4A3JH

Rna polymerase ii initial transcribing complex with a 2nt dna-rna hybrid and soaked with gmpcpp
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3jH00
2VQFL 5GAHC 3GTKH 1VQ8A 1EQQA 4WJ4A 4JYAQ 1HNXQ 2IX0A 1QVFA 1QVCA 2AKWB 4LF9Q 3M7NA 4HIDA 1YJ9A 1Q81C 4QIWE 1Q46A 1TWGH 3T1YQ 1I3QH 1V43A 2LXJA 3NENA 3PO2H 3HOUG 4JG2A 4XTCS 4JV5Q 3M9BA 4DV4L 1K9MC 5ELOA 2YU9H 1TWAH 1Q82C 4DR3Q 2D0PA 4R4TA 4GKKQ 1HR0Q 2CFMA 5GAEC 1TWFH 1UE5A 2WAQE 4IPHA 4P71A 5GQOA 1IBKQ 3OTOL 2IHFA 2LSSA 4GLXA 2GVAA 4OWTB 1K8AC 3UDIA 2NN6G 4KHPL 3PF4A 1E3PA 1OXSC 1NBWA 1KXLA 4IOAA 2MFIA 3K80C 4BY1G 4HIKA 1I94Q 1Q12A 2ASBA 4JI8L 1HH2P 2PQAA 5IYBH 3GTLH 4B3ML 5JEAJ 1S72A 4UP8A 3TS2A 2Z0SA 4JI7Q 4NXML 1YJWA 1RIPA 4IJHA 2KHJA 4K0KL 1MIUA 4X66Q 1IZ6A 4GN5A 4A3JH 1KQSA 4B3SQ 3CCVA 1MKHA 1B7YB 1JB7A 1CSQA 1VQMA 3I4NG 1G6PA 2PI2E 3F2CA 4A3KH 4JI3Q 4JI5Q 3S1QH 2BH8A 5LMUQ 1YZ6A 1QUQB 1L2FA 4LFBL 4OWWB 2K5NA 1N9WA 1X54A 4MNOA 4A3IH 1N33Q 3M85A 3S2HH 3G71A 2RHQB 4DAMA 3HFZB 5M3MG 1HNXL 3HOZG 3AFPA 4DNIA 4LF9L 1A8VA 1D7QA 2I5HA 1SN8A 4DV3Q 4LUZA 1NMGA 2NVXH 2JA8G 2JK8A 3I4MH 4LUVA 4L5TA 4GNXC 4OX9Q 4DR7Q 4MTNA 2B63G 2JA7G 2V1CC 3CCMA 2N49A 4LFCQ 4JV5L 4DV6Q 3CC7A 4LFAL 2UXDL 1PVOA 1NJIC 4R4IA 1M1KC 2UUAL 1HR0L 4LF5L 3K0XA 3PGZA 4GKKL 4DR6L 4A76A 4GS3A 1E7ZA 1IBKL 4BA2I 4B3RQ 5IYDH 1O7IA 3PUWA 1FGUA 3L0OA 4DV7Q 5IWAQ 1CKOA 1WYDA 1N34Q 1SRUA 5H1SE 2ID0A 1VQ7A 1EQRA 1YITA 2NVQH 3HOWH 2R6GA 5IP9H 1I94L 3KYHC 1PH1A 1Y1WH 5BR8L 3J7A5 4GOPC 4P72A 1VQLA 5C4XH 1BBWA 4QJFA 1IXRA 3CPFA 5C44G 2K5VA 5EAYA 4AQYL 3KFUA 3ICEA 1XTDA 4Y7NH 2UXCL 1VQHA 4GLAC 4R4QA 4LW1A 3W1BA 4X66L 3HOYG 3PO3G 1CKNB 1XMQL 2EQSA 2GN5A 3HOUH 4UY8C 1NY4A 1V1QA 4JI3L 3AEVA 4OO1I 5LMUL 3S24A 4A3IG 2RCNA 1N33L 1B8AA 2HQLA 4DR1Q 4LF8Q 1FL0A 1OXTA 2JA9A 4HJ9A 3F2DA 1GM5A 4DR5Q 1L1OB 3W5OA 2K14A 1DGSA 4LF6L 4YY3Q 4C3JH 4YCWA 1KHIA 2WP8J 5FLXc 1Q7YC 4DV5Q 4DV3L 4DR7L 4P75A 4OX9L 2KCTA 1PH4A 1KIXA 3CQZH 2YTVA 4POGA 4A93G 2Z6KA 1N8RC 1KRTA 4LFCL 4DPGA 4DV1Q 4X65L 2UUBQ 4DV6L 4JI4Q 3W1GA 2E2HH 1S40A 1C9OA 3OYYA 2D0OA 2K50A 1EYGA 2L15A 1UE7A 4JCVE 1HNZQ 3K7UC 3STBC 4A3EG 4DV0Q 5M3FG 3H3VH 4JI0L 1MJEA 1XNRQ 4A3GG 4B3RL 4UP7A 4HJ7A 1A62A 5M5WH 3GTOH 2H5XA 3CXCA 3H0GG 4DUZQ 4DV7L 2NN6I 5IWAL 4DR2L 3L7ZC 3SGIA 1WOCA 2I5MX 4IFDG 3T1HQ 4OO1G 3I4NH 3GD7A 1PH9A 4L5QA 1R9TH 3GTMH 1WCMG 2DGYA 4IO9A 4NXNQ 4PZ6A 1KD1C 4OWXB 3H3VI 3J80i 2PMZE 3ULJA 5M3MH 1V9PA 1VQCA 3S16H 1C0AA 3HOZH 2Q2HA 2AHOB 5FJ8G 4H02A 1RL2A 3HOXG 3PSIA 2JA8H 1T9HA 4AYBG 2N8NA 1BKBA 1X55A 2PNHA 1X3EA 5JJKA 2B63H 4C3IH 2JA7H 2BA1A 2JE6I 3CCEA 4B3TQ 2CKZB 1D8LA 3CW2C 2E5LQ 3CCRA 4DR1L 4LF8L 3GTPH 1X56A 4DR5L 1S3OA 1YHBA 1AE3A 2OTLA 1LTLA 3J7ZC 1YIJA 4A3LG 2EIFA 4AH6A 3RN2A 1W3SA 1UE1A 4PMWA 4RG1A 1TXYA 2YYZA 2K75A 3MEFA 2PI2A 3CMEA 4YWMA 2R92G 4NPSA 2KHIA 4MZ9A 4DV1L 4JI4L 4BA1I 4YCUA 3KF8B 1WFQA 3KF6A 1PH3A 2JQOA 1IBML 3CP0A 5C44H 4DV0L 5AJ3Q 2B3GA 2WFWA 4HJ5A 1N36L 1XNRL 5C0XJ 1VQ4A 2F4VL 5GAGC 4GKJQ 4DUZL 1N32Q 4DR4Q 5LMNL 1ASYA 3RN5A 3HOYH 4P74A 3PO3H 1VQFA 4IJLA 1PYBA 4JOIC 4LF4Q 3T1HL 1VQKA 1HNWQ 2VY3A 3PUZA 3S1MH 1JJCB 5C4JH 1PYSB 3PV0A 3KJPA 1NE3A 1EWIA 3I4OA 3K7AH 3STBD 3J81j 2AMCB 1LM0A 1OXUA 2NZOA 2E2IH 1SROA 1E22A 4POFA 4GN3B 1Q1EA 4JYAL 2HT1A 4BXXG 4AIMA 4IFDJ 1EFWA 3F1ZA 3DLLA 1LYLA 4BBRG 2Q2IA 1PHJA 3T1YL 4PG3A 1P8LA 2NVTH 1CUKA 1XPUA 3TRZA 4A93H 4X6AH 3FP9A 4GLVB 4IPGA 4TQUS 5M5YH 4JBWA 3RLFA 4UP9A 2ES2A 2N3SA 5E7NA 4QQBX 2YV5A 4AYBE 2E5LL 2R93G 4DR3L 1EIFA 1GO3E 1UWVA 4OXPA 4HJ8A 1I6HH 3B6YA 1G51A 1X3GA 3BU2A 4A3GH 4A3EH 1L1OC 3F8TA 4R4OA 5M3FH 2YTYA 3KDFA 3RR5A 1EUJA 2HIVA 3LGJA 3J81i 1Q1BA 1PFSA 2CWPA 3KLWA 3D0FA 1EIYB 1E24A 3H0GH 2DUDA 1XNQQ 2PQAB 1I50H 1YNXA 2IX1A 3UE1A 3HKSA 3PIOA 2K4KA 2E8GA 3TREA 1WCMH 2QGQA 4UPAA 3FHWA 2KBNA 3NEMA 5AJ3L 4JI7L 2UUCQ 3CCLA 1E1OA 4GKJL 1TWHH 5FJ8H 1N32L 4DR4L 4B3SL 3HOXH 4IOCA 3DM3A 4GOPA 4A3BG 4JI5L 4IFDI 4X62Q 3KOJA 2IY5B 1VQ9A 1JJGA 1PH8A 1EOVA 4LNQA 4DV2Q 3S17H 4APVA 3PUYA 2I5LX 3K81C 3GTJH 3I56A 5IY0A 4A3LH 1J6QA 1YVCA 2OCEA 3D31A 2CWAA 3TS0A 3U4VA 4EX5A 1XPOA 2R92H 5C0XG 2NVYH 5FLMG 3CMAA 1IL2A 2QA4A 1FJGQ 1KAWA 3ZJYC 1PV4A 3FKIG 5ELNA 4HIOA 3UDGA 1L0WA 1K3RA 3I2ZA 3ULLA 3PIPA 3L2PA 2AWOA 4DV4Q 1A0IA 1GKHA 4DAYB 3RLNA 4EQ5A 2QEXA 1XMOQ 1JJ2A 4J15A 1KRSA 2RHSB 1Y1VG 3J80c 2JEAI 3S1NH 1VCIA 3NELA 3AQQA 2A8VA 3OTOQ 3JC66 1N34L 1X65A 4A75A 3U4ZA 4P73A 5GROA 4DK3C 1UEBA 4QY7A 2R7DA 1HZBA 1Y14B 2IHEA 2K52A 1QVGA 3AYHB 3RZOH 4ALPA 1YI2A 1JMCA 4QL5A 1GVPA 4YCVA 5HY6A 3M4OH 4JC0A 4YWKA 4JI8Q 2OTJA 3PUVA 4Y52H 1B70B 2ALYB 3ERSX 4BXXH 1NTGA 4BBRH 3S1RH 2UXBQ 3S2DH 1MJCA 1QZHA 4L5SA 5IT9c 3S15H 4BY7G 1P16A 2ZJQA 4RMFA 4K0KQ 1GD7A 5IYCG 2FXQA 4X62L 3PUXA 5HGQA 2HIXA 1ASZA 2R93H 5J3BA 2IT1A 5JJIA 2JA5G 4DV2L 4R1JA 4LFBQ 3UDFA 4BBSG 4YY3L 4HJAA 1Q86C 1K73C 2OQ0A 4DV5L 2Y0SG 2JA6G 3A74A 2VUMG 3PCOB 2OWOA 4JBJA 2A19A 1QUQA 5C3EG 2VZAA 2BA0A 2UUBL 2F52A 4X64Q 1VQ6A 3RNUA 1OXVA 1FJGL 4JI6Q 4DKAC 1YJNA 1SLJA 4OONA 1H95A 1WJJA 1HNZL 1FVIA 3ER0A 4QGUA 3IRBA 2C35B 1XMOL 4WJ3M 4A3FG 3M3YH 4LFAQ 3CC4A 2BH2A 2UXDQ 3HKZG 2UUAQ 1XJVA 4LF5Q 4A3DG 2MNAA 4DR6Q 3M4PA 1A63A 3I7FA 2R7ZG 4A3BH 1HZ9A 2VNUD 3JAMc 3KJOA 4IPCA 3E9IA 4C3HH 1BBUA 1SMXA 3RLOA 2F3IA 1CSPA 1M90C 2OQKA 1VQEA 4NXNL 4C2MH 3I55A 3K8AA 1PA6A 4GN4B 3U58A 1I5FA 1VQNA 5BR8Q 2VW9A 1W2BA 1VQPA 5IP7G 4JOIA 2EXDA 3J81c 3PF5A 4KI0A 3A5UA 1E1TA 4AQYQ 1C7YA 2Q2TA 3CF5A 1KC8C 1OTCA 2UXCQ 2UXBL 2HHHQ 3JAMi 4GNXA 1BVSA 4A3CH 1IBLQ 1J5EQ 4B3TL 3UE0A 5FLMH 4A3MG 1PH5A 1VQ5A 1XMQQ 3HOVH 2D62A 2E2JH 3FKIH 4DK6C 3UDXA 1WI5A 3H15A 1NMFA 1CKNA 1VS0A 1Y1VH 1X9NA 3CD6A 1K83H 4JI1Q 1Z9FA 3E9HA 3KF6B 4LF6Q 2KENA 3G6EA 3CPWA 3GTGH 4X64L 2JEBI 5C0XI 5K36G 2Y0SE 1TWCH 4JI6L 3PO2G 1HZAA 1L1OA 4XIGS 2ZJRA 3TQYA 4X65Q 4KLKA 1U0LA 1VQIA 2VL6A 3ULPA 1YHAA 2ZJPA 2VQEQ 1SFOH 1JT8A 4DUYQ 4JI0Q 2ZTEA 3AFQA 4PZ7A 2NZHA 3HKZE 2N78A 3CC2A 2UU9Q 4LF4L 2XTIA 4LF7Q 4BY7H 4IPDA 4ME3A 1HZCA 2WB1G 4YHHQ 4DR2Q 1HNWL 5IYCH 2XGTA 3MXNB 4JI2Q 2YTXA 1KL9A 2I0QA 1VQBA 3NBHB 3S14H 2ZTDA 3G4SA 4O0AA 1K8GA 4PZ8A 1VQDA 4YWLA 3TEHB 2JA5H 1HJPA 2JJQA 5IYBG 4BBSH 2ZM6Q 4NB3A 2VQFQ 3CCUA 1SE8A 1AE2A 3F2BA 1AH9A 4LUOA 1G291 5DLQE 2JA6H 2MQHA 2VUMH 2HHHL 4R4CA 1YBYA 1SR3A 4L5RC 5C3EH 4A3JG 1PH6A 4A3CG 1IBLL 4FDBA 3GTQH 3BJUA 4GNXB 1J5EL 3KDFB 3CCSA 5LMNW 3HOVG 1JE5A 3EBEA 3CCJA 4A3KG 4O2DA 3CCQA 2ZTCA 3G48A 2WAQG 4LWCA 2R7FA 3BZKA 5GADC 1X3FA 1UE6A 4A4IA 3A5ZB 2Z6KC 1U5KA 4A3FH 5IE8A 1YHQA 1CKMA 1PH7A 4A3DH 2B29A 4JI1L 5M5XH 1XNQL 2R7ZH 1IYJB 1X6OA 3BZCA 3M4QA 1LUZA 1YEZA 4JBMA 4KHPQ 3GDEA 5JEAG 3CAMA 3I4MG 1PH2A 2Q2UA 5JJLA 2AWNA 3EN2A 2GVBA 2MO0A 1VQGA 2ATWA 3E0EA 3RZDH 4BY1H 4GOPB 1QZGA 2UUCL 4JBKA 4TVAB 1XPRA 4KHZA 5IP7H 1OXXK 2VQEL 3WWVA 1HR0W 2MO1A 1IBMQ 4B3MQ 1Z47A 3OW2A 5IYDG 3EIVA 4DUYL 1N36Q 2CCZA 4NXMQ 1VQJA 2UU9L 4LF7L 2F4VQ 1K0RA 2VS1A 4YHHL 1Q8KA 4HIMA 2KCMA 5LMNQ 2A1AA 4A3MH 2CQOA 4JI2L 2K5HA 3Q8DA 3VDYA 3HOWG 3GO5A 5IP9G 1Y1WG 2LXKA 2WB1E 3A0JA 1VQOA 1VQAA 2RF4A 3U50C 5C4XG 2ZM6L
chains in the Genus database with same CATH superfamily
3SHLA 3MFYA 3GTKH 1DZ1A 3M7NA 5CR3A 3URYA 1ZYRC 1HUMA 1Q46A 3SK5A 5K36H 2SOBA 2G9DA 4XTCS 1K9MC 1TS3A 3QB3A 5JAVA 2CFMA 1WTWA 2WAQE 3S1QB 1ICFB 1C48A 4KHVA 4P71A 2A69D 2IHFA 2LSSA 4OWTB 3ND9A 3PF4A 2K5QA 1WTPA 1STNA 1ML0D 2DY8A 2MFIA 3K80C 4JI8L 1HH2P 2NVTB 4KY5A 2EXZA 2VB3X 4V190 4UP8A 3ND8A 2QKIC 4KY6A 4JI7Q 1B2TA 5J1ZA 4KJNA 4IJHA 3CU7A 4X66Q 1GUGA 1B7YB 1CSQA 3BDOA 1VQMA 3SDZA 1EY7A 1UUPA 5E1FA 4CKBA 3I4NG 1Q90A 1STBA 2PI2E 4LK1C 1JB3A 2R61A 3F2CA 2BH8A 4LFBL 1N9WA 1X54A 4KN7C 1TS4A 4LMQD 2NVQB 1RHPA 3HFZB 5M3MG 4G4KA 1B9NA 1DCZA 4H0LC 1A8VA 2I5HA 4LUZA 4GNXC 4MTNA 1A2UA 1J8IA 3CCMA 4LFCQ 1JR0D 1GUOA 1T5XD 3K0XA 1SYCA 1ENCA 1F2MA 2I07B 3PUWA 3C46A 3QOJA 5IWAQ 1N34Q 5H1SE 4C3JB 1VQ7A 4RKLA 4OO1H 3KYHC 4DK0A 1Y1WH 1L0YB 5C4XH 2K5WA 3GV3A 1EY9A 3BVZA 3KFUA 2FJ2A 1VQHA 1S4ZA 1MBYA 2F0QA 1CT1D 4L6TB 4DK1A 2AUKA 5JOBA 2EQSA 2GN5A 4UY8C 4JI3L 4OO1I 5LMUL 2H1EA 1B8AA 2PZUA 2HQLA 1EY5A 4IUUA 2JA9A 1GM5A 2F0TA 1L1OB 5CV8A 3W5OA 1B50A 4YY3Q 4YCWA 1TKWB 4DV3L 3SEBA 2NN6H 2IW3A 4OX9L 2YTVA 2ZXRA 4X65L 1S40A 1EYGA 3S2DB 1UE7A 1I4XA 1V8QA 4IALA 2JA7B 4DV0Q 1MJEA 4B3RL 3SR1A 1A62A 5LL6S 1EOTA 2Q8IB 3GTOH 1NAPA 3R8BA 4DV7L 2NN6I 4DR2L 4HAEA 1RF2D 3SGIA 1ZKOA 3TMEA 4IFDG 2F0PA 1QOHA 1O7YA 2PMZE 3ULJA 1C0AA 5FK9C 2Q2HA 3NHHA 3M3YB 2L4NA 2CQAA 3CCEA 3N6RA 3BDLA 1A6XA 2E5LQ 3G6JB 2HQEA 4LF8L 3GTPH 2L5TA 4DR5L 3I73A 3SK8A 2EY2A 3S1MB 2OTLA 1YIJA 3LWEA 4AH6A 4C2MB 5I2YA 3RN2A 1S5ED 4PMWA 4RG1A 1TXYA 3MEFA 4YWMA 3SVMA 2MGSA 2EE1A 4DV1L 2FINB 3KF8B 1IBML 3CP0A 2KECA 5C3XA 1JC7A 1T5EA 1BOSA 2O2LD 4GKJQ 5GAGC 4DUZL 4WRDA 1N32Q 5E4XA 4DR4Q 4Z9CB 2EPBA 1ASYA 3RN5A 4P74A 2QEJC 1VQKA 2VY3A 2EYPA 4K8JA 3STBD 3QO2A 1XXGA 1LM0A 2AMCB 1BUVT 2BDNA 3MZ5A 2HT1A 4AIMA 3K5LA 2Q2IA 2NBFA 4X6AH 3TRZA 1LACA 3FP9A 3G7LA 4GLVB 4G7ZC 3RLFA 4DXFA 2ES2A 5IGBA 2YV5A 5CC4A 1GO3E 3O13A 4H7BA 1I6HH 1S5BD 5C3WA 4A3GH 5M3FH 1EUJA 1ZYRD 2HIVA 3J81i 2CWPA 2XRQD 4R8NA 3H0GH 1K28A 1XNQQ 2JA5B 3FRPB 4TKOB 4ABNA 1FNVA 4C1NK 3PIOA 4KKUA 3HRZC 3RD4A 2Y0SB 2JA6B 2R92B 2RQXA 3A8KE 4UPAA 4EVOA 3FHWA 5ELEA 4JI7L 1E1OA 1TWHH 5FJ8H 4IOCA 2ICIA 2ZT9C 3DM3A 4A3BG 2PW7A 3R3OA 2CVRA 4ODGA 2R7ZB 3NSWA 1VQ9A 1PH8A 3NXWA 2I5LX 3KLSX 3S9WA 