I H;  1VQ6 A;  4DUY Q;  2IY5 B;  2I5H A;  4A4I A;  1WOC A;  3K8A A;  2CQO A;  4JOI C;  4LUV A;  4C2M H;  4DNI A;  4MZ9 A;  4X65 L;  3J7Z C;  4DV7 Q;  2B63 G;  4A3D G;  1EQQ A;  1VCI A;  4KHP L;  2JK8 A;  4DV0 Q;  2UU9 L;  3NBH B;  1IL2 A;  1MJC A;  3PIP A;  4JBW A;  4R4Q A;  1ASZ A;  4MNO A;  4IJL A;  3A0J A;  4JI7 Q;  4RMF A;  4A3E G;  4GLA C;  1AE3 A;  1MIU A;  2Q2I A;  1LYL A;  4OON A;  4P73 A;  2ZM6 Q;  3CD6 A;  4UY8 C;  4A3G G;  2UUB Q;  4IFD I;  1XMO Q;  2YYZ A;  2PQA B;  4QY7 A;  1G29 1;  2QGQ A;  4DR3 L;  1QVG A;  4HJ7 A;  4BY7 H;  1A63 A;  1QVF A;  4QQB X;  4IJH A;  4YY3 Q;  4JI1 L;  3VDY A;  1O7I A;  1WI5 A;  4A3L G;  4KHP Q;  3UDI A;  2NVX H;  3CCJ A;  4LFB Q;  4DV4 Q;  3HFZ B;  4DR2 L;  4JG2 A;  3S1M H;  4DR4 Q;  4L5S A;  2MNA A;  4B3M L;  1NTG A;  1WFQ A;  2LXK A;  1M90 C;  1VQH A;  2R92 G;  3HKZ E;  4DK3 C;  2NVT H;  1VQD A;  2UUB L;  1TWA H;  1V43 A;  3LGJ A;  5IP9 G;  1XNQ L;  4YHH L;  3ULJ A;  5ELO A;  2EQS A;  2HHH L;  4DV2 L;  3G4S A;  4K0K Q;  3S17 H;  4GKJ Q;  4DV3 L;  3BU2 A;  2AKW B;  5EAY A;  1B70 B;  5IYB G;  1JT8 A;  3K7U C;  3J7A 5;  4PZ8 A;  1VQ9 A;  3AYH B;  4JI5 Q;  1UWV A;  1SRU A;  4NPS A;  3PO2 H;  3HOU G;  1E24 A;  2JA8 G;  3RNU A;  1XNR Q;  4JV5 L;  2KCT A;  2MQH A;  3T1H Q;  1YHB A;  4UP9 A;  2ZTD A;  4BXX H;  5FLM G;  3CCE A;  3TS0 A;  2N49 A;  4DPG A;  4JYA Q;  2F3I A;  1K73 C;  2A8V A;  3RR5 A;  5K36 G;  4YWK A;  4HJA A;  3HOY H;  2R93 H;  4OWT B;  1PA6 A;  2D0P A;  3W1G A;  3CCU A;  2B29 A;  2VUM H;  5C44 G;  5JJK A;  4LF9 Q;  4XTC S;  1SMX A;  4X62 L;  2HIX A;  5BR8 Q;  3ULL A;  4LUZ A;  2JA6 G;  2CCZ A;  2PQA A;  4BY1 G;  1LM0 A;  5C4J H;  4UP7 A;  4IO9 A;  2WAQ E;  1HZA A;  1Y1W G;  1C0A A;  1K8A C;  2BH8 A;  5C0X I;  2R92 H;  3T1H L;  2OCE A;  3KF6 A;  3JC6 6;  1N34 L;  1OXU A;  2GVA A;  1KIX A;  2K50 A;  3S1N H;  1HJP A;  5IYD H;  2MFI A;  2QA4 A;  4A3B G;  3F2B A;  3S1Q H;  2R7F A;  3CP0 A;  2NN6 G;  3F8T A;  3S15 H;  5BR8 L;  1AH9 A;  4GN3 B;  2JA7 G;  1PH8 A;  4BA1 I;  2WB1 E;  2K52 A;  4B3R Q;  4JI6 Q;  1PH2 A;  1X55 A;  4JI8 L;  3M4Q A;  2XTI A;  2MO1 A;  4LFC L;  3J81 j;  4AIM A;  2KHI A;  2R6G A;  4B3T L;  1FJG Q;  3RN5 A;  2E5L Q;  3J80 i;  1PVO A;  1I3Q H;  2BA1 A;  1QUQ A;  1WJJ A;  3SGI A;  3WWV A;  5DLQ E;  5M5X H;  4R4O A;  1RL2 A;  2JEB I;  1HNW L;  3IRB A;  4DV6 Q;  4FDB A;  3HOW G;  3CPW A;  1GKH A;  3A74 A;  2I5L X;  1VQI A;  4KLK A;  4L5Q A;  1PH9 A;  2R7Z G;  1HNX Q;  4NXN Q;  4AQY Q;  1D7Q A;  2EXD A;  4IPC A;  4JI2 L;  2HIV A;  1UE5 A;  2I5M X;  1PH3 A;  3NEM A;  5M3F G;  4RG1 A;  4KI0 A;  2K5N A;  4JI0 Q;  1A8V A;  3D0F A;  4HIM A;  3FHW A;  1MKH A;  5J3B A;  4EQ5 A;  4DV0 L;  5GAG C;  2UU9 Q;  2LSS A;  4JBJ A;  3G71 A;  3RN2 A;  1ASY A;  2ZJQ A;  1LTL A;  3CCM A;  1W2B A;  1Q8K A;  1X65 A;  3K0X A;  3JAM i;  4LFA Q;  3J80 c;  2ES2 A;  4LF8 L;  1WCM H;  1IYJ B;  1Q12 A;  3CPF A;  4X64 Q;  1X3G A;  3H15 A;  4DV5 Q;  1X6O A;  4JC0 A;  1JMC A;  1WCM G;  2ALY B;  4DUZ L;  2N8N A;  3A5Z B;  1K3R A;  5IP7 G;  1PYS B;  3CF5 A;  3D31 A;  1OXT A;  3KJO A;  4A3I G;  1E1O A;  1IBM L;  5GAH C;  3UE0 A;  5M3F H;  2KBN A;  3KDF A;  4IPH A;  3FKI H;  4B3S L;  4LW1 A;  2UUA Q;  4GKK Q;  4P75 A;  5FJ8 H;  2WAQ G;  2BH2 A;  2YU9 H;  1VQO A;  4A76 A;  5ELN A;  4LFA L;  2AHO B;  4OXP A;  1YJ9 A;  4OO1 I;  4R4C A;  3ICE A;  3PSI A;  4PMW A;  1EFW A;  4A93 G;  4AYB G;  1N33 L;  2AMC B;  1Y1V G;  2D62 A;  3E9H A;  1HR0 W;  1DGS A;  3S24 A;  2Z6K A;  3PF5 A;  5M5W H;  4HJ9 A;  3HKZ G;  2HQL A;  1Q7Y C;  1XPU A;  1EIY B;  3GTL H;  4LF5 L;  3TS2 A;  4K0K L;  1J5E Q;  1E3P A;  1KRS A;  1X56 A;  4A3F H;  1KQS A;  2V1C C;  2WP8 J;  5FLX c;  1EIF A;  2DUD A;  1PV4 A;  1H95 A;  4JBK A;  2WFW A;  4B3S Q;  1T9H A;  2K75 A;  3DLL A;  3HOZ H;  1P8L A;  1UEB A;  1VQG A;  3U4Z A;  2ZM6 L;  3KJP A;  4YWL A;  3FP9 A;  3GDE A;  3I4N H;  4JI5 L;  3H0G G;  4Y7N H;  2VW9 A;  4DR1 L;  1GM5 A;  4BBR G;  1V1Q A;  1YJN A;  3PUZ A;  3ULP A;  3F2D A;  4ME3 A;  1YHA A;  1Q81 C;  1VQ7 A;  1SR3 A;  2NZH A;  2NN6 I;  4A75 A;  1C7Y A;  3S16 H;  3U50 C;  4BBS G;  2VZA A;  3GD7 A;  4P74 A;  3Q8D A;  4A3D H;  4A3B H;  1D8L A;  4BBR H;  1VQP A;  1HR0 Q;  4POG A;  1YEZ A;  2E2J H;  4JI4 L;  2JEA I;  3PUY A;  3UDG A;  4DR6 Q;  4B3M Q;  2OTL A;  1PH4 A;  4NB3 A;  3CCQ A;  1TWF H;  4LF7 L;  1UE6 A;  4GN4 B;  3CME A;  2JA5 G;  3RZD H;  2JA5 H;  1Z9F A;  4GKJ L;  4L5R C;  5C3E G;  4A3M H;  4YHH Q;  3RLN A;  3KLW A;  4A3F G;  3HKS A;  2IT1 A;  3HOV G;  4JI3 L;  4LUO A;  1IXR A;  3HOX H;  2WB1 G;  4DR5 L;  1SN8 A;  2YTY A;  1KRT A;  1NY4 A;  4HIK A;  1HNZ Q;  4NXM L;  3OYY A;  1JB7 A;  1XMO L;  3W1B A;  5C4X H;  3KFU A;  4AYB E;  2L15 A;  1K83 H;  2VY3 A;  2Y0S E;  3HOY G;  4JOI A;  1G6P A;  5FJ8 G;  4JI1 Q;  3M4P A;  1JE5 A;  1A0I A;  4WJ3 M;  1PH5 A;  2NVQ H;  3CCL A;  3UE1 A;  3HOZ G;  4IOA A;  4EX5 A;  5IYD G;  1XMQ Q;  1RIP A;  4DR4 L;  3GTG H;  3I4M H;  2KCM A;  2HT1 A;  3E0E A;  1TXY A;  3TQY A;  4HJ8 A;  1IZ6 A;  4DR5 Q;  1L1O A;  1NBW A;  2DGY A;  1K8G A;  1CSQ A;  3T1Y Q;  1IBL L;  3H3V I;  5IT9 c;  5LMN Q;  1QUQ B;  4B3T Q;  4LF6 Q;  4LF9 L;  2UXC Q;  1LUZ A;  4HID A;  4DV2 Q;  1N9W A;  5JJL A;  3F2C A;  3AFQ A;  3CAM A;  4PG3 A;  4GS3 A;  2E2I