4A3JH

Rna polymerase ii initial transcribing complex with a 2nt dna-rna hybrid and soaked with gmpcpp
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3jH00
1PH9A 3PUZA 4JI8L 4HJ7A 1S40A 1PYBA 3J7ZC 1PH7A 3T1HL 1C9OA 4FDBA 3UE0A 2OTJA 4JI0L 3CPWA 3S16H 4JYAL 3CC2A 1HR0Q 2AHOB 1PH6A 3CMEA 1EIFA 2JA7G 4A3CH 1CKNA 5GADC 3F2BA 1WFQA 2ZTCA 5C4JH 1PHJA 4DV7Q 4JI6L 4WJ3M 3RNUA 4BY1G 3RZOH 3J80c 4DV2Q 4QL5A 5C0XG 2A8VA 1X65A 3PF5A 1ASZA 2K52A 1YIJA 2QA4A 2ZM6Q 2WAQE 3CW2C 4JI7Q 4YCVA 1N33L 5IWAL 2E2IH 1HZ9A 1NBWA 1Q8KA 5E7NA 2ZJRA 2ES2A 2JA9A 5IYDG 3AFQA 1L1OB 4J15A 2R92G 2IX0A 5ELOA 2OQKA 3CPFA 4LUZA 4X66L 3MEFA 1UE7A 4JI5L 2N49A 2UUBQ 5JEAG 1E3PA 1EQRA 3K0XA 1GO3E 1OXUA 2E8GA 3AFPA 1N9WA 2A1AA 2Q2IA 1EIYB 2MO0A 1FVIA 1YJWA 3TREA 5FLMH 2I5HA 2IHFA 2ATWA 3ULPA 1TXYA 1JJ2A 2RCNA 1HNXQ 4DR5Q 1XJVA 4HIOA 5LMNW 4A3JH 1I3QH 3KF6A 3RZDH 2NN6G 2GVBA 3L2PA 4A3LG 1TWCH 2LXJA 4NB3A 4K0KL 2UUCL 3K7AH 3CCMA 1YJ9A 2F3IA 3HOYH 4DR7Q 3PSIA 1JJCB 4LNQA 2L15A 3J81i 3S1RH 4JYAQ 3G48A 4LFBL 4DV6L 2CQOA 1VQIA 1QZGA 2HQLA 3K81C 4DK6C 3U58A 3GDEA 3PUXA 2EXDA 3HOUH 4JI1Q 1TWHH 4GLAC 1VQ7A 3BU2A 4JBKA 4JI2L 2DGYA 1JMCA 1IYJB 1BBUA 3DLLA 3RN2A 4DR3Q 1WCMG 3HOXH 4A3GH 1W3SA 4AH6A 5FJ8H 3PGZA 4AYBG 2PQAB 4YY3Q 3K7UC 4LF9L 5IP9H 1VQBA 3AQQA 5M3MG 3TS0A 4DUZQ 4A3KG 5BR8L 2YTVA 3KJPA 1N33Q 5IWAQ 2BA1A 2JK8A 3JAMc 3RLOA 3I4MH 1QZHA 4X6AH 1YI2A 4OX9L 3L0OA 2UXDL 5IYBH 2YTXA 3GTJH 1UWVA 4GS3A 4X66Q 2Z6KC 1XMQL 1PH1A 4JI5Q 2R7ZH 2F4VL 4YCUA 2ALYB 4HJAA 3HFZB 1EFWA 1YJNA 4AQYL 1HR0W 2AMCB 1QVGA 2HIXA 2Z0SA 4MNOA 3FP9A 3HKZE 4RG1A 4JI3L 2IX1A 4A3MH 4O2DA 1VQ9A 2NN6I 3TS2A 1AE2A 1I94L 3W1GA 1A63A 3K80C 2I0QA 4BY7G 3E0EA 4DPGA 3GTOH 2UXCQ 4K0KQ 4LF7Q 2NVTH 2UUCQ 2MFIA 3FKIH 1VQ6A 3H15A 1Q46A 2JA6G 4A3BG 1D8LA 4XTCS 3HOZG 2N8NA 1E7ZA 5IYCG 1N34L 5GAGC 1FGUA 1HZAA 1VCIA 1X54A 1XNQL 1EUJA 2R7DA 1SROA 1YHBA 2UUAQ 3GTGH 4LFBQ 2KBNA 5HY6A 1Y1VH 2Q2HA 4A3EH 2JA5H 4A76A 2BH2A 3CQZH 1I50H 4JOIC 5IE8A 4JI2Q 4DK3C 4A3FH 1WYDA 3FHWA 5DLQE 1VQHA 4DV4L 4JC0A 1D7QA 3KJOA 2WB1G 3CXCA 1PFSA 3WWVA 3PO3H 2VQFL 1HJPA 2R93G 5BR8Q 1VQFA 3IRBA 4YWMA 3STBC 4AYBE 3CCEA 2E5LL 3JC66 2ZJPA 1KD1C 4OX9Q 3HOWG 5JJLA 4LFCL 4R4TA 1O7IA 2AWOA 3GD7A 2JE6I 3E9IA 5IP7H 2FXQA 1N8RC 1M90C 4DV1L 1BVSA 1R9TH 5M5YH 1LM0A 4AQYQ 3CCLA 1TWFH 1B70B 1FJGL 4LUOA 4JBMA 3F8TA 1XMOQ 3GTQH 2LXKA 4JI3Q 2CWAA 3H0GG 5LMUL 1XPRA 2VUMG 3PO2G 2ID0A 3J81c 1OXSC 1YVCA 4GN4B 4UP9A 3CCUA 1I94Q 3KOJA 2BH8A 2C35B 2VNUD 1PH8A 4DV5L 4BBRG 1X55A 2LSSA 4DV0L 2CKZB 1YNXA 1IBKQ 2XTIA 1QVCA 1TWAH 5C44H 4GOPA 4PZ8A 3I4NG 4UY8C 3PUYA 1XNQQ 4GKKL 4DV3L 4LUVA 4MTNA 2I5MX 3ULJA 4HJ9A 4LFAL 4C3IH 3CCSA 4DNIA 4L5RC 4JI4Q 3RLFA 1WI5A 1EYGA 4A75A 3S15H 1QVFA 1KL9A 3KDFA 1Q86C 1YHAA 4XIGS 2VQFQ 1XPOA 4QQBX 1Q12A 1L2FA 1YEZA 3NBHB 4A4IA 4X62L 5AJ3Q 3I55A 1Y1WH 1XPUA 2D62A 2AKWB 4YWKA 3OTOL 1VQDA 4KHPL 1X3EA 4JCVE 2K50A 1N32L 2V1CC 1JE5A 4DV1Q 4A3LH 4APVA 5M3FH 1VQ8A 3RN5A 3J7A5 1HZBA 2GVAA 1KXLA 1MIUA 2Y0SG 1FJGQ 4IFDG 4NPSA 3CCVA 2MO1A 2KCMA 3M3YH 1RL2A 5C4XH 1YZ6A 2JJQA 5LMUQ 3D31A 4HJ5A 3PV0A 3UDIA 4H02A 3CC4A 2JA8G 3CCJA 4JI8Q 2NVXH 3SGIA 1VQNA 3HOVH 3A0JA 1M1KC 3T1HQ 4DV5Q 4R4CA 4JI0Q 2VW9A 1J6QA 1WCMH 1L1OA 2WP8J 1I5FA 4X64L 3ERSX 2HHHL 4B3ML 3MXNB 3I4OA 3CC7A 4GKKQ 4JI6Q 1GKHA 4EQ5A 4POFA 3BZCA 4JBJA 2NZHA 4UP7A 1PYSB 4DUYL 1Q82C 4TQUS 2D0OA 1AH9A 2ASBA 3H3VH 5FLMG 4GNXC 4A3DG 2B63H 1PVOA 1JJGA 4P72A 4A3IH 5C3EH 1B8AA 4IOAA 4IOCA 4A3JG 1VQGA 1A8VA 2UXBL 4YCWA 4X62Q 1SE8A 1KRTA 1JB7A 2HT1A 1KRSA 3STBD 2CCZA 5C0XJ 4MZ9A 3OTOQ 3M4PA 4KHPQ 1LUZA 1NJIC 4Y52H 3AYHB 1YHQA 3HOYG 4L5SA 4BY7H 4IFDI 4KHZA 1QUQB 3PUWA 1YBYA 1C0AA 4R1JA 4YHHL 1FL0A 4A3BH 2H5XA 2AWNA 4GNXB 4DAYB 2JEAI 3F1ZA 3S1QH 3VDYA 5HGQA 1YITA 3J80i 3A5ZB 4PZ6A 3A5UA 2IY5B 4OO1I 1VQAA 5GAEC 4ME3A 5JEAJ 4A3GG 3F2CA 3HOXG 2PQAA 3S2DH 4C3JH 3CF5A 1P16A 1UE5A 2MNAA 3EN2A 5IP9G 4BA2I 1NE3A 1X3FA 2PMZE 2JQOA 1H95A 3M9BA 1K73C 4DV6Q 4X64Q 5K36G 2IT1A 2PI2A 2CWPA 4B3MQ 5IYBG 1K3RA 2QEXA 2R7ZG 3UDXA 1Q81C 2Q2TA 1V1QA 3ICEA 1IZ6A 4PMWA 4DUYQ 1NMFA 2VS1A 3RR5A 1PH3A 3M4OH 4BBSG 4LF9Q 4A93H 1PV4A 2NVQH 1VQKA 1A0IA 3GO5A 1NTGA 3S24A 1CUKA 4UP8A 4GOPC 3CCRA 4A3MG 4R4IA 3U4VA 3EIVA 1GVPA 2UXDQ 1VQPA 4DKAC 1IBML 3H0GH 1XMQQ 2K5HA 1N36L 4LF5L 2UXBQ 1KAWA 2DUDA 4OXPA 3CCQA 4DV7L 3CMAA 2K5NA 2Z6KA 3KYHC 2F4VQ 4DAMA 2WAQG 3FKIG 3TQYA 4R4QA 1XTDA 1T9HA 1VQEA 3GTKH 4GLVB 4IPHA 4JI7L 5M5XH 2OQ0A 4LW1A 4B3TL 2MQHA 1MJCA 2B3GA 2VY3A 4R4OA 1VQ4A 2NVYH 3UDGA 1Y1VG 2JA7H 4A3EG 2JA5G 3I4NH 2K5VA 4UPAA 1CKNB 3M4QA 1Z47A 1Q7YC 4A3FG 4BY1H 4DR1L 3BJUA 3S2HH 1G291 1HNWL 3CP0A 3I56A 3OW2A 1V43A 1E1TA 3PO3G 1N34Q 2KHIA 3ZJYC 2IHEA 3PUVA 4B3SL 3NENA 4IJHA 1WJJA 4OWXB 5GROA 2F52A 4JBWA 1X9NA 2R92H 5IYDH 3RLNA 1LYLA 2KCTA 3ER0A 2VZAA 1OXVA 3TEHB 5M5WH 3UDFA 3AEVA 2K4KA 4QY7A 1HNZL 5IP7G 4BXXG 1Q1EA 4HIDA 4JOIA 