1BO0A 2NWGA 3U4VA 1K3BC 2KCNA 1JOKA 1DJRD 1D1KA 3ZJYC 1PV4A 4KK7A 5ELNA 3UDGA 5FO8B 5ISRA 1C8CA 3I2ZA 4XDXA 3ULLA 3I8ZA 1GKHA 4CKCA 3RLNA 2JEAI 1KRSA 3J80c 1E0BA 2A8VA 4NMZA 4IUTA 1N34L 1X65A 2MHVA 3MXUA 5GROA 3NE5B 5EPJA 4F87A 1KDCA 2K52A 3RZOH 4IUNA 1JMCA 1HPCA 5HY6A 2XWBB 2WKDA 1Y69U 3M4OH 2OTJA 3PUVA 1HTPA 4EQOA 3BG3A 1F9RA 4MIUA 3V2TA 4BBRH 1EZ8A 2EYOA 2ZJQA 4K0KQ 1GD7A 2Q8RE 5IYCG 4X62L 3EFXD 2R93H 5JJIA 5BN3A 2JA5G 4DV2L 5FLXE 3EVQA 3UDFA 4YY3L 2DNCA 2F0FA 5D14A 2OQ0A 2RSOA 2Y0SG 2JA6G 2OWOA 4J1MA 2EY5A 1I4HA 1DYQA 1OXVA 5IGCA 2Z4IA 1PRTB 4DAVA 1FVIA 3ER0A 3D6WA 2C35B 1XMOL 2A6EC 2AUJD 4A3FG 4LFAQ 2IX3A 3HOVB 1JORA 2MNAA 3I7FA 2R7ZG 2JYOA 4CDFC 3JAMc 3E9IA 1SMXA 3NPPA 3RLOA 1CSPA 1AP0A 1I5FA 1VQNA 2VW9A 1UNSA 4FNFA 1TWCB 3MAQA 3PF5A 3QOLA 1RJTA 2HHHQ 5CBAE 1SFOB 1AW7A 4A3CH 5FLMH 4A3MG 3P20A 1XMQQ 2D62A 1WD1A 3FKIH 4DK6C 3IFDA 5FLXL 2M9VA 1Y1VH 3ONAB 1TY2A 1Z9FA 3E6ZX 1Y8OB 3W2DA 3GTGH 4X64L 5C4XB 5K36G 2ZJRA 3OSOA 3A56A 1GUNA 5KNBA 5JJZA 4ZAIA 5KYIA 1JT8A 1JWMD 5FO9B 2NZHA 3HKZE 3CC2A 2UU9Q 4BY7H 4YHHQ 2L11A 3PIP3 2XGTA 3MXNB 1VQBA 3NBHB 2KVMA 2V4DA 1PXUA 4O0AA 4PZ8A 3TEHB 1DOMA 4IQZA 1YNNC 1NNXA 5JVH3 1AH9A 3TP5A 2MQHA 2B2UA 1SR3A 2A69C 5C3EH 1PH6A 1IBLL 4FDBA 1J5EL 3KDFB 1STGA 1B9MA 3HOVG 2MP1A 1H9JA 4O2DA 3CCQA 3GTOB 3VYUA 4CJ0B 3A7LA 1U5KA 3U9SA 5IE8A 1CKMA 1YHQA 1CHPD 1D5XC 1KLUD 4JI1L 5M5XH 1XNQL 1IYJB 1X6OA 1LUZA 4B9XA 1PH2A 2Q2UA 2GVBA 4K6LA 1SYFA 3K5MA 3E0EA 4GOPB 1QZGA 2A74C 3MVVA 4J6HA 1O7ZA 3R93A 1XPRA 1BDOA 1YNJC 5EQ0A 2O4XA 1N36Q 4LF7L 1TWFB 3EA6A 2A1AA 2EYHA 4JI2L 1II3A 2QDLA 5CV9A 3GO5A 4G7HC 1Y1WG 2WB1B 1YJ9A 5C4XG 5DAUA 2VQFL 1DONA 1R4PB 5TSSA 4RHSA 1VQ8A 4WJ4A 2B2YA 1QVFA 2AKWB 2QW7A 1Q81C 4QIWE 3T1YQ 3NENA 4HCEA 5CBEE 2YU9H 4Q5VA 1EFID 1SYBA 1TWAH 4DR3Q 2D0PA 4R4TA 3H09A 3TZUA 4N8FA 4TRDA 5C5LA 2NN6G 4HMIA 5CYUA 3R2IA 1NBWA 4IOAA 1EEFD 4RFBA 1Q12A 3T16A 2PQAA 3P75A 5C4ZA 4KKTA 5JEAJ 4NXML 4WORA 1KDBA 1YJWA 4O1NA 2KHJA 4K0KL 1MIUA 4A3JH 2F0DA 4GN5A 3M4YA 1JB7A 1MKHA 1RD9D 3AMUA 4A3GB 2QCPX 4RAUC 4JI3Q 4JI5Q 1VDZA 5LMUQ 1QUQB 3H0GB 4MNOA 4A3IH 3S2HH 2RHQB 4DAMA 4HSVA 1LO5D 3AFPA 4DNIA 3MXNA 5ELDA 4DV3Q 1NMGA 1B4OA 5JEAH 3I4MH 4LUVA 4CKEA 4OX9Q 2F0EA 3DWQA 2N49A 3J7AF 4JV5L 1TWHB 3CKIB 4RCNA 2F0HA 1RDPD 2D5DA 1EEID 4K8IA 4RHRA 4LFAL 1PVOA 1NJIC 4FXGC 1HR0L 4A76A 1U4MA 4GS3A 1J9OA 2XIWA 4B3RQ 2E2DC 4H13C 1EIHA 1HA6A 4DV7Q 4JK1C 2ID0A 4KD3A 1FR3A 2A6ED 3HOWH 2J0TD 1I94L 3J81E 4P72A 2Z9HA 5EAYA 4X3SA 2PZWA 4QUCA 4U68A 1XTDA 2PW5A 1EYCA 4GLAC 3W1BA 3NQIA 5JVG3 2N88A 1CKNB 1XMQL 3HOUH 2XSCA 4OIJA 3ITPA 5I9OA 1N33L 4LF8Q 3QG1A 4IURA 3F2DA 4DR5Q 3RZOB 1BNZA 3ERQA 3MA2B 5K5PA 5IGGA 2K04A 2WP8J 4DR7L 3M4OB 4J8QA 4P75A 1KIXA 3CQZH 3LWUA 3S16B 1N8RC 1I4GA 4DV1Q 4BWGB 4N9TA 4DV6L 2CH4W 3W1GA 1CZWA 4BBRB 2D0OA 2K50A 4C1NI 2L15A 3A54A 4JCVE 1JQYD 1CA6A 5D3DA 3STBC 4A3GG 5M3FG 1U4PA 3CXCA 4G57A 3H0GG 2R93B 4DUZQ 3BVMA 1SJED 1PH9A 4L5QA 3J81L 4FVMA 4IO9A 1AFPA 3OPOA 1S5FD 1V9PA 1H9RA 3KBGA 3HOZH 5FJ8G 2F0NA 1V1OA 4OHJA 4WFN3 2N8NA 4C3IH 1A3UA 5BN5A 1YNND 5KNCA 3CW2C 5I2XA 1STAA 3IKJA 4DR1L 1YHBA 1AE3A 4PQXA 1EY6A 3H94A 1LTLA 1WTXA 3J7ZC 1E2ZA 1W3SA 2NTTA 4ZKCB 3CMEA 5I6WA 4NPSA 4B08A 1ILPA 1LTGD 3T56B 1LT5D 4BA1I 1WFQA 2RDGA 1VMCA 3KF6A 5J22A 1PH3A 2JQOA 5C44H 2F0OA 1N36L 1XNRL 3GP7A 5C0XJ 4ID6A 1G2TA 4IJLA 4LF4Q 4JVZA 5IIFA 5FKAC 3T1HL 1Y1VB 1DOKA 1HNWQ 1BCPB 1YNJD 3PV0A 5C4JH 1NE3A 2XWJB 3K7AH 2N55A 2NZOA 2E2IH 1E22A 1Q1EA 3OIQA 1GOZA 1EFWA 2H4OA 1LYLA 3VA7A 4BBRG 3T1YL 3A55A 4FF4A 1XPUA 4IZ8A 4A93H 1F9QA 5M5YH 4JBWA 4UP9A 2N3SA 4QQBX 3I4LA 4K5WA 4AYBE 4ZLTF 4DR3L 2R93G 4HJ8A 1RCVD 4BY7B 2MJ8A 4A3EH 4R4OA 2YTYA 3RR5A 2M00A 3LGJA 1O7LA 1MHWC 3KLWA 1EIYB 3D0FA 1I50H 2LKVA 1AEXA 3HKSA 4NP5A 2K4KA 3V96A 1WCMH 3SE0A 3KBXA 5C3EB 1EU4A 2UUCQ 3CCLA 3FPPA 1SMYC 3HOXH 3NBIA 4QUFA 4JI5L 4XYOA 4X62Q 3KOJA 2B2UC 1KNEA 3NUCA 1H9SB 3Q23A 4DV2Q 3S17H 2M2LA 2F0LA 3A7AB 3D4RA 3I56A 2RDHA 2F0MA 5IY0A 4A3LH 1BXTA 1IYUA 1J6QA 4CHTB 1PYWD 1XPOA 2NVYH 5FLMG 2KHSA 3S1RB 3FKIG 4HIOA 1FYCA 5ELFA 1K3RA 3PIPA 4DV4Q 2A6HD 2IWHA 2F1MA 2HUGA 1XMOQ 2QEXA 3S1NH 4J15A 2RHSB 1Y1VG 2JP1A 1I4QA 2G9HD 3JC66 4P73A 2NUCA 1QVGA 2IHEA 3VR6A 3AYHB 4ALPA 1YI2A 1TU2B 4YCVA 3HG9A 5L37A 1LLRD 4JC0A 1O78A 4Y52H 2ALYB 3ERSX 4BXXH 3OOCA 2BE5D 3FVQA 1TWAB 3S15H 1RKNA 4BY7G 2X6LA 4RMFA 3GQBA 2WKCA 2B2YC 3PUXA 5LL6X 4Q0FA 5J3BA 2IT1A 4A3BB 3L9AX 4V0BA 3K57A 4FF2A 3BVGA 1BBXC 1TS5A 3U9OA 1ET9A 1C4QA 3PCOB 5C3EG 2VZAA 4X64Q 3VA5A 1FJGL 4HN7A 1SLJA 4HR7B 5IGEA 4UAIA 4A3JB 2F0KA 4WJ3M 1QILA 3CC4A 2BH2A 2UXDQ 4LF5Q 4DR6Q 4XXEA 3I72A 1EY0A 2WAQB 3TDQA 1AZPA 3CRKC 1KDAA 3KJOA 4IPCA 3S2HB 1EY4A 4C3HH 1BBUA 2PCFB 2F3IA 2C9OA 3M7GA 1VQEA 5BR8Q 1W2BA 1VQPA 4JOIA 2EXDA 1M8AA 3H91A 4KI0A 4AQYQ 5EPKA 1KC8C 1OTCA 2UXCQ 2LFNA 5I4DA 1BVSA 1IBLQ 1J5EQ 3UE0A 2E2JH 4DFAA 3UDXA 1B3AA 1NMFA 1R4QB 1HFGA 1VS0A 2JSOA 4ZYSA 3CD6A 2WIIB 1K83H 4JI1Q 1U4LA 3G6EA 2BCOA 3SXHA 1GUWA 2JEBI 2RDFA 1H9SA 1LT4D 4JI6L 1L1OA 4M8AA 5I6YA 2HCCA 1D6EC 4MHEA 2A5HA 3TQYA 4KLKA 1A15A 1VQIA 3ULPA 2ZJPA 3HOUB 2F0WA 4JI0Q 4LF4L 2N78A 4A3FB 4LF7Q 5G3LF 2R3ZA 1I6VC 4IPDA 4ME3A 1HZCA 1HNWL 2F0JA 4JI2Q 2I0QA 1KL9A 3S14H 1I4PA 1VQDA 1IKMA 1HJPA 2JJQA 2AQ1B 1GUSA 2VQFQ 4F88A 1SE8A 1G91A 1QJOA 4P2CB 2B2TA 2EZVA 1G291 1PFNA 1PTOC 4BY1B 2VUMH 1YBYA 1EQTA 4A3JG 3GTQH 4GNXB 5LMNW 3EBEA 1TIID 1ESRA 1TQOA 2WAQG 3DMUA 2R7FA 1X3FA 3FMCA 4A3MB 4HEDA 2B29A 1CQVA 1YEZA 3E5SA 4JBMA 5JEAG 3CAMA 3I4MG 1HRJA 3GTKB 2F03A 1VF7A 1XTCD 3RZDH 1JOOA 3AB9A 2UUCL 2VQEL 1HR0W 2PPBC 3EIVA 4NXMQ 1EL0A 5D3IB 3NTKA 3KF8A 1ENFA 2TMPA 1Q8KA 5LMNQ 3Q8DA 3HOWG 1SNQA 1PFMA 2LXKA 2WB1E 4FXDA 2AQ2B 1SMYD 2ZM6L 1YITA 1NR4A 4JYAQ 4B9WA 2IX0A 1QVCA 4DAPA 5A2QE 2EJGC 1S5CD 5HGTA 1I3QH 1V43A 5C44B 2EVBA 3PO2H 3HOUG 1ZXTA 4JV5Q 3M9BA 4DV4L 5ELOA 1Q82C 4NDXA 1HR0Q 2B2WA 5G3LD 1VMPA 1MI2A 2Z4HA 4GLXA 4KHPL 1K8AC 1G6ZA 1E3PA 3MXGA 3T13A 4BY1G 1I94Q 2ASBA 3DUZA 3GTLH 4B3ML 4UHVA 5IT9E 2BDOA 1S72A 5M5YB 3T53B 1V1PB 1IZ6A 1KQSA 4B3SQ 3PMFA 4A3EB 3S1QH 4A3KH 1YZ6A 2K5NA 1N33Q 4LAAA 1BQQT 3VR3A 5KIXA 1F9PA 1SEBD 3G71A 1IKLA 2D9UA 2PNRC 1HNXL 1Y1WB 3HOZG 1HHVA 2XVSA 4LF9L 2NYZD 1EWHA 2F4IA 1CQFA 4XQJA 5A2QL 4DR7Q 1STEA 4C3IG 3D4WA 2V1CC 2OEOA 4DV6Q 3CC7A 1SDFA 4M1UB 2UXDL 4LF5L 4GKKL 3VYSA 4DR6L 1FNWA 1E7ZA 3AU7A 1IBKL 4BA2I 5IYDH 1NR2A 3L0OA 1PTOF 3ZYYX 1FNUA 2E75C 3S17B 1SAPA 1PZKD 2NTSA 2NVQH 5IGDA 5IP9H 1PH1A 2P5ZX 5BR8L 3J7A5 3HEJA 1BBWA 4QJFA 5C44G 2K5VA 5IT9L 4AQYL 2UXCL 3VYRA 4LW1A 4PV1C 4OEMB 3D3RA 5T1GA 3S1NB 3BYYB 1NY4A 3AEVA 1F77A 4DR1Q 1FL0A 1OXTA 3K5NA 2K14A 1LTAD 1JE4A 4C3JH 1WTQA 1KHIA 5FO7B 5FLXc 1Q7YC 3Q6SA 4HSPA 4KTAA 1PDQA 1QE6A 2B2VA 4A93G 2Z6KA 2F0UA 3P1HA 4ZUJA 5LHY1 3QJYA 1L0XB 2E2HH 1K8MA 1C9OA 4XQQA 1EU3A 4G7OC 3OW7A 3BS1A 4A3EG 3H3VH 4JI0L 1XNRQ 4HJ7A 5M5WH 2H5XA 3QR8A 3GTPB 3L7ZC 4XT1B 1WOCA 2I5MX 4L63B 4OO1G 3T1HQ 3GD7A 1QB5D 3K5OA 1R9TH 1Z7TA 3GTMH 2O5IC 1WCMG 2DGYA 1X3QA 4PZ6A 3H3VI 5CV6A 3J80i 5EKLA 4FXKC 1VQCA 2ZXPA 4DF7A 2NZ1D 1KNAA 2KEEA 4H02A 3HOXG 3PSIA 2JA8H 1HUNA 1X55A 3NTHA 3P7JA 4KMUC 1X3EA 5JJKA 2B63H 3FPUB 2JA7H 2Z6BA 2JE6I 4B3TQ 2K6AA 1D8LA 5F2DA 1PTOD 3K0YA 5ELBA 3BDCA 2PYKA 4N8X1 4A3LG 2OT2A 2EIFA 1AZQA 1ILQA 2K7VA 4KY7A 2YYZA 2MPMA 3KLRA 4PNYA 3C3LA 3J7AV 1WTHA 2KHIA 4MZ9A 4JI4L 3OMGA 4RKBA 4ZQ3A 2B8FA 4YCUA 2SNSA 3BYTB 1IHZA 5I9PA 4HJ5A 1I6HB 2MUYA 5LMNL 3HOYH 3PO3H 1D1IA 1VQFA 4JOIC 5M3FB 2FFKB 1E2WA 3PUZA 3S1MH 1K83B 3KJPA 1EYDA 3I4OA 2EY1A 3J81j 1OXUA 3OMCA 3DM1A 4GN3B 4JYAL 2A6HC 1B1ZA 4BXXG 2L12A 2PO4A 3F1ZA 4H44C 4K14A 3NBHA 4HCSA 1PHJA 4PG3A 1GHKA 1SE2A 2RVLA 2XN9C 3DXJC 5C4HA 3H3VC 4IPGA 4X3KA 2F0IA 1KABA 1UWVA 3MFGA 4OXPA 1G51A 2NB0A 3BU2A 4DGZA 1L1OC 3KDFA 4UDUC 3S14B 1Q1BA 1E24A 4CJ2C 1YNXA 1HXYD 2BE5C 3UE1A 2L55A 1ENAA 4ZCKA 3C2PA 1SNOA 3V05A 2JN4A 4KJOA 1CTMA 3GTQB 2KBNA 3NEMA 5AJ3L 3N52A 2L0CA 3OWFA 1DM0B 4EGVA 4B3SL 4GOPA 4GZYC 3HKZB 1OO9B 2B2TC 4C3HG 2CW0C 5CORA 4APVA 3PUYA 1AN8A 3K81C 3GTJH 3L3OC 1EZ6A 5EPLA 5KNDA 1YVCA 2G5DA 2OCEA 1LABA 2CWAA 3D31A 4K6DA 4EX5A 2R92H 1Z6HA 1MD2D 1IL2A 1FJGQ 1KAWA 3SK4A 1SBBB 3L2PA 1JJ2A 1A0IA 1JWUD 2EY6A 4OL7A 1DXMA 5E4WC 1VCIA 1QCBD 3NELA 3AQQA 3OTOQ 4A75A 3U4ZA 4DK3C 1UEBA 2R7DA 3CHBD 1HZBA 3A8JE 1U9RA 4QL5A 1GVPA 1BCPF 1DOLA 1I3QB 3PO2B 1B70B 2RA4A 3T4AC 3H6MA 1NTGA 3QIAA 3VYTA 1CHQD 1MJCA 4L5SA 4E6IA 1X3PA 1F2LA 2D2CC 1P16A 2K28A 2FXQA 4F8MA 2HCIA 2HIXA 1ASZA 4DNTB 3KK7A 4R1JA 1LTID 4HJAA 1SNCA 3A74A 2VUMG 4TSSA 1QUQA 2B2WC 2BA0A 3GTLB 2ZXOA 3RNUA 3TP6A 3NWTA 4QIWB 4DKAC 5CV5A 4JI6Q 1Y8NB 4OONA 1WTVA 3EJIA 1WJJA 3MTSA 4QGUA 3HS0C 3IRBA 3SK6A 5CV7A 3HKZG 2UUAQ 1SJHD 3FKIB 4A3KB 3M4PA 1A63A 3I90A 1HZ9A 1WVLA 3X3NA 1M90C 2XRSD 3HZXA 3GTGB 5EBCA 2DJGC 4QB4A 2OXPA 3W3AA 3J81c 5NUCA 3A5UA 1E1TA 2Q2TA 1C7YA 3CF5A 2UXBL 1EIGA 3OWEB 5C5MA 5C0XH 4B3TL 3I91A 1PH5A 1VQ5A 1B3QA 3HOVH 2EYFA 5CMDA 4DN4M 2OF1A 1WI5A 4QMGA 3H15A 5KRUA 1CKNA 3HGBA 4MN3A 3E9HA 4LF6Q 3CPWA 1BCPD 2KA7A 5C0XI 5HURA 2Y0SE 1TWCH 3PO2G 5DM73 2F3VA 1ZEQX 1QWYA 1YHAA 2VQEQ 1SFOH 4FP5D 2ZTEA 4PZ7A 4PMCA 3R2TA 4QCLA 4YIJA 2K33A 5M5XB 3NK9A 2ZTDA 3G4SA 2DN8A 2IPKD 4BBSH 2ZM6Q 4NB3A 4CGYB 3CCUA 1AE2A 1JWSD 4JW0A 4LUOA 5DLQE 4K5VA 2E2HB 4R4CA 4A3CG 3CCSA 2IL8A 2KCCA 2X69A 1JE5A 4CDCC 3TP7A 4A3KG 5M5WB 4LWCA 1LT3D 