H;  3MEF A;  2VNU D;  1VQC A;  2ASB A;  4GOP A;  3RLF A;  1I6H H;  1N32 Q;  5HY6 A;  3STB D;  3CCV A;  2UXD Q;  1OXV A;  3OTO L;  1XPR A;  4QIW E;  2N3S A;  1N34 Q;  4UP8 A;  2LXJ A;  2PNH A;  4LNQ A;  3I7F A;  2R7Z H;  5IP7 H;  4HJ5 A;  2C35 B;  2VL6 A;  4X66 Q;  4GN5 A;  4JI2 Q;  3CCR A;  3GTO H;  1Q46 A;  3B6Y A;  1Q1E A;  3HOU H;  1Y14 B;  2BA0 A;  4MTN A;  1L0W A;  2VQF Q;  4KHZ A;  4A3L H;  3GTP H;  1GVP A;  4DK6 C;  2EIF A;  2OQK A;  4GNX B;  3M4O H;  4QJF A;  1B7Y B;  4ALP A;  2CKZ B;  3U58 A;  4IFD G;  2Y0S G;  5E7N A;  1I94 Q;  4JI8 Q;  1GD7 A;  2E2H H;  1L1O C;  4GOP B;  2H5X A;  2GVB A;  1BVS A;  3RLO A;  1YHQ A;  3CC4 A;  3E9I A;  3EBE A;  3S1R H;  1MJE A;  1IBK Q;  3ERS X;  2Z0S A;  3BZC A;  4UPA A;  5IE8 A;  1K0R A;  2YTV A;  2I0Q A;  1QVC A;  2NZO A;  2CWP A;  1CKO A;  4IOC A;  1FGU A;  2B63 H;  2FXQ A;  3I4N G;  1HNW Q;  2N78 A;  4DV6 L;  1SLJ A;  1X9N A;  1S3O A;  4P71 A;  4A3K H;  2UXB Q;  1NJI C;  1UE1 A;  1PH6 A;  4DR3 Q;  2A19 A;  2RHQ B;  1N33 Q;  3DM3 A;  1C9O A;  1SRO A;  5M5Y H;  4LF4 Q;  4A3C G;  5IWA L;  4YY3 L;  4DAY B;  2F4V L;  1AE2 A;  1E7Z A;  4AH6 A;  3S2D H;  1R9T H;  4IFD J;  1J5E L;  1Y1W H;  3EN2 A;  4DV4 L;  4DR2 Q;  1EWI A;  1XJV A;  3BJU A;  1VQE A;  2OWO A;  4A93 H;  1YJW A;  2Q2T A;  2RF4 A;  2K14 A;  1BBU A;  4BBS H;  2JA7 H;  4DV7 L;  4X64 L;  1JJG A;  2IX1 A;  2UXB L;  1YBY A;  1N36 Q;  3L7Z C;  4R1J A;  5IYC G;  1PYB A;  2ZJR A;  3ER0 A;  1XPO A;  3H0G H;  1PFS A;  3CC7 A;  1PHJ A;  2HHH Q;  3CCS A;  4OX9 L;  5IWA Q;  1Z47 A;  2VS1 A;  3F1Z A;  1IBM Q;  5AJ3 Q;  1VQ5 A;  1U0L A;  4WJ4 A;  4GNX C;  2UUA L;  4GKK L;  1CKN B;  1I5F A;  3KF8 B;  2YV5 A;  4NXN L;  3M85 A;  1YIJ A;  1HNX L;  1N8R C;  1NE3 A;  2JA6 H;  5H1S E;  2MO0 A;  3MXN B;  4C3J H;  1L1O B;  1BKB A;  1Q1B A;  1TWC H;  2IHF A;  5C44 H;  3CMA A;  2UUC Q;  1X54 A;  3I4O A;  2ID0 A;  2RHS B;  4JI3 Q;  4Y52 H;  4O0A A;  1Q86 C;  1CKM A;  3G48 A;  1UE7 A;  5IP9 H;  4NXM Q;  3M9B A;  1HH2 P;  3J81 c;  1YNX A;  4R4T A;  5AJ3 L;  5LMU L;  2NVY H;  1J6Q A;  1S40 A;  1KC8 C;  1XNQ Q;  3PO3 G;  3L2P A;  3HOW H;  3AFP A;  2IX0 A;  3S14 H;  2KHJ A;  3CW2 C;  5M3M G;  3GO5 A;  3KF6 B;  1TWH H;  1VS0 A;  1P16 A;  4JI7 L;  4TVA B;  2VQE L;  2UUC L;  1EYG A;  1XMQ L;  5IYB H;  1VQF A;  3KYH C;  1PH7 A;  1NMF A;  1W3S A;  3TEH B;  3PIO A;  1XTD A;  4GOP C;  1YVC A;  3PF4 A;  1JJC B;  1GO3 E;  5LMN W;  1XNR L;  4JV5 Q;  2K5H A;  4LWC A;  1IBL Q;  1L2F A;  2B3G A;  1OTC A;  5LMU Q;  1CKN A;  1VQ4 A;  4GLX A;  2JE6 I;  1I50 H;  4O2D A;  1KD1 C;  3TRE A;  1KXL A;  2YTX A;  3PCO B;  3A5U A;  5C4X G;  1KAW A;  2K4K A;  3OW2 A;  4LFB L;  4YCV A;  3I2Z A;  1VQK A;  2ATW A;  1X3F A;  1K9M C;  3S2H H;  4YCW A;  4P72 A;  4IPD A;  2CWA A;  1KL9 A;  2VQE Q;  1JJ2 A;  1HNZ L;  3HOV H;  4X62 Q;  5GQO A;  4A3K G;  3J81 i;  4A3M G;  5C3E H;  1WYD A;  3ZJY C;  3U4V A;  4DR1 Q;  1PH1 A;  2ZTC A;  2E8G A;  2GN5 A;  3CQZ H;  1S72 A;  2E5L L;  3KOJ A;  4X66 L;  1U5K A;  5JEA J;  3G6E A;  1QZG A;  3M3Y H;  3K81 C;  5C0X J;  5GAE C;  4DV3 Q;  1M1K C;  4A3G H;  1OXX K; 
#chains in the Genus database with same CATH topology
 4A3E H;  4DR6 L;  3GTJ H;  1V9P A;  1SYE A;  1LV9 A;  1FVI A;  1IKL A;  2QIL A;  2MJ8 A;  5IY0 A;  3GTQ H;  4R4I A;  4DNR B;  1HTP A;  4JI0 L;  3GTM H;  3J81 L;  2PMZ E;  5FLM H;  1YI2 A;  1IBK L;  1RDP D;  4JYA L;  5GAD C;  3N52 A;  2QW7 A;  5JJI A;  3MVV A;  2JA8 H;  1VQM A;  2NWG A;  2QEX A;  4XIG S;  1STN A;  3CC2 A;  2D0O A;  2QEJ C;  4FF4 A;  1BF4 A;  1SE8 A;  3RZO H;  1HPC A;  1VQB A;  5E1F A;  2IHE A;  3P20 A;  2OQ0 A;  4OWW B;  1LT6 D;  5FO7 B;  3FKI G;  1ILP A;  1HRJ A;  4TQU S;  4KY6 A;  1CA5 A;  2VB3 X;  3BVZ A;  3STB C;  4F8M A;  4BXX G;  1EY9 A;  1N36 L;  1TY0 A;  2F0K A;  5IYC H;  2E2H B;  1STH A;  2M2L A;  1B1Z A;  2ZTE A;  2KEN A;  5T1G A;  1SFO H;  2AWN A;  4DV5 L;  3A7A B;  4DUY L;  4X6A H;  4X65 Q;  1LT5 D;  1G51 A;  1S5D D;  4OEL B;  1YZ6 A;  3DWQ A;  2X6G A;  1VQJ A;  1HZC A;  3EIV A;  3MWY W;  4YIJ A;  4A3C H;  3ONA B;  3NEN A;  1BCP D;  1KHI A;  1LTS D;  2AWO A;  1OXS C;  3VR3 A;  4GNX A;  5LL6 S;  1VQ6 A;  3HOY B;  3GTK B;  1LT4 D;  2B63 G;  1SYC A;  2RDF A;  1EQQ A;  2QCP X;  4DV0 Q;  1U4P A;  4JBW A;  2O2L D;  5KEE A;  3A0J A;  4RMF A;  4KKT A;  1AE3 A;  1MIU A;  2Q2I A;  2ZM6 Q;  3FVQ A;  2UUB Q;  4IFD I;  1EZ6 A;  1XMO Q;  1VF5 C;  2YYZ A;  2Y0S B;  2PQA B;  1A3U A;  2QGQ A;  1QVG A;  1ESR A;  1A63 A;  2FJ2 A;  4IJH A;  5CBE E;  3VDY A;  1KNE A;  1O7I A;  3T13 A;  4KHP Q;  3J7A F;  3CCJ A;  3HFZ B;  2Q8R E;  4JG2 A;  4L5S A;  2MNA A;  1VQH A;  5G3L F;  4DK3 C;  1VQD A;  4CKC A;  1V43 A;  3LGJ A;  5CV9 A;  1RCV D;  1S5C D;  2MUY A;  2F3W A;  3E3X A;  4K0K Q;  3K5N A;  1EY8 A;  5ELB A;  5EAY A;  5IYB G;  4C3J G;  3J7A 5;  1ET6 A;  3EQL C;  4PZ8 A;  1VQ9 A;  3AYH B;  1IKM A;  1UWV A;  2LY7 A;  4RCN A;  4JV5 L;  2KCT A;  3T1H Q;  4EGV A;  2F0S A;  5K36 G;  4YWK A;  4HJA A;  3HOY H;  4OWT B;  1HCZ A;  2O5J C;  5IOD A;  3W1G A;  2B29 A;  2VUM H;  4RWS C;  4X62 L;  4LUZ A;  4ZQ3 A;  3D4W A;  3VR4 A;  1G2S A;  1SFO B;  2WII B;  1SNQ A;  3J7Y W;  1C0A A;  1JC7 A;  4NKL A;  5BN4 A;  2R92 H;  3KF6 A;  1LTG D;  5M3M B;  1KIX A;  1TY2 A;  5IYD H;  3NTI A;  