4L5TA 4DV4Q 3U50C 4L5QA 1SN8A 1E22A 1VQCA 4DR7L 2NZOA 3NELA 3A74A 1L1OC 4OONA 2WB1E 2E5LQ 4X65L 4WJ4A 2KHJA 1E1OA 3D0FA 2GN5A 1U5KA 2PNHA 2QGQA 4JI1L 4LFCQ 1IBMQ 2YV5A 4P73A 4NXNL 1N36Q 1VQ5A 4LF5Q 4DR4L 3KF6B 1G51A 4P75A 1IBLL 4DR3L 4DR2L 3I7FA 1VQLA 2JA8H 2B29A 4YY3L 5C44G 4IPCA 1Q1BA 2E2JH 2OWOA 4DUZL 4A3CG 1WOCA 3PIOA 4B3TQ 2YYZA 1VQMA 5JJKA 3U4ZA 1IL2A 1X3GA 2VQEL 4LF6L 1SLJA 4OO1G 4HJ8A 1V9PA 3BZKA 3W5OA 4EX5A 1OTCA 1S72A 2ZTEA 4PG3A 4DV0Q 4DR1Q 3HKZG 3UE1A 1LTLA 1HNWQ 5J3BA 4C2MH 4GN3B 5M3MH 4A3KH 3KLWA 3I2ZA 4B3SQ 3EBEA 3OYYA 4IPGA 4A3DH 1K83H 1UEBA 1Y1WG 4DV3Q 4GN5A 2BA0A 2N78A 4QGUA 2UU9L 4LFAQ 1HNZQ 4LF8L 2UXCL 3S1MH 1HZCA 5M3FG 4LF7L 1E24A 4C3HH 1J5EL 2OTLA 2RHSB 2XGTA 4JV5L 1DGSA 1NMGA 3G4SA 4B3RL 3M85A 5C4XG 2OCEA 4P74A 3GTLH 3T1YL 1S3OA 4PZ7A 1MJEA 4X65Q 5IT9c 2UUAL 3GTPH 1VS0A 4HIKA 5LMNL 3HOVG 5C0XI 2ZJQA 2EIFA 2K75A 4NXNQ 1N32Q 4QIWE 3S14H 2RF4A 3J81j 4DR4Q 3B6YA 1IBLQ 1A62A 4DR2Q 3S17H 1PH5A 3PCOB 2JA6H 2N3SA 2VL6A 3HOUG 5GQOA 2E2HH 1EOVA 5GAHC 2YU9H 3HOZH 1I6HH 5IYCH 1KIXA 1VQJA 2Y0SE 4GKJL 1JT8A 1GD7A 1C7YA 2K14A 1XNRL 4JG2A 4NXML 2I5LX 4QJFA 2VQEQ 5FJ8G 4LF6Q 3NEMA 3PIPA 5FLXc 3F2DA 1Y14B 1TWGH 3S1NH 3L7ZC 3E9HA 5IY0A 1K8AC 2B63G 1BKBA 1KC8C 4A3IG 1CKMA 5C3EG 3I4MG 4BBSH 4IFDJ 4Y7NH 4LF4L 2HHHQ 4RMFA 1XMOL 2R93H 3LGJA 1PH2A 1OXXK 3DM3A 4DR6L 1CSPA 1UE1A 2R6GA 1RIPA 5EAYA 4AIMA 3KF8B 3HOWH 1CKOA 1IXRA 1CSQA 4HIMA 1QUQA 4P71A 1W2BA 2UU9Q 1P8LA 1Z9FA 3W1BA 1B7YB 1X6OA 1X56A 3K8AA 4GLXA 1VQOA 1ASYA 4LF8Q 3G6EA 4GNXA 1J5EQ 1IBKL 1HR0L 1AE3A 3CD6A 4JV5Q 3G71A 4B3RQ 1HH2P 4IPDA 1MKHA 1EQQA 3KFUA 2RHQB 2HIVA 2VUMH 5JJIA 3T1YQ 3Q8DA 3PO2H 5ELNA 2A19A 4DV2L 1G6PA 2D0PA 1KQSA 5LMNQ 5H1SE 2PI2E 1K0RA 1SRUA 1NY4A 1SR3A 4OWTB 4BBRH 3CAMA 4TVAB 2ZM6L 1K9MC 4JI4L 4YHHQ 4OWWB 4IO9A 2KENA 1EWIA 1UE6A 4GOPB 4O0AA 4ALPA 4GKJQ 5AJ3L 1XNRQ 4KLKA 2UUBL 2R7FA 4NXMQ 3H3VI 4BA1I 4LWCA 1GM5A 1BBWA 2WFWA 4YWLA 2Q2UA 3GTMH 3JAMi 4BXXH 4A93G 2ZTDA 1K8GA 1KHIA 1SMXA 1SFOH 1PH4A 2JEBI 3TRZA 3M7NA 1HNXL 4LF4Q 4DR5L 2EQSA 3ULLA 3PF4A 4POGA 3HKSA 3KDFB 2YTYA 1L0WA 1OXTA 4DR6Q 1PA6A 4IJLA 4KI0A 1U0LA 2CFMA
chains in the Genus database with same CATH superfamily
3CQZB 1Q8IA 3PUZA 4JI8L 3J7ZC 2EXZA 2Z6BA 3W2DA 3UE0A 3HP3A 1C8CA 4EQPA 1SNOA 1KTKA 2SNSA 1HR0Q 3CC2A 1PZJD 1CZGA 1DONA 3H94A 2KEDA 1PH6A 2KECA 2JXMB 4IFDH 1EIFA 2JA7G 1CKNA 3MWYW 1WFQA 3C46A 1HCZA 3RNUA 3J80c 4X3KA 4QL5A 1X65A 3K5LA 4LAAA 1SFOB 5M5YB 1HZ9A 5J22A 2F3VA 2R92G 5IYDG 2X6GA 1T5EA 3ERQA 3TN2A 5ELOA 2OQKA 3MEFA 4JI5L 1H9RA 2KJXA 2N49A 2UUBQ 5JEAG 1EQRA 1EY5A 2NWGA 1YJWA 1FNWA 5FLMH 2IHFA 3A8KE 1C48A 4KK7A 4XDXA 2F0VA 3VYTA 5IIFA 5C4JB 4HIOA 4A3JH 3RZOB 3O13A 4CKEA 2NN6G 2GVBA 3L2PA 3MFGA 2SEBD 3K5NA 2F0FA 2F0QA 2K04A 4NMZA 4K0KL 2UUCL 4IUUA 4C3IB 3K7AH 1YJ9A 2EOTA 1PRTC 2L15A 2E2IB 5DEHA 4I65A 1VQIA 2HQLA 4DK6C 2EXDA 3BYYB 2M9VA 1VQ7A 2CQAA 4JBKA 1G8ZD 4C1NI 1JMCA 1IYJB 1EU4A 3NP8A 3L9AX 4YY3Q 2PQAB 3K5MA 3RMHA 3I4MH 1V8QA 1QZHA 3L0OA 5IYBH 3MXGA 2YTXA 2Z6KC 4CKCA 3PIO3 4JI5Q 3EQLC 3HOYB 1HR0W 4XQNA 4JI3L 3HOUB 4A3MH 4O2DA 1D5XC 2NN6I 1TWHB 1JICA 3W1GA 1A63A 3K80C 3URYA 2I0QA 3E0EA 4DNRB 4DPGA 1JB3A 3GTOH 2UXCQ 4K0KQ 2UUCQ 1WVLA 2JA6G 1Q46A 1D8LA 3EVQA 2F03A 1E7ZA 1NAPA 5GAGC 1PFBA 4HEDA 5KEEA 1SROA 1YHBA 2UUAQ 5HY6A 4K14A 1Y1VH 2Q2HA 5EKKA 2KUMA 5CBAE 3CQZH 4QB4A 5IE8A 1CT1D 2F0SA 4EQOA 4DV4L 4JC0A 3U9OA 3J81L 3KJOA 5CC4A 3CRKC 2Z4HA 1HJPA 2VQFL 4FNFA 4YWMA 2PZTA 1RJTA 2ZJPA 4KHVA 3K57A 1KD1C 4LFCL 4CBVA 3WOEA 3E9IA 1M90C 4FF4A 2NVTB 2EJGC 1BVSA 1R9TH 2AQ2B 2RQXA 5M5YH 3CCLA 1BXTA 2JSOA 1STEA 2LXKA 4JI3Q 3BVZA 3GTGB 3BYTB 5I6YA 2K6AA 1WTQA 3DWQA 1OXSC 4GN4B 4UP9A 3KOJA 4DV5L 5G3LF 4BBRG 2L0CA 2F0HA 4PZ8A 2DY8A 3NPPA 4RKLA 4GKKL 2I5MX 2OXPA 2WKDA 3WOFA 4C3IH 4RHSA 2WACA 4K2KA 3DEPA 3GTQB 2LKVA 2VQFQ 3SK6A 2RSNA 1YEZA 4NKLA 2D62A 2AKWB 4S3SA 4JCVE 2V1CC 1E2WA 2HCCA 5DAUA 4A3LH 3OW7A 3SK5A 2F0MA 1ILQA 1MIUA 2Y0SG 4IFDG 4NPSA 2KCMA 3M3YH 1KDCA 2JJQA 2RA4A 1BR9A 4IUTA 4HJ5A 1F77A 1QE6A 4H02A 4FF1A 2DNCA 3SXHA 2MP1A 3T1HQ 4DV5Q 1SYGA 4R4CA 3S15B 3GP7A 1I5FA 3ERSX 2L1BA 2G5DA 4B3ML 3TMEA 1Y1WB 3I4OA 4GKKQ 2BE5D 1Z7TA 3MA2B 4DUYL 4ABNA 2D0OA 5FLMG 4A3DG 2PMZB 1IKMA 1JJGA 1Q3LA 2B8FA 1B2TA 1ZEQX 2EZVA 1RTNA 4A3JG 3EA6A 1SE8A 2HT1A 3JAME 5C0XJ 1BCPD 5D65A 2PYKA 4CDFC 1NJIC 4V190 4J6HA 1WCMB 4IFDI 3BVMA 1EWCA 1C0AA 5CORA 4C2MB 1FL0A 4A3BH 1SBBB 1H9MA 4DAYB 2BDOA 1RODA 5BN4A 5HGQA 2IY5B 1K83B 3A5ZB 1B9NA 4OO1I 1D5MC 4ME3A 2PQAA 1X32A 3A55A 2QEJC 4C3JH 3CF5A 1UE5A 1H9KA 1A2UA 2JQOA 1B3AA 1H95A 3UI2A 4B3MQ 4IUPA 1G2TA 5IYBG 1K3RA 2QEXA 3W3AA 3AB9A 1Q81C 4QF4A 4PMWA 4DUYQ 4BY7B 4G7HC 3M4OH 4FF3A 4LF9Q 1B3QA 5JPNC 3GO5A 4A3MG 3S1QB 5FO8B 1VQPA 4I7ZC 1IBML 3H0GH 1XMQQ 2K5HA 1EYCA 2DUDA 4OXPA 2K5NA 2E74C 3CKIB 3GTKH 3GV3A 4HAEA 4IPHA 4JI7L 5M5XH 3FDTA 1S5DD 1D1IA 4R4OA 3OSOA 1Y1VG 