1TR5A 2B2VC 4A4IA 2Z6KC 4R9WA 2K01A 1SNPA 4A3DH 1KTKA 1R9TB 3GTMB 2QDBA 3BZCA 4KHPQ 3GDEA 4HTHA 5KGUA 2FHTA 5JPMC 2KEDA 3EN2A 1VQGA 1PRTC 1TS2A 2JA8B 2Z8LA 4JBKA 4TVAB 5IP7H 2F3WA 3WWVA 4B3MQ 2B63B 1Z47A 3Q0AA 3OW2A 5IYDG 2YU9B 4DUYL 2CCZA 4XQNA 1F2ZA 4XT3B 2F4VQ 3IL8A 1K0RA 2X6GA 2VS1A 4K5XA 1JOQA 1G2SA 4HIMA 2K5HA 1GHJA 3VDYA 2PQEA 1HQMC 2SNMA 5IP9G 1ET6A 1VQOA 4HMJA 2L1BA 1VQAA 2RF4A 2WV6D 5CGKA 1LTBD 4ZUIA 3U50C 1UEAB 5GAHC 1B44D 1EQQA 3VR5A 1HNXQ 3WOEA 4LF9Q 4HIDA 1XWEA 2CW0D 1TWGH 5JPNC 3E0JA 2LXJA 5D65A 4JG2A 1SYEA 3LX0A 3J80E 1PTOH 4ZKBB 4IUPA 3HOYB 3PO3B 4GKKQ 5GAEC 1KAAA 1TWFH 1UE5A 4IPHA 1SE4A 4IUVA 5GQOA 1IBKQ 4C3JG 3OTOL 1CM9A 4A3IB 1F9SA 2GVAA 2B39A 3UDIA 1OXSC 2HDLA 4KN4C 5IODA 1KXLA 3I3CA 2CHBD 1G8ZD 4HIKA 4IN3A 3DEPA 3I4MB 2F0VA 2J4XA 5IYBH 4QF4A 3TS2A 2Z0SA 1A2TA 1RIPA 3MC0B 4FYDA 3NQTA 5A35A 1SYDA 3T51B 5EJWA 2HDMA 4RA8A 4RWSC 3CCVA 3MEHA 1G6PA 5KEEA 1L2FA 2RKSA 4OWWB 2EOTA 3M85A 1MGSA 2QILA 3HOWB 2KJXA 5EBDA 2TSSA 1D7QA 1SN8A 1QG7A 3PQIA 2JA8G 2NVXH 2JK8A 1QNKA 2WINB 4L5TA 4DU9A 2K32A 2B63G 2JA7G 2K1BA 3J80L 1W6JA 3BZDB 1W6KA 4R4IA 4AYBB 1WD0A 1M1KC 3PGZA 4ZRZA 2UUAL 2ICEC 3JAME 1CZGA 1O7IA 2WACA 1FGUA 2AQ3B 4RGTA 4DXGA 1D2BA 2B8GA 3VR4A 4RCOA 1CKOA 1WYDA 2VXWA 3QWNA 1SRUA 3GTJB 1EQRA 2R6GA 1WTOA 4GOPC 2BOSA 2FMMA 2L9HA 3CQZB 1VQLA 2LY7A 1IXRA 3CPFA 3D8GA 3ICEA 4Y7NH 3NP8A 4R4QA 1DD2A 4X66L 3HOYG 3PO3G 4CDEC 3OIPA 4CJ1B 3D6CA 1V1QA 3RMHA 3S24A 3VR2A 2LMCB 4A3IG 1PRTF 2RCNA 4RGOS 4HJ9A 4EQPA 1LTSD 2E74C 1DGSA 4LF6L 1ICWA 5FOBB 4DV5Q 2KCTA 2HD3A 1PH4A 4POGA 1IW7C 1FD7D 4PMBA 2KUMA 4LFCL 1TVXA 1KRTA 4DPGA 2UUBQ 4JI4Q 3HOZB 2EDGA 3Q22A 1HQRD 3OYYA 2K5DA 4KD4A 1HNZQ 1CK1A 1A3TA 3K7UC 5EGTA 4C3IB 2F0SA 3JAML 5DEHA 4UP7A 1A3VA 3KUPA 5IWAL 2A73B 1SXTA 4CDDC 1IYVA 3I4NH 4NXNQ 1SNDA 1KD1C 4OWXB 4K2LA 5M3MH 3S16H 2EYMA 2PMZB 2AHOB 3WDNA 1RL2A 5C6AA 3TP8A 5IGFA 1T9HA 2QF7A 4AYBG 1BKBA 2PNHA 3KLSA 4ILWA 2BA1A 2CKZB 3E3XA 3CCRA 1STHA 1B53A 1S3OA 4KV6A 1WTRA 4R8IA 5C4JB 1HA5A 3K7AB 2E2IB 1UE1A 1BF4A 2ENBA 2K75A 3F2UA 2PI2A 2R92G 2SDFA 3K59A 1PFBA 3TN2A 4A93B 1PZJD 4DV0L 5AJ3Q 2B3GA 2WFWA 1VQ4A 4I65A 2F4VL 3DEOA 3X3MA 1H9MA 1PRTD 5KYLA 1PYBA 1CFMA 4RGNA 4EQNA 1JJCB 4OGQC 1PYSB 1I50B 1EWIA 1SROA 4POFA 4C56C 4IFDJ 4DA2A 3I70A 1WCMB 3DLLA 1P8LA 2NVTH 1CUKA 1ESFA 5CV4A 4TQUS 4OIKA 1F2YA 1HCZA 1E2VA 5E7NA 2I46A 1CA5A 2E5LL 3HOXB 1EIFA 3B6YA 1X3GA 3F8TA 4GNXA 1PFSA 1QNUA 2DUDA 2PQAB 2IX1A 1I4RA 4CBVA 4BBSB 1K8OA 4IFDH 1JICA 2E8GA 3TREA 2QGQA 1KLGD 2NVYB 2RCFA 1PMRA 3A8IE 1MSGA 4ULLA 2A68C 4GKJL 4MTKA 1N32L 1CI3M 4DR4L 3UI2A 1UAPA 1M4VA 2VB2X 3IFTA 4RH6A 1NSNS 4IFDI 4A3DB 4U673 4F7XA 2IY5B 1JJGA 1EOVA 1U4RA 4LNQA 1GXDC 1SSOA 1NUCA 2SEBD 4L8JA 1HFNA 3TS0A 4NW2A 5C0XG 3CMAA 2IJ0A 2QA4A 4KKSA 3S15B 1L0WA 3TZDA 2AWOA 3WOFA 2F0GA 1JCKB 4DAYB 4EQ5A 3J7YW 4X3UA 1EQVA 3C1FA 2DNEA 3MHBA 4K2KA 2CH4A 3K58A 4QY7A 1Y14B 4FO2A 3CRLC 4JI8Q 4YWKA 1TWGB 2EYLA 2RSNA 4BS9A 1X32A 4ME5A 1PTOB 2JXMB 3S1RH 1FGBD 2UXBQ 3S2DH 1QZHA 2FMCA 5IT9c 4NKLA 4ZK9B 1BCPC 5HGQA 3RUZA 1XX8A 3FDTA 1V1PA 3OHXC 5IOCA 1XYIA 4X3TA 4LFBQ 1Q8IA 4C3HB 4BBSG 3DWAA 2K05A 1S5DD 2KQ3A 4IUQA 1Q86C 1K73C 4DV5L 1Q3LA 3IAYA 4JBJA 2A19A 2O5JC 3DWPA 2UUBL 2F52A 1VQ6A 1RTNA 5EKIA 1LTRD 3DHQA 1YJNA 1H95A 4JPBW 4FF1A 1HNZL 2J7ZA 4I7ZC 3M3YH 1EY8A 1GUTA 1XJVA 4A3DG 1K0SA 2E2JB 1D5MC 1IW7D 2Z1CA 3K6OA 4A3BH 2VNUD 3C1EA 2DY7A 2RBMA 4S3SA 4XYQA 2OQKA 4C2MH 4NXNL 1LT6D 3I55A 3K8AA 1PA6A 1D5ZC 3NWSA 4GN4B 3U58A 2NVXB 1HTLD 2DJFC 5IP7G 5EKKA 3EROA 2LS01 2XNAC 1PZID 3PIO3 1RODA 3JAMi 3HP3A 5T1IA 3Q24A 1TT2A 1ONLA 2Q8TA 1PLFA 2GA4B 4LJZC 2PZTA 5J39A 1X9NA 3NTIA 5E3FA 3TBIB 1EWCA 3EQLC 3KF6B 2E76C 2KOLA 2KENA 5COYA 4FF3A 1HZAA 4XIGS 4Y7NB 2VUMB 3TSSA 5M9OA 4I7AA 4X65Q 3FEWX 1U0LA 2VL6A 4OELB 1LTTD 4DUYQ 2K03A 1NCVA 3AFQA 4WJWA 2XTIA 1Y8PB 2WB1G 4DR2Q 5IYCH 1VF5C 4DAYA 2YTXA 4N9PA 1K8GA 5BN4A 3GV6A 4YWLA 2JA5H 5IYBG 3F2BA 5AFWA 1SE3A 3RZDB 1GJXA 2JA6H 2HHHL 4L5RC 2C5CA 3BJUA 1IL8A 1RTOA 3CCJA 2ZTCA 3G48A 4O42A 1BR9A 3BZKA 5GADC 1UE6A 2EJFC 3A5ZB 4A3FH 1PH7A 1H9KA 1TY0A 3I4NB 1O80A 5DM63 2R7ZH 1SYGA 3M4QA 5DNFA 5JJLA 2EJMA 2AWNA 2MO0A 3D4DA 5M3MB 2ATWA 1STYA 1LV9A 3LNNA 4DNRB 3MXPA 4BY1H 4KHZA 1OXXK 2MO1A 1IBMQ 1MSHA 1VQJA 2UU9L 1EYAA 4YHHL 2KCMA 4A3MH 2CQOA 1SNMA 2EYJA 5ELCA 4RGMA 2A68D 3A0JA 1X56A 3MWYW
chains in the Genus database with same CATH topology
2VQFL 5GAHC 3GTKH 1VQ8A 1EQQA 4WJ4A 4JYAQ 1HNXQ 2IX0A 1QVFA 1QVCA 2AKWB 4LF9Q 3M7NA 4HIDA 1YJ9A 1Q81C 4QIWE 1Q46A 1TWGH 3T1YQ 1I3QH 1V43A 2LXJA 3NENA 3PO2H 3HOUG 4JG2A 4XTCS 4JV5Q 3M9BA 4DV4L 1K9MC 5ELOA 2YU9H 1TWAH 1Q82C 4DR3Q 2D0PA 4R4TA 4GKKQ 1HR0Q 2CFMA 5GAEC 1TWFH 1UE5A 2WAQE 4IPHA 4P71A 5GQOA 1IBKQ 3OTOL 2IHFA 2LSSA 4GLXA 2GVAA 4OWTB 1K8AC 3UDIA 2NN6G 4KHPL 3PF4A 1E3PA 1OXSC 1NBWA 1KXLA 4IOAA 2MFIA 3K80C 4BY1G 4HIKA 1I94Q 1Q12A 2ASBA 4JI8L 1HH2P 2PQAA 5IYBH 3GTLH 4B3ML 5JEAJ 1S72A 4UP8A 3TS2A 2Z0SA 4JI7Q 4NXML 1YJWA 1RIPA 4IJHA 2KHJA 4K0KL 1MIUA 4X66Q 1IZ6A 4GN5A 4A3JH 1KQSA 4B3SQ 3CCVA 1MKHA 1B7YB 1JB7A 1CSQA 1VQMA 3I4NG 1G6PA 2PI2E 3F2CA 4A3KH 4JI3Q 4JI5Q 3S1QH 2BH8A 5LMUQ 1YZ6A 1QUQB 1L2FA 4LFBL 4OWWB 2K5NA 1N9WA 1X54A 4MNOA 4A3IH 1N33Q 3M85A 3S2HH 3G71A 2RHQB 4DAMA 3HFZB 5M3MG 1HNXL 3HOZG 3AFPA 4DNIA 4LF9L 1A8VA 1D7QA 2I5HA 1SN8A 4DV3Q 4LUZA 1NMGA 2NVXH 2JA8G 2JK8A 3I4MH 4LUVA 4L5TA 4GNXC 4OX9Q 4DR7Q 4MTNA 2B63G 2JA7G 2V1CC 3CCMA 2N49A 4LFCQ 4JV5L 4DV6Q 3CC7A 4LFAL 2UXDL 1PVOA 1NJIC 4R4IA 1M1KC 2UUAL 1HR0L 4LF5L 3K0XA 3PGZA 4GKKL 4DR6L 4A76A 4GS3A 1E7ZA 1IBKL 4BA2I 4B3RQ 5IYDH 1O7IA 3PUWA 1FGUA 3L0OA 4DV7Q 5IWAQ 1CKOA 1WYDA 1N34Q 1SRUA 5H1SE 2ID0A 1VQ7A 1EQRA 1YITA 2NVQH 3HOWH 2R6GA 5IP9H 1I94L 3KYHC 1PH1A 1Y1WH 5BR8L 3J7A5 4GOPC 4P72A 1VQLA 5C4XH 1BBWA 4QJFA 1IXRA 3CPFA 5C44G 2K5VA 5EAYA 4AQYL 3KFUA 3ICEA 1XTDA 4Y7NH 2UXCL 1VQHA 4GLAC 4R4QA 4LW1A 3W1BA 4X66L 3HOYG 3PO3G 1CKNB 1XMQL 2EQSA 2GN5A 3HOUH 4UY8C 1NY4A 1V1QA 4JI3L 3AEVA 4OO1I 5LMUL 3S24A 4A3IG 2RCNA 1N33L 1B8AA 2HQLA 4DR1Q 4LF8Q 1FL0A 1OXTA 2JA9A 4HJ9A 3F2DA 1GM5A 4DR5Q 1L1OB 3W5OA 2K14A 1DGSA 4LF6L 4YY3Q 4C3JH 4YCWA 1KHIA 2WP8J 5FLXc 1Q7YC 4DV5Q 4DV3L 4DR7L 4P75A 4OX9L 2KCTA 1PH4A 1KIXA 3CQZH 2YTVA 4POGA 4A93G 2Z6KA 1N8RC 1KRTA 4LFCL 4DPGA 4DV1Q 4X65L 2UUBQ 4DV6L 4JI4Q 3W1GA 2E2HH 1S40A 1C9OA 3OYYA 2D0OA 2K50A 1EYGA 2L15A 1UE7A 4JCVE 1HNZQ 3K7UC 3STBC 4A3EG 4DV0Q 5M3FG 3H3VH 4JI0L 1MJEA 1XNRQ 4A3GG 4B3RL 4UP7A 4HJ7A 1A62A 5M5WH 3GTOH 2H5XA 3CXCA 3H0GG 4DUZQ 4DV7L 2NN6I 5IWAL 4DR2L 3L7ZC 3SGIA 1WOCA 2I5MX 4IFDG 3T1HQ 4OO1G 3I4NH 3GD7A 1PH9A 4L5QA 1R9TH 3GTMH 1WCMG 2DGYA 4IO9A 4NXNQ 4PZ6A 1KD1C 4OWXB 3H3VI 3J80i 2PMZE 3ULJA 5M3MH 1V9PA 1VQCA 3S16H 1C0AA 3HOZH 2Q2HA 2AHOB 5FJ8G 4H02A 1RL2A 3HOXG 3PSIA 2JA8H 1T9HA 4AYBG 2N8NA 1BKBA 1X55A 2PNHA 1X3EA 5JJKA 2B63H 4C3IH 2JA7H 2BA1A 2JE6I 3CCEA 4B3TQ 2CKZB 1D8LA 3CW2C 2E5LQ 3CCRA 4DR1L 4LF8L 3GTPH 1X56A 4DR5L 1S3OA 1YHBA 1AE3A 2OTLA 1LTLA 3J7ZC 1YIJA 4A3LG 2EIFA 4AH6A 3RN2A 1W3SA 1UE1A 4PMWA 4RG1A 1TXYA 2YYZA 2K75A 3MEFA 2PI2A 3CMEA 4YWMA 2R92G 4NPSA 2KHIA 4MZ9A 4DV1L 4JI4L 4BA1I 4YCUA 3KF8B 1WFQA 3KF6A 1PH3A 2JQOA 1IBML 3CP0A 5C44H 4DV0L 5AJ3Q 2B3GA 2WFWA 4HJ5A 1N36L 1XNRL 5C0XJ 1VQ4A 2F4VL 5GAGC 4GKJQ 4DUZL 1N32Q 4DR4Q 5LMNL 1ASYA 3RN5A 3HOYH 4P74A 3PO3H 1VQFA 4IJLA 1PYBA 4JOIC 4LF4Q 3T1HL 1VQKA 1HNWQ 2VY3A 3PUZA 3S1MH 1JJCB 5C4JH 1PYSB 3PV0A 3KJPA 1NE3A 1EWIA 3I4OA 3K7AH 3STBD 3J81j 2AMCB 1LM0A 1OXUA 2NZOA 2E2IH 1SROA 1E22A 4POFA 4GN3B 1Q1EA 4JYAL 2HT1A 4BXXG 4AIMA 4IFDJ 1EFWA 3F1ZA 3DLLA 1LYLA 4BBRG 2Q2IA 1PHJA 3T1YL 4PG3A 1P8LA 2NVTH 1CUKA 1XPUA 3TRZA 4A93H 4X6AH 3FP9A 4GLVB 4IPGA 4TQUS 5M5YH 4JBWA 3RLFA 4UP9A 2ES2A 2N3SA 5E7NA 4QQBX 2YV5A 4AYBE 2E5LL 2R93G 4DR3L 1EIFA 1GO3E 1UWVA 4OXPA 4HJ8A 1I6HH 3B6YA 1G51A 1X3GA 3BU2A 4A3GH 4A3EH 1L1OC 3F8TA 4R4OA 5M3FH 2YTYA 3KDFA 3RR5A 1EUJA 2HIVA 3LGJA 3J81i 1Q1BA 1PFSA 2CWPA 3KLWA 3D0FA 1EIYB 1E24A 3H0GH 2DUDA 1XNQQ 2PQAB 1I50H 1YNXA 2IX1A 3UE1A 3HKSA 3PIOA 2K4KA 2E8GA 3TREA 1WCMH 2QGQA 4UPAA 3FHWA 2KBNA 3NEMA 5AJ3L 4JI7L 2UUCQ 3CCLA 1E1OA 4GKJL 1TWHH 5FJ8H 1N32L 4DR4L 4B3SL 3HOXH 4IOCA 3DM3A 4GOPA 4A3BG 4JI5L 4IFDI 4X62Q 3KOJA 2IY5B 1VQ9A 1JJGA 1PH8A 1EOVA 4LNQA 4DV2Q 3S17H 4APVA 3PUYA 2I5LX 3K81C 3GTJH 3I56A 5IY0A 4A3LH 1J6QA 1YVCA 2OCEA 3D31A 2CWAA 3TS0A 3U4VA 4EX5A 1XPOA 2R92H 5C0XG 2NVYH 5FLMG 3CMAA 1IL2A 2QA4A 1FJGQ 1KAWA 3ZJYC 1PV4A 3FKIG 5ELNA 4HIOA 3UDGA 1L0WA 1K3RA 3I2ZA 3ULLA 3PIPA 3L2PA 2AWOA 4DV4Q 1A0IA 1GKHA 4DAYB 3RLNA 4EQ5A 2QEXA 1XMOQ 1JJ2A 4J15A 1KRSA 2RHSB 1Y1VG 3J80c 2JEAI 3S1NH 1VCIA 3NELA 3AQQA 2A8VA 3OTOQ 3JC66 1N34L 1X65A 4A75A 3U4ZA 4P73A 5GROA 4DK3C 1UEBA 4QY7A 2R7DA 1HZBA 1Y14B 2IHEA 2K52A 1QVGA 3AYHB 3RZOH 4ALPA 1YI2A 1JMCA 4QL5A 1GVPA 4YCVA 5HY6A 3M4OH 4JC0A 4YWKA 4JI8Q 2OTJA 3PUVA 4Y52H 1B70B 2ALYB 3ERSX 4BXXH 1NTGA 4BBRH 3S1RH 2UXBQ 3S2DH 1MJCA 1QZHA 4L5SA 5IT9c 3S15H 4BY7G 1P16A 2ZJQA 4RMFA 4K0KQ 1GD7A 5IYCG 2FXQA 4X62L 3PUXA 5HGQA 2HIXA 1ASZA 2R93H 5J3BA 2IT1A 5JJIA 2JA5G 4DV2L 4R1JA 4LFBQ 3UDFA 4BBSG 4YY3L 4HJAA 1Q86C 1K73C 2OQ0A 4DV5L 2Y0SG 2JA6G 3A74A 2VUMG 3PCOB 2OWOA 4JBJA 2A19A 1QUQA 5C3EG 2VZAA 2BA0A 2UUBL 2F52A 4X64Q 1VQ6A 3RNUA 1OXVA 1FJGL 4JI6Q 4DKAC 1YJNA 1SLJA 4OONA 1H95A 1WJJA 1HNZL 1FVIA 3ER0A 4QGUA 3IRBA 2C35B 1XMOL 4WJ3M 4A3FG 3M3YH 4LFAQ 