3X3M A;  4A3B G;  4K8J A;  5DM7 3;  3S1Q H;  2NN6 G;  3QB3 A;  2FIN B;  1EWC A;  3OMG A;  1JQY D;  2EYM A;  1I4R A;  3P7J A;  3M4Q A;  4LFC L;  2R6G A;  1FJG Q;  3RN5 A;  1JCK B;  4V19 0;  4PNY A;  3SVM A;  4A3K B;  1O78 A;  1HNW L;  3IRB A;  4DV6 Q;  1DXM A;  2I5L X;  2TMP A;  1HNX Q;  2EXD A;  2G9H D;  3D8G A;  1WD0 A;  1JE4 A;  2F0F A;  2HIV A;  2I5M X;  3NEM A;  1PH3 A;  3S1M B;  2K5N A;  3QR8 A;  2XWB B;  1LTL A;  2NZ1 D;  5JJZ A;  1PRT C;  2BDO A;  4LF8 L;  1WCM H;  1NUC A;  1X6O A;  4JC0 A;  5CBA E;  1ICF B;  4ZUJ A;  2CHB D;  2PCF B;  5F2D A;  3CF5 A;  2K01 A;  1OXT A;  3KJO A;  3JAM E;  2KBN A;  3KDF A;  3FKI H;  1W6K A;  4P75 A;  2WAQ G;  1XXG A;  3DWP A;  4A76 A;  5ELN A;  2AHO B;  1YJ9 A;  4OO1 I;  4A93 G;  1LAB A;  2CH4 W;  1BR9 A;  2LS0 1;  4AYB G;  2AMC B;  1DGS A;  3S24 A;  4HJ9 A;  1Q7Y C;  4K0K L;  1J5E Q;  1X56 A;  1ZYR C;  1XTC D;  4CGY B;  1PV4 A;  2DUD A;  2B2W C;  2WFW A;  1B2T A;  4B3S Q;  1DJR D;  3HOZ H;  1P8L A;  1UEB A;  3KJP A;  4JI5 L;  4Y7N H;  1MI2 A;  1EY6 A;  4RGT A;  4DR1 L;  1GM5 A;  3PUZ A;  2L0C A;  4I7A A;  4CDC C;  1D1K A;  1I3Q B;  2NN6 I;  5C6A A;  5CMD A;  3H91 A;  4K2L A;  2F0G A;  4K14 A;  3M7G A;  1D8L A;  3K5O A;  1HR0 Q;  2JEA I;  4DR6 Q;  3UDG A;  4Q0F A;  1JOR A;  1B53 A;  2K5W A;  4GN4 B;  3CME A;  2JA5 G;  3EA6 A;  2JSO A;  1ZYR D;  1YNN D;  2DNE A;  4YHH Q;  3RLN A;  3KLW A;  4A3F G;  1JOK A;  2F0Q A;  3SHL A;  2IT1 A;  3HOV G;  3HOZ B;  4RKL A;  2WB1 G;  2B39 A;  1B9N A;  1KRT A;  3AU7 A;  1II3 A;  4NXM L;  1JB7 A;  3ITP A;  2L15 A;  1K83 H;  2NB0 A;  2EPB A;  2VY3 A;  4JOI A;  2IX3 A;  5C4J B;  1H9S B;  4RKB A;  1A0I A;  1PH5 A;  1GJX A;  4EX5 A;  3NUC A;  4B9X A;  4DR4 L;  2KA7 A;  3E0E A;  3TME A;  1TXY A;  2JA7 B;  1NBW A;  2DGY A;  1O7L A;  3LWE A;  4OEM B;  5CC4 A;  5ELF A;  1LUZ A;  1TWF B;  3SDZ A;  3AFQ A;  4GS3 A;  5I6Y A;  2VNU D;  2X69 A;  1I4H A;  1N32 Q;  3MTS A;  3STB D;  1N34 Q;  1G6Z A;  3QOL A;  1MSG A;  1A3T A;  1H9S A;  2LXJ A;  4LNQ A;  1FNW A;  2R7Z H;  2XIW A;  4MIU A;  2VL6 A;  2LMC B;  3CCR A;  3CKI B;  2RSO A;  1LTB D;  3I73 A;  3IAY A;  1GVP A;  4DK6 C;  2OQK A;  4GNX B;  1B7Y B;  4IFD G;  5E7N A;  5KNB A;  4N8X 1;  4JI8 Q;  3OSO A;  2E2H H;  2JP1 A;  1YHQ A;  1BVS A;  3RLO A;  5EKL A;  2WKD A;  3NWT A;  5CGK A;  3E9I A;  5D3D A;  3EBE A;  3BZC A;  1QVC A;  3KK7 A;  5CV7 A;  4C3H B;  1FGU A;  1HTL D;  1SND A;  2FXQ A;  2N78 A;  1SLJ A;  3K58 A;  1S3O A;  4P71 A;  1FNU A;  5EBD A;  4G7H C;  5M5X B;  2XVS A;  1B9M A;  1E0B A;  1SRO A;  5TSS A;  5KGU A;  4X3T A;  1STA A;  1AE2 A;  4AH6 A;  4Y7N B;  4G57 A;  4CDF C;  1R9T H;  4IFD J;  5I4D A;  1J5E L;  1Y1W H;  1EWI A;  3BJU A;  1SXT A;  1AEX A;  4A93 H;  2Q2T A;  2K14 A;  5G3L D;  3P75 A;  2JA7 H;  4DV7 L;  1MSH A;  4DA2 A;  4ABN A;  3BG3 A;  4QB4 A;  3ER0 A;  3H0G H;  1PFS A;  5J22 A;  5IIF A;  1GXD C;  2PQE A;  2QF7 A;  1K83 B;  4C3I G;  4OX9 L;  1K0S A;  2EDG A;  5AJ3 Q;  5EPK A;  1D6E C;  4NXN L;  2YV5 A;  3TBI B;  2VUM B;  1EYD A;  1S5F D;  3R2I A;  1NE3 A;  1S4Z A;  2JA6 H;  1E2V A;  5M9O A;  1BKB A;  2IHF A;  2Z6B A;  2DJG C;  1X54 A;  3J80 E;  2F03 A;  3G48 A;  5IP9 H;  1DZ1 A;  3J81 c;  1YNX A;  2F4I A;  1WTH A;  4R4T A;  4XDX A;  2NVY H;  1J6Q A;  1S40 A;  1XNQ Q;  3PO3 G;  3L2P A;  2L9H A;  3AFP A;  5M3M G;  1KDB A;  2A5H A;  3E5S A;  1LTA D;  3GO5 A;  2F0O A;  3BDO A;  2RDG A;  1P16 A;  4JI7 L;  4TVA B;  2UUC L;  1YNJ D;  3KYH C;  4E6I A;  3CHB D;  3EJI A;  1SMY D;  1JJC B;  5DEH A;  1XNR L;  4TKO B;  4LWC A;  1EEI D;  3DHQ A;  2BCO A;  5IGE A;  1VQ4 A;  2NTS A;  2L5T A;  1KXL A;  4LFB L;  4YCV A;  4L63 B;  3I2Z A;  1K9M C;  4YCW A;  1HNZ L;  5C5M A;  4X62 Q;  4KHV A;  3HOV H;  1EY0 A;  4RHR A;  1EY7 A;  2K1B A;  4A3K G;  4DAP A;  5C3E H;  3ZJY C;  2ZTC A;  2GN5 A;  4K2K A;  3M3Y H;  1TII D;  1NSN S;  3K81 C;  4HMJ A;  1IW7 D;  4DV3 Q;  4C3H H;  1C4Q A;  4HIO A;  4BA2 I;  1FD7 D;  4O1N A;  1ZKO A;  1YNN C;  3BZK A;  4LF7 Q;  1PYW D;  2CFM A;  2R93 G;  5KYL A;  2K32 A;  5LMN L;  2EZV A;  4YCU A;  4H02 A;  5EPL A;  1I4Q A;  2WKC A;  3E6Z X;  4K6D A;  4OO1 G;  2JJQ A;  2MHV A;  3MC0 B;  3M7N A;  4EQO A;  1FJG L;  3OTO Q;  4XQQ A;  5JPN C;  1NMG A;  5LL6 X;  2JQO A;  1Y1V H;  4ULL A;  1JR0 D;  4BY1 H;  2XRQ D;  5HGQ A;  3ERO A;  1EIH A;  3Q22 A;  1AN8 A;  5GRO A;  4R8I A;  4PZ7 A;  3PV0 A;  3C1F A;  1X3E A;  2NYZ D;  4L6T B;  3MEH A;  4A3I H;  1E1T A;  4DV1 L;  4KJO A;  3K7A H;  4N8F A;  2K03 A;  1I6V C;  3I4M G;  3VYT A;  2PI2 E;  1D5X C;  2ZT9 C;  1CA6 A;  4LF5 Q;  4JI6 L;  3PGZ A;  4OX9 Q;  4Z9C B;  3CXC A;  4CJ0 B;  1O80 A;  2F52 A;  2BDN A;  4BY7 G;  4KKS A;  4H13 C;  1I4P A;  5FOB B;  2EY5 A;  2NVX B;  4DKA C;  4J15 A;  2SOB A;  3K6O A;  3C2P A;  3J80 L;  1F77 A;  4PZ6 A;  1Q82 C;  1FL0 A;  4DAM A;  1WTR A;  1HZ9 A;  3H6M A;  1HR0 L;  4IPG A;  1HZB A;  3QJY A;  2IY5 B;  1I4X A;  4A4I A;  4X65 L;  3K8A A;  2CQO A;  3J7Z C;  4DNI A;  4A3D G;  1JWM D;  1VCI A;  4KHP L;  4OGQ C;  2JK8 A;  2UU9 L;  4LK1 C;  1IL2 A;  5KNC A;  1ASZ A;  2F0D A;  4IUV A;  4A3E G;  3S2H B;  1LYL A;  3CD6 A;  1GUO A;  5JAV A;  3MFG A;  2RQX A;  4BY7 H;  1QCB D;  2KCN A;  3MXU A;  4QQB X;  4YY3 Q;  4JI1 L;  1WI5 A;  3UDI A;  2K5D A;  4DV4 Q;  