1F9RA 1B53A 3T16A 3I4NH 2EDGA 5EPLA 1I4HA 4LJZC 3L3OC 1BDOA 5CV6A 3OWFA 3J81E 1G291 1UAPA 4QUFA 3OW2A 2NVQB 2B2VC 2C9OA 2IHEA 5EPJA 1PRTD 4IJHA 5GROA 2FINB 3J80L 4HMIA 4XQJA 3RLNA 1LYLA 3ER0A 2KCTA 1OXVA 3OIPA 1JCKB 3UDFA 1SAPA 2NTSA 5CR3A 5JVG3 1KABA 3D4DA 4DR7L 2JYOA 5JJZA 2NZOA 1SMYC 1IW7C 2A6HD 2EY5A 1Q90A 4J1MA 2K01A 3VYUA 4RGNA 1MSHA 3LWEA 2JA7B 2KHJA 1E1OA 1M8AA 3OMGA 2GN5A 1QWYA 1IBMQ 2YV5A 4P73A 4DR4L 5EKIA 1G51A 1IBLL 4DR3L 2B29A 1I4GA 2WIIB 1Q1BA 2XRQD 5F2DA 4DXGA 2YYZA 1VQMA 5JJKA 1A3TA 2A69D 1JOQA 1IL2A 2VQEL 4LF6L 5CV5A 1DJRD 1V9PA 4C3IG 2ZTEA 4RH6A 2ENBA 3OMCA 1PTOF 1VMCA 4C2MH 4GN3B 3KLWA 3I2ZA 3OYYA 1K83H 1UEBA 2K33A 1SNCA 1TIID 2DY7A 3TZDA 2N78A 4LFAQ 4KMUC 3R3OA 1HZCA 1E24A 1CHPD 3G6JB 4C3HH 1WTHA 1WTXA 4C56C 3I90A 4P74A 2PO4A 3T1YL 4K2LA 1S3OA 4H13C 2ZJQA 1F2MA 2VB3X 4QIWE 4DR4Q 3J81j 3B6YA 1IBLQ 3S17H 1PH5A 3HOUG 3HOZH 1EOVA 4XYOA 3J7AF 2Y0SE 3NTKA 4JG2A 4UHVA 4NXML 3DUZA 2VQEQ 4LF6Q 3NEMA 3PIPA 2EYMA 5FLXc 3F2DA 3S1MB 1TS2A 3E6ZX 4V0BA 1U9RA 1K8AC 1B44D 2X69A 2V4DA 4Y7NH 2HHHQ 4RMFA 3GTLB 5C3XA 3DM3A 1HUMA 1UE1A 2R6GA 1RIPA 5EAYA 4IURA 4TSSA 2XIWA 2XWBB 1P8LA 4GLXA 1ASYA 1VQOA 1X56A 1I4PA 5CV4A 3BS1A 2JA6B 2E2HB 4DAYA 1AE3A 1HH2P 1MKHA 3ITPA 2RHQB 2VUMH 3T1YQ 3PO2H 5ELNA 1KQSA 4HR7B 1TWGB 2F0LA 1R4PB 2PI2E 1JOKA 2EVBA 1PDQA 2ZM6L 4JI4L 4TVAB 4YHHQ 4B9WA 1SYCA 5AJ3L 4NXMQ 1EQVA 3HRZC 3VA7A 4YWLA 2KEEA 2I46A 4OL7A 3JAMi 3GTMH 2WAQB 1PTOH 1PH4A 2DJGC 2JEBI 4OGQC 1G6ZA 3ULLA 2K5DA 3KDFB 5CV8A 1U0LA 2CFMA 1PH9A 5LL6X 4HJ7A 1S40A 4BBRB 1PH7A 2B2WA 4JI0L 3CPWA 3CMEA 1GUOA 4A3CH 3SR1A 3AMUA 4JI6L 5HURA 1D5ZC 5C0XG 2A8VA 3PF5A 1ASZA 2EY6A 2K52A 4OEMB 4ZAIA 2ZM6Q 1K0SA 1A6XA 3J80E 2HCIA 1Q8KA 1NBWA 1RD9D 4G7OC 1ZYRD 2HDLA 3TDQA 2HQEA 4LUZA 1SJED 4RGTA 4QIWB 1QOHA 4CHTB 1E3PA 3K0XA 4PQXA 4RFBA 1OXUA 2E8GA 2Q2IA 2AQ1B 1KNAA 1JJ2A 2XRSD 2F0IA 3FEWX 3FVQA 4ZLTF 3GV6A 2EYOA 4RGMA 3G7LA 1JJCB 1II3A 3HKZB 3J81i 1QJOA 4ID6A 3R93A 2CQOA 1QZGA 3K81C 4FP5D 4JI1Q 3ND8A 3BU2A 4LMQD 2DGYA 1BBUA 3DLLA 1WCMG 1W3SA 5FJ8H 3K7UC 3AQQA 3TS0A 4DUZQ 3KJPA 1F2YA 2JK8A 4A3JB 4OX9L 3PQIA 5EBDA 2R61A 3H91A 2UXDL 5D14A 1UWVA 4GS3A 4KD3A 2AQ3B 2ALYB 4HJAA 4RCNA 3VA5A 4C3HG 4DAVA 2Z0SA 1HUNA 4F88A 2IX1A 3A56A 2E76C 1VQ9A 1H9SB 3NK9A 3QWNA 3V96A 2RBMA 4BY7G 1TS3A 1S5FD 1RKNA 4IQZA 4UDUC 2F0TA 2MFIA 2FMCA 1XTCD 1BUVT 1FYCA 3DWPA 3HOZG 2BE5C 1FGUA 1VCIA 2AUKA 1X54A 4K5WA 3I4MB 1D2BA 2NUCA 1WD1A 1IW7D 3HZXA 2KBNA 4HN7A 5KGUA 4A76A 3NE5B 4JOIC 4DK3C 1LV9A 1D7QA 2XN9C 5EQ0A 2B2WC 2EY1A 3WWVA 3PO3H 1CA6A 3Q6SA 4A3MB 1VQFA 3CCEA 1BCPC 2E5LL 3D6WA 4OX9Q 3GTOB 2AWOA 1N8RC 3S2DB 1IHZA 4DV1L 1NR2A 4TKOB 1TWFH 1B70B 3PIP3 1D6EC 1XMOQ 2VUMG 4RGOS 3PO2G 1Y1VB 2ID0A 1FNUA 4DXFA 4ME5A 2BH8A 2C35B 2VNUD 2M00A 3GQBA 3HG9A 2J0TD 4CJ1B 1HFNA 2CKZB 2F3WA 4ZKCB 5EKLA 4GZYC 5BN3A 4LUVA 3QB3A 1KDBA 4OO1H 1R9TB 3CCSA 4DNIA 4L5RC 3RLFA 2HD3A 5FOBB 1WI5A 4U68A 1QVFA 1KL9A 4WRDA 3KDFA 1XPOA 4A4IA 3I55A 3R2TA 2F0UA 4G4KA 4YWKA 1VQDA 4KHPL 1X3EA 5EPKA 2K50A 2KOLA 4DV1Q 5M9OA 3RN5A 1KLUD 2MO1A 4CJ2C 2DJFC 1ONLA 3NSWA 1HTPA 4MHEA 3P7JA 3U9SA 4JI8Q 2MHVA 2NVXH 1I6VC 2H1EA 4ILWA 4EVOA 1STHA 1EY7A 1O7ZA 2KQ3A 2L55A 1CM9A 3CC7A 4EQ5A 4POFA 4PV1C 2A6HC 5ISRA 3H3VH 4FYDA 5G3LD 1G91A 2L4NA 1I4QA 5KIXA 3M3YB 5FLXL 4OHJA 3QOJA 1TKWB 3STBD 1Y8PB 3M4PA 1U4LA 3E0JA 4KHPQ 1GUTA 1LUZA 4ZRZA 5T1IA 4KHZA 1QUQB 2A69C 3PUWA 3QIAA 4X3SA 2H5XA 4GNXB 2JEAI 3VDYA 4KJOA 3J80i 1YITA 3A5UA 1WTRA 4XXEA 5GAEC 3J7AV 3NWTA 3S2DH 2L5TA 1P16A 3V2TA 5IGFA 2QDBA 1ET9A 1SYEA 2PMZE 3SHLA 4MIUA 2IT1A 2PI2A 5IGGA 2Z4IA 1O80A 2L12A 3FPUB 1EIHA 1DZ1A 2PCFB 2F1MA 3S14B 4A93H 4IUNA 1PV4A 3C1EA 1VQKA 4A3BB 1A0IA 1H9SA 1NTGA 3S24A 3CCRA 3U4VA 1HFGA 3NHHA 1N36L 1STGA 5I6WA 4DV7L 2BCOA 3BZDB 3NUCA 4C3JB 4DAMA 2WAQG 4R4QA 1VQEA 4LW1A 1EY8A 1VQ4A 4KN4C 1XYIA 2K5QA 1Q7YC 4L8JA 3BJUA 5IGCA 3S2HH 3M4OB 3CP0A 3I56A 1HNWL 4LK1C 1E1TA 2O5IC 3PO3G 1M4VA 4RAUC 3NENA 4H7BA 3BG3A 2F52A 4JBWA 2AUJD 3H0GB 4FVMA 3AEVA 4QY7A 1LABA 4JW0A 1IYVA 2X6LA 4L5TA 4DV4Q 1EY6A 4L5QA 3U50C 3GTKB 1QG7A 1SN8A 1VQCA 5M5XB 3NELA 1CFMA 5ELEA 3TSSA 5L37A 1HPCA 3I4NB 4QMGA 1JC7A 1U5KA 2QGQA 4LFCQ 4O42A 3SE0A 4NXNL 5CGKA 1N36Q 2NYZD 1GUWA 1EU3A 4DR2L 1VQLA 2JA8H 5E4WC 1U4MA 1PMRA 1WOCA 2Q8RE 4DFAA 4IZ8A 4Q0FA 4U673 1O78A 4ULLA 4OO1G 4KY7A 2OT2A 3BZKA 3W5OA 1AEXA 4EX5A 3C2PA 1GHKA 3HKZG 1LTLA 1HNWQ 5J3BA 3IFDA 4A3KH 3S16B 3HS0C 4G7ZC 4GN5A 2I07B 4PMCA 4OIKA 3TP7A 4FXDA 1DM0B 1C4QA 4LF7L 1CZWA 2IL8A 4JV5L 4B3RL 1FGBD 3M85A 4ZKBB 2NB0A 4WJWA 3GTPH 1VF7A 1VS0A 1RF2D 1SXTA 5LMNL 2EIFA 2K75A 4NXNQ 2EYPA 3S14H 2RF4A 1A62A 1ZYRC 4DR2Q 3PCOB 3T4AC 2N3SA 2VL6A 2YU9H 1RTOA 5GAHC 1AFPA 5IYCH 1VQJA 2K7VA 3D4WA 3M7GA 4I7AA 1C7YA 2K14A 1XNRL 2I5LX 2MUYA 5IODA 3P1HA 1S4ZA 4HMJA 1MI2A 1Y14B 5IY0A 4FXKC 4C3HB 2O4XA 2ZXPA 1BKBA 3DWAA 5ELCA 3V05A 3I4MG 4BBSH 3S1RB 