3CC4A 2BH2A 2UXDQ 3HKZG 2UUAQ 1XJVA 4LF5Q 4A3DG 2MNAA 4DR6Q 3M4PA 1A63A 3I7FA 2R7ZG 4A3BH 1HZ9A 2VNUD 3JAMc 3KJOA 4IPCA 3E9IA 4C3HH 1BBUA 1SMXA 3RLOA 2F3IA 1CSPA 1M90C 2OQKA 1VQEA 4NXNL 4C2MH 3I55A 3K8AA 1PA6A 4GN4B 3U58A 1I5FA 1VQNA 5BR8Q 2VW9A 1W2BA 1VQPA 5IP7G 4JOIA 2EXDA 3J81c 3PF5A 4KI0A 3A5UA 1E1TA 4AQYQ 1C7YA 2Q2TA 3CF5A 1KC8C 1OTCA 2UXCQ 2UXBL 2HHHQ 3JAMi 4GNXA 1BVSA 4A3CH 1IBLQ 1J5EQ 4B3TL 3UE0A 5FLMH 4A3MG 1PH5A 1VQ5A 1XMQQ 3HOVH 2D62A 2E2JH 3FKIH 4DK6C 3UDXA 1WI5A 3H15A 1NMFA 1CKNA 1VS0A 1Y1VH 1X9NA 3CD6A 1K83H 4JI1Q 1Z9FA 3E9HA 3KF6B 4LF6Q 2KENA 3G6EA 3CPWA 3GTGH 4X64L 2JEBI 5C0XI 5K36G 2Y0SE 1TWCH 4JI6L 3PO2G 1HZAA 1L1OA 4XIGS 2ZJRA 3TQYA 4X65Q 4KLKA 1U0LA 1VQIA 2VL6A 3ULPA 1YHAA 2ZJPA 2VQEQ 1SFOH 1JT8A 4DUYQ 4JI0Q 2ZTEA 3AFQA 4PZ7A 2NZHA 3HKZE 2N78A 3CC2A 2UU9Q 4LF4L 2XTIA 4LF7Q 4BY7H 4IPDA 4ME3A 1HZCA 2WB1G 4YHHQ 4DR2Q 1HNWL 5IYCH 2XGTA 3MXNB 4JI2Q 2YTXA 1KL9A 2I0QA 1VQBA 3NBHB 3S14H 2ZTDA 3G4SA 4O0AA 1K8GA 4PZ8A 1VQDA 4YWLA 3TEHB 2JA5H 1HJPA 2JJQA 5IYBG 4BBSH 2ZM6Q 4NB3A 2VQFQ 3CCUA 1SE8A 1AE2A 3F2BA 1AH9A 4LUOA 1G291 5DLQE 2JA6H 2MQHA 2VUMH 2HHHL 4R4CA 1YBYA 1SR3A 4L5RC 5C3EH 4A3JG 1PH6A 4A3CG 1IBLL 4FDBA 3GTQH 3BJUA 4GNXB 1J5EL 3KDFB 3CCSA 5LMNW 3HOVG 1JE5A 3EBEA 3CCJA 4A3KG 4O2DA 3CCQA 2ZTCA 3G48A 2WAQG 4LWCA 2R7FA 3BZKA 5GADC 1X3FA 1UE6A 4A4IA 3A5ZB 2Z6KC 1U5KA 4A3FH 5IE8A 1YHQA 1CKMA 1PH7A 4A3DH 2B29A 4JI1L 5M5XH 1XNQL 2R7ZH 1IYJB 1X6OA 3BZCA 3M4QA 1LUZA 1YEZA 4JBMA 4KHPQ 3GDEA 5JEAG 3CAMA 3I4MG 1PH2A 2Q2UA 5JJLA 2AWNA 3EN2A 2GVBA 2MO0A 1VQGA 2ATWA 3E0EA 3RZDH 4BY1H 4GOPB 1QZGA 2UUCL 4JBKA 4TVAB 1XPRA 4KHZA 5IP7H 1OXXK 2VQEL 3WWVA 1HR0W 2MO1A 1IBMQ 4B3MQ 1Z47A 3OW2A 5IYDG 3EIVA 4DUYL 1N36Q 2CCZA 4NXMQ 1VQJA 2UU9L 4LF7L 2F4VQ 1K0RA 2VS1A 4YHHL 1Q8KA 4HIMA 2KCMA 5LMNQ 2A1AA 4A3MH 2CQOA 4JI2L 2K5HA 3Q8DA 3VDYA 3HOWG 3GO5A 5IP9G 1Y1WG 2LXKA 2WB1E 3A0JA 1VQOA 1VQAA 2RF4A 3U50C 5C4XG 2ZM6L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQF L;  5GAH C;  3GTK H;  1VQ8 A;  1EQQ A;  4WJ4 A;  4JYA Q;  1HNX Q;  2IX0 A;  1QVF A;  1QVC A;  2AKW B;  4LF9 Q;  3M7N A;  4HID A;  1YJ9 A;  1Q81 C;  4QIW E;  1Q46 A;  1TWG H;  3T1Y Q;  1I3Q H;  1V43 A;  2LXJ A;  3NEN A;  3PO2 H;  3HOU G;  4JG2 A;  4XTC S;  4JV5 Q;  3M9B A;  4DV4 L;  1K9M C;  5ELO A;  2YU9 H;  1TWA H;  1Q82 C;  4DR3 Q;  2D0P A;  4R4T A;  4GKK Q;  1HR0 Q;  2CFM A;  5GAE C;  1TWF H;  1UE5 A;  2WAQ E;  4IPH A;  4P71 A;  5GQO A;  1IBK Q;  3OTO L;  2IHF A;  2LSS A;  4GLX A;  2GVA A;  4OWT B;  1K8A C;  3UDI A;  2NN6 G;  4KHP L;  3PF4 A;  1E3P A;  1OXS C;  1NBW A;  1KXL A;  4IOA A;  2MFI A;  3K80 C;  4BY1 G;  4HIK A;  1I94 Q;  1Q12 A;  2ASB A;  4JI8 L;  1HH2 P;  2PQA A;  5IYB H;  3GTL H;  4B3M L;  5JEA J;  1S72 A;  4UP8 A;  3TS2 A;  2Z0S A;  4JI7 Q;  4NXM L;  1YJW A;  1RIP A;  4IJH A;  2KHJ A;  4K0K L;  1MIU A;  4X66 Q;  1IZ6 A;  4GN5 A;  4A3J H;  1KQS A;  4B3S Q;  3CCV A;  1MKH A;  1B7Y B;  1JB7 A;  1CSQ A;  1VQM A;  3I4N G;  1G6P A;  2PI2 E;  3F2C A;  4A3K H;  4JI3 Q;  4JI5 Q;  3S1Q H;  2BH8 A;  5LMU Q;  1YZ6 A;  1QUQ B;  1L2F A;  4LFB L;  4OWW B;  2K5N A;  1N9W A;  1X54 A;  4MNO A;  4A3I H;  1N33 Q;  3M85 A;  3S2H H;  3G71 A;  2RHQ B;  4DAM A;  3HFZ B;  5M3M G;  1HNX L;  3HOZ G;  3AFP A;  4DNI A;  4LF9 L;  1A8V A;  1D7Q A;  2I5H A;  1SN8 A;  4DV3 Q;  4LUZ A;  1NMG A;  2NVX H;  2JA8 G;  2JK8 A;  3I4M H;  4LUV A;  4L5T A;  4GNX C;  4OX9 Q;  4DR7 Q;  4MTN A;  2B63 G;  2JA7 G;  2V1C C;  3CCM A;  2N49 A;  4LFC Q;  4JV5 L;  4DV6 Q;  3CC7 A;  4LFA L;  2UXD L;  1PVO A;  1NJI C;  4R4I A;  1M1K C;  2UUA L;  1HR0 L;  4LF5 L;  3K0X A;  3PGZ A;  4GKK L;  4DR6 L;  4A76 A;  4GS3 A;  1E7Z A;  1IBK L;  4BA2 I;  4B3R Q;  5IYD H;  1O7I A;  3PUW A;  1FGU A;  3L0O A;  4DV7 Q;  5IWA Q;  1CKO A;  1WYD A;  1N34 Q;  1SRU A;  5H1S E;  2ID0 A;  1VQ7 A;  1EQR A;  1YIT A;  2NVQ H;  3HOW H;  2R6G A;  5IP9 H;  1I94 L;  3KYH C;  1PH1 A;  1Y1W H;  5BR8 L;  3J7A 5;  4GOP C;  4P72 A;  1VQL A;  5C4X H;  1BBW A;  4QJF A;  1IXR A;  3CPF A;  5C44 G;  2K5V A;  5EAY A;  4AQY L;  3KFU A;  3ICE A;  1XTD A;  4Y7N H;  2UXC L;  1VQH A;  4GLA C;  4R4Q A;  4LW1 A;  3W1B A;  4X66 L;  3HOY G;  3PO3 G;  1CKN B;  1XMQ L;  2EQS A;  2GN5 A;  3HOU H;  4UY8 C;  1NY4 A;  1V1Q A;  4JI3 L;  3AEV A;  4OO1 I;  5LMU L;  3S24 A;  4A3I G;  2RCN A;  1N33 L;  1B8A A;  2HQL A;  4DR1 Q;  4LF8 Q;  1FL0 A;  1OXT A;  2JA9 A;  4HJ9 A;  3F2D A;  1GM5 A;  4DR5 Q;  1L1O B;  3W5O A;  2K14 A;  1DGS A;  4LF6 L;  4YY3 Q;  4C3J H;  4YCW A;  1KHI A;  2WP8 J;  5FLX c;  1Q7Y C;  4DV5 Q;  4DV3 L;  4DR7 L;  4P75 A;  4OX9 L;  2KCT A;  1PH4 A;  1KIX A;  3CQZ H;  2YTV A;  4POG A;  4A93 G;  2Z6K A;  1N8R C;  1KRT A;  4LFC L;  4DPG A;  4DV1 Q;  4X65 L;  2UUB Q;  4DV6 L;  4JI4 Q;  3W1G A;  2E2H H;  1S40 A;  1C9O A;  3OYY A;  2D0O A;  2K50 A;  1EYG A;  2L15 A;  1UE7 A;  4JCV E;  1HNZ Q;  3K7U C;  3STB C;  4A3E G;  4DV0 Q;  5M3F G;  3H3V H;  4JI0 L;  1MJE A;  1XNR Q;  4A3G G;  4B3R L;  4UP7 A;  4HJ7 A;  1A62 A;  5M5W H;  3GTO H;  2H5X A;  3CXC A;  3H0G G;  4DUZ Q;  4DV7 L;  2NN6 I;  5IWA L;  4DR2 L;  3L7Z C;  3SGI A;  1WOC A;  2I5M X;  4IFD G;  3T1H Q;  4OO1 G;  3I4N H;  3GD7 A;  1PH9 A;  4L5Q A;  1R9T H;  3GTM H;  1WCM G;  2DGY A;  4IO9 A;  4NXN Q;  4PZ6 A;  1KD1 C;  4OWX B;  3H3V I;  3J80 i;  2PMZ E;  3ULJ A;  5M3M H;  1V9P A;  1VQC A;  3S16 H;  1C0A A;  3HOZ H;  2Q2H A;  2AHO B;  5FJ8 G;  4H02 A;  1RL2 A;  3HOX G;  3PSI A;  2JA8 H;  1T9H A;  4AYB G;  2N8N A;  1BKB A;  1X55 A;  2PNH A;  1X3E A;  5JJK A;  2B63 H;  4C3I H;  2JA7 H;  2BA1 A;  2JE6 I;  3CCE A;  4B3T Q;  2CKZ B;  1D8L A;  3CW2 C;  2E5L Q;  3CCR A;  4DR1 L;  4LF8 L;  3GTP H;  1X56 A;  4DR5 L;  1S3O A;  1YHB A;  1AE3 A;  2OTL A;  1LTL A;  3J7Z C;  1YIJ A;  4A3L G;  2EIF A;  4AH6 A;  3RN2 A;  1W3S A;  1UE1 A;  4PMW A;  4RG1 A;  1TXY A;  2YYZ A;  2K75 A;  3MEF A;  2PI2 A;  3CME A;  4YWM A;  2R92 G;  4NPS A;  2KHI A;  4MZ9 A;  4DV1 L;  4JI4 L;  4BA1 I;  4YCU A;  3KF8 B;  1WFQ A;  3KF6 A;  1PH3 A;  2JQO A;  1IBM L;  3CP0 A;  5C44 H;  4DV0 L;  5AJ3 Q;  2B3G A;  2WFW A;  4HJ5 A;  1N36 L;  1XNR L;  5C0X J;  1VQ4 A;  2F4V L;  5GAG C;  4GKJ Q;  4DUZ L;  1N32 Q;  4DR4 Q;  5LMN L;  1ASY A;  3RN5 A;  3HOY H;  4P74 A;  3PO3 H;  1VQF A;  4IJL A;  1PYB A;  4JOI C;  4LF4 Q;  3T1H L;  1VQK A;  1HNW Q;  2VY3 A;  3PUZ A;  3S1M H;  1JJC B;  5C4J H;  1PYS B;  3PV0 A;  3KJP A;  1NE3 A;  1EWI A;  3I4O A;  3K7A H;  3STB D;  3J81 j;  2AMC B;  1LM0 A;  1OXU A;  2NZO A;  2E2I H;  1SRO A;  1E22 A;  4POF A;  4GN3 B;  1Q1E A;  4JYA L;  2HT1 A;  4BXX G;  4AIM A;  4IFD J;  1EFW A;  3F1Z A;  3DLL A;  1LYL A;  4BBR G;  2Q2I A;  1PHJ A;  3T1Y L;  4PG3 A;  1P8L A;  2NVT H;  1CUK A;  1XPU A;  3TRZ A;  4A93 H;  4X6A H;  3FP9 A;  4GLV B;  4IPG A;  4TQU S;  5M5Y H;  4JBW A;  3RLF A;  4UP9 A;  2ES2 A;  2N3S A;  5E7N A;  4QQB X;  2YV5 A;  4AYB E;  2E5L L;  2R93 G;  4DR3 L;  1EIF A;  1GO3 E;  1UWV A;  4OXP A;  4HJ8 A;  1I6H H;  3B6Y A;  1G51 A;  1X3G A;  3BU2 A;  4A3G H;  4A3E H;  1L1O C;  3F8T A;  4R4O A;  5M3F H;  2YTY A;  3KDF A;  3RR5 A;  1EUJ A;  2HIV A;  3LGJ A;  3J81 i;  1Q1B A;  1PFS A;  2CWP A;  3KLW A;  3D0F A;  1EIY B;  1E24 A;  3H0G H;  2DUD A;  1XNQ Q;  2PQA B;  1I50 H;  1YNX A;  2IX1 A;  3UE1 A;  3HKS A;  3PIO A;  2K4K A;  2E8G A;  3TRE A;  1WCM H;  2QGQ A;  4UPA A;  3FHW A;  2KBN A;  3NEM A;  5AJ3 L;  4JI7 L;  2UUC Q;  3CCL A;  1E1O A;  4GKJ L;  1TWH H;  5FJ8 H;  1N32 L;  4DR4 L;  4B3S L;  3HOX H;  4IOC A;  3DM3 A;  4GOP A;  4A3B G;  4JI5 L;  4IFD I;  4X62 Q;  3KOJ A;  2IY5 B;  1VQ9 A;  1JJG A;  1PH8 A;  1EOV A;  4LNQ A;  4DV2 Q;  3S17 H;  4APV A;  3PUY A;  2I5L X;  3K81 C;  3GTJ H;  3I56 A;  5IY0 A;  4A3L H;  1J6Q A;  1YVC A;  2OCE A;  3D31 A;  2CWA A;  3TS0 A;  3U4V A;  4EX5 A;  1XPO A;  2R92 H;  5C0X G;  2NVY H;  5FLM G;  3CMA A;  1IL2 A;  2QA4 A;  1FJG Q;  1KAW A;  3ZJY C;  1PV4 A;  3FKI G;  5ELN A;  4HIO A;  3UDG A;  1L0W A;  1K3R A;  3I2Z A;  3ULL A;  3PIP A;  3L2P A;  2AWO A;  4DV4 Q;  1A0I A;  1GKH A;  4DAY B;  3RLN A;  4EQ5 A;  2QEX A;  1XMO Q;  1JJ2 A;  4J15 A;  1KRS A;  2RHS B;  1Y1V G;  3J80 c;  2JEA I;  3S1N H;  1VCI A;  3NEL A;  3AQQ A;  2A8V A;  3OTO Q;  3JC6 6;  1N34 L;  1X65 A;  4A75 A;  3U4Z A;  4P73 A;  5GRO A;  4DK3 C;  1UEB A;  4QY7 A;  2R7D A;  1HZB A;  1Y14 B;  2IHE A;  2K52 A;  1QVG A;  3AYH B;  3RZO H;  4ALP A;  1YI2 A;  1JMC A;  4QL5 A;  1GVP A;  4YCV A;  5HY6 A;  3M4O H;  4JC0 A;  4YWK A;  4JI8 Q;  2OTJ A;  3PUV A;  4Y52 H;  1B70 B;  2ALY B;  3ERS X;  4BXX H;  1NTG A;  4BBR H;  3S1R H;  2UXB Q;  3S2D H;  1MJC A;  1QZH A;  4L5S A;  5IT9 c;  3S15 H;  4BY7 G;  1P16 A;  2ZJQ A;  4RMF A;  4K0K Q;  1GD7 A;  5IYC G;  2FXQ A;  4X62 L;  3PUX A;  5HGQ A;  2HIX A;  1ASZ A;  2R93 H;  5J3B A;  2IT1 A;  5JJI A;  2JA5 G;  4DV2 L;  4R1J A;  4LFB Q;  3UDF A;  4BBS G;  4YY3 L;  4HJA A;  1Q86 C;  1K73 C;  2OQ0 A;  4DV5 L;  2Y0S G;  2JA6 G;  3A74 A;  2VUM G;  3PCO B;  2OWO A;  4JBJ A;  2A19 A;  1QUQ A;  5C3E G;  2VZA A;  2BA0 A;  2UUB L;  2F52 A;  4X64 Q;  1VQ6 A;  3RNU A;  1OXV A;  1FJG L;  4JI6 Q;  4DKA C;  1YJN A;  1SLJ A;  4OON A;  1H95 A;  1WJJ A;  1HNZ L;  1FVI A;  3ER0 A;  4QGU A;  3IRB A;  2C35 B;  1XMO