5E4X A;  2A74 C;  1NTG A;  2LXK A;  2F0L A;  2R92 G;  1TWA H;  3WDN A;  5M5Y B;  1E2W A;  1A3V A;  4QUF A;  2EQS A;  1DON A;  3KBX A;  4GKJ Q;  3S2D B;  4ZYS A;  1SJE D;  2HD3 A;  4C56 C;  3RMH A;  1U4R A;  2PZU A;  1SRU A;  3PO2 H;  1C8C A;  1E24 A;  4MN3 A;  2JA8 G;  3RNU A;  4K5W A;  4BY1 B;  5FLM G;  5I6W A;  3MXP A;  3OOC A;  2N49 A;  2F3V A;  2A8V A;  4KTA A;  5DM6 3;  1WTQ A;  2R93 H;  4IUR A;  3NXW A;  1HFG A;  3LNN A;  5C44 G;  1GUS A;  4LF9 Q;  4A3F B;  2ZXO A;  2VXW A;  1QNK A;  2HIX A;  1T5E A;  4OHJ A;  2JA6 G;  4C3H G;  5D3I B;  2OCE A;  5IT9 E;  1N34 L;  1OXU A;  1HJP A;  3R8B A;  1LTR D;  4IAL A;  4C1N K;  4BBS B;  2QA4 A;  2JYO A;  3KBG A;  3BZD B;  4OIK A;  1STB A;  2JA7 G;  1PH8 A;  3CQZ B;  3QWN A;  1DYQ A;  1U9R A;  3T56 B;  4BA1 I;  2WB1 E;  1EWH A;  4A3E B;  1ZEQ X;  2IJ0 A;  3TN2 A;  4JI8 L;  2K5Q A;  2XTI A;  2MO1 A;  1MGS A;  4AIM A;  3NWS A;  2PW5 A;  1SSO A;  1XYI A;  3S16 B;  1QUQ A;  2A69 D;  3W3A A;  3NTK A;  4U67 3;  1H9J A;  1R4Q B;  3IL8 A;  4DNT B;  1XX8 A;  1HUM A;  4KLK A;  4L5Q A;  3BS1 A;  4NXN Q;  5JOB A;  1LT3 D;  1QG7 A;  5M3F G;  5BN5 A;  1V8Q A;  4EQN A;  4JI0 Q;  1A8V A;  3D0F A;  1SDF A;  4GZY C;  2J7Z A;  1STG A;  5E4W C;  5J3B A;  2UU9 Q;  4KD4 A;  1CZW A;  1PTO B;  1W2B A;  4PMC A;  1Q8K A;  1I6H B;  3GTJ B;  1JMC A;  3H15 A;  1X3G A;  2IWH A;  2RKS A;  5JVG 3;  4KN4 C;  4X3U A;  3MXN A;  4ILW A;  5A2Q L;  3A5Z B;  1PYS B;  3FRP B;  2Z9H A;  4KMU C;  4DXF A;  3UE0 A;  1TS3 A;  3KLR A;  5M3F H;  4IPH A;  5FJ8 H;  2BH2 A;  1VQO A;  1U4L A;  4LFA L;  3A7L A;  5AFW A;  2L11 A;  1KAA A;  3E9H A;  4CKE A;  1HR0 W;  5M5W H;  3HKZ G;  2HQL A;  5IGD A;  1ENC A;  1ONL A;  1EIY B;  4GKJ L;  2V1C C;  5J1Z A;  2FFK B;  1Z6H A;  2K75 A;  3DLL A;  2ZM6 L;  2A6H D;  2X6L A;  1CHQ D;  4AYB B;  3UI2 A;  3FP9 A;  3H0G G;  3GQB A;  1PTO D;  3ULP A;  3F2D A;  1VQ7 A;  3CU7 A;  3S16 H;  1TS4 A;  3GD7 A;  1Y1V B;  1GOZ A;  3Q8D A;  4A3B H;  1YEZ A;  1EU4 A;  4QUC A;  2TSS A;  2EYL A;  3KLS X;  2OTL A;  4NB3 A;  3R93 A;  3CCQ A;  4IFD H;  4LF7 L;  3OHX C;  2HCC A;  2PO4 A;  2JA5 H;  1Z9F A;  3ND9 A;  1SAP A;  2BE5 D;  2EYH A;  1F2Z A;  4LUO A;  4DR5 L;  1HNZ Q;  3NBH A;  1ROD A;  3QO2 A;  4FO2 A;  4DK0 A;  1XMO L;  2B2V C;  3KFU A;  1SNP A;  3EFX D;  5I2Y A;  3TP6 A;  3HOY G;  1G6P A;  3U9S A;  2NVT B;  2D9U A;  3M4P A;  2DJF C;  3E0J A;  4WJ3 M;  3HOZ G;  2R7Z B;  1XMQ Q;  2YU9 B;  1RIP A;  4XQJ A;  2HT1 A;  4HJ8 A;  1IZ6 A;  5C3E B;  1JB3 A;  5IGF A;  5IT9 c;  5M5W B;  5LMN Q;  1QUQ B;  1KDC A;  4B3T Q;  4LF6 Q;  2K04 A;  1N9W A;  4ZCK A;  3F2C A;  1VMP A;  2Z4H A;  3CAM A;  4PG3 A;  4FP5 D;  3S9W A;  4F88 A;  5HUR A;  5I2X A;  1VQC A;  4GOP A;  3RLF A;  3CRL C;  2UXD Q;  3OTO L;  1XPR A;  2EYO A;  4QIW E;  5FLX L;  3TP7 A;  4UP8 A;  2PNH A;  1SMY C;  5KIX A;  1NR2 A;  3ND8 A;  3LX0 A;  1Q46 A;  2MGS A;  2SNS A;  1Q1E A;  4MTN A;  2BA0 A;  3MHB A;  4KHZ A;  3K5M A;  3M4O H;  2E2D C;  1RJT A;  2CKZ B;  3U58 A;  1LO5 D;  1I94 Q;  2H5X A;  1CT1 D;  3H0G B;  4DN4 M;  4UPA A;  2RVL A;  5IE8 A;  2DN8 A;  1K0R A;  2NBF A;  5EQ0 A;  1SE2 A;  1CKO A;  1BBX C;  3HG9 A;  1HNW Q;  4DV6 L;  2UXB Q;  2A19 A;  2C9O A;  2RHQ B;  3PQI A;  1C9O A;  1CHP D;  5M5Y H;  4LF4 Q;  1CZG A;  4A3C G;  4IUP A;  4DAY B;  2F4V L;  1RD9 D;  1E7Z A;  1B3Q A;  2PMZ B;  4DR2 Q;  1VQE A;  2OWO A;  2RF4 A;  3GTG B;  3I4M B;  5CV5 A;  2VB2 X;  1KNA A;  2L1B A;  4A93 B;  4X64 L;  2AQ2 B;  1TR5 A;  2IX1 A;  2GA4 B;  4J8Q A;  2G5D A;  2K05 A;  4R1J A;  1PYB A;  4IN3 A;  5IWA Q;  1Z47 A;  4OIJ A;  4WJ4 A;  4GNX C;  3M85 A;  3KF8 B;  1HNX L;  1AP0 A;  1BQQ T;  4N9P A;  3FKI B;  3NTH A;  1L1O B;  5DAU A;  1S5E D;  1JWS D;  3L3O C;  3NSW A;  1SYG A;  2E75 C;  4Y52 H;  1UE7 A;  2ZXP A;  1EOT A;  1HXY D;  1RF2 D;  4A3D B;  3M9B A;  1HH2 P;  3S17 B;  3VR2 A;  2NUC A;  3SR1 A;  4LMQ D;  2IX0 A;  2KHJ A;  4OO1 H;  3V96 A;  3KF6 B;  1GUG A;  1OO9 B;  1VS0 A;  1FR3 A;  1VDZ A;  3I90 A;  4CJ2 C;  1EYG A;  1XMQ L;  5IYB H;  1NMF A;  3G7L A;  3TEH B;  1A2U A;  3D4R A;  1QIL A;  5LMN W;  2IW3 A;  1CKN A;  4GLX A;  3DWA A;  1EY5 A;  1JOO A;  3TRE A;  3A5U A;  1KAW A;  2K4K A;  3H94 A;  4DF7 A;  1VQK A;  2NN6 H;  4KJN A;  2VQE Q;  4P72 A;  4IPD A;  1JJ2 A;  2PZW A;  1UNS A;  4A3M G;  1H9K A;  1WYD A;  3U4V A;  4DR1 Q;  1WTW A;  1PH1 A;  2DY8 A;  3HGB A;  2E5L L;  5FK9 C;  4X66 L;  1U5K A;  3M4Y A;  2P5Z X;  2K28 A;  4C1N I;  5C0X J;  5GAE C;  2EY2 A;  4A3G H;  2F0U A;  2ZJP A;  4JI4 Q;  4KK7 A;  2EYF A;  4WOR A;  4QL5 A;  2ICE C;  2PI2 A;  1TKW B;  1VQ8 A;  1DD2 A;  2B2U C;  2UXC L;  3QIA A;  4L5T A;  1L0Y B;  5M3M H;  3PO3 H;  4I65 A;  1G8Z D;  1N32 L;  2L4N A;  5JEA G;  1XWE A;  2Q2H A;  5C0X G;  1CI3 M;  4JCV E;  3I56 A;  4RHS A;  1TWG B;  2Z6K C;  4QGU A;  3Q6S A;  1WVL A;  1GUT A;  2NTT A;  4XQN A;  4IUN A;  3NHH A;  1RTO A;  2WB1 B;  4K6L A;  1YIT A;  2MPM A;  2XGT A;  1AZP A;  1BO0 A;  1SYB A;  5E3F A;  5JEA H;  1HHV A;  4XYQ A;  1EQR A;  1CK1 A;  2AQ3 B;  2XRS D;  1A6X A;  5A35 A;  3DXJ C;  3PO2 G;  2JN4 A;  1VQN A;  3OIQ A;  3LWU A;  1E22 A;  3K80 C;  4KV6 A;  1MBY A;  5LHY 1;  4LFC Q;  4DR7 Q;  2K7V A;  1SE3 A;  3X3N A;  2K5V A;  2Q2U A;  4KN7 C;  2OTJ A;  3SK4 A;  1CSP A;  3I8Z