5FLXE 2R93H 2NBFA 3LGJA 1OXXK 4DR6L 4E6IA 1KNEA 1LLRD 1AP0A 3C1FA 5TSSA 3HOWH 3KF8B 1CKOA 1CSQA 1QUQA 1FD7D 1W2BA 3S17B 1TT2A 1JQYD 1W6JA 3HOZB 1EYAA 4GNXA 1IBKL 3VR4A 4JV5Q 4B3RQ 1CQFA 1SEBD 3KLRA 5JJIA 1A15A 4N8X1 1L0YB 2A19A 4DV2L 2F0PA 2D0PA 2RDGA 5LMNQ 1MHWC 4B9XA 3MEHA 4X3TA 2ZXOA 3KBGA 1SRUA 2K32A 4OWTB 3FPPA 1JOOA 5E1FA 1ZKOA 2MGSA 1K9MC 4Y7NB 1B4OA 3KLSX 5EGTA 4ALPA 1SYDA 1XNRQ 3NXWA 2R7FA 3H3VI 4DA2A 1TY0A 2WFWA 2D9UA 2Q2UA 5DM73 4DAPA 4A93G 4BXXH 2ZTDA 3I4LA 5D3IB 1KHIA 2H4OA 1DD2A 1LTAD 1EY0A 2VUMB 3PF4A 3PO2B 2YTYA 4XYQA 4DR6Q 3M4YA 4KI0A 1GHJA 4A3EB 1GOZA 1LTID 4QCLA 4R8IA 4B08A 3S16H 2A74C 2AHOB 4HSVA 1STNA 1JR0D 3K58A 4DV2Q 4KN7C 1TS5A 3GTMB 1PTOB 2WAQE 4JI7Q 2SDFA 2K05A 1TU2B 1SNQA 2ES2A 1L1OB 4ZCKA 3MHBA 3CPFA 2CW0C 4X66L 5I9PA 2MJ8A 1DOMA 5CBEE 1EFID 1N9WA 2A1AA 1EIYB 3BDOA 1GJXA 1FVIA 2I5HA 3ULPA 1TXYA 1F2ZA 1TWAB 3Q23A 1T5XD 1DOKA 2QF7A 5AFWA 5LMNW 1I3QH 3RZDH 4A3LG 1TWCH 4NB3A 3DM1A 1AZQA 4TRDA 2F3IA 4DR7Q 3PSIA 4PNYA 2TSSA 3S1RH 3DHQA 4M1UB 1JWMD 4LFBL 4DV6L 1QNUA 3GDEA 1O7YA 3PUXA 4MN3A 4JI2L 4A3GH 3RN2A 4DR3Q 3HOXH 4A3KG 1VQBA 2EJFC 1ZXTA 2YTVA 5C4HA 2BA1A 3JAMc 5K36H 3NBIA 1STBA 4X66Q 1PH1A 2F4VL 1LTGD 1LT6D 1E0BA 2CHBD 3LWUA 4MTKA 1CA5A 3HFZB 5K5PA 1EFWA 1LTRD 1QVGA 2HIXA 4MNOA 3HKZE 1PRTF 1DXMA 2A68D 1WTOA 4KY5A 4NDXA 4KKTA 1AE2A 1I94L 1GUNA 3N52A 1BBXC 1GXDC 1PYWD 3EFXD 2BDNA 3FKIH 1VQ6A 3H15A 4A3BG 4XTCS 5IGDA 2N8NA 3RUZA 5IYCG 1N34L 4A3IB 1TR5A 5JVH3 3T51B 1HZAA 1XNQL 2R7DA 4LFBQ 4K8JA 1F9PA 4C3JG 5D3DA 4A3EH 1I50H 4JI2Q 1A3UA 1U4RA 3FHWA 4ZYSA 2EYLA 5DLQE 3RD4A 1VQHA 3CXCA 3K59A 1LTTD 3EJIA 2R93G 3IRBA 3STBC 4AYBE 2F0OA 3KF8A 3HOWG 1S5CD 1XXGA 1O7IA 1RCVD 4LUOA 4JBMA 1XX8A 5IGEA 2CWAA 3H0GG 4BWGB 1XPRA 4L6TB 2K03A 4PMBA 3J81c 1CI3M 1I94Q 3TP8A 1QCBD 4OIJA 1X55A 1ICWA 2LSSA 3I73A 4DV0L 3CHBD 3PO3B 1QVCA 5KYIA 2PPBC 1TWAH 4YIJA 1LO5D 4KJNA 4UY8C 3PUYA 3I4NG 3OHXC 1XNQQ 1KAAA 4DV3L 5NUCA 3ULJA 2FHTA 2L11A 1BNZA 1F9QA 4JI4Q 1SYBA 1TWFB 4A75A 3IKJA 1LACA 4XIGS 2IJ0A 3X3NA 2ZXRA 1Q12A 1L2FA 1ENAA 5EBCA 5AJ3Q 1Z6HA 3KLSA 1XPUA 3HGBA 1BO0A 3OTOL 4DK1A 4ZUJA 1N32L 1ENCA 2EE1A 2EJMA 1VQ8A 3J7A5 1HZBA 2GVAA 2K5WA 2PW7A 1RL2A 2Q8IB 1YZ6A 2LY7A 4ZUIA 3D31A 2PW5A 3PV0A 5FO7B 3CC4A 3CCJA 1SNMA 1VQNA 3A0JA 3K6OA 2KCCA 4JI0Q 1AW7A 2VW9A 1J6QA 5IGBA 1L1OA 3I3CA 3A8IE 4EQNA 3MXNB 3VR2A 4JI6Q 3MFYA 3IL8A 3BZCA 3TP5A 1Q82C 2O2LD 1BF4A 2C5CA 3R2IA 2B63H 1NUCA 4A3IH 5C3EH 1PFNA 4IOAA 1A3VA 3FMCA 1A8VA 1HXYD 4F87A 1MGSA 2NVXB 1KRSA 3OTOQ 4DN4M 1IL8A 3WDNA 3AYHB 4JK1C 1EY9A 2KVMA 4L5SA 3A54A 5C5MA 1YBYA 2RDHA 4AYBB 5I9OA 5M3MB 2HUGA 2JP1A 3NQIA 4A3GG 3F2CA 3HOXG 2F0NA 1CQVA 2R3ZA 4CKBA 3LNNA 3FRPB 1NE3A 1R4QB 3KBXA 3M9BA 1K73C 5K36G 1TS4A 1F2LA 2CWPA 3UDXA 2QCPX 2Q2TA 1S5ED 1V1QA 1DCZA 1JORA 1NMFA 1PH3A 1W6KA 3ND9A 4UP8A 1KDAA 1KLGD 2B2TA 4R4IA 1GVPA 1QB5D 2UXDQ 1EIGA 4LF5L 2CH4W 1KAWA 3CCQA 3NQTA 2CW0D 3CMAA 2Z6KA 3HEJA 2L9HA 2RSOA 3FKIG 3TQYA 2RVLA 2Z8LA 1T9HA 4GLVB 5C4ZA 5I2YA 2OQ0A 2MQHA 1MJCA 2A5HA 3E5SA 4XQQA 2VY3A 4A3EG 3F2UA 4UPAA 1TY2A 3M4QA 4KTAA 4BY1H 2F0KA 4DR1L 1NSNS 4A93B 1V43A 4UAIA 3ZJYC 1WJJA 4KKSA 1TQOA 3K0YA 3P20A 4G57A 4RKBA 2F0GA 2VZAA 3E3XA 2OEOA 2K4KA 5I2XA 1HNZL 1Q1EA 2WV6D 5KNCA 1PTOC 2B39A 2ZT9C 1E22A 2SNMA 2WINB 1L1OC 4OONA 2E5LQ 3TP6A 2A73B 3D0FA 2PNHA 4LF5Q 1VQ5A 5E4XA 3S2HB 3KF6B 2BOSA 3I7FA 4YY3L 3SK8A 3TBIB 2B2YA 2E2JH 4A3CG 2OWOA 1LTSD 4IALA 3U4ZA 1X3GA 2VXWA 1SLJA 2B8GA 4K8IA 1OTCA 1EWHA 1MBYA 4PG3A 3Q0AA 4DR1Q 2O5JC 3UE1A 4K5VA 5JAVA 3TZUA 5M3MH 1X3PA 4A3DH 2IX3A 3DMUA 1PZKD 2GA4B 4XT1B 4C1NK 2UU9L 4QGUA 1HNZQ 2JA8B 2UXCL 2D5DA 3JAML 1J5EL 2RHSB 3MXUA 1IKLA 1EL0A 1DGSA 1NMGA 3MTSA 3G4SA 4OELB 2FJ2A 2OCEA 1GUSA 5JOBA 1BQQT 4PZ7A 2FFKB 2UUAL 5IT9c 1NCVA 5FKAC 4HIKA 1CK1A 1J8IA 4A3KB 1LT4D 3MXNA 5CMDA 4K6DA 4RA8A 1I6HH 1V1PB 4WFN3 1PFMA 4GKJL 2B2TC 1GD7A 4RCOA 2DN8A 4QJFA 5FJ8G 4K5XA 3S1NH 2B63G 4A3IG 5C3EG 4H0LC 4LF4L 1UNSA 2P5ZX 2VB2X 2LS01 1CSPA 3GTPB 3IFTA 3OWEB 2UU9Q 4HIMA 3W1BA 2QILA 1B7YB 3K8AA 2XVSA 2YU9B 1J5EQ 1ICFB 1A2TA 3CD6A 4CDCC 3G71A 4IPDA 1EQQA 3MC0B 4RWSC 2HIVA 3A7AB 3Q8DA 4BS9A 4X3UA 1NNXA 2K1BA 4CJ0B 5BN5A 3GTJB 1LT3D 2NZ1D 5H1SE 2R7ZB 2RDFA 4KY6A 1K0RA 2KCNA 1CTMA 3PMFA 4BBSB 2R93B 4IO9A 2A6ED 1B1ZA 1UE6A 4GOPB 4O0AA 4GKJQ 5LL6S 1VMPA 3A8JE 4KLKA 3HOWB 3P75A 1PZID 3D4RA 2A68C 2SOBA 1K8GA 1SFOH 1SMXA 2B2YC 1HRJA 1HNXL 4LF4Q 4DR5L 5DM63 4POGA 1L0WA 2IWHA 4DGZA 1YNNC 2JA5B 1SYFA 4KV6A 1HTLD 1PYBA 4A3FB 3T1HL 1C9OA 4FDBA 1ESFA 2OTJA 1AZPA 4JYAL 1PXUA 1EY4A 5GADC 3F2BA 2ZTCA 2PZWA 5C4JH 1Y8NB 1PHJA 4DV7Q 4WJ3M 3Q24A 4BY1G 3RZOH 1B9MA 4P2CB 1UEAB 4NP5A 1YIJA 2QA4A 3CW2C 4YCVA 1N33L 5IWAL 2E2IH 2ZJRA 5E7NA 2JA9A 3AFQA 1JWUD 4J15A 2IX0A 1UE7A 2MPMA 1GO3E 3AFPA 2MO0A 3H6MA 2ATWA 3TREA 2B2VA 5C44B 2RCNA 1HNXQ 4DR5Q 1XJVA 5KYLA 3KF6A 3KUPA 4O1NA 2IW3A 3T56B 4J8QA 2LXJA 