L;  4WJ3 M;  4A3F G;  3M3Y H;  4LFA Q;  3CC4 A;  2BH2 A;  2UXD Q;  3HKZ G;  2UUA Q;  1XJV A;  4LF5 Q;  4A3D G;  2MNA A;  4DR6 Q;  3M4P A;  1A63 A;  3I7F A;  2R7Z G;  4A3B H;  1HZ9 A;  2VNU D;  3JAM c;  3KJO A;  4IPC A;  3E9I A;  4C3H H;  1BBU A;  1SMX A;  3RLO A;  2F3I A;  1CSP A;  1M90 C;  2OQK A;  1VQE A;  4NXN L;  4C2M H;  3I55 A;  3K8A A;  1PA6 A;  4GN4 B;  3U58 A;  1I5F A;  1VQN A;  5BR8 Q;  2VW9 A;  1W2B A;  1VQP A;  5IP7 G;  4JOI A;  2EXD A;  3J81 c;  3PF5 A;  4KI0 A;  3A5U A;  1E1T A;  4AQY Q;  1C7Y A;  2Q2T A;  3CF5 A;  1KC8 C;  1OTC A;  2UXC Q;  2UXB L;  2HHH Q;  3JAM i;  4GNX A;  1BVS A;  4A3C H;  1IBL Q;  1J5E Q;  4B3T L;  3UE0 A;  5FLM H;  4A3M G;  1PH5 A;  1VQ5 A;  1XMQ Q;  3HOV H;  2D62 A;  2E2J H;  3FKI H;  4DK6 C;  3UDX A;  1WI5 A;  3H15 A;  1NMF A;  1CKN A;  1VS0 A;  1Y1V H;  1X9N A;  3CD6 A;  1K83 H;  4JI1 Q;  1Z9F A;  3E9H A;  3KF6 B;  4LF6 Q;  2KEN A;  3G6E A;  3CPW A;  3GTG H;  4X64 L;  2JEB I;  5C0X I;  5K36 G;  2Y0S E;  1TWC H;  4JI6 L;  3PO2 G;  1HZA A;  1L1O A;  4XIG S;  2ZJR A;  3TQY A;  4X65 Q;  4KLK A;  1U0L A;  1VQI A;  2VL6 A;  3ULP A;  1YHA A;  2ZJP A;  2VQE Q;  1SFO H;  1JT8 A;  4DUY Q;  4JI0 Q;  2ZTE A;  3AFQ A;  4PZ7 A;  2NZH A;  3HKZ E;  2N78 A;  3CC2 A;  2UU9 Q;  4LF4 L;  2XTI A;  4LF7 Q;  4BY7 H;  4IPD A;  4ME3 A;  1HZC A;  2WB1 G;  4YHH Q;  4DR2 Q;  1HNW L;  5IYC H;  2XGT A;  3MXN B;  4JI2 Q;  2YTX A;  1KL9 A;  2I0Q A;  1VQB A;  3NBH B;  3S14 H;  2ZTD A;  3G4S A;  4O0A A;  1K8G A;  4PZ8 A;  1VQD A;  4YWL A;  3TEH B;  2JA5 H;  1HJP A;  2JJQ A;  5IYB G;  4BBS H;  2ZM6 Q;  4NB3 A;  2VQF Q;  3CCU A;  1SE8 A;  1AE2 A;  3F2B A;  1AH9 A;  4LUO A;  1G29 1;  5DLQ E;  2JA6 H;  2MQH A;  2VUM H;  2HHH L;  4R4C A;  1YBY A;  1SR3 A;  4L5R C;  5C3E H;  4A3J G;  1PH6 A;  4A3C G;  1IBL L;  4FDB A;  3GTQ H;  3BJU A;  4GNX B;  1J5E L;  3KDF B;  3CCS A;  5LMN W;  3HOV G;  1JE5 A;  3EBE A;  3CCJ A;  4A3K G;  4O2D A;  3CCQ A;  2ZTC A;  3G48 A;  2WAQ G;  4LWC A;  2R7F A;  3BZK A;  5GAD C;  1X3F A;  1UE6 A;  4A4I A;  3A5Z B;  2Z6K C;  1U5K A;  4A3F H;  5IE8 A;  1YHQ A;  1CKM A;  1PH7 A;  4A3D H;  2B29 A;  4JI1 L;  5M5X H;  1XNQ L;  2R7Z H;  1IYJ B;  1X6O A;  3BZC A;  3M4Q A;  1LUZ A;  1YEZ A;  4JBM A;  4KHP Q;  3GDE A;  5JEA G;  3CAM A;  3I4M G;  1PH2 A;  2Q2U A;  5JJL A;  2AWN A;  3EN2 A;  2GVB A;  2MO0 A;  1VQG A;  2ATW A;  3E0E A;  3RZD H;  4BY1 H;  4GOP B;  1QZG A;  2UUC L;  4JBK A;  4TVA B;  1XPR A;  4KHZ A;  5IP7 H;  1OXX K;  2VQE L;  3WWV A;  1HR0 W;  2MO1 A;  1IBM Q;  4B3M Q;  1Z47 A;  3OW2 A;  5IYD G;  3EIV A;  4DUY L;  1N36 Q;  2CCZ A;  4NXM Q;  1VQJ A;  2UU9 L;  4LF7 L;  2F4V Q;  1K0R A;  2VS1 A;  4YHH L;  1Q8K A;  4HIM A;  2KCM A;  5LMN Q;  2A1A A;  4A3M H;  2CQO A;  4JI2 L;  2K5H A;  3Q8D A;  3VDY A;  3HOW G;  3GO5 A;  5IP9 G;  1Y1W G;  2LXK A;  2WB1 E;  3A0J A;  1VQO A;  1VQA A;  2RF4 A;  3U50 C;  5C4X G;  2ZM6 L; 
#chains in the Genus database with same CATH topology
 3SHL A;  3MFY A;  3GTK H;  1DZ1 A;  3M7N A;  5CR3 A;  3URY A;  1ZYR C;  1HUM A;  1Q46 A;  3SK5 A;  5K36 H;  2SOB A;  2G9D A;  4XTC S;  1K9M C;  1TS3 A;  3QB3 A;  5JAV A;  2CFM A;  1WTW A;  2WAQ E;  3S1Q B;  1ICF B;  1C48 A;  4KHV A;  4P71 A;  2A69 D;  2IHF A;  2LSS A;  4OWT B;  3ND9 A;  3PF4 A;  2K5Q A;  1WTP A;  1STN A;  1ML0 D;  2DY8 A;  2MFI A;  3K80 C;  4JI8 L;  1HH2 P;  2NVT B;  4KY5 A;  2EXZ A;  2VB3 X;  4V19 0;  4UP8 A;  3ND8 A;  2QKI C;  4KY6 A;  4JI7 Q;  1B2T A;  5J1Z A;  4KJN A;  4IJH A;  3CU7 A;  4X66 Q;  1GUG A;  1B7Y B;  1CSQ A;  3BDO A;  1VQM A;  3SDZ A;  1EY7 A;  1UUP A;  5E1F A;  4CKB A;  3I4N G;  1Q90 A;  1STB A;  2PI2 E;  4LK1 C;  1JB3 A;  2R61 A;  3F2C A;  2BH8 A;  4LFB L;  1N9W A;  1X54 A;  4KN7 C;  1TS4 A;  4LMQ D;  2NVQ B;  1RHP A;  3HFZ B;  5M3M G;  4G4K A;  1B9N A;  1DCZ A;  4H0L C;  1A8V A;  2I5H A;  4LUZ A;  4GNX C;  4MTN A;  1A2U A;  1J8I A;  3CCM A;  4LFC Q;  1JR0 D;  1GUO A;  1T5X D;  3K0X A;  1SYC A;  1ENC A;  1F2M A;  2I07 B;  3PUW A;  3C46 A;  3QOJ A;  5IWA Q;  1N34 Q;  5H1S E;  4C3J B;  1VQ7 A;  4RKL A;  4OO1 H;  3KYH C;  4DK0 A;  1Y1W H;  1L0Y B;  5C4X H;  2K5W A;  3GV3 A;  1EY9 A;  3BVZ A;  3KFU A;  2FJ2 A;  1VQH A;  1S4Z A;  1MBY A;  2F0Q A;  1CT1 D;  4L6T B;  4DK1 A;  2AUK A;  5JOB A;  2EQS A;  2GN5 A;  4UY8 C;  4JI3 L;  4OO1 I;  5LMU L;  2H1E A;  1B8A A;  2PZU A;  2HQL A;  1EY5 A;  4IUU A;  2JA9 A;  1GM5 A;  2F0T A;  1L1O B;  5CV8 A;  3W5O A;  1B50 A;  4YY3 Q;  4YCW A;  1TKW B;  4DV3 L;  3SEB A;  2NN6 H;  2IW3 A;  4OX9 L;  2YTV A;  2ZXR A;  4X65 L;  1S40 A;  1EYG A;  3S2D B;  1UE7 A;  1I4X A;  1V8Q A;  4IAL A;  2JA7 B;  4DV0 Q;  1MJE A;  4B3R L;  3SR1 A;  1A62 A;  5LL6 S;  1EOT A;  2Q8I B;  3GTO H;  1NAP A;  3R8B A;  4DV7 L;  2NN6 I;  4DR2 L;  4HAE A;  1RF2 D;  3SGI A;  1ZKO A;  3TME A;  4IFD G;  2F0P A;  1QOH A;  1O7Y A;  2PMZ E;  3ULJ A;  1C0A A;  5FK9 C;  2Q2H A;  3NHH A;  3M3Y B;  2L4N A;  2CQA A;  3CCE A;  3N6R A;  3BDL A;  1A6X A;  2E5L Q;  3G6J B;  2HQE A;  4LF8 L;  3GTP H;  2L5T A;  4DR5 L;  3I73 A;  3SK8 A;  2EY2 A;  3S1M B;  2OTL A;  1YIJ A;  3LWE A;  4AH6 A;  4C2M B;  5I2Y A;  3RN2 A;  1S5E D;  4PMW A;  4RG1 A;  1TXY A;  3MEF A;  4YWM A;  3SVM A;  2MGS A;  2EE1 A;  4DV1 L;  2FIN B;  3KF8 B;  1IBM L;  3CP0 A;  2KEC A;  5C3X A;  1JC7 A;  1T5E A;  1BOS A;  2O2L D;  4GKJ Q;  5GAG C;  4DUZ L;  4WRD A;  1N32 Q;  5E4X A;  4DR4 Q;  4Z9C B;  2EPB A;  1ASY A;  3RN5 A;  4P74 A;  2QEJ C;  1VQK A;  2VY3 A;  2EYP A;  4K8J A;  3STB D;  3QO2 A;  1XXG A;  1LM0 A;  2AMC B;  1BUV T;  2BDN A;  3MZ5 A;  2HT1 A;  4AIM A;  3K5L A;  2Q2I A;  2NBF A;  4X6A H;  3TRZ A;  1LAC A;  3FP9 A;  3G7L A;  4GLV B;  4G7Z C;  3RLF A;  4DXF A;  2ES2 A;  5IGB A;  2YV5 A;  5CC4 A;  1GO3 E;  3O13 A;  4H7B A;  1I6H H;  1S5B D;  5C3W A;  4A3G H;  5M3F H;  1EUJ A;  1ZYR D;  2HIV A;  3J81 i;  2CWP A;  2XRQ D;  4R8N A;  3H0G H;  1K28 A;  1XNQ Q;  2JA5 B;  3FRP B;  4TKO B;  4ABN A;  1FNV A;  4C1N K;  3PIO A;  4KKU A;  3HRZ C;  3RD4 A;  2Y0S B;  2JA6 B;  2R92 B;  2RQX A;  3A8K E;  4UPA A;  4EVO A;  3FHW A;  5ELE A;  4JI7 L;  1E1O A;  1TWH H;  5FJ8 H;  4IOC A;  2ICI A;  2ZT9 C;  3DM3 A;  4A3B G;  2PW7 A;  3R3O A;  2CVR A;  4ODG A;  2R7Z B;  3NSW A;  1VQ9 A;  1PH8 A;  3NXW A;  2I5L X;  3KLS X;  3S9W A;  1BO0 A;  2NWG A;  3U4V A;  1K3B C;  2KCN A;  1JOK A;  1DJR D;  1D1K A;  3ZJY C;  1PV4 A;  4KK7 A;  5ELN A;  3UDG A;  5FO8 B;  5ISR A;  1C8C A;  3I2Z A;  4XDX A;  3ULL A;  3I8Z A;  1GKH A;  4CKC A;  3RLN A;  2JEA I;  1KRS A;  3J80 c;  1E0B A;  2A8V A;  4NMZ A;  4IUT A;  1N34 L;  1X65 A;  2MHV A;  3MXU A;  5GRO A;  3NE5 B;  5EPJ A;  4F87 A;  1KDC A;  2K52 A;  3RZO H;  4IUN A;  1JMC A;  1HPC A;  5HY6 A;  2XWB B;  2WKD A;  1Y69 U;  3M4O H;  2OTJ A;  3PUV A;  1HTP A;  4EQO A;  3BG3 A;  1F9R A;  4MIU A;  3V2T A;  4BBR H;  1EZ8 A;  2EYO A;  2ZJQ A;  4K0K Q;  1GD7 A;  2Q8R E;  5IYC G;  4X62 L;  3EFX D;  2R93 H;  5JJI A;  5BN3 A;  2JA5 G;  4DV2 L;  5FLX E;  3EVQ A;  3UDF A;  4YY3 L;  2DNC A;  2F0F A;  5D14 A;  2OQ0 A;  2RSO A;  2Y0S G;  2JA6 G;  2OWO A;  4J1M A;  2EY5 A;  1I4H A;  1DYQ A;  1OXV A;  5IGC A;  2Z4I A;  1PRT B;  4DAV A;  1FVI A;  3ER0 A;  3D6W A;  2C35 B;  1XMO L;  2A6E C;  2AUJ D;  4A3F G;  4LFA Q;  2IX3 A;  3HOV B;  1JOR A;  2MNA A;  3I7F A;  2R7Z G;  2JYO A;  4CDF C;  3JAM c;  3E9I A;  1SMX A;  3NPP A;  3RLO A;  1CSP A;  1AP0 A;  1I5F A;  1VQN A;  2VW9 A;  1UNS A;  4FNF A;  1TWC B;  3MAQ A;  3PF5 A;  3QOL A;  1RJT A;  2HHH Q;  5CBA E;  1SFO B;  1AW7 A;  4A3C H;  5FLM H;  4A3M G;  3P20 A;  1XMQ Q;  2D62 A;  1WD1 A;  3FKI H;  4DK6 C;  3IFD A;  5FLX L;  2M9V A;  1Y1V H;  3ONA B;  1TY2 A;  1Z9F A;  3E6Z X;  1Y8O B;  3W2D A;  3GTG H;  4X64 L;  5C4X B;  5K36 G;  2ZJR A;  3OSO A;  3A56 A;  1GUN A;  5KNB A;  5JJZ A;  4ZAI A;  5KYI A;  1JT8 A;  1JWM D;  5FO9 B;  2NZH A;  3HKZ E;  3CC2 A;  2UU9 Q;  4BY7 H;  4YHH Q;  2L11 A;  3PIP 3;  2XGT A;  3MXN B;  1VQB A;  3NBH B;  2KVM A;  2V4D A;  1PXU A;  4O0A A;  4PZ8 A;  3TEH B;  1DOM A;  4IQZ A;  1YNN C;  1NNX A;  5JVH 3;  1AH9 A;  3TP5 A;  2MQH A;  2B2U A;  1SR3 A;  2A69 C;  5C3E H;  1PH6 A;  1IBL L;  4FDB A;  1J5E L;  3KDF B;  1STG A;  1B9M A;  3HOV G;  2MP1 A;  1H9J A;  4O2D A;  3CCQ A;  3GTO B;  3VYU A;  4CJ0 B;  3A7L A;  1U5K A;  3U9S A;  5IE8 A;  1CKM A;  1YHQ A;  1CHP D;  1D5X C;  1KLU D;  4JI1 L;  5M5X H;  1XNQ L;  1IYJ B;  1X6O A;  1LUZ A;  4B9X A;  1PH2 A;  2Q2U A;  2GVB A;  4K6L A;  1SYF A;  3K5M A;  3E0E A;  4GOP B;  1QZG A;  2A74 C;  3MVV A;  4J6H A;  1O7Z A;  3R93 A;  1XPR A;  1BDO A;  1YNJ C;  5EQ0 A;  2O4X A;  1N36 Q;  4LF7 L;  1TWF B;  3EA6 A;  2A1A A;  2EYH A;  4JI2 L;  1II3 A;  2QDL A;  5CV9 A;  3GO5 A;  4G7H C;  1Y1W G;  2WB1 B;  1YJ9 A;  5C4X G;  5DAU A;  2VQF L;  1DON A;  1R4P B;  5TSS A;  4RHS A;  1VQ8 A;  4WJ4 A;  2B2Y A;  1QVF A;  2AKW B;  2QW7 A;  1Q81 C;  4QIW E;  3T1Y Q;  3NEN A;  4HCE A;  5CBE E;  2YU9 H;  4Q5V A;  1EFI D;  1SYB A;  1TWA H;  4DR3 Q;  2D0P A;  4R4T A;  3H09 A;  3TZU A;  4N8F A;  4TRD A;  5C5L A;  2NN6 G;  4HMI A;  5CYU A;  3R2I A;  1NBW A;  4IOA A;  1EEF D;  4RFB A;  1Q12 A;  3T16 A;  2PQA A;  3P75 A;  5C4Z A;  4KKT A;  5JEA J;  4NXM L;  4WOR A;  