A;  2RBM A;  1ZXT A;  4DV1 Q;  3HOX G;  3SK8 A;  1F2L A;  2D2C C;  4APV A;  4U68 A;  1CFM A;  4IUU A;  4EVO A;  3EVQ A;  4BY7 B;  4XXE A;  1EOV A;  1ILQ A;  3PUX A;  1CTM A;  3NEL A;  3PUW A;  5KND A;  2SNM A;  4C3I H;  2EJG C;  2HUG A;  2I5H A;  3T4A C;  4LUV A;  4JOI C;  3SK6 A;  5A2Q E;  4DV7 Q;  1Y69 U;  1Q3L A;  2I07 B;  3NBH B;  1SNM A;  1G2T A;  1PDQ A;  1MJC A;  3NQI A;  3PIP A;  2KUM A;  1Z7T A;  4R4Q A;  4IJL A;  2A68 D;  4MTK A;  1HA6 A;  1QE6 A;  3O13 A;  4GLA C;  4P73 A;  2WV6 D;  4OON A;  2XNA C;  4UY8 C;  1SJH D;  1BCP C;  4QY7 A;  4DR3 L;  1Q90 A;  5EGT A;  1PZJ D;  1QVF A;  1IYU A;  1M4V A;  4A3L G;  5JPM C;  2NVX H;  4WJW A;  1ENA A;  3S1M H;  4ODG A;  4B3M L;  1WFQ A;  3TDQ A;  3PMF A;  3GV3 A;  2NVT H;  3ERQ A;  4B08 A;  3PIP 3;  1XNQ L;  3ULJ A;  5ELO A;  2HHH L;  3L9A X;  4IZ8 A;  4RFB A;  3OWE B;  4ID6 A;  3GP7 A;  3OPO A;  2RDH A;  3OMC A;  1JT8 A;  3K7U C;  4HN7 A;  2OXP A;  4CKB A;  4JI5 Q;  5L37 A;  1XNR Q;  3HP3 A;  5C3X A;  4H7B A;  4XYO A;  1YHB A;  3CCE A;  3TS0 A;  2B2W A;  1QB5 D;  4JYA Q;  4S3S A;  1ENF A;  1PA6 A;  3JAM L;  4EQP A;  3CCU A;  1EEF D;  1VF7 A;  1SMX A;  2F0T A;  5BR8 Q;  3ULL A;  4N9T A;  4BY1 G;  1TS2 A;  2A6H C;  5C4J H;  4UP7 A;  2WAQ E;  1HZA A;  4ZAI A;  1Y1W G;  1K8A C;  3T51 B;  1CQV A;  5C0X I;  1X32 A;  2GVA A;  2D5D A;  3S1N H;  2SDF A;  3VA7 A;  2MFI A;  3K5L A;  5EJW A;  5CV4 A;  1BOS A;  3F2B A;  1KTK A;  2R7F A;  3CP0 A;  3F8T A;  2EJF C;  2EOT A;  1AH9 A;  1LAC A;  2XN9 C;  3A55 A;  1RTN A;  2MP1 A;  3K0Y A;  4RAU C;  4HMI A;  4UHV A;  5EBC A;  2F0N A;  4ZRZ A;  2KHI A;  2E74 C;  3J80 i;  1PVO A;  1I3Q H;  2BA1 A;  3SGI A;  1B44 D;  5DLQ E;  2QDL A;  4DXG A;  3J7A V;  1EU3 A;  3BVG A;  4KD3 A;  5J39 A;  4BWG B;  3HOW G;  2EY6 A;  2L12 A;  2AUK A;  3A74 A;  1F2M A;  4AQY Q;  3SK5 A;  4IPC A;  4RG1 A;  1SEB D;  2WAQ B;  2LKV A;  4HIM A;  3FHW A;  4EQ5 A;  4DV0 L;  5GAG C;  4CJ1 B;  4A3I B;  1ASY A;  2ZJQ A;  3G71 A;  4XT3 B;  3CCM A;  3JAM i;  4LFA Q;  5IGB A;  1HQR D;  1IYJ B;  1Q12 A;  1F9S A;  3CPF A;  4X64 Q;  4F87 A;  5I9P A;  2F0H A;  1WCM G;  2ALY B;  3QOJ A;  4DUZ L;  2EE1 A;  1HFN A;  3NE5 B;  1HA5 A;  5IP7 G;  1UEA B;  5CV8 A;  4C3J B;  1SBB B;  4UAI A;  3V2T A;  3J81 E;  4LW1 A;  2UUA Q;  1X3Q A;  1EYC A;  2CQA A;  1PRT D;  3U9O A;  4OXP A;  4R4C A;  1PLF A;  2AQ1 B;  3ICE A;  4PMW A;  4LAA A;  1C48 A;  1YNJ C;  1SYD A;  2OEO A;  3PF5 A;  1XPU A;  3GTL H;  2R3Z A;  4LF5 L;  1V1P B;  4IUQ A;  1KRS A;  1KQS A;  5CYU A;  2WP8 J;  5FLX c;  1WTX A;  1F2Y A;  4JBK A;  2ZXR A;  1IHZ A;  1WTV A;  1T9H A;  2LFN A;  5IGG A;  4JW0 A;  4FYD A;  1VQG A;  1TU2 B;  2DNC A;  3U4Z A;  4YWL A;  2HDL A;  4K8I A;  2VW9 A;  1V1Q A;  1R9T B;  3IKJ A;  3TZU A;  1Q81 C;  1YHA A;  2EYP A;  3NQT A;  2NZH A;  5ISR A;  4A75 A;  1C7Y A;  1PXU A;  4QCL A;  1LTT D;  3WOF A;  3VA5 A;  3TP8 A;  4POG A;  4JI4 L;  2E2J H;  3RUZ A;  1UE6 A;  2A68 C;  3RZD H;  3RZO B;  1GHK A;  3DMU A;  4L5R C;  3S1Q B;  1QJO A;  3HKS A;  4LJZ C;  1GHJ A;  4JI3 L;  5FKA C;  4BS9 A;  3HOX H;  1SN8 A;  4HIK A;  3MAQ A;  2KVM A;  3OWF A;  1V1O A;  5C4X H;  4AYB E;  3T53 B;  1TS5 A;  2KOL A;  1TWA B;  5K36 H;  5FJ8 G;  2KEC A;  4JI1 Q;  3SXH A;  4HSV A;  4DAY A;  3GTM B;  4IOA A;  5IYD G;  1K28 A;  2JA5 B;  3TQY A;  4DR5 Q;  2F0E A;  2NVY B;  1IBL L;  3NP8 A;  2UXC Q;  4LF9 L;  4HID A;  1O7Y A;  3BVM A;  3FEW X;  3DM1 A;  4DV2 Q;  2KJX A;  3AMU A;  2ASB A;  3CRK C;  2F0W A;  3CCV A;  2N3S A;  3A54 A;  1WTP A;  1EIG A;  2B63 B;  2PPB C;  3I7F A;  5IP7 H;  2C35 B;  3B6Y A;  3M4O B;  1F9P A;  5KYI A;  3GTP H;  2EIF A;  4HCS A;  4HSP A;  1EZ8 A;  1BUV T;  2Y0S G;  3NK9 A;  1GD7 A;  1L1O C;  4GOP B;  2EJM A;  1PFM A;  1NCV A;  2GVB A;  2B8G A;  2V4D A;  2O5I C;  1MJE A;  4TSS A;  3RZD B;  3ERS X;  4R8N A;  4Q5V A;  2CWP A;  2B2Y A;  4QF4 A;  2B63 H;  3I4N G;  1O7Z A;  4RGM A;  1X9N A;  1NJI C;  5C44 B;  4DR3 Q;  3K7A B;  4X3K A;  1MHW C;  5IWA L;  2PW7 A;  1G91 A;  5C3W A;  4I7Z C;  2AUJ D;  3EN2 A;  1B3A A;  3N6R A;  3NBI A;  1EQT A;  3FPP A;  2J4X A;  3I3C A;  3IFT A;  1B4O A;  3G6J B;  1BBU A;  4BBS H;  1JJG A;  3SEB A;  1H9R A;  1YBY A;  2UXB L;  3A8K E;  1FNV A;  5IYC G;  1XPO A;  2HHH Q;  2BOS A;  1PHJ A;  3D4D A;  2VS1 A;  1IBM Q;  2F1M A;  4NP5 A;  1PFB A;  2B2Y C;  2G9D A;  3HOX B;  4GKK L;  4M1U B;  1Y8N B;  1YIJ A;  1X3P A;  2N55 A;  1N8R C;  3VR5 A;  5H1S E;  3CMA A;  1Q1B A;  2M9V A;  1TWC B;  2RHS B;  4JI3 Q;  1STY A;  4CHT B;  1Q86 C;  3DUZ A;  5D14 A;  4NXM Q;  2E2J B;  5LMU L;  4A3B B;  3ZYY X;  4G7O C;  1KC8 C;  3HOW H;  3CW2 C;  1BDO A;  4HR7 B;  1JWU D;  4UDU C;  2VQE L;  2XSC A;  1M8A A;  3Q23 A;  1VQF A;  3K57 A;  1PH7 A;  1W3S A;  1L0X B;  5D65 A;  3PF4 A;  4NMZ A;  4JV5 Q;  1KAB A;  1IBL Q;  2B3G A;  1EL0 A;  4CDE C;  4RCO A;  1OTC A;  5BN3 A;  2JE6 I;  1I50 H;  1KD1 C;  4G7Z C;  3PCO B;  5C4X G;  1DOM A;  4X3S A;  1EFI D;  3OW2 A;  1DOL A;  3PIO 3;  2ATW A;  1X3F A;  3S2H H;  1BCP F;  1KL9 A;  4V0B A;  1AW7 A;  2A69 C;  2WAC A;  3J81 i;  3W2D A;  2RA4 A;  2B8F A;  3K59 A;  1S72 A;  3KOJ A;  1QZG A;  4RA8 A;  2OT2 A;  1QWY A;  4ZUI A;  1FYC A;  3HEJ A;  4ZK9 B;  1OXX K;  1F9Q A;  3JAM c;  1TWG H;  5IGC A;  4DK1 A;  4JBM A;  