1QNKA 3CCMA 3HOYH 3MVVA 1EZ6A 4LNQA 4M8AA 4JYAQ 3G48A 3HOUH 3U58A 3H09A 4Z9CB 1TWHH 4GLAC 5CV7A 4AH6A 3PGZA 1Y69U 4AYBG 4LF9L 5DNFA 5IP9H 1YNJC 5M3MG 5M3FB 2KHSA 3MXPA 1BOSA 5BR8L 4HCSA 1N33Q 5IWAQ 4HTHA 3RLOA 1XWEA 3SVMA 4X6AH 1YI2A 1I3QB 5C4XB 3RZDB 3GTJH 1XMQL 1GUGA 1TWCB 2R7ZH 3H3VC 4YCUA 3HOVB 1YJNA 4AQYL 2AMCB 4IUVA 2B2UA 1QILA 4RG1A 3FP9A 1MD2D 5LHY1 3NTIA 3TS2A 1VDZA 3IAYA 2KA7A 3SEBA 4A3GB 2E2DC 3VR6A 3HOXB 1JWSD 4LF7Q 2NVTH 5FO9B 1PTOD 1V1PA 4XT3B 1ENFA 4FXGC 3N6RA 1EUJA 3GTGH 1LT5D 2JA5H 5C3WA 2BH2A 4CDDC 2NTTA 4A3FH 1WYDA 1EQTA 2EY2A 4DF7A 2WB1G 1PFSA 1RHPA 3NWSA 5KRUA 5BR8Q 2G9DA 3JC66 5JJLA 2D2CC 3GD7A 4R4TA 2JE6I 5IP7H 2FXQA 2EYJA 3FKIB 1MSGA 1LM0A 4AQYQ 1FJGL 3I72A 3F8TA 1WTVA 3GTQH 5KNDA 5LMUL 3C3LA 1I50B 1YVCA 3CCUA 1BCPB 2PQEA 1PLFA 2CVRA 1PH8A 2N88A 5T1GA 1YNXA 5C0XH 1IBKQ 2XTIA 1G2SA 1I4XA 4L63B 4GOPA 2CH4A 5C44H 1LTBD 3EROA 1SE3A 2QDLA 1BCPF 2EYFA 4MTNA 4HJ9A 2F0WA 4LFAL 1K8OA 2XSCA 4KD4A 1EYGA 3QR8A 3S15H 4JVZA 1SSOA 3QJYA 5ELBA 1Q86C 1YHAA 4QQBX 3BDCA 4N8FA 2K28A 3QG1A 2F4IA 3NBHB 4X62L 1Y1WH 2NVYB 1B50A 1NR4A 1EEFD 1FNVA 3D6CA 3T13A 1JE5A 4APVA 4DK0A 5M3FH 3VR3A 4DNTB 1KXLA 1FJGQ 4CDEC 3OIQA 3CCVA 5C4XH 5LMUQ 2R92B 2XWJB 3X3MA 3UDIA 1EEID 1S5BD 2JA8G 5M5WB 3SGIA 3HOVH 1M1KC 3DEOA 3BVGA 1WCMH 2Q8TA 5IT9L 2WP8J 2B2UC 5KNBA 4X64L 2FMMA 2HHHL 1K3BC 1GKHA 4JBJA 5E3FA 4IN3A 2NZHA 4UP7A 4EGVA 1PYSB 5ELDA 1AN8A 4TQUS 1TVXA 1AH9A 2ASBA 4GNXC 3I91A 4ZK9B 1PVOA 1ET6A 4P72A 1PRTB 1B8AA 1K8MA 3I8ZA 5CYUA 1STAA 2JN4A 4IOCA 1VQGA 5J1ZA 2UXBL 1HQRD 4K6LA 4YCWA 1SE2A 4X62Q 1KRTA 1JB7A 2CCZA 4MZ9A 4Y52H 1YHQA 3HOYG 4BY7H 3VR5A 4ZQ3A 4R1JA 4YHHL 3OOCA 2AWNA 4H44C 3F1ZA 2RKSA 3S1QH 1SNPA 4PZ6A 1H9JA 1VQAA 1K28A 5JEAJ 3VYSA 1YNND 1ML0D 4Q5VA 2MNAA 3EN2A 5IP9G 2B63B 4BA2I 2RCFA 3MAQA 2PZUA 1X3FA 5C3EB 3SK4A 5A2QL 4DV6Q 4X64Q 4N9TA 4RHRA 1SJHD 1HHVA 1SE4A 1JE4A 2R7ZG 3ICEA 1IZ6A 3RR5A 2VS1A 4KKUA 2WKCA 4BBSG 2NVQH 2J4XA 2EYHA 4R9WA 4GOPC 1CUKA 3D8GA 4HCEA 3EIVA 4HSPA 2LFNA 3CU7A 4DKAC 3KK7A 2UXBQ 2HDMA 3VYRA 4JPBW 5J39A 1U4PA 2F4VQ 2TMPA 3KYHC 2QW7A 1UUPA 1XTDA 4B3TL 2B3GA 5ELFA 2NVYH 3UDGA 2JA7H 2JA5G 2K5VA 4NW2A 1CKNB 3BDLA 1Z47A 4A3FG 5C5LA 4QUCA 3NTHA 1DOLA 1N34Q 2KHIA 3PUVA 4B3SL 1ILPA 4OWXB 2Z9HA 2R92H 1X9NA 5IYDH 1J9OA 3TEHB 1HA5A 1STYA 5M5WH 1FR3A 5IP7G 4BXXG 4HIDA 4JOIA 5JEAH 3MZ5A 1D1KA 4F8MA 2F0JA 1L0XB 3K5OA 2F0DA 3A74A 4R8NA 1YNJD 2WB1E 4X65L 2M2LA 4WJ4A 1Y8OB 1SDFA 4JI1L 5HGTA 3Q22A 1IYUA 4BY1B 2NN6H 1HQMC 4P75A 3LX0A 2A6EC 3ONAB 1WD0A 5EJWA 5C44G 4IPCA 1ESRA 2QKIC 4DUZL 3PIOA 4B3TQ 3S9WA 2IPKD 4HJ8A 2DNEA 1VF5C 3D3RA 1S72A 4DV0Q 1F9SA 3NBHA 4B3SQ 3EBEA 4IPGA 3T53B 2Y0SB 1Y1WG 4DV3Q 2BA0A 5COYA 2ICIA 3R8BA 4LF8L 3S1MH 5M3FG 4DU9A 2OTLA 2E2JB 2XGTA 5C4XG 3GTLH 3DXJC 1MJEA 2PNRC 4X65Q 5C6AA 3HOVG 5C0XI 1N32Q 3ZYYX 2E75C 3OPOA 5IT9E 2JA6H 1RDPD 5GQOA 4IUQA 2E2HH 3I70A 4A3DB 1KIXA 1EOTA 1JT8A 1OO9B 3J7YW 1O7LA 2Z1CA 1TWGH 4CGYB 3L7ZC 3E9HA 1I4RA 3AU7A 3K7AB 1KC8C 1CKMA 2OF1A 4IFDJ 1SNDA 1E2VA 1XMOL 1PH2A 1DYQA 4N9PA 2F0EA 4AIMA 4FF2A 4ODGA 1IXRA 2G9HD 4FO2A 2XNAC 3A7LA 4P71A 1E2ZA 1Z9FA 1X6OA 4LF8Q 1CHQD 3G6EA 3QO2A 3SDZA 5I4DA 1I6HB 1HR0L 1EZ8A 2N55A 3KFUA 4WORA 1SMYD 2EPBA 3QOLA 1G6PA 3S1NB 1EYDA 5FK9C 2LMCB 4BBRH 1NY4A 1SR3A 5A35A 5IOCA 3CAMA 5JPMC 5A2QE 2WB1B 4OWWB 2KENA 1EWIA 2J7ZA 2UUBL 4BA1I 1HA6A 4LWCA 1WTWA 5CV9A 1GM5A 1BBWA 3CRLC 1V1OA 3TRZA 3M7NA 1X3QA 2EQSA 3HKSA 1OXTA 4F7XA 1PA6A 1WTPA 4IJLA 2ICEC
chains in the Genus database with same CATH topology
1PH9A 3PUZA 4JI8L 4HJ7A 1S40A 1PYBA 3J7ZC 1PH7A 3T1HL 1C9OA 4FDBA 3UE0A 2OTJA 4JI0L 3CPWA 3S16H 4JYAL 3CC2A 1HR0Q 2AHOB 1PH6A 3CMEA 1EIFA 2JA7G 4A3CH 1CKNA 5GADC 3F2BA 1WFQA 2ZTCA 5C4JH 1PHJA 4DV7Q 4JI6L 4WJ3M 3RNUA 4BY1G 3RZOH 3J80c 4DV2Q 4QL5A 5C0XG 2A8VA 1X65A 3PF5A 1ASZA 2K52A 1YIJA 2QA4A 2ZM6Q 2WAQE 3CW2C 4JI7Q 4YCVA 1N33L 5IWAL 2E2IH 1HZ9A 1NBWA 1Q8KA 5E7NA 2ZJRA 2ES2A 2JA9A 5IYDG 3AFQA 1L1OB 4J15A 2R92G 2IX0A 5ELOA 2OQKA 3CPFA 4LUZA 4X66L 3MEFA 1UE7A 4JI5L 2N49A 2UUBQ 5JEAG 1E3PA 1EQRA 3K0XA 1GO3E 1OXUA 2E8GA 3AFPA 1N9WA 2A1AA 2Q2IA 1EIYB 2MO0A 1FVIA 1YJWA 3TREA 5FLMH 2I5HA 2IHFA 2ATWA 3ULPA 1TXYA 1JJ2A 2RCNA 1HNXQ 4DR5Q 1XJVA 4HIOA 5LMNW 4A3JH 1I3QH 3KF6A 3RZDH 2NN6G 2GVBA 3L2PA 4A3LG 1TWCH 2LXJA 4NB3A 4K0KL 2UUCL 3K7AH 3CCMA 1YJ9A 2F3IA 3HOYH 4DR7Q 3PSIA 1JJCB 4LNQA 2L15A 3J81i 3S1RH 4JYAQ 3G48A 4LFBL 4DV6L 2CQOA 1VQIA 1QZGA 2HQLA 3K81C 4DK6C 3U58A 3GDEA 3PUXA 2EXDA 3HOUH 4JI1Q 1TWHH 4GLAC 1VQ7A 3BU2A 4JBKA 4JI2L 2DGYA 1JMCA 1IYJB 1BBUA 3DLLA 3RN2A 4DR3Q 1WCMG 3HOXH 4A3GH 1W3SA 4AH6A 5FJ8H 3PGZA 4AYBG 2PQAB 4YY3Q 3K7UC 4LF9L 5IP9H 1VQBA 3AQQA 5M3MG 3TS0A 4DUZQ 4A3KG 5BR8L 2YTVA 3KJPA 1N33Q 5IWAQ 2BA1A 2JK8A 3JAMc 3RLOA 3I4MH 1QZHA 4X6AH 1YI2A 4OX9L 3L0OA 2UXDL 5IYBH 2YTXA 3GTJH 1UWVA 4GS3A 4X66Q 2Z6KC 1XMQL 1PH1A 4JI5Q 2R7ZH 2F4VL 4YCUA 