1KDB A;  1YJW A;  4O1N A;  2KHJ A;  4K0K L;  1MIU A;  4A3J H;  2F0D A;  4GN5 A;  3M4Y A;  1JB7 A;  1MKH A;  1RD9 D;  3AMU A;  4A3G B;  2QCP X;  4RAU C;  4JI3 Q;  4JI5 Q;  1VDZ A;  5LMU Q;  1QUQ B;  3H0G B;  4MNO A;  4A3I H;  3S2H H;  2RHQ B;  4DAM A;  4HSV A;  1LO5 D;  3AFP A;  4DNI A;  3MXN A;  5ELD A;  4DV3 Q;  1NMG A;  1B4O A;  5JEA H;  3I4M H;  4LUV A;  4CKE A;  4OX9 Q;  2F0E A;  3DWQ A;  2N49 A;  3J7A F;  4JV5 L;  1TWH B;  3CKI B;  4RCN A;  2F0H A;  1RDP D;  2D5D A;  1EEI D;  4K8I A;  4RHR A;  4LFA L;  1PVO A;  1NJI C;  4FXG C;  1HR0 L;  4A76 A;  1U4M A;  4GS3 A;  1J9O A;  2XIW A;  4B3R Q;  2E2D C;  4H13 C;  1EIH A;  1HA6 A;  4DV7 Q;  4JK1 C;  2ID0 A;  4KD3 A;  1FR3 A;  2A6E D;  3HOW H;  2J0T D;  1I94 L;  3J81 E;  4P72 A;  2Z9H A;  5EAY A;  4X3S A;  2PZW A;  4QUC A;  4U68 A;  1XTD A;  2PW5 A;  1EYC A;  4GLA C;  3W1B A;  3NQI A;  5JVG 3;  2N88 A;  1CKN B;  1XMQ L;  3HOU H;  2XSC A;  4OIJ A;  3ITP A;  5I9O A;  1N33 L;  4LF8 Q;  3QG1 A;  4IUR A;  3F2D A;  4DR5 Q;  3RZO B;  1BNZ A;  3ERQ A;  3MA2 B;  5K5P A;  5IGG A;  2K04 A;  2WP8 J;  4DR7 L;  3M4O B;  4J8Q A;  4P75 A;  1KIX A;  3CQZ H;  3LWU A;  3S16 B;  1N8R C;  1I4G A;  4DV1 Q;  4BWG B;  4N9T A;  4DV6 L;  2CH4 W;  3W1G A;  1CZW A;  4BBR B;  2D0O A;  2K50 A;  4C1N I;  2L15 A;  3A54 A;  4JCV E;  1JQY D;  1CA6 A;  5D3D A;  3STB C;  4A3G G;  5M3F G;  1U4P A;  3CXC A;  4G57 A;  3H0G G;  2R93 B;  4DUZ Q;  3BVM A;  1SJE D;  1PH9 A;  4L5Q A;  3J81 L;  4FVM A;  4IO9 A;  1AFP A;  3OPO A;  1S5F D;  1V9P A;  1H9R A;  3KBG A;  3HOZ H;  5FJ8 G;  2F0N A;  1V1O A;  4OHJ A;  4WFN 3;  2N8N A;  4C3I H;  1A3U A;  5BN5 A;  1YNN D;  5KNC A;  3CW2 C;  5I2X A;  1STA A;  3IKJ A;  4DR1 L;  1YHB A;  1AE3 A;  4PQX A;  1EY6 A;  3H94 A;  1LTL A;  1WTX A;  3J7Z C;  1E2Z A;  1W3S A;  2NTT A;  4ZKC B;  3CME A;  5I6W A;  4NPS A;  4B08 A;  1ILP A;  1LTG D;  3T56 B;  1LT5 D;  4BA1 I;  1WFQ A;  2RDG A;  1VMC A;  3KF6 A;  5J22 A;  1PH3 A;  2JQO A;  5C44 H;  2F0O A;  1N36 L;  1XNR L;  3GP7 A;  5C0X J;  4ID6 A;  1G2T A;  4IJL A;  4LF4 Q;  4JVZ A;  5IIF A;  5FKA C;  3T1H L;  1Y1V B;  1DOK A;  1HNW Q;  1BCP B;  1YNJ D;  3PV0 A;  5C4J H;  1NE3 A;  2XWJ B;  3K7A H;  2N55 A;  2NZO A;  2E2I H;  1E22 A;  1Q1E A;  3OIQ A;  1GOZ A;  1EFW A;  2H4O A;  1LYL A;  3VA7 A;  4BBR G;  3T1Y L;  3A55 A;  4FF4 A;  1XPU A;  4IZ8 A;  4A93 H;  1F9Q A;  5M5Y H;  4JBW A;  4UP9 A;  2N3S A;  4QQB X;  3I4L A;  4K5W A;  4AYB E;  4ZLT F;  4DR3 L;  2R93 G;  4HJ8 A;  1RCV D;  4BY7 B;  2MJ8 A;  4A3E H;  4R4O A;  2YTY A;  3RR5 A;  2M00 A;  3LGJ A;  1O7L A;  1MHW C;  3KLW A;  1EIY B;  3D0F A;  1I50 H;  2LKV A;  1AEX A;  3HKS A;  4NP5 A;  2K4K A;  3V96 A;  1WCM H;  3SE0 A;  3KBX A;  5C3E B;  1EU4 A;  2UUC Q;  3CCL A;  3FPP A;  1SMY C;  3HOX H;  3NBI A;  4QUF A;  4JI5 L;  4XYO A;  4X62 Q;  3KOJ A;  2B2U C;  1KNE A;  3NUC A;  1H9S B;  3Q23 A;  4DV2 Q;  3S17 H;  2M2L A;  2F0L A;  3A7A B;  3D4R A;  3I56 A;  2RDH A;  2F0M A;  5IY0 A;  4A3L H;  1BXT A;  1IYU A;  1J6Q A;  4CHT B;  1PYW D;  1XPO A;  2NVY H;  5FLM G;  2KHS A;  3S1R B;  3FKI G;  4HIO A;  1FYC A;  5ELF A;  1K3R A;  3PIP A;  4DV4 Q;  2A6H D;  2IWH A;  2F1M A;  2HUG A;  1XMO Q;  2QEX A;  3S1N H;  4J15 A;  2RHS B;  1Y1V G;  2JP1 A;  1I4Q A;  2G9H D;  3JC6 6;  4P73 A;  2NUC A;  1QVG A;  2IHE A;  3VR6 A;  3AYH B;  4ALP A;  1YI2 A;  1TU2 B;  4YCV A;  3HG9 A;  5L37 A;  1LLR D;  4JC0 A;  1O78 A;  4Y52 H;  2ALY B;  3ERS X;  4BXX H;  3OOC A;  2BE5 D;  3FVQ A;  1TWA B;  3S15 H;  1RKN A;  4BY7 G;  2X6L A;  4RMF A;  3GQB A;  2WKC A;  2B2Y C;  3PUX A;  5LL6 X;  4Q0F A;  5J3B A;  2IT1 A;  4A3B B;  3L9A X;  4V0B A;  3K57 A;  4FF2 A;  3BVG A;  1BBX C;  1TS5 A;  3U9O A;  1ET9 A;  1C4Q A;  3PCO B;  5C3E G;  2VZA A;  4X64 Q;  3VA5 A;  1FJG L;  4HN7 A;  1SLJ A;  4HR7 B;  5IGE A;  4UAI A;  4A3J B;  2F0K A;  4WJ3 M;  1QIL A;  3CC4 A;  2BH2 A;  2UXD Q;  4LF5 Q;  4DR6 Q;  4XXE A;  3I72 A;  1EY0 A;  2WAQ B;  3TDQ A;  1AZP A;  3CRK C;  1KDA A;  3KJO A;  4IPC A;  3S2H B;  1EY4 A;  4C3H H;  1BBU A;  2PCF B;  2F3I A;  2C9O A;  3M7G A;  1VQE A;  5BR8 Q;  1W2B A;  1VQP A;  4JOI A;  2EXD A;  1M8A A;  3H91 A;  4KI0 A;  4AQY Q;  5EPK A;  1KC8 C;  1OTC A;  2UXC Q;  2LFN A;  5I4D A;  1BVS A;  1IBL Q;  1J5E Q;  3UE0 A;  2E2J H;  4DFA A;  3UDX A;  1B3A A;  1NMF A;  1R4Q B;  1HFG A;  1VS0 A;  2JSO A;  4ZYS A;  3CD6 A;  2WII B;  1K83 H;  4JI1 Q;  1U4L A;  3G6E A;  2BCO A;  3SXH A;  1GUW A;  2JEB I;  2RDF A;  1H9S A;  1LT4 D;  4JI6 L;  1L1O A;  4M8A A;  5I6Y A;  2HCC A;  1D6E C;  4MHE A;  2A5H A;  3TQY A;  4KLK A;  1A15 A;  1VQI A;  3ULP A;  2ZJP A;  3HOU B;  2F0W A;  4JI0 Q;  4LF4 L;  2N78 A;  4A3F B;  4LF7 Q;  5G3L F;  2R3Z A;  1I6V C;  4IPD A;  4ME3 A;  1HZC A;  1HNW L;  2F0J A;  4JI2 Q;  2I0Q A;  1KL9 A;  3S14 H;  1I4P A;  1VQD A;  1IKM A;  1HJP A;  2JJQ A;  2AQ1 B;  1GUS A;  2VQF Q;  4F88 A;  1SE8 A;  1G91 A;  1QJO A;  4P2C B;  2B2T A;  2EZV A;  1G29 1;  1PFN A;  1PTO C;  4BY1 B;  2VUM H;  1YBY A;  1EQT A;  4A3J G;  3GTQ H;  4GNX B;  5LMN W;  3EBE A;  1TII D;  1ESR A;  1TQO A;  2WAQ G;  3DMU A;  2R7F A;  1X3F A;  3FMC A;  4A3M B;  4HED A;  2B29 A;  1CQV A;  1YEZ A;  3E5S A;  4JBM A;  5JEA G;  3CAM A;  3I4M G;  1HRJ A;  3GTK B;  2F03 A;  1VF7 A;  1XTC D;  3RZD H;  1JOO A;  3AB9 A;  2UUC L;  2VQE L;  1HR0 W;  2PPB C;  3EIV A;  4NXM Q;  1EL0 A;  5D3I B;  3NTK A;  3KF8 A;  1ENF A;  2TMP A;  1Q8K A;  5LMN Q;  3Q8D A;  3HOW G;  1SNQ A;  1PFM A;  2LXK A;  2WB1 E;  4FXD A;  2AQ2 B;  1SMY D;  2ZM6 L;  1YIT A;  1NR4 A;  4JYA Q;  4B9W A;  2IX0 A;  1QVC A;  4DAP A;  5A2Q E;  2EJG C;  1S5C D;  5HGT A;  1I3Q H;  1V43 A;  5C44 B;  2EVB A;  3PO2 H;  3HOU G;  1ZXT A;  4JV5 Q;  3M9B A;  4DV4 L;  5ELO A;  1Q82 C;  4NDX A;  1HR0 Q;  2B2W A;  5G3L D;  1VMP A;  1MI2 A;  2Z4H A;  4GLX A;  4KHP L;  1K8A C;  1G6Z A;  1E3P A;  3MXG A;  3T13 A;  4BY1 G;  1I94 Q;  2ASB A;  3DUZ A;  3GTL H;  4B3M L;  4UHV A;  5IT9 E;  2BDO A;  1S72 A;  5M5Y B;  3T53 B;  1V1P B;  1IZ6 A;  1KQS A;  4B3S Q;  3PMF A;  4A3E B;  3S1Q H;  4A3K H;  1YZ6 A;  2K5N A;  1N33 Q;  4LAA A;  1BQQ T;  3VR3 A;  5KIX A;  1F9P A;  1SEB D;  3G71 A;  1IKL A;  2D9U A;  2PNR C;  1HNX L;  1Y1W B;  3HOZ G;  1HHV A;  2XVS A;  4LF9 L;  2NYZ D;  1EWH A;  2F4I A;  1CQF A;  4XQJ A;  5A2Q L;  4DR7 Q;  1STE A;  4C3I G;  3D4W A;  2V1C C;  2OEO A;  4DV6 Q;  3CC7 A;  1SDF A;  4M1U B;  2UXD L;  4LF5 L;  4GKK L;  3VYS A;  4DR6 L;  1FNW A;  1E7Z A;  3AU7 A;  1IBK L;  4BA2 I;  5IYD H;  1NR2 A;  3L0O A;  1PTO F;  3ZYY X;  1FNU A;  2E75 C;  3S17 B;  1SAP A;  1PZK D;  2NTS A;  2NVQ H;  5IGD A;  5IP9 H;  1PH1 A;  2P5Z X;  5BR8 L;  3J7A 5;  3HEJ A;  1BBW A;  4QJF A;  5C44 G;  2K5V A;  5IT9 L;  4AQY L;  2UXC L;  3VYR A;  4LW1 A;  4PV1 C;  4OEM B;  3D3R A;  5T1G A;  3S1N B;  3BYY B;  1NY4 A;  3AEV A;  1F77 A;  4DR1 Q;  1FL0 A;  1OXT A;  3K5N A;  2K14 A;  1LTA D;  1JE4 A;  4C3J H;  1WTQ A;  1KHI A;  5FO7 B;  5FLX c;  1Q7Y C;  3Q6S A;  4HSP A;  4KTA A;  1PDQ A;  1QE6 A;  2B2V A;  4A93 G;  2Z6K A;  2F0U A;  3P1H A;  4ZUJ A;  5LHY 1;  3QJY A;  1L0X B;  2E2H H;  1K8M A;  1C9O A;  4XQQ A;  1EU3 A;  4G7O C;  3OW7 A;  3BS1 A;  4A3E G;  3H3V H;  4JI0 L;  1XNR Q;  4HJ7 A;  5M5W H;  2H5X A;  3QR8 A;  3GTP B;  3L7Z C;  4XT1 B;  1WOC A;  2I5M X;  4L63 B;  4OO1 G;  3T1H Q;  3GD7 A;  1QB5 D;  3K5O A;  1R9T H;  1Z7T A;  3GTM H;  2O5I C;  1WCM G;  2DGY A;  1X3Q A;  4PZ6 A;  3H3V I;  5CV6 A;  3J80 i;  5EKL A;  4FXK C;  1VQC A;  2ZXP A;  4DF7 A;  2NZ1 D;  1KNA A;  2KEE A;  4H02 A;  3HOX G;  3PSI A;  2JA8 H;  1HUN A;  1X55 A;  3NTH A;  3P7J A;  4KMU C;  1X3E A;  5JJK A;  2B63 H;  3FPU B;  2JA7 H;  2Z6B A;  2JE6 I;  4B3T Q;  2K6A A;  1D8L A;  5F2D A;  1PTO D;  3K0Y A;  5ELB A;  3BDC A;  2PYK A;  4N8X 1;  4A3L G;  2OT2 A;  2EIF A;  1AZQ A;  1ILQ A;  2K7V A;  4KY7 A;  2YYZ A;  2MPM A;  3KLR A;  4PNY A;  3C3L A;  3J7A V;  1WTH A;  2KHI A;  4MZ9 A;  4JI4 L;  3OMG A;  4RKB A;  4ZQ3 A;  2B8F A;  4YCU A;  2SNS A;  3BYT B;  1IHZ A;  5I9P A;  4HJ5 A;  1I6H B;  2MUY A;  5LMN L;  3HOY H;  3PO3 H;  1D1I A;  1VQF A;  4JOI C;  5M3F B;  2FFK B;  1E2W A;  3PUZ A;  3S1M H;  1K83 B;  3KJP A;  1EYD A;  3I4O A;  2EY1 A;  3J81 j;  1OXU A;  3OMC A;  3DM1 A;  4GN3 B;  4JYA L;  2A6H C;  1B1Z A;  4BXX G;  2L12 A;  2PO4 A;  3F1Z A;  4H44 C;  4K14 A;  3NBH A;  4HCS A;  1PHJ A;  4PG3 A;  1GHK A;  1SE2 A;  2RVL A;  2XN9 C;  3DXJ C;  5C4H A;  3H3V C;  4IPG A;  4X3K A;  2F0I A;  1KAB A;  1UWV A;  3MFG A;  4OXP A;  1G51 A;  2NB0 A;  3BU2 A;  4DGZ A;  1L1O C;  3KDF A;  4UDU C;  3S14 B;  1Q1B A;  1E24 A;  4CJ2 C;  1YNX A;  1HXY D;  2BE5 C;  3UE1 A;  2L55 A;  1ENA A;  4ZCK A;  3C2P A;  1SNO A;  3V05 A;  2JN4 A;  4KJO A;  1CTM A;  3GTQ B;  2KBN A;  3NEM A;  5AJ3 L;  3N52 A;  2L0C A;  3OWF A;  1DM0 B;  4EGV A;  4B3S L;  4GOP A;  4GZY C;  3HKZ B;  1OO9 B;  2B2T C;  4C3H G;  2CW0 C;  5COR A;  4APV A;  3PUY A;  1AN8 A;  3K81 C;  3GTJ H;  3L3O C;  1EZ6 A;  5EPL A;  5KND A;  1YVC A;  2G5D A;  2OCE A;  1LAB A;  2CWA A;  3D31 A;  4K6D A;  4EX5 A;  2R92 H;  1Z6H A;  1MD2 D;  1IL2 A;  1FJG Q;  1KAW A;  3SK4 A;  1SBB B;  3L2P A;  1JJ2 A;  1A0I A;  1JWU D;  2EY6 A;  4OL7 A;  1DXM A;  