1A2T A;  4RGO S;  2CH4 A;  3AEV A;  2NVQ B;  4AQY L;  5ELC A;  3T1Y L;  1VQL A;  3I55 A;  4POF A;  3H3V H;  2R92 B;  4LF6 L;  1PZI D;  2QKI C;  5JVH 3;  3S1N B;  3KDF B;  2FHT A;  4KKU A;  4WFN 3;  1K3B C;  4LF8 Q;  2RCN A;  4JK1 C;  1Y1W B;  4KY7 A;  2UXD L;  1EUJ A;  3L0O A;  3W5O A;  4DAV A;  4FF1 A;  1NR4 A;  2BE5 C;  5COR A;  5IOC A;  3TRZ A;  1TQO A;  2ENB A;  4HTH A;  2VUM G;  3UDX A;  2VQF L;  4DR7 L;  2R61 A;  1ET9 A;  4A3J G;  4OL7 A;  3GTK H;  1SYF A;  4H44 C;  4FXK C;  3D3R A;  2FMC A;  2KQ3 A;  1VQA A;  1I94 L;  3PUV A;  3BDL A;  4GLV B;  3A56 A;  4OWX B;  4B3R L;  3AQQ A;  2A1A A;  3RD4 A;  4A3J H;  2R7D A;  3QG1 A;  1MD2 D;  3TP5 A;  5I9O A;  1PFN A;  1B8A A;  5C4H A;  4DUZ Q;  1NAP A;  2JA9 A;  3FDT A;  2Z4I A;  3MFY A;  2KEE A;  4B9W A;  3UDF A;  1BXT A;  3HOW B;  4LF4 L;  5C4X B;  1BBW A;  2F0V A;  4J6H A;  4ZLT F;  2B2T C;  2F4V Q;  4YWM A;  1A62 A;  1LTI D;  1QZH A;  2SEB D;  1PRT B;  1CUK A;  4R9W A;  5DNF A;  4DUY Q;  1WOC A;  1R4P B;  4C2M H;  4MZ9 A;  4H0L C;  1T5X D;  3MA2 B;  3I91 A;  4MNO A;  4JI7 Q;  4G4K A;  3M3Y B;  4A3G G;  2RCF A;  4O42 A;  1G29 1;  1PTO F;  4HJ7 A;  3H09 A;  2IPK D;  3MZ5 A;  2K6A A;  1TVX A;  4LFB Q;  4DR2 L;  4FXD A;  4DR4 Q;  3TSS A;  3C3L A;  1M90 C;  1SNO A;  3HKZ E;  2UUB L;  1PZK D;  2OF1 A;  1FGB D;  5IP9 G;  4YHH L;  5EKI A;  2A6E D;  4DV2 L;  3G4S A;  1QOH A;  3S17 H;  1HQM C;  4DV3 L;  3BU2 A;  4XT1 B;  2AKW B;  4CBV A;  1B70 B;  4KY5 A;  4JVZ A;  1CQF A;  3I72 A;  5HGT A;  4NPS A;  5ELE A;  1CM9 A;  3HOU G;  1K8M A;  2MQH A;  5FO8 B;  1AFP A;  3I70 A;  2ZTD A;  4UP9 A;  4ZKC B;  4BXX H;  4DPG A;  2F3I A;  1K73 C;  3RR5 A;  2D0P A;  5JJK A;  4XTC S;  4IQZ A;  2KED A;  2CCZ A;  2PQA A;  1LM0 A;  4IO9 A;  1D1I A;  1Q8I A;  2BH8 A;  3GTP B;  3T1H L;  3JC6 6;  1GUN A;  2K50 A;  3MXG A;  3S15 H;  4BBR B;  5BR8 L;  4GN3 B;  2KHS A;  2WIN B;  3WOE A;  3V05 A;  4RGN A;  2K52 A;  4B3R Q;  4DU9 A;  4JI6 Q;  2JA6 B;  3S14 B;  1PH2 A;  1ESF A;  4QIW B;  4F7X A;  1X55 A;  3H3V C;  3J81 j;  2I46 A;  4B3T L;  2E5L Q;  1Y8P B;  1HUN A;  3IFD A;  1WJJ A;  3WWV A;  5M5X H;  1EY4 A;  4R4O A;  1RL2 A;  2JEB I;  1SNC A;  1STE A;  4FDB A;  4FVM A;  3CPW A;  1GKH A;  4CDD C;  1VQI A;  2R7Z G;  1PH9 A;  1D7Q A;  3R3O A;  3PO3 B;  1I4G A;  2PNR C;  4JI2 L;  4A3M B;  3GTL B;  1UE5 A;  3I4L A;  2PZT A;  4KI0 A;  2DY7 A;  1MKH A;  2LSS A;  4JBJ A;  5KRU A;  3RN2 A;  4K5V A;  4WRD A;  3T16 A;  2CW0 D;  1X65 A;  3K0X A;  3J80 c;  2ES2 A;  1D5M C;  3HKZ B;  4DV5 Q;  3HOU B;  2N8N A;  1K3R A;  1LLR D;  3D31 A;  3I4N B;  4A3I G;  1E1O A;  1IBM L;  5GAH C;  1DM0 B;  3OIP A;  1KLU D;  4B3S L;  4GKK Q;  2JA8 B;  2YU9 H;  4NW2 A;  5NUC A;  2CW0 C;  1BCP B;  1F9R A;  3PSI A;  1EFW A;  3P1H A;  1N33 L;  1Y1V G;  2D62 A;  2A73 B;  3F2U A;  3KLS A;  2Z6K A;  2F0P A;  4C3I B;  3TS2 A;  1E3P A;  3BYY B;  4A3F H;  4PQX A;  4P2C B;  1EIF A;  4FF2 A;  5EPJ A;  4FXG C;  2EXZ A;  1H95 A;  4FF3 A;  3AB9 A;  4PV1 C;  2XWJ B;  2R93 B;  3GDE A;  3I4N H;  1B50 A;  1EQV A;  4BBR G;  1GUW A;  2B2U A;  1YJN A;  3C46 A;  4ME3 A;  1D2B A;  1SR3 A;  3U50 C;  4BBS G;  2VZA A;  1H9M A;  4PMB A;  3HOV B;  4HCE A;  4P74 A;  4A3D H;  4BBR H;  1VQP A;  3NPP A;  3PUY A;  4B3M Q;  5CV6 A;  1PH4 A;  1TWF H;  2O4X A;  2H4O A;  2CVR A;  1S5B D;  5C3E G;  4A3M H;  1PTO H;  4HED A;  1ICW A;  3S15 B;  1D5Z C;  1IXR A;  3URY A;  2YTY A;  1NY4 A;  3OYY A;  2F0J A;  4QMG A;  1W6J A;  3W1B A;  3R2T A;  2Y0S E;  1I50 B;  5C4Z A;  4A3J B;  1DCZ A;  1JE5 A;  2J0T D;  2NVQ H;  4JPB W;  3UE1 A;  3CCL A;  3GTG H;  3I4M H;  2FMM A;  2KCM A;  5M3F B;  2A6E C;  1L1O A;  1K8G A;  1CSQ A;  3T1Y Q;  3H3V I;  1J8I A;  5C5L A;  2KCC A;  4TRD A;  2HDM A;  3KF8 A;  5JJL A;  1J9O A;  4FNF A;  2K33 A;  2E2I H;  2C5C A;  3MEF A;  3HS0 C;  1IL8 A;  3GV6 A;  3Q24 A;  5HY6 A;  1I6H H;  1OXV A;  1ML0 D;  1PRT F;  2L55 A;  2HCI A;  2B2V A;  2EVB A;  1IYV A;  4HJ5 A;  4X66 Q;  4GN5 A;  4JI2 Q;  3GTO H;  3HOU H;  1Y14 B;  1L0W A;  4A3L H;  2VQF Q;  1V1P A;  5CR3 A;  3DEO A;  2Q8T A;  3Q0A A;  4QJF A;  1UUP A;  4ALP A;  3A8I E;  3BDC A;  5COY A;  1AZQ A;  2N88 A;  1TWH B;  3CC4 A;  4A3G B;  3VR6 A;  3S1R H;  2RSN A;  1IBK Q;  2Z0S A;  2I0Q A;  2YTV A;  2NZO A;  3HZX A;  1TT2 A;  2F0M A;  2IL8 A;  4IOC A;  1NNX A;  2JXM B;  1UAP A;  4C2M B;  2EYJ A;  3SE0 A;  4A3K H;  3VYS A;  1UE1 A;  1WCM B;  4L8J A;  5EKK A;  1WTO A;  1PH6 A;  1JOQ A;  1N33 Q;  3DM3 A;  1E2Z A;  4YY3 L;  1KLG D;  3S2D H;  4DV4 L;  1XJV A;  2Z1C A;  1WD1 A;  1YJW A;  2ICI A;  3FPU B;  1A15 A;  2F0I A;  3D6C A;  1BNZ A;  1PMR A;  3FMC A;  4RH6 A;  3S1R B;  1Y8O B;  1N36 Q;  3L7Z C;  1RKN A;  3BYT B;  1EYA A;  2ZJR A;  3CC7 A;  4HAE A;  3CCS A;  3F1Z A;  1VQ5 A;  3GTQ B;  1U0L A;  2UUA L;  1CKN B;  1I5F A;  2M00 A;  1RHP A;  5ELD A;  2EY1 A;  5K5P A;  2MO0 A;  3MXN B;  2QDB A;  4C3J H;  4IUT A;  1SE4 A;  1TWC H;  5C44 H;  2UUC Q;  1K8O A;  5FO9 B;  4ZKB B;  2Z8L A;  3DEP A;  3I4O A;  2ID0 A;  5C0X H;  4O0A A;  1KDA A;  3A8J E;  1CKM A;  1IW7 C;  3D6W A;  3VYU A;  4M8A A;  3PO2 B;  2HQE A;  5AJ3 L;  2E2I B;  2H1E A;  1U4M A;  3S14 H;  1TWH H;  2B2T A;  4NDX A;  3OW7 A;  4J1M A;  1VMC A;  2Q8I B;  5T1I A;  3PIO A;  1XTD A;  4GOP C;  1YVC A;  1GO3 E;  4ME5 A;  3VYR A;  1DOK A;  2K5H A;  1L2F A;  3KUP A;  2PYK A;  5LMU Q;  3GTO B;  3C1E A;  4O2D A;  2YTX A;  5FLX E;  1QNU A;  1JIC A;  5IT9 L;  4K5X A;  4DFA A;  3HRZ C;  2CWA A;  1PTO C;  2E76 C;  3TZD A;  5GQO A;  4MHE A;  2E8G A;  3CQZ H;  3G6E A;  5JEA J;  4DGZ A;  1M1K C; 