2ALYB 4HJAA 3HFZB 1EFWA 1YJNA 4AQYL 1HR0W 2AMCB 1QVGA 2HIXA 2Z0SA 4MNOA 3FP9A 3HKZE 4RG1A 4JI3L 2IX1A 4A3MH 4O2DA 1VQ9A 2NN6I 3TS2A 1AE2A 1I94L 3W1GA 1A63A 3K80C 2I0QA 4BY7G 3E0EA 4DPGA 3GTOH 2UXCQ 4K0KQ 4LF7Q 2NVTH 2UUCQ 2MFIA 3FKIH 1VQ6A 3H15A 1Q46A 2JA6G 4A3BG 1D8LA 4XTCS 3HOZG 2N8NA 1E7ZA 5IYCG 1N34L 5GAGC 1FGUA 1HZAA 1VCIA 1X54A 1XNQL 1EUJA 2R7DA 1SROA 1YHBA 2UUAQ 3GTGH 4LFBQ 2KBNA 5HY6A 1Y1VH 2Q2HA 4A3EH 2JA5H 4A76A 2BH2A 3CQZH 1I50H 4JOIC 5IE8A 4JI2Q 4DK3C 4A3FH 1WYDA 3FHWA 5DLQE 1VQHA 4DV4L 4JC0A 1D7QA 3KJOA 2WB1G 3CXCA 1PFSA 3WWVA 3PO3H 2VQFL 1HJPA 2R93G 5BR8Q 1VQFA 3IRBA 4YWMA 3STBC 4AYBE 3CCEA 2E5LL 3JC66 2ZJPA 1KD1C 4OX9Q 3HOWG 5JJLA 4LFCL 4R4TA 1O7IA 2AWOA 3GD7A 2JE6I 3E9IA 5IP7H 2FXQA 1N8RC 1M90C 4DV1L 1BVSA 1R9TH 5M5YH 1LM0A 4AQYQ 3CCLA 1TWFH 1B70B 1FJGL 4LUOA 4JBMA 3F8TA 1XMOQ 3GTQH 2LXKA 4JI3Q 2CWAA 3H0GG 5LMUL 1XPRA 2VUMG 3PO2G 2ID0A 3J81c 1OXSC 1YVCA 4GN4B 4UP9A 3CCUA 1I94Q 3KOJA 2BH8A 2C35B 2VNUD 1PH8A 4DV5L 4BBRG 1X55A 2LSSA 4DV0L 2CKZB 1YNXA 1IBKQ 2XTIA 1QVCA 1TWAH 5C44H 4GOPA 4PZ8A 3I4NG 4UY8C 3PUYA 1XNQQ 4GKKL 4DV3L 4LUVA 4MTNA 2I5MX 3ULJA 4HJ9A 4LFAL 4C3IH 3CCSA 4DNIA 4L5RC 4JI4Q 3RLFA 1WI5A 1EYGA 4A75A 3S15H 1QVFA 1KL9A 3KDFA 1Q86C 1YHAA 4XIGS 2VQFQ 1XPOA 4QQBX 1Q12A 1L2FA 1YEZA 3NBHB 4A4IA 4X62L 5AJ3Q 3I55A 1Y1WH 1XPUA 2D62A 2AKWB 4YWKA 3OTOL 1VQDA 4KHPL 1X3EA 4JCVE 2K50A 1N32L 2V1CC 1JE5A 4DV1Q 4A3LH 4APVA 5M3FH 1VQ8A 3RN5A 3J7A5 1HZBA 2GVAA 1KXLA 1MIUA 2Y0SG 1FJGQ 4IFDG 4NPSA 3CCVA 2MO1A 2KCMA 3M3YH 1RL2A 5C4XH 1YZ6A 2JJQA 5LMUQ 3D31A 4HJ5A 3PV0A 3UDIA 4H02A 3CC4A 2JA8G 3CCJA 4JI8Q 2NVXH 3SGIA 1VQNA 3HOVH 3A0JA 1M1KC 3T1HQ 4DV5Q 4R4CA 4JI0Q 2VW9A 1J6QA 1WCMH 1L1OA 2WP8J 1I5FA 4X64L 3ERSX 2HHHL 4B3ML 3MXNB 3I4OA 3CC7A 4GKKQ 4JI6Q 1GKHA 4EQ5A 4POFA 3BZCA 4JBJA 2NZHA 4UP7A 1PYSB 4DUYL 1Q82C 4TQUS 2D0OA 1AH9A 2ASBA 3H3VH 5FLMG 4GNXC 4A3DG 2B63H 1PVOA 1JJGA 4P72A 4A3IH 5C3EH 1B8AA 4IOAA 4IOCA 4A3JG 1VQGA 1A8VA 2UXBL 4YCWA 4X62Q 1SE8A 1KRTA 1JB7A 2HT1A 1KRSA 3STBD 2CCZA 5C0XJ 4MZ9A 3OTOQ 3M4PA 4KHPQ 1LUZA 1NJIC 4Y52H 3AYHB 1YHQA 3HOYG 4L5SA 4BY7H 4IFDI 4KHZA 1QUQB 3PUWA 1YBYA 1C0AA 4R1JA 4YHHL 1FL0A 4A3BH 2H5XA 2AWNA 4GNXB 4DAYB 2JEAI 3F1ZA 3S1QH 3VDYA 5HGQA 1YITA 3J80i 3A5ZB 4PZ6A 3A5UA 2IY5B 4OO1I 1VQAA 5GAEC 4ME3A 5JEAJ 4A3GG 3F2CA 3HOXG 2PQAA 3S2DH 4C3JH 3CF5A 1P16A 1UE5A 2MNAA 3EN2A 5IP9G 4BA2I 1NE3A 1X3FA 2PMZE 2JQOA 1H95A 3M9BA 1K73C 4DV6Q 4X64Q 5K36G 2IT1A 2PI2A 2CWPA 4B3MQ 5IYBG 1K3RA 2QEXA 2R7ZG 3UDXA 1Q81C 2Q2TA 1V1QA 3ICEA 1IZ6A 4PMWA 4DUYQ 1NMFA 2VS1A 3RR5A 1PH3A 3M4OH 4BBSG 4LF9Q 4A93H 1PV4A 2NVQH 1VQKA 1A0IA 3GO5A 1NTGA 3S24A 1CUKA 4UP8A 4GOPC 3CCRA 4A3MG 4R4IA 3U4VA 3EIVA 1GVPA 2UXDQ 1VQPA 4DKAC 1IBML 3H0GH 1XMQQ 2K5HA 1N36L 4LF5L 2UXBQ 1KAWA 2DUDA 4OXPA 3CCQA 4DV7L 3CMAA 2K5NA 2Z6KA 3KYHC 2F4VQ 4DAMA 2WAQG 3FKIG 3TQYA 4R4QA 1XTDA 1T9HA 1VQEA 3GTKH 4GLVB 4IPHA 4JI7L 5M5XH 2OQ0A 4LW1A 4B3TL 2MQHA 1MJCA 2B3GA 2VY3A 4R4OA 1VQ4A 2NVYH 3UDGA 1Y1VG 2JA7H 4A3EG 2JA5G 3I4NH 2K5VA 4UPAA 1CKNB 3M4QA 1Z47A 1Q7YC 4A3FG 4BY1H 4DR1L 3BJUA 3S2HH 1G291 1HNWL 3CP0A 3I56A 3OW2A 1V43A 1E1TA 3PO3G 1N34Q 2KHIA 3ZJYC 2IHEA 3PUVA 4B3SL 3NENA 4IJHA 1WJJA 4OWXB 5GROA 2F52A 4JBWA 1X9NA 2R92H 5IYDH 3RLNA 1LYLA 2KCTA 3ER0A 2VZAA 1OXVA 3TEHB 5M5WH 3UDFA 3AEVA 2K4KA 4QY7A 1HNZL 5IP7G 4BXXG 1Q1EA 4HIDA 4JOIA 4L5TA 4DV4Q 3U50C 4L5QA 1SN8A 1E22A 1VQCA 4DR7L 2NZOA 3NELA 3A74A 1L1OC 4OONA 2WB1E 2E5LQ 4X65L 4WJ4A 2KHJA 1E1OA 3D0FA 2GN5A 1U5KA 2PNHA 2QGQA 4JI1L 4LFCQ 1IBMQ 2YV5A 4P73A 4NXNL 1N36Q 1VQ5A 4LF5Q 4DR4L 3KF6B 1G51A 4P75A 1IBLL 4DR3L 4DR2L 3I7FA 1VQLA 2JA8H 2B29A 4YY3L 5C44G 4IPCA 1Q1BA 2E2JH 2OWOA 4DUZL 4A3CG 1WOCA 3PIOA 4B3TQ 2YYZA 1VQMA 5JJKA 3U4ZA 1IL2A 1X3GA 2VQEL 4LF6L 1SLJA 4OO1G 4HJ8A 1V9PA 3BZKA 3W5OA 4EX5A 1OTCA 1S72A 2ZTEA 4PG3A 4DV0Q 4DR1Q 3HKZG 3UE1A 1LTLA 1HNWQ 5J3BA 4C2MH 4GN3B 5M3MH 4A3KH 3KLWA 3I2ZA 4B3SQ 3EBEA 3OYYA 4IPGA 4A3DH 1K83H 1UEBA 1Y1WG 4DV3Q 4GN5A 2BA0A 2N78A 4QGUA 2UU9L 4LFAQ 1HNZQ 4LF8L 2UXCL 3S1MH 1HZCA 5M3FG 4LF7L 1E24A 4C3HH 1J5EL 2OTLA 2RHSB 2XGTA 4JV5L 1DGSA 1NMGA 3G4SA 4B3RL 3M85A 5C4XG 2OCEA 4P74A 3GTLH 3T1YL 1S3OA 4PZ7A 1MJEA 4X65Q 5IT9c 2UUAL 3GTPH 1VS0A 4HIKA 5LMNL 3HOVG 5C0XI 2ZJQA 2EIFA 2K75A 4NXNQ 1N32Q 4QIWE 3S14H 2RF4A 3J81j 4DR4Q 3B6YA 1IBLQ 1A62A 4DR2Q 3S17H 1PH5A 3PCOB 2JA6H 2N3SA 2VL6A 3HOUG 5GQOA 2E2HH 1EOVA 5GAHC 2YU9H 3HOZH 1I6HH 5IYCH 1KIXA 1VQJA 2Y0SE 4GKJL 1JT8A 1GD7A 1C7YA 2K14A 1XNRL 4JG2A 4NXML 2I5LX 4QJFA 2VQEQ 5FJ8G 4LF6Q 3NEMA 3PIPA 5FLXc 3F2DA 1Y14B 1TWGH 3S1NH 3L7ZC 3E9HA 5IY0A 1K8AC 2B63G 1BKBA 1KC8C 4A3IG 1CKMA 5C3EG 3I4MG 4BBSH 4IFDJ 4Y7NH 4LF4L 2HHHQ 4RMFA 1XMOL 2R93H 3LGJA 1PH2A 1OXXK 3DM3A 4DR6L 1CSPA 1UE1A 2R6GA 1RIPA 5EAYA 4AIMA 3KF8B 3HOWH 1CKOA 1IXRA 1CSQA 4HIMA 1QUQA 4P71A 1W2BA 2UU9Q 1P8LA 1Z9FA 3W1BA 1B7YB 1X6OA 1X56A 3K8AA 4GLXA 