5E4W C;  1VCI A;  1QCB D;  3NEL A;  3AQQ A;  3OTO Q;  4A75 A;  3U4Z A;  4DK3 C;  1UEB A;  2R7D A;  3CHB D;  1HZB A;  3A8J E;  1U9R A;  4QL5 A;  1GVP A;  1BCP F;  1DOL A;  1I3Q B;  3PO2 B;  1B70 B;  2RA4 A;  3T4A C;  3H6M A;  1NTG A;  3QIA A;  3VYT A;  1CHQ D;  1MJC A;  4L5S A;  4E6I A;  1X3P A;  1F2L A;  2D2C C;  1P16 A;  2K28 A;  2FXQ A;  4F8M A;  2HCI A;  2HIX A;  1ASZ A;  4DNT B;  3KK7 A;  4R1J A;  1LTI D;  4HJA A;  1SNC A;  3A74 A;  2VUM G;  4TSS A;  1QUQ A;  2B2W C;  2BA0 A;  3GTL B;  2ZXO A;  3RNU A;  3TP6 A;  3NWT A;  4QIW B;  4DKA C;  5CV5 A;  4JI6 Q;  1Y8N B;  4OON A;  1WTV A;  3EJI A;  1WJJ A;  3MTS A;  4QGU A;  3HS0 C;  3IRB A;  3SK6 A;  5CV7 A;  3HKZ G;  2UUA Q;  1SJH D;  3FKI B;  4A3K B;  3M4P A;  1A63 A;  3I90 A;  1HZ9 A;  1WVL A;  3X3N A;  1M90 C;  2XRS D;  3HZX A;  3GTG B;  5EBC A;  2DJG C;  4QB4 A;  2OXP A;  3W3A A;  3J81 c;  5NUC A;  3A5U A;  1E1T A;  2Q2T A;  1C7Y A;  3CF5 A;  2UXB L;  1EIG A;  3OWE B;  5C5M A;  5C0X H;  4B3T L;  3I91 A;  1PH5 A;  1VQ5 A;  1B3Q A;  3HOV H;  2EYF A;  5CMD A;  4DN4 M;  2OF1 A;  1WI5 A;  4QMG A;  3H15 A;  5KRU A;  1CKN A;  3HGB A;  4MN3 A;  3E9H A;  4LF6 Q;  3CPW A;  1BCP D;  2KA7 A;  5C0X I;  5HUR A;  2Y0S E;  1TWC H;  3PO2 G;  5DM7 3;  2F3V A;  1ZEQ X;  1QWY A;  1YHA A;  2VQE Q;  1SFO H;  4FP5 D;  2ZTE A;  4PZ7 A;  4PMC A;  3R2T A;  4QCL A;  4YIJ A;  2K33 A;  5M5X B;  3NK9 A;  2ZTD A;  3G4S A;  2DN8 A;  2IPK D;  4BBS H;  2ZM6 Q;  4NB3 A;  4CGY B;  3CCU A;  1AE2 A;  1JWS D;  4JW0 A;  4LUO A;  5DLQ E;  4K5V A;  2E2H B;  4R4C A;  4A3C G;  3CCS A;  2IL8 A;  2KCC A;  2X69 A;  1JE5 A;  4CDC C;  3TP7 A;  4A3K G;  5M5W B;  4LWC A;  1LT3 D;  1TR5 A;  2B2V C;  4A4I A;  2Z6K C;  4R9W A;  2K01 A;  1SNP A;  4A3D H;  1KTK A;  1R9T B;  3GTM B;  2QDB A;  3BZC A;  4KHP Q;  3GDE A;  4HTH A;  5KGU A;  2FHT A;  5JPM C;  2KED A;  3EN2 A;  1VQG A;  1PRT C;  1TS2 A;  2JA8 B;  2Z8L A;  4JBK A;  4TVA B;  5IP7 H;  2F3W A;  3WWV A;  4B3M Q;  2B63 B;  1Z47 A;  3Q0A A;  3OW2 A;  5IYD G;  2YU9 B;  4DUY L;  2CCZ A;  4XQN A;  1F2Z A;  4XT3 B;  2F4V Q;  3IL8 A;  1K0R A;  2X6G A;  2VS1 A;  4K5X A;  1JOQ A;  1G2S A;  4HIM A;  2K5H A;  1GHJ A;  3VDY A;  2PQE A;  1HQM C;  2SNM A;  5IP9 G;  1ET6 A;  1VQO A;  4HMJ A;  2L1B A;  1VQA A;  2RF4 A;  2WV6 D;  5CGK A;  1LTB D;  4ZUI A;  3U50 C;  1UEA B;  5GAH C;  1B44 D;  1EQQ A;  3VR5 A;  1HNX Q;  3WOE A;  4LF9 Q;  4HID A;  1XWE A;  2CW0 D;  1TWG H;  5JPN C;  3E0J A;  2LXJ A;  5D65 A;  4JG2 A;  1SYE A;  3LX0 A;  3J80 E;  1PTO H;  4ZKB B;  4IUP A;  3HOY B;  3PO3 B;  4GKK Q;  5GAE C;  1KAA A;  1TWF H;  1UE5 A;  4IPH A;  1SE4 A;  4IUV A;  5GQO A;  1IBK Q;  4C3J G;  3OTO L;  1CM9 A;  4A3I B;  1F9S A;  2GVA A;  2B39 A;  3UDI A;  1OXS C;  2HDL A;  4KN4 C;  5IOD A;  1KXL A;  3I3C A;  2CHB D;  1G8Z D;  4HIK A;  4IN3 A;  3DEP A;  3I4M B;  2F0V A;  2J4X A;  5IYB H;  4QF4 A;  3TS2 A;  2Z0S A;  1A2T A;  1RIP A;  3MC0 B;  4FYD A;  3NQT A;  5A35 A;  1SYD A;  3T51 B;  5EJW A;  2HDM A;  4RA8 A;  4RWS C;  3CCV A;  3MEH A;  1G6P A;  5KEE A;  1L2F A;  2RKS A;  4OWW B;  2EOT A;  3M85 A;  1MGS A;  2QIL A;  3HOW B;  2KJX A;  5EBD A;  2TSS A;  1D7Q A;  1SN8 A;  1QG7 A;  3PQI A;  2JA8 G;  2NVX H;  2JK8 A;  1QNK A;  2WIN B;  4L5T A;  4DU9 A;  2K32 A;  2B63 G;  2JA7 G;  2K1B A;  3J80 L;  1W6J A;  3BZD B;  1W6K A;  4R4I A;  4AYB B;  1WD0 A;  1M1K C;  3PGZ A;  4ZRZ A;  2UUA L;  2ICE C;  3JAM E;  1CZG A;  1O7I A;  2WAC A;  1FGU A;  2AQ3 B;  4RGT A;  4DXG A;  1D2B A;  2B8G A;  3VR4 A;  4RCO A;  1CKO A;  1WYD A;  2VXW A;  3QWN A;  1SRU A;  3GTJ B;  1EQR A;  2R6G A;  1WTO A;  4GOP C;  2BOS A;  2FMM A;  2L9H A;  3CQZ B;  1VQL A;  2LY7 A;  1IXR A;  3CPF A;  3D8G A;  3ICE A;  4Y7N H;  3NP8 A;  4R4Q A;  1DD2 A;  4X66 L;  3HOY G;  3PO3 G;  4CDE C;  3OIP A;  4CJ1 B;  3D6C A;  1V1Q A;  3RMH A;  3S24 A;  3VR2 A;  2LMC B;  4A3I G;  1PRT F;  2RCN A;  4RGO S;  4HJ9 A;  4EQP A;  1LTS D;  2E74 C;  1DGS A;  4LF6 L;  1ICW A;  5FOB B;  4DV5 Q;  2KCT A;  2HD3 A;  1PH4 A;  4POG A;  1IW7 C;  1FD7 D;  4PMB A;  2KUM A;  4LFC L;  1TVX A;  1KRT A;  4DPG A;  2UUB Q;  4JI4 Q;  3HOZ B;  2EDG A;  3Q22 A;  1HQR D;  3OYY A;  2K5D A;  4KD4 A;  1HNZ Q;  1CK1 A;  1A3T A;  3K7U C;  5EGT A;  4C3I B;  2F0S A;  3JAM L;  5DEH A;  4UP7 A;  1A3V A;  3KUP A;  5IWA L;  2A73 B;  1SXT A;  4CDD C;  1IYV A;  3I4N H;  4NXN Q;  1SND A;  1KD1 C;  4OWX B;  4K2L A;  5M3M H;  3S16 H;  2EYM A;  2PMZ B;  2AHO B;  3WDN A;  1RL2 A;  5C6A A;  3TP8 A;  5IGF A;  1T9H A;  2QF7 A;  4AYB G;  1BKB A;  2PNH A;  3KLS A;  4ILW A;  2BA1 A;  2CKZ B;  3E3X A;  3CCR A;  1STH A;  1B53 A;  1S3O A;  4KV6 A;  1WTR A;  4R8I A;  5C4J B;  1HA5 A;  3K7A B;  2E2I B;  1UE1 A;  1BF4 A;  2ENB A;  2K75 A;  3F2U A;  2PI2 A;  2R92 G;  2SDF A;  3K59 A;  1PFB A;  3TN2 A;  4A93 B;  1PZJ D;  4DV0 L;  5AJ3 Q;  2B3G A;  2WFW A;  1VQ4 A;  4I65 A;  2F4V L;  3DEO A;  3X3M A;  1H9M A;  1PRT D;  5KYL A;  1PYB A;  1CFM A;  4RGN A;  4EQN A;  1JJC B;  4OGQ C;  1PYS B;  1I50 B;  1EWI A;  1SRO A;  4POF A;  4C56 C;  4IFD J;  4DA2 A;  3I70 A;  1WCM B;  3DLL A;  1P8L A;  2NVT H;  1CUK A;  1ESF A;  5CV4 A;  4TQU S;  4OIK A;  1F2Y A;  1HCZ A;  1E2V A;  5E7N A;  2I46 A;  1CA5 A;  2E5L L;  3HOX B;  1EIF A;  3B6Y A;  1X3G A;  3F8T A;  4GNX A;  1PFS A;  1QNU A;  2DUD A;  2PQA B;  2IX1 A;  1I4R A;  4CBV A;  4BBS B;  1K8O A;  4IFD H;  1JIC A;  2E8G A;  3TRE A;  2QGQ A;  1KLG D;  2NVY B;  2RCF A;  1PMR A;  3A8I E;  1MSG A;  4ULL A;  2A68 C;  4GKJ L;  4MTK A;  1N32 L;  1CI3 M;  4DR4 L;  3UI2 A;  1UAP A;  1M4V A;  2VB2 X;  3IFT A;  4RH6 A;  1NSN S;  4IFD I;  4A3D B;  4U67 3;  4F7X A;  2IY5 B;  1JJG A;  1EOV A;  1U4R A;  4LNQ A;  1GXD C;  1SSO A;  1NUC A;  2SEB D;  4L8J A;  1HFN A;  3TS0 A;  4NW2 A;  5C0X G;  3CMA A;  2IJ0 A;  2QA4 A;  4KKS A;  3S15 B;  1L0W A;  3TZD A;  2AWO A;  3WOF A;  2F0G A;  1JCK B;  4DAY B;  4EQ5 A;  3J7Y W;  4X3U A;  1EQV A;  3C1F A;  2DNE A;  3MHB A;  4K2K A;  2CH4 A;  3K58 A;  4QY7 A;  1Y14 B;  4FO2 A;  3CRL C;  4JI8 Q;  4YWK A;  1TWG B;  2EYL A;  2RSN A;  4BS9 A;  1X32 A;  4ME5 A;  1PTO B;  2JXM B;  3S1R H;  1FGB D;  2UXB Q;  3S2D H;  1QZH A;  2FMC A;  5IT9 c;  4NKL A;  4ZK9 B;  1BCP C;  5HGQ A;  3RUZ A;  1XX8 A;  3FDT A;  1V1P A;  3OHX C;  5IOC A;  1XYI A;  4X3T A;  4LFB Q;  1Q8I A;  4C3H B;  4BBS G;  3DWA A;  2K05 A;  1S5D D;  2KQ3 A;  4IUQ A;  1Q86 C;  1K73 C;  4DV5 L;  1Q3L A;  3IAY A;  4JBJ A;  2A19 A;  2O5J C;  3DWP A;  2UUB L;  2F52 A;  1VQ6 A;  1RTN A;  5EKI A;  1LTR D;  3DHQ A;  1YJN A;  1H95 A;  4JPB W;  4FF1 A;  1HNZ L;  2J7Z A;  4I7Z C;  3M3Y H;  1EY8 A;  1GUT A;  1XJV A;  4A3D G;  1K0S A;  2E2J B;  1D5M C;  1IW7 D;  2Z1C A;  3K6O A;  4A3B H;  2VNU D;  3C1E A;  2DY7 A;  2RBM A;  4S3S A;  4XYQ A;  2OQK A;  4C2M H;  4NXN L;  1LT6 D;  3I55 A;  3K8A A;  1PA6 A;  1D5Z C;  3NWS A;  4GN4 B;  3U58 A;  2NVX B;  1HTL D;  2DJF C;  5IP7 G;  5EKK A;  3ERO A;  2LS0 1;  2XNA C;  1PZI D;  3PIO 3;  1ROD A;  3JAM i;  3HP3 A;  5T1I A;  3Q24 A;  1TT2 A;  1ONL A;  2Q8T A;  1PLF A;  2GA4 B;  4LJZ C;  2PZT A;  5J39 A;  1X9N A;  3NTI A;  5E3F A;  3TBI B;  1EWC A;  3EQL C;  3KF6 B;  2E76 C;  2KOL A;  2KEN A;  5COY A;  4FF3 A;  1HZA A;  4XIG S;  4Y7N B;  2VUM B;  3TSS A;  5M9O A;  4I7A A;  4X65 Q;  3FEW X;  1U0L A;  2VL6 A;  4OEL B;  1LTT D;  4DUY Q;  2K03 A;  1NCV A;  3AFQ A;  4WJW A;  2XTI A;  1Y8P B;  2WB1 G;  4DR2 Q;  5IYC H;  1VF5 C;  4DAY A;  2YTX A;  4N9P A;  1K8G A;  5BN4 A;  3GV6 A;  4YWL A;  2JA5 H;  5IYB G;  3F2B A;  5AFW A;  1SE3 A;  3RZD B;  1GJX A;  2JA6 H;  2HHH L;  4L5R C;  2C5C A;  3BJU A;  1IL8 A;  1RTO A;  3CCJ A;  2ZTC A;  3G48 A;  4O42 A;  1BR9 A;  3BZK A;  5GAD C;  1UE6 A;  2EJF C;  3A5Z B;  4A3F H;  1PH7 A;  1H9K A;  1TY0 A;  3I4N B;  1O80 A;  5DM6 3;  2R7Z H;  1SYG A;  3M4Q A;  5DNF A;  5JJL A;  2EJM A;  2AWN A;  2MO0 A;  3D4D A;  5M3M B;  2ATW A;  1STY A;  1LV9 A;  3LNN A;  4DNR B;  3MXP A;  4BY1 H;  4KHZ A;  1OXX K;  2MO1 A;  1IBM Q;  1MSH A;  1VQJ A;  2UU9 L;  1EYA A;  4YHH L;  2KCM A;  4A3M H;  2CQO A;  1SNM A;  2EYJ A;  5ELC A;  4RGM A;  2A68 D;  3A0J A;  1X56 A;  3MWY W; 
#chains in the Genus database with same CATH homology