#chains in the Genus database with same CATH homology
 4A3E H;  2ZJP A;  4C3H H;  3JAM c;  1TWG H;  4HIO A;  4JI4 Q;  4BA2 I;  4DR6 L;  4JBM A;  3GTJ H;  1V9P A;  3BZK A;  4QL5 A;  4LF7 Q;  1FVI A;  3AEV A;  3GTQ H;  5IY0 A;  4AQY L;  2PI2 A;  2CFM A;  2R93 G;  1VQ8 A;  4R4I A;  3T1Y L;  1VQL A;  3I55 A;  5LMN L;  4POF A;  3H3V H;  4LF6 L;  2UXC L;  4YCU A;  4JI0 L;  4L5T A;  4H02 A;  3GTM H;  2PMZ E;  5FLM H;  1YI2 A;  1IBK L;  4JYA L;  5GAD C;  3KDF B;  5M3M H;  4OO1 G;  5JJI A;  2JA8 H;  3PO3 H;  1VQM A;  2JJQ A;  4LF8 Q;  2RCN A;  3M7N A;  1N32 L;  1FJG L;  2UXD L;  2QEX A;  3OTO Q;  5JEA G;  1EUJ A;  4XIG S;  2Q2H A;  1NMG A;  3CC2 A;  2D0O A;  4JCV E;  2JQO A;  3L0O A;  1Y1V H;  3W5O A;  1SE8 A;  5C0X G;  2Z6K C;  3I56 A;  3RZO H;  4BY1 H;  1VQB A;  5HGQ A;  4QGU A;  3TRZ A;  2IHE A;  2OQ0 A;  4OWW B;  2VUM G;  3UDX A;  5GRO A;  2VQF L;  4DR7 L;  4PZ7 A;  4A3J G;  3FKI G;  3GTK H;  4TQU S;  3PV0 A;  1YIT A;  1X3E A;  2XGT A;  4A3I H;  3STB C;  1E1T A;  4DV1 L;  1I94 L;  1EQR A;  1VQA A;  3K7A H;  4BXX G;  3PUV A;  1N36 L;  3I4M G;  4GLV B;  2PI2 E;  3PO2 G;  4LF5 Q;  4OWX B;  5IYC H;  1VQN A;  4JI6 L;  3AQQ A;  2A1A A;  1E22 A;  3PGZ A;  3CXC A;  4OX9 Q;  4B3R L;  2ZTE A;  2F52 A;  2KEN A;  2R7D A;  3K80 C;  4A3J H;  4BY7 G;  1SFO H;  2AWN A;  4DV5 L;  4LFC Q;  4DR7 Q;  4DUY L;  4X6A H;  4X65 Q;  2K5V A;  2Q2U A;  1B8A A;  4DUZ Q;  1G51 A;  2OTJ A;  2JA9 A;  1CSP A;  1YZ6 A;  4DV1 Q;  1VQJ A;  1HZC A;  3EIV A;  3UDF A;  4DKA C;  3HOX G;  4APV A;  4J15 A;  4LF4 L;  1BBW A;  4A3C H;  2F4V Q;  4YWM A;  4PZ6 A;  1A62 A;  1QZH A;  1Q82 C;  1FL0 A;  3NEN A;  1CUK A;  1EOV A;  3PUX A;  1KHI A;  1HZ9 A;  3NEL A;  2AWO A;  4DAM A;  1OXS C;  3PUW A;  1HR0 L;  4IPG A;  4GNX A;  1HZB A;  4C3I H;  1VQ6 A;  4DUY Q;  2IY5 B;  2I5H A;  4A4I A;  1WOC A;  3K8A A;  2CQO A;  4JOI C;  4LUV A;  4C2M H;  4DNI A;  4MZ9 A;  4X65 L;  3J7Z C;  4DV7 Q;  2B63 G;  4A3D G;  1EQQ A;  1VCI A;  4KHP L;  2JK8 A;  4DV0 Q;  2UU9 L;  3NBH B;  1IL2 A;  1MJC A;  3PIP A;  4JBW A;  4R4Q A;  1ASZ A;  4MNO A;  4IJL A;  3A0J A;  4JI7 Q;  4RMF A;  4A3E G;  4GLA C;  1AE3 A;  1MIU A;  2Q2I A;  1LYL A;  4OON A;  4P73 A;  2ZM6 Q;  3CD6 A;  4UY8 C;  4A3G G;  2UUB Q;  4IFD I;  1XMO Q;  2YYZ A;  2PQA B;  4QY7 A;  1G29 1;  2QGQ A;  4DR3 L;  1QVG A;  4HJ7 A;  4BY7 H;  1A63 A;  1QVF A;  4QQB X;  4IJH A;  4YY3 Q;  4JI1 L;  3VDY A;  1O7I A;  1WI5 A;  4A3L G;  4KHP Q;  3UDI A;  2NVX H;  3CCJ A;  4LFB Q;  4DV4 Q;  3HFZ B;  4DR2 L;  4JG2 A;  3S1M H;  4DR4 Q;  4L5S A;  2MNA A;  4B3M L;  1NTG A;  1WFQ A;  2LXK A;  1M90 C;  1VQH A;  2R92 G;  3HKZ E;  4DK3 C;  2NVT H;  1VQD A;  2UUB L;  1TWA H;  1V43 A;  3LGJ A;  5IP9 G;  1XNQ L;  4YHH L;  3ULJ A;  5ELO A;  2EQS A;  2HHH L;  4DV2 L;  3G4S A;  4K0K Q;  3S17 H;  4GKJ Q;  4DV3 L;  3BU2 A;  2AKW B;  5EAY A;  1B70 B;  5IYB G;  1JT8 A;  3K7U C;  3J7A 5;  4PZ8 A;  1VQ9 A;  3AYH B;  4JI5 Q;  1UWV A;  1SRU A;  4NPS A;  3PO2 H;  3HOU G;  1E24 A;  2JA8 G;  3RNU A;  1XNR Q;  4JV5 L;  2KCT A;  2MQH A;  3T1H Q;  1YHB A;  4UP9 A;  2ZTD A;  4BXX H;  5FLM G;  3CCE A;  3TS0 A;  2N49 A;  4DPG A;  4JYA Q;  2F3I A;  1K73 C;  2A8V A;  3RR5 A;  5K36 G;  4YWK A;  4HJA A;  3HOY H;  2R93 H;  4OWT B;  1PA6 A;  2D0P A;  3W1G A;  3CCU A;  2B29 A;  2VUM H;  5C44 G;  5JJK A;  4LF9 Q;  4XTC S;  1SMX A;  4X62 L;  2HIX A;  5BR8 Q;  3ULL A;  4LUZ A;  2JA6 G;  2CCZ A;  2PQA A;  4BY1 G;  1LM0 A;  5C4J H;  4UP7 A;  4IO9 A;  2WAQ E;  1HZA A;  1Y1W G;  1C0A A;  1K8A C;  2BH8 A;  5C0X I;  2R92 H;  3T1H L;  2OCE A;  3KF6 A;  3JC6 6;  1N34 L;  1OXU A;  2GVA A;  1KIX A;  2K50 A;  3S1N H;  1HJP A;  5IYD H;  2MFI A;  2QA4 A;  4A3B G;  3F2B A;  3S1Q H;  2R7F A;  3CP0 A;  2NN6 G;  3F8T A;  3S15 H;  5BR8 L;  1AH9 A;  4GN3 B;  2JA7 G;  1PH8 A;  4BA1 I;  2WB1 E;  2K52 A;  4B3R Q;  4JI6 Q;  1PH2 A;  1X55 A;  4JI8 L;  3M4Q A;  2XTI A;  2MO1 A;  4LFC L;  3J81 j;  4AIM A;  2KHI A;  2R6G A;  4B3T L;  1FJG Q;  3RN5 A;  2E5L Q;  3J80 i;  1PVO A;  1I3Q H;  2BA1 A;  1QUQ A;  1WJJ A;  3SGI A;  3WWV A;  5DLQ E;  5M5X H;  4R4O A;  1RL2 A;  2JEB I;  1HNW L;  3IRB A;  4DV6 Q;  4FDB A;  3HOW G;  3CPW A;  1GKH A;  3A74 A;  2I5L X;  1VQI A;  4KLK A;  4L5Q A;  1PH9 A;  2R7Z G;  1HNX Q;  4NXN Q;  4AQY Q;  1D7Q A;  2EXD A;  4IPC A;  4JI2 L;  2HIV A;  1UE5 A;  2I5M X;  1PH3 A;  3NEM A;  5M3F G;  4RG1 A;  4KI0 A;  2K5N A;  4JI0 Q;  1A8V A;  3D0F A;  4HIM A;  3FHW A;  1MKH A;  5J3B A;  4EQ5 A;  4DV0 L;  5GAG C;  2UU9 Q;  2LSS A;  4JBJ A;  3G71 A;  3RN2 A;  1ASY A;  2ZJQ A;  1LTL A;  3CCM A;  1W2B A;  1Q8K A;  1X65 A;  3K0X A;  3JAM i;  4LFA Q;  3J80 c;  2ES2 A;  4LF8 L;  1WCM H;  1IYJ B;  1Q12 A;  3CPF A;  4X64 Q;  1X3G A;  3H15 A;  4DV5 Q;  1X6O A;  4JC0 A;  1JMC A;  1WCM G;  2ALY B;  4DUZ L;  2N8N A;  3A5Z B;  1K3R A;  5IP7 G;  1PYS B;  3CF5 A;  3D31 A;  1OXT A;  3KJO A;  4A3I G;  1E1O A;  1IBM L;  5GAH C;  3UE0 A;  5M3F H;  2KBN A;  3KDF A;  4IPH