1VQOA 1ASYA 4LF8Q 3G6EA 4GNXA 1J5EQ 1IBKL 1HR0L 1AE3A 3CD6A 4JV5Q 3G71A 4B3RQ 1HH2P 4IPDA 1MKHA 1EQQA 3KFUA 2RHQB 2HIVA 2VUMH 5JJIA 3T1YQ 3Q8DA 3PO2H 5ELNA 2A19A 4DV2L 1G6PA 2D0PA 1KQSA 5LMNQ 5H1SE 2PI2E 1K0RA 1SRUA 1NY4A 1SR3A 4OWTB 4BBRH 3CAMA 4TVAB 2ZM6L 1K9MC 4JI4L 4YHHQ 4OWWB 4IO9A 2KENA 1EWIA 1UE6A 4GOPB 4O0AA 4ALPA 4GKJQ 5AJ3L 1XNRQ 4KLKA 2UUBL 2R7FA 4NXMQ 3H3VI 4BA1I 4LWCA 1GM5A 1BBWA 2WFWA 4YWLA 2Q2UA 3GTMH 3JAMi 4BXXH 4A93G 2ZTDA 1K8GA 1KHIA 1SMXA 1SFOH 1PH4A 2JEBI 3TRZA 3M7NA 1HNXL 4LF4Q 4DR5L 2EQSA 3ULLA 3PF4A 4POGA 3HKSA 3KDFB 2YTYA 1L0WA 1OXTA 4DR6Q 1PA6A 4IJLA 4KI0A 1U0LA 2CFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PH9 A;  3PUZ A;  4JI8 L;  4HJ7 A;  1S40 A;  1PYB A;  3J7Z C;  1PH7 A;  3T1H L;  1C9O A;  4FDB A;  3UE0 A;  2OTJ A;  4JI0 L;  3CPW A;  3S16 H;  4JYA L;  3CC2 A;  1HR0 Q;  2AHO B;  1PH6 A;  3CME A;  1EIF A;  2JA7 G;  4A3C H;  1CKN A;  5GAD C;  3F2B A;  1WFQ A;  2ZTC A;  5C4J H;  1PHJ A;  4DV7 Q;  4JI6 L;  4WJ3 M;  3RNU A;  4BY1 G;  3RZO H;  3J80 c;  4DV2 Q;  4QL5 A;  5C0X G;  2A8V A;  1X65 A;  3PF5 A;  1ASZ A;  2K52 A;  1YIJ A;  2QA4 A;  2ZM6 Q;  2WAQ E;  3CW2 C;  4JI7 Q;  4YCV A;  1N33 L;  5IWA L;  2E2I H;  1HZ9 A;  1NBW A;  1Q8K A;  5E7N A;  2ZJR A;  2ES2 A;  2JA9 A;  5IYD G;  3AFQ A;  1L1O B;  4J15 A;  2R92 G;  2IX0 A;  5ELO A;  2OQK A;  3CPF A;  4LUZ A;  4X66 L;  3MEF A;  1UE7 A;  4JI5 L;  2N49 A;  2UUB Q;  5JEA G;  1E3P A;  1EQR A;  3K0X A;  1GO3 E;  1OXU A;  2E8G A;  3AFP A;  1N9W A;  2A1A A;  2Q2I A;  1EIY B;  2MO0 A;  1FVI A;  1YJW A;  3TRE A;  5FLM H;  2I5H A;  2IHF A;  2ATW A;  3ULP A;  1TXY A;  1JJ2 A;  2RCN A;  1HNX Q;  4DR5 Q;  1XJV A;  4HIO A;  5LMN W;  4A3J H;  1I3Q H;  3KF6 A;  3RZD H;  2NN6 G;  2GVB A;  3L2P A;  4A3L G;  1TWC H;  2LXJ A;  4NB3 A;  4K0K L;  2UUC L;  3K7A H;  3CCM A;  1YJ9 A;  2F3I A;  3HOY H;  4DR7 Q;  3PSI A;  1JJC B;  4LNQ A;  2L15 A;  3J81 i;  3S1R H;  4JYA Q;  3G48 A;  4LFB L;  4DV6 L;  2CQO A;  1VQI A;  1QZG A;  2HQL A;  3K81 C;  4DK6 C;  3U58 A;  3GDE A;  3PUX A;  2EXD A;  3HOU H;  4JI1 Q;  1TWH H;  4GLA C;  1VQ7 A;  3BU2 A;  4JBK A;  4JI2 L;  2DGY A;  1JMC A;  1IYJ B;  1BBU A;  3DLL A;  3RN2 A;  4DR3 Q;  1WCM G;  3HOX H;  4A3G H;  1W3S A;  4AH6 A;  5FJ8 H;  3PGZ A;  4AYB G;  2PQA B;  4YY3 Q;  3K7U C;  4LF9 L;  5IP9 H;  1VQB A;  3AQQ A;  5M3M G;  3TS0 A;  4DUZ Q;  4A3K G;  5BR8 L;  2YTV A;  3KJP A;  1N33 Q;  5IWA Q;  2BA1 A;  2JK8 A;  3JAM c;  3RLO A;  3I4M H;  1QZH A;  4X6A H;  1YI2 A;  4OX9 L;  3L0O A;  2UXD L;  5IYB H;  2YTX A;  3GTJ H;  1UWV A;  4GS3 A;  4X66 Q;  2Z6K C;  1XMQ L;  1PH1 A;  4JI5 Q;  2R7Z H;  2F4V L;  4YCU A;  2ALY B;  4HJA A;  3HFZ B;  1EFW A;  1YJN A;  4AQY L;  1HR0 W;  2AMC B;  1QVG A;  2HIX A;  2Z0S A;  4MNO A;  3FP9 A;  3HKZ E;  4RG1 A;  4JI3 L;  2IX1 A;  4A3M H;  4O2D A;  1VQ9 A;  2NN6 I;  3TS2 A;  1AE2 A;  1I94 L;  3W1G A;  1A63 A;  3K80 C;  2I0Q A;  4BY7 G;  3E0E A;  4DPG A;  3GTO H;  2UXC Q;  4K0K Q;  4LF7 Q;  2NVT H;  2UUC Q;  2MFI A;  3FKI H;  1VQ6 A;  3H15 A;  1Q46 A;  2JA6 G;  4A3B G;  1D8L A;  4XTC S;  3HOZ G;  2N8N A;  1E7Z A;  5IYC G;  1N34 L;  5GAG C;  1FGU A;  1HZA A;  1VCI A;  1X54 A;  1XNQ L;  1EUJ A;  2R7D A;  1SRO A;  1YHB A;  2UUA Q;  3GTG H;  4LFB Q;  2KBN A;  5HY6 A;  1Y1V H;  2Q2H A;  4A3E H;  2JA5 H;  4A76 A;  2BH2 A;  3CQZ H;  1I50 H;  4JOI C;  5IE8 A;  4JI2 Q;  4DK3 C;  4A3F H;  1WYD A;  3FHW A;  5DLQ E;  1VQH A;  4DV4 L;  4JC0 A;  1D7Q A;  3KJO A;  2WB1 G;  3CXC A;  1PFS A;  3WWV A;  3PO3 H;  2VQF L;  1HJP A;  2R93 G;  5BR8 Q;  1VQF A;  3IRB A;  4YWM A;  3STB C;  4AYB E;  3CCE A;  2E5L L;  3JC6 6;  2ZJP A;  1KD1 C;  4OX9 Q;  3HOW G;  5JJL A;  4LFC L;  4R4T A;  1O7I A;  2AWO A;  3GD7 A;  2JE6 I;  3E9I A;  5IP7 H;  2FXQ A;  1N8R C;  1M90 C;  4DV1 L;  1BVS A;  1R9T H;  5M5Y H;  1LM0 A;  4AQY Q;  3CCL A;  1TWF H;  1B70 B;  1FJG L;  4LUO A;  4JBM A;  3F8T A;  1XMO Q;  3GTQ H;  2LXK A;  4JI3 Q;  2CWA A;  3H0G G;  5LMU L;  1XPR A;  2VUM G;  3PO2 G;  2ID0 A;  3J81 c;  1OXS C;  1YVC A;  4GN4 B;  4UP9 A;  3CCU A;  1I94 Q;  3KOJ A;  2BH8 A;  2C35 B;  2VNU D;  1PH8 A;  4DV5 L;  4BBR G;  1X55 A;  2LSS A;  4DV0 L;  2CKZ B;  1YNX A;  1IBK Q;  2XTI A;  1QVC A;  1TWA H;  5C44 H;  4GOP A;  4PZ8 A;  3I4N G;  4UY8 C;  3PUY A;  1XNQ Q;  4GKK L;  4DV3 L;  4LUV A;  4MTN A;  2I5M X;  3ULJ A;  4HJ9 A;  4LFA L;  4C3I H;  3CCS A;  4DNI A;  4L5R C;  4JI4 Q;  3RLF A;  1WI5 A;  1EYG A;  4A75 A;  3S15 H;  1QVF A;  1KL9 A;  3KDF A;  1Q86 C;  1YHA A;  4XIG S;  2VQF Q;  1XPO A;  4QQB X;  1Q12 A;  1L2F A;  1YEZ A;  3NBH B;  4A4I A;  4X62 L;  5AJ3 Q;  3I55 A;  1Y1W H;  1XPU A;  2D62 A;  2AKW B;  4YWK A;  3OTO L;  1VQD A;  4KHP L;  1X3E A;  4JCV E;  2K50 A;  1N32 L;  2V1C C;  1JE5 A;  4DV1 Q;  4A3L H;  4APV A;  5M3F H;  1VQ8 A;  