 2VQF L;  5GAH C;  3GTK H;  1VQ8 A;  1EQQ A;  4WJ4 A;  4JYA Q;  1HNX Q;  2IX0 A;  1QVF A;  1QVC A;  2AKW B;  4LF9 Q;  3M7N A;  4HID A;  1YJ9 A;  1Q81 C;  4QIW E;  1Q46 A;  1TWG H;  3T1Y Q;  1I3Q H;  1V43 A;  2LXJ A;  3NEN A;  3PO2 H;  3HOU G;  4JG2 A;  4XTC S;  4JV5 Q;  3M9B A;  4DV4 L;  1K9M C;  5ELO A;  2YU9 H;  1TWA H;  1Q82 C;  4DR3 Q;  2D0P A;  4R4T A;  4GKK Q;  1HR0 Q;  2CFM A;  5GAE C;  1TWF H;  1UE5 A;  2WAQ E;  4IPH A;  4P71 A;  5GQO A;  1IBK Q;  3OTO L;  2IHF A;  2LSS A;  4GLX A;  2GVA A;  4OWT B;  1K8A C;  3UDI A;  2NN6 G;  4KHP L;  3PF4 A;  1E3P A;  1OXS C;  1NBW A;  1KXL A;  4IOA A;  2MFI A;  3K80 C;  4BY1 G;  4HIK A;  1I94 Q;  1Q12 A;  2ASB A;  4JI8 L;  1HH2 P;  2PQA A;  5IYB H;  3GTL H;  4B3M L;  5JEA J;  1S72 A;  4UP8 A;  3TS2 A;  2Z0S A;  4JI7 Q;  4NXM L;  1YJW A;  1RIP A;  4IJH A;  2KHJ A;  4K0K L;  1MIU A;  4X66 Q;  1IZ6 A;  4GN5 A;  4A3J H;  1KQS A;  4B3S Q;  3CCV A;  1MKH A;  1B7Y B;  1JB7 A;  1CSQ A;  1VQM A;  3I4N G;  1G6P A;  2PI2 E;  3F2C A;  4A3K H;  4JI3 Q;  4JI5 Q;  3S1Q H;  2BH8 A;  5LMU Q;  1YZ6 A;  1QUQ B;  1L2F A;  4LFB L;  4OWW B;  2K5N A;  1N9W A;  1X54 A;  4MNO A;  4A3I H;  1N33 Q;  3M85 A;  3S2H H;  3G71 A;  2RHQ B;  4DAM A;  3HFZ B;  5M3M G;  1HNX L;  3HOZ G;  3AFP A;  4DNI A;  4LF9 L;  1A8V A;  1D7Q A;  2I5H A;  1SN8 A;  4DV3 Q;  4LUZ A;  1NMG A;  2NVX H;  2JA8 G;  2JK8 A;  3I4M H;  4LUV A;  4L5T A;  4GNX C;  4OX9 Q;  4DR7 Q;  4MTN A;  2B63 G;  2JA7 G;  2V1C C;  3CCM A;  2N49 A;  4LFC Q;  4JV5 L;  4DV6 Q;  3CC7 A;  4LFA L;  2UXD L;  1PVO A;  1NJI C;  4R4I A;  1M1K C;  2UUA L;  1HR0 L;  4LF5 L;  3K0X A;  3PGZ A;  4GKK L;  4DR6 L;  4A76 A;  4GS3 A;  1E7Z A;  1IBK L;  4BA2 I;  4B3R Q;  5IYD H;  1O7I A;  3PUW A;  1FGU A;  3L0O A;  4DV7 Q;  5IWA Q;  1CKO A;  1WYD A;  1N34 Q;  1SRU A;  5H1S E;  2ID0 A;  1VQ7 A;  1EQR A;  1YIT A;  2NVQ H;  3HOW H;  2R6G A;  5IP9 H;  1I94 L;  3KYH C;  1PH1 A;  1Y1W H;  5BR8 L;  3J7A 5;  4GOP C;  4P72 A;  1VQL A;  5C4X H;  1BBW A;  4QJF A;  1IXR A;  3CPF A;  5C44 G;  2K5V A;  5EAY A;  4AQY L;  3KFU A;  3ICE A;  1XTD A;  4Y7N H;  2UXC L;  1VQH A;  4GLA C;  4R4Q A;  4LW1 A;  3W1B A;  4X66 L;  3HOY G;  3PO3 G;  1CKN B;  1XMQ L;  2EQS A;  2GN5 A;  3HOU H;  4UY8 C;  1NY4 A;  1V1Q A;  4JI3 L;  3AEV A;  4OO1 I;  5LMU L;  3S24 A;  4A3I G;  2RCN A;  1N33 L;  1B8A A;  2HQL A;  4DR1 Q;  4LF8 Q;  1FL0 A;  1OXT A;  2JA9 A;  4HJ9 A;  3F2D A;  1GM5 A;  4DR5 Q;  1L1O B;  3W5O A;  2K14 A;  1DGS A;  4LF6 L;  4YY3 Q;  4C3J H;  4YCW A;  1KHI A;  2WP8 J;  5FLX c;  1Q7Y C;  4DV5 Q;  4DV3 L;  4DR7 L;  4P75 A;  4OX9 L;  2KCT A;  1PH4 A;  1KIX A;  3CQZ H;  2YTV A;  4POG A;  4A93 G;  2Z6K A;  1N8R C;  1KRT A;  4LFC L;  4DPG A;  4DV1 Q;  4X65 L;  2UUB Q;  4DV6 L;  4JI4 Q;  3W1G A;  2E2H H;  1S40 A;  1C9O A;  3OYY A;  2D0O A;  2K50 A;  1EYG A;  2L15 A;  1UE7 A;  4JCV E;  1HNZ Q;  3K7U C;  3STB C;  4A3E G;  4DV0 Q;  5M3F G;  3H3V H;  4JI0 L;  1MJE A;  1XNR Q;  4A3G G;  4B3R L;  4UP7 A;  4HJ7 A;  1A62 A;  5M5W H;  3GTO H;  2H5X A;  3CXC A;  3H0G G;  4DUZ Q;  4DV7 L;  2NN6 I;  5IWA L;  4DR2 L;  3L7Z C;  3SGI A;  1WOC A;  2I5M X;  4IFD G;  3T1H Q;  4OO1 G;  3I4N H;  3GD7 A;  1PH9 A;  4L5Q A;  1R9T H;  3GTM H;  1WCM G;  2DGY A;  4IO9 A;  4NXN Q;  4PZ6 A;  1KD1 C;  4OWX B;  3H3V I;  3J80 i;  2PMZ E;  3ULJ A;  5M3M H;  1V9P A;  1VQC A;  3S16 H;  1C0A A;  3HOZ H;  2Q2H A;  2AHO B;  5FJ8 G;  4H02 A;  1RL2 A;  3HOX G;  3PSI A;  2JA8 H;  1T9H A;  4AYB G;  2N8N A;  1BKB A;  1X55 A;  2PNH A;  1X3E A;  5JJK A;  2B63 H;  4C3I H;  2JA7 H;  2BA1 A;  2JE6 I;  3CCE A;  4B3T Q;  2CKZ B;  1D8L A;  3CW2 C;  2E5L Q;  3CCR A;  4DR1 L;  4LF8 L;  3GTP H;  1X56 A;  4DR5 L;  1S3O A;  1YHB A;  1AE3 A;  2OTL A;  1LTL A;  3J7Z C;  1YIJ A;  4A3L G;  2EIF A;  4AH6 A;  3RN2 A;  1W3S A;  1UE1 A;  4PMW A;  4RG1 A;  1TXY A;  2YYZ A;  2K75 A;  3MEF A;  2PI2 A;  3CME A;  4YWM A;  2R92 G;  4NPS A;  2KHI A;  4MZ9 A;  4DV1 L;  4JI4 L;  4BA1 I;  4YCU A;  3KF8 B;  1WFQ A;  3KF6 A;  1PH3 A;  2JQO A;  1IBM L;  3CP0 A;  5C44 H;  4DV0 L;  5AJ3 Q;  2B3G A;  2WFW A;  4HJ5 A;  1N36 L;  1XNR L;  5C0X J;  1VQ4 A;  2F4V L;  5GAG C;  4GKJ Q;  4DUZ L;  1N32 Q;  4DR4 Q;  5LMN L;  1ASY A;  3RN5 A;  3HOY H;  4P74 A;  3PO3 H;  1VQF A;  4IJL A;  1PYB A;  4JOI C;  4LF4 Q;  3T1H L;  1VQK A;  1HNW Q;  2VY3 A;  3PUZ A;  3S1M H;  1JJC B;  5C4J H;  1PYS B;  3PV0 A;  3KJP A;  1NE3 A;  1EWI A;  3I4O A;  3K7A H;  3STB D;  3J81 j;  2AMC B;  1LM0 A;  1OXU A;  2NZO A;  2E2I H;  1SRO A;  1E22 A;  4POF A;  4GN3 B;  1Q1E A;  4JYA L;  2HT1 A;  4BXX G;  4AIM A;  4IFD J;  1EFW A;  3F1Z A;  3DLL A;  1LYL A;  4BBR G;  2Q2I A;  1PHJ A;  3T1Y L;  4PG3 A;  1P8L A;  2NVT H;  1CUK A;  1XPU A;  3TRZ A;  4A93 H;  4X6A H;  3FP9 A;  4GLV B;  4IPG A;  4TQU S;  5M5Y H;  4JBW A;  3RLF A;  4UP9 A;  2ES2 A;  2N3S A;  5E7N A;  4QQB X;  2YV5 A;  4AYB E;  2E5L L;  2R93 G;  4DR3 L;  1EIF A;  1GO3 E;  1UWV A;  4OXP A;  4HJ8 A;  1I6H H;  3B6Y A;  1G51 A;  1X3G A;  3BU2 A;  4A3G H;  4A3E H;  1L1O C;  3F8T A;  4R4O A;  5M3F H;  2YTY A;  3KDF A;  3RR5 A;  1EUJ A;  2HIV A;  3LGJ A;  3J81 i;  1Q1B A;  1PFS A;  2CWP A;  3KLW A;  3D0F A;  1EIY B;  1E24 A;  3H0G H;  2DUD A;  1XNQ Q;  2PQA B;  1I50 H;  1YNX A;  2IX1 A;  3UE1 A;  3HKS A;  3PIO A;  2K4K A;  2E8G A;  3TRE A;  1WCM H;  2QGQ A;  4UPA A;  3FHW A;  2KBN A;  3NEM A;  5AJ3 L;  4JI7 L;  2UUC Q;  3CCL A;  1E1O A;  4GKJ L;  1TWH H;  5FJ8 H;  1N32 L;  4DR4 L;  4B3S L;  3HOX H;  4IOC A;  3DM3 A;  4GOP A;  4A3B G;  4JI5 L;  4IFD I;  4X62 Q;  3KOJ A;  2IY5 B;  1VQ9 A;  1JJG A;  1PH8 A;  1EOV A;  4LNQ A;  4DV2 Q;  3S17 H;  4APV A;  3PUY A;  2I5L X;  3K81 C;  3GTJ H;  3I56 A;  5IY0 A;  4A3L H;  1J6Q A;  1YVC A;  2OCE A;  3D31 A;  2CWA A;  3TS0 A;  3U4V A;  4EX5 A;  1XPO A;  2R92 H;  5C0X G;  2NVY H;  5FLM G;  3CMA A;  1IL2 A;  2QA4 A;  1FJG Q;  1KAW A;  3ZJY C;  1PV4 A;  3FKI G;  5ELN A;  4HIO A;  3UDG A;  1L0W A;  1K3R A;  3I2Z A;  3ULL A;  3PIP A;  3L2P A;  2AWO A;  4DV4 Q;  1A0I A;  1GKH A;  4DAY B;  3RLN A;  4EQ5 A;  2QEX A;  1XMO Q;  1JJ2 A;  4J15 A;  1KRS A;  2RHS B;  1Y1V G;  3J80 c;  2JEA I;  3S1N H;  1VCI A;  3NEL A;  3AQQ A;  2A8V A;  3OTO Q;  3JC6 6;  1N34 L;  1X65 A;  4A75 A;  3U4Z A;  4P73 A;  5GRO A;  4DK3 C;  1UEB A;  4QY7 A;  2R7D A;  1HZB A;  1Y14 B;  2IHE A;  2K52 A;  1QVG A;  3AYH B;  3RZO H;  4ALP A;  1YI2 A;  1JMC A;  4QL5 A;  1GVP A;  4YCV A;  5HY6 A;  3M4O H;  4JC0 A;  4YWK A;  4JI8 Q;  2OTJ A;  3PUV A;  4Y52 H;  1B70 B;  2ALY B;  3ERS X;  4BXX H;  1NTG A;  4BBR H;  3S1R H;  2UXB Q;  3S2D H;  1MJC A;  1QZH A;  4L5S A;  5IT9 c;  3S15 H;  4BY7 G;  1P16 A;  2ZJQ A;  4RMF A;  4K0K Q;  1GD7 A;  5IYC G;  2FXQ A;  4X62 L;  3PUX A;  5HGQ A;  2HIX A;  1ASZ A;  2R93 H;  5J3B A;  2IT1 A;  5JJI A;  2JA5 G;  4DV2 L;  4R1J A;  4LFB Q;  3UDF A;  4BBS G;  4YY3 L;  4HJA A;  1Q86 C;  1K73 C;  2OQ0 A;  4DV5 L;  2Y0S G;  2JA6 G;  3A74 A;  2VUM G;  3PCO B;  2OWO A;  4JBJ A;  2A19 A;  1QUQ A;  5C3E G;  2VZA A;  2BA0 A;  2UUB L;  2F52 A;  4X64 Q;  1VQ6 A;  3RNU A;  1OXV A;  1FJG L;  4JI6 Q;  4DKA C;  1YJN A;  1SLJ A;  4OON A;  1H95 A;  1WJJ A;  1HNZ L;  1FVI A;  3ER0 A;  4QGU A;  3IRB A;  2C35 B;  1XMO L;  4WJ3 M;  4A3F G;  3M3Y H;  4LFA Q;  3CC4 A;  2BH2 A;  2UXD Q;  3HKZ G;  2UUA Q;  1XJV A;  4LF5 Q;  4A3D G;  2MNA A;  4DR6 Q;  3M4P A;  1A63 A;  3I7F A;  2R7Z G;  4A3B H;  1HZ9 A;  2VNU D;  3JAM c;  3KJO A;  4IPC A;  3E9I A;  4C3H H;  1BBU A;  1SMX A;  3RLO A;  2F3I A;  1CSP A;  1M90 C;  2OQK A;  1VQE A;  4NXN L;  4C2M H;  3I55 A;  3K8A A;  1PA6 A;  4GN4 B;  3U58 A;  1I5F A;  1VQN A;  5BR8 Q;  2VW9 A;  1W2B A;  1VQP A;  5IP7 G;  4JOI A;  2EXD A;  3J81 c;  3PF5 A;  4KI0 A;  3A5U A;  1E1T A;  4AQY Q;  1C7Y A;  2Q2T A;  3CF5 A;  1KC8 C;  1OTC A;  2UXC Q;  2UXB L;  2HHH Q;  3JAM i;  4GNX A;  1BVS A;  4A3C H;  1IBL Q;  1J5E Q;  4B3T L;  3UE0 A;  5FLM H;  4A3M G;  1PH5 A;  1VQ5 A;  1XMQ Q;  3HOV H;  2D62 A;  2E2J H;  3FKI H;  4DK6 C;  3UDX A;  1WI5 A;  3H15 A;  1NMF A;  1CKN A;  1VS0 A;  1Y1V H;  1X9N A;  3CD6 A;  1K83 H;  4JI1 Q;  1Z9F A;  3E9H A;  3KF6 B;  4LF6 Q;  2KEN A;  3G6E A;  3CPW A;  3GTG H;  4X64 L;  2JEB I;  5C0X I;  5K36 G;  2Y0S E;  1TWC H;  4JI6 L;  3PO2 G;  1HZA A;  1L1O A;  4XIG S;  2ZJR A;  3TQY A;  4X65 Q;  4KLK A;  1U0L A;  1VQI A;  2VL6 A;  3ULP A;  1YHA A;  2ZJP A;  2VQE Q;  1SFO H;  1JT8 A;  4DUY Q;  4JI0 Q;  2ZTE A;  3AFQ A;  4PZ7 A;  2NZH A;  3HKZ E;  2N78 A;  3CC2 A;  2UU9 Q;  4LF4 L;  2XTI A;  4LF7 Q;  4BY7 H;  4IPD A;  4ME3 A;  1HZC A;  2WB1 G;  4YHH Q;  4DR2 Q;  1HNW L;  5IYC H;  2XGT A;  3MXN B;  4JI2 Q;  2YTX A;  1KL9 A;  2I0Q A;  1VQB A;  3NBH B;  3S14 H;  2ZTD A;  3G4S A;  4O0A A;  1K8G A;  4PZ8 A;  1VQD A;  4YWL A;  3TEH B;  2JA5 H;  1HJP A;  2JJQ A;  5IYB G;  4BBS H;  2ZM6 Q;  4NB3 A;  2VQF Q;  3CCU A;  1SE8 A;  1AE2 A;  3F2B A;  1AH9 A;  4LUO A;  1G29 1;  5DLQ E;  2JA6 H;  2MQH A;  2VUM H;  2HHH L;  4R4C A;  1YBY A;  1SR3 A;  4L5R C;  5C3E H;  4A3J G;  1PH6 A;  4A3C G;  1IBL L;  4FDB A;  3GTQ H;  3BJU A;  4GNX B;  1J5E L;  3KDF B;  3CCS A;  5LMN W;  3HOV G;  1JE5 A;  3EBE A;  3CCJ A;  4A3K G;  4O2D A;  3CCQ A;  2ZTC A;  3G48 A;  2WAQ G;  4LWC A;  2R7F A;  3BZK A;  5GAD C;  1X3F A;  1UE6 A;  4A4I A;  3A5Z B;  2Z6K C;  1U5K A;  4A3F H;  5IE8 A;  1YHQ A;  1CKM A;  1PH7 A;  4A3D H;  2B29 A;  4JI1 L;  5M5X H;  1XNQ L;  2R7Z H;  1IYJ B;  1X6O A;  3BZC A;  3M4Q A;  1LUZ A;  1YEZ A;  4JBM A;  4KHP Q;  3GDE A;  5JEA G;  3CAM A;  3I4M G;  1PH2 A;  2Q2U A;  5JJL A;  2AWN A;  3EN2 A;  2GVB A;  2MO0 A;  1VQG A;  2ATW A;  3E0E A;  3RZD H;  4BY1 H;  4GOP B;  1QZG A;  2UUC L;  4JBK A;  4TVA B;  1XPR A;  4KHZ A;  5IP7 H;  1OXX K;  2VQE L;  3WWV A;  1HR0 W;  2MO1 A;  1IBM Q;  4B3M Q;  1Z47 A;  3OW2 A;  5IYD G;  3EIV A;  4DUY L;  1N36 Q;  2CCZ A;  4NXM Q;  1VQJ A;  2UU9 L;  4LF7 L;  2F4V Q;  1K0R A;  2VS1 A;  4YHH L;  1Q8K A;  4HIM A;  2KCM A;  5LMN Q;  2A1A A;  4A3M H;  2CQO A;  4JI2 L;  2K5H A;  3Q8D A;  3VDY A;  3HOW G;  3GO5 A;  5IP9 G;  1Y1W G;  2LXK A;  2WB1 E;  3A0J A;  1VQO A;  1VQA A;  2RF4 A;  3U50 C;  5C4X G;  2ZM6 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...