A;  3FKI H;  4B3S L;  4LW1 A;  2UUA Q;  4GKK Q;  4P75 A;  5FJ8 H;  2WAQ G;  2BH2 A;  2YU9 H;  1VQO A;  4A76 A;  5ELN A;  4LFA L;  2AHO B;  4OXP A;  1YJ9 A;  4OO1 I;  4R4C A;  3ICE A;  3PSI A;  4PMW A;  1EFW A;  4A93 G;  4AYB G;  1N33 L;  2AMC B;  1Y1V G;  2D62 A;  3E9H A;  1HR0 W;  1DGS A;  3S24 A;  2Z6K A;  3PF5 A;  5M5W H;  4HJ9 A;  3HKZ G;  2HQL A;  1Q7Y C;  1XPU A;  1EIY B;  3GTL H;  4LF5 L;  3TS2 A;  4K0K L;  1J5E Q;  1E3P A;  1KRS A;  1X56 A;  4A3F H;  1KQS A;  2V1C C;  2WP8 J;  5FLX c;  1EIF A;  2DUD A;  1PV4 A;  1H95 A;  4JBK A;  2WFW A;  4B3S Q;  1T9H A;  2K75 A;  3DLL A;  3HOZ H;  1P8L A;  1UEB A;  1VQG A;  3U4Z A;  2ZM6 L;  3KJP A;  4YWL A;  3FP9 A;  3GDE A;  3I4N H;  4JI5 L;  3H0G G;  4Y7N H;  2VW9 A;  4DR1 L;  1GM5 A;  4BBR G;  1V1Q A;  1YJN A;  3PUZ A;  3ULP A;  3F2D A;  4ME3 A;  1YHA A;  1Q81 C;  1VQ7 A;  1SR3 A;  2NZH A;  2NN6 I;  4A75 A;  1C7Y A;  3S16 H;  3U50 C;  4BBS G;  2VZA A;  3GD7 A;  4P74 A;  3Q8D A;  4A3D H;  4A3B H;  1D8L A;  4BBR H;  1VQP A;  1HR0 Q;  4POG A;  1YEZ A;  2E2J H;  4JI4 L;  2JEA I;  3PUY A;  3UDG A;  4DR6 Q;  4B3M Q;  2OTL A;  1PH4 A;  4NB3 A;  3CCQ A;  1TWF H;  4LF7 L;  1UE6 A;  4GN4 B;  3CME A;  2JA5 G;  3RZD H;  2JA5 H;  1Z9F A;  4GKJ L;  4L5R C;  5C3E G;  4A3M H;  4YHH Q;  3RLN A;  3KLW A;  4A3F G;  3HKS A;  2IT1 A;  3HOV G;  4JI3 L;  4LUO A;  1IXR A;  3HOX H;  2WB1 G;  4DR5 L;  1SN8 A;  2YTY A;  1KRT A;  1NY4 A;  4HIK A;  1HNZ Q;  4NXM L;  3OYY A;  1JB7 A;  1XMO L;  3W1B A;  5C4X H;  3KFU A;  4AYB E;  2L15 A;  1K83 H;  2VY3 A;  2Y0S E;  3HOY G;  4JOI A;  1G6P A;  5FJ8 G;  4JI1 Q;  3M4P A;  1JE5 A;  1A0I A;  4WJ3 M;  1PH5 A;  2NVQ H;  3CCL A;  3UE1 A;  3HOZ G;  4IOA A;  4EX5 A;  5IYD G;  1XMQ Q;  1RIP A;  4DR4 L;  3GTG H;  3I4M H;  2KCM A;  2HT1 A;  3E0E A;  1TXY A;  3TQY A;  4HJ8 A;  1IZ6 A;  4DR5 Q;  1L1O A;  1NBW A;  2DGY A;  1K8G A;  1CSQ A;  3T1Y Q;  1IBL L;  3H3V I;  5IT9 c;  5LMN Q;  1QUQ B;  4B3T Q;  4LF6 Q;  4LF9 L;  2UXC Q;  1LUZ A;  4HID A;  4DV2 Q;  1N9W A;  5JJL A;  3F2C A;  3AFQ A;  3CAM A;  4PG3 A;  4GS3 A;  2E2I H;  3MEF A;  2VNU D;  1VQC A;  2ASB A;  4GOP A;  3RLF A;  1I6H H;  1N32 Q;  5HY6 A;  3STB D;  3CCV A;  2UXD Q;  1OXV A;  3OTO L;  1XPR A;  4QIW E;  2N3S A;  1N34 Q;  4UP8 A;  2LXJ A;  2PNH A;  4LNQ A;  3I7F A;  2R7Z H;  5IP7 H;  4HJ5 A;  2C35 B;  2VL6 A;  4X66 Q;  4GN5 A;  4JI2 Q;  3CCR A;  3GTO H;  1Q46 A;  3B6Y A;  1Q1E A;  3HOU H;  1Y14 B;  2BA0 A;  4MTN A;  1L0W A;  2VQF Q;  4KHZ A;  4A3L H;  3GTP H;  1GVP A;  4DK6 C;  2EIF A;  2OQK A;  4GNX B;  3M4O H;  4QJF A;  1B7Y B;  4ALP A;  2CKZ B;  3U58 A;  4IFD G;  2Y0S G;  5E7N A;  1I94 Q;  4JI8 Q;  1GD7 A;  2E2H H;  1L1O C;  4GOP B;  2H5X A;  2GVB A;  1BVS A;  3RLO A;  1YHQ A;  3CC4 A;  3E9I A;  3EBE A;  3S1R H;  1MJE A;  1IBK Q;  3ERS X;  2Z0S A;  3BZC A;  4UPA A;  5IE8 A;  1K0R A;  2YTV A;  2I0Q A;  1QVC A;  2NZO A;  2CWP A;  1CKO A;  4IOC A;  1FGU A;  2B63 H;  2FXQ A;  3I4N G;  1HNW Q;  2N78 A;  4DV6 L;  1SLJ A;  1X9N A;  1S3O A;  4P71 A;  4A3K H;  2UXB Q;  1NJI C;  1UE1 A;  1PH6 A;  4DR3 Q;  2A19 A;  2RHQ B;  1N33 Q;  3DM3 A;  1C9O A;  1SRO A;  5M5Y H;  4LF4 Q;  4A3C G;  5IWA L;  4YY3 L;  4DAY B;  2F4V L;  1AE2 A;  1E7Z A;  4AH6 A;  3S2D H;  1R9T H;  4IFD J;  1J5E L;  1Y1W H;  3EN2 A;  4DV4 L;  4DR2 Q;  1EWI A;  1XJV A;  3BJU A;  1VQE A;  2OWO A;  4A93 H;  1YJW A;  2Q2T A;  2RF4 A;  2K14 A;  1BBU A;  4BBS H;  2JA7 H;  4DV7 L;  4X64 L;  1JJG A;  2IX1 A;  2UXB L;  1YBY A;  1N36 Q;  3L7Z C;  4R1J A;  5IYC G;  1PYB A;  2ZJR A;  3ER0 A;  1XPO A;  3H0G H;  1PFS A;  3CC7 A;  1PHJ A;  2HHH Q;  3CCS A;  4OX9 L;  5IWA Q;  1Z47 A;  2VS1 A;  3F1Z A;  1IBM Q;  5AJ3 Q;  1VQ5 A;  1U0L A;  4WJ4 A;  4GNX C;  2UUA L;  4GKK L;  1CKN B;  1I5F A;  3KF8 B;  2YV5 A;  4NXN L;  3M85 A;  1YIJ A;  1HNX L;  1N8R C;  1NE3 A;  2JA6 H;  5H1S E;  2MO0 A;  3MXN B;  4C3J H;  1L1O B;  1BKB A;  1Q1B A;  1TWC H;  2IHF A;  5C44 H;  3CMA A;  2UUC Q;  1X54 A;  3I4O A;  2ID0 A;  2RHS B;  4JI3 Q;  4Y52 H;  4O0A A;  1Q86 C;  1CKM A;  3G48 A;  1UE7 A;  5IP9 H;  4NXM Q;  3M9B A;  1HH2 P;  3J81 c;  1YNX A;  4R4T A;  5AJ3 L;  5LMU L;  2NVY H;  1J6Q A;  1S40 A;  1KC8 C;  1XNQ Q;  3PO3 G;  3L2P A;  3HOW H;  3AFP A;  2IX0 A;  3S14 H;  2KHJ A;  3CW2 C;  5M3M G;  3GO5 A;  3KF6 B;  1TWH H;  1VS0 A;  1P16 A;  4JI7 L;  4TVA B;  2VQE L;  2UUC L;  1EYG A;  1XMQ L;  5IYB H;  1VQF A;  3KYH C;  1PH7 A;  1NMF A;  1W3S A;  3TEH B;  3PIO A;  1XTD A;  4GOP C;  1YVC A;  3PF4 A;  1JJC B;  1GO3 E;  5LMN W;  1XNR L;  4JV5 Q;  2K5H A;  4LWC A;  1IBL Q;  1L2F A;  2B3G A;  1OTC A;  5LMU Q;  1CKN A;  1VQ4 A;  4GLX A;  2JE6 I;  1I50 H;  4O2D A;  1KD1 C;  3TRE A;  1KXL A;  2YTX A;  3PCO B;  3A5U A;  5C4X G;  1KAW A;  2K4K A;  3OW2 A;  4LFB L;  4YCV A;  3I2Z A;  1VQK A;  2ATW A;  1X3F A;  1K9M C;  3S2H H;  4YCW A;  4P72 A;  4IPD A;  2CWA A;  1KL9 A;  2VQE Q;  1JJ2 A;  1HNZ L;  3HOV H;  4X62 Q;  5GQO A;  4A3K G;  3J81 i;  4A3M G;  5C3E H;  1WYD A;  3ZJY C;  3U4V A;  4DR1 Q;  1PH1 A;  2ZTC A;  2E8G A;  2GN5 A;  3CQZ H;  1S72 A;  2E5L L;  3KOJ A;  4X66 L;  1U5K A;  5JEA J;  3G6E A;  1QZG A;  3M3Y H;  3K81 C;  5C0X J;  5GAE C;  4DV3 Q;  1M1K C;  4A3G H;  1OXX K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...