3RN5 A;  3J7A 5;  1HZB A;  2GVA A;  1KXL A;  1MIU A;  2Y0S G;  1FJG Q;  4IFD G;  4NPS A;  3CCV A;  2MO1 A;  2KCM A;  3M3Y H;  1RL2 A;  5C4X H;  1YZ6 A;  2JJQ A;  5LMU Q;  3D31 A;  4HJ5 A;  3PV0 A;  3UDI A;  4H02 A;  3CC4 A;  2JA8 G;  3CCJ A;  4JI8 Q;  2NVX H;  3SGI A;  1VQN A;  3HOV H;  3A0J A;  1M1K C;  3T1H Q;  4DV5 Q;  4R4C A;  4JI0 Q;  2VW9 A;  1J6Q A;  1WCM H;  1L1O A;  2WP8 J;  1I5F A;  4X64 L;  3ERS X;  2HHH L;  4B3M L;  3MXN B;  3I4O A;  3CC7 A;  4GKK Q;  4JI6 Q;  1GKH A;  4EQ5 A;  4POF A;  3BZC A;  4JBJ A;  2NZH A;  4UP7 A;  1PYS B;  4DUY L;  1Q82 C;  4TQU S;  2D0O A;  1AH9 A;  2ASB A;  3H3V H;  5FLM G;  4GNX C;  4A3D G;  2B63 H;  1PVO A;  1JJG A;  4P72 A;  4A3I H;  5C3E H;  1B8A A;  4IOA A;  4IOC A;  4A3J G;  1VQG A;  1A8V A;  2UXB L;  4YCW A;  4X62 Q;  1SE8 A;  1KRT A;  1JB7 A;  2HT1 A;  1KRS A;  3STB D;  2CCZ A;  5C0X J;  4MZ9 A;  3OTO Q;  3M4P A;  4KHP Q;  1LUZ A;  1NJI C;  4Y52 H;  3AYH B;  1YHQ A;  3HOY G;  4L5S A;  4BY7 H;  4IFD I;  4KHZ A;  1QUQ B;  3PUW A;  1YBY A;  1C0A A;  4R1J A;  4YHH L;  1FL0 A;  4A3B H;  2H5X A;  2AWN A;  4GNX B;  4DAY B;  2JEA I;  3F1Z A;  3S1Q H;  3VDY A;  5HGQ A;  1YIT A;  3J80 i;  3A5Z B;  4PZ6 A;  3A5U A;  2IY5 B;  4OO1 I;  1VQA A;  5GAE C;  4ME3 A;  5JEA J;  4A3G G;  3F2C A;  3HOX G;  2PQA A;  3S2D H;  4C3J H;  3CF5 A;  1P16 A;  1UE5 A;  2MNA A;  3EN2 A;  5IP9 G;  4BA2 I;  1NE3 A;  1X3F A;  2PMZ E;  2JQO A;  1H95 A;  3M9B A;  1K73 C;  4DV6 Q;  4X64 Q;  5K36 G;  2IT1 A;  2PI2 A;  2CWP A;  4B3M Q;  5IYB G;  1K3R A;  2QEX A;  2R7Z G;  3UDX A;  1Q81 C;  2Q2T A;  1V1Q A;  3ICE A;  1IZ6 A;  4PMW A;  4DUY Q;  1NMF A;  2VS1 A;  3RR5 A;  1PH3 A;  3M4O H;  4BBS G;  4LF9 Q;  4A93 H;  1PV4 A;  2NVQ H;  1VQK A;  1A0I A;  3GO5 A;  1NTG A;  3S24 A;  1CUK A;  4UP8 A;  4GOP C;  3CCR A;  4A3M G;  4R4I A;  3U4V A;  3EIV A;  1GVP A;  2UXD Q;  1VQP A;  4DKA C;  1IBM L;  3H0G H;  1XMQ Q;  2K5H A;  1N36 L;  4LF5 L;  2UXB Q;  1KAW A;  2DUD A;  4OXP A;  3CCQ A;  4DV7 L;  3CMA A;  2K5N A;  2Z6K A;  3KYH C;  2F4V Q;  4DAM A;  2WAQ G;  3FKI G;  3TQY A;  4R4Q A;  1XTD A;  1T9H A;  1VQE A;  3GTK H;  4GLV B;  4IPH A;  4JI7 L;  5M5X H;  2OQ0 A;  4LW1 A;  4B3T L;  2MQH A;  1MJC A;  2B3G A;  2VY3 A;  4R4O A;  1VQ4 A;  2NVY H;  3UDG A;  1Y1V G;  2JA7 H;  4A3E G;  2JA5 G;  3I4N H;  2K5V A;  4UPA A;  1CKN B;  3M4Q A;  1Z47 A;  1Q7Y C;  4A3F G;  4BY1 H;  4DR1 L;  3BJU A;  3S2H H;  1G29 1;  1HNW L;  3CP0 A;  3I56 A;  3OW2 A;  1V43 A;  1E1T A;  3PO3 G;  1N34 Q;  2KHI A;  3ZJY C;  2IHE A;  3PUV A;  4B3S L;  3NEN A;  4IJH A;  1WJJ A;  4OWX B;  5GRO A;  2F52 A;  4JBW A;  1X9N A;  2R92 H;  5IYD H;  3RLN A;  1LYL A;  2KCT A;  3ER0 A;  2VZA A;  1OXV A;  3TEH B;  5M5W H;  3UDF A;  3AEV A;  2K4K A;  4QY7 A;  1HNZ L;  5IP7 G;  4BXX G;  1Q1E A;  4HID A;  4JOI A;  4L5T A;  4DV4 Q;  3U50 C;  4L5Q A;  1SN8 A;  1E22 A;  1VQC A;  4DR7 L;  2NZO A;  3NEL A;  3A74 A;  1L1O C;  4OON A;  2WB1 E;  2E5L Q;  4X65 L;  4WJ4 A;  2KHJ A;  1E1O A;  3D0F A;  2GN5 A;  1U5K A;  2PNH A;  2QGQ A;  4JI1 L;  4LFC Q;  1IBM Q;  2YV5 A;  4P73 A;  4NXN L;  1N36 Q;  1VQ5 A;  4LF5 Q;  4DR4 L;  3KF6 B;  1G51 A;  4P75 A;  1IBL L;  4DR3 L;  4DR2 L;  3I7F A;  1VQL A;  2JA8 H;  2B29 A;  4YY3 L;  5C44 G;  4IPC A;  1Q1B A;  2E2J H;  2OWO A;  4DUZ L;  4A3C G;  1WOC A;  3PIO A;  4B3T Q;  2YYZ A;  1VQM A;  5JJK A;  3U4Z A;  1IL2 A;  1X3G A;  2VQE L;  4LF6 L;  1SLJ A;  4OO1 G;  4HJ8 A;  1V9P A;  3BZK A;  3W5O A;  4EX5 A;  1OTC A;  1S72 A;  2ZTE A;  4PG3 A;  4DV0 Q;  4DR1 Q;  3HKZ G;  3UE1 A;  1LTL A;  1HNW Q;  5J3B A;  4C2M H;  4GN3 B;  5M3M H;  4A3K H;  3KLW A;  3I2Z A;  4B3S Q;  3EBE A;  3OYY A;  4IPG A;  4A3D H;  1K83 H;  1UEB A;  1Y1W G;  4DV3 Q;  4GN5 A;  2BA0 A;  2N78 A;  4QGU A;  2UU9 L;  4LFA Q;  1HNZ Q;  4LF8 L;  2UXC L;  3S1M H;  1HZC A;  5M3F G;  4LF7 L;  1E24 A;  4C3H H;  1J5E L;  2OTL A;  2RHS B;  2XGT A;  4JV5 L;  1DGS A;  1NMG A;  3G4S A;  4B3R L;  3M85 A;  5C4X G;  2OCE A;  4P74 A;  3GTL H;  3T1Y L;  1S3O A;  4PZ7 A;  1MJE A;  4X65 Q;  5IT9 c;  2UUA L;  3GTP H;  1VS0 A;  4HIK A;  5LMN L;  3HOV G;  5C0X I;  2ZJQ A;  2EIF A;  2K75 A;  4NXN Q;  1N32 Q;  4QIW E;  3S14 H;  2RF4 A;  3J81 j;  4DR4 Q;  3B6Y A;  1IBL Q;  1A62 A;  4DR2 Q;  3S17 H;  1PH5 A;  3PCO B;  2JA6 H;  2N3S A;  2VL6 A;  3HOU G;  5GQO A;  2E2H H;  1EOV A;  5GAH C;  2YU9 H;  3HOZ H;  1I6H H;  5IYC H;  1KIX A;  1VQJ A;  2Y0S E;  4GKJ L;  1JT8 A;  1GD7 A;  1C7Y A;  2K14 A;  1XNR L;  4JG2 A;  4NXM L;  2I5L X;  4QJF A;  2VQE Q;  5FJ8 G;  4LF6 Q;  3NEM A;  3PIP A;  5FLX c;  3F2D A;  1Y14 B;  1TWG H;  3S1N H;  3L7Z C;  3E9H A;  5IY0 A;  1K8A C;  2B63 G;  1BKB A;  1KC8 C;  4A3I G;  1CKM A;  5C3E G;  3I4M G;  4BBS H;  4IFD J;  4Y7N H;  4LF4 L;  2HHH Q;  4RMF A;  1XMO L;  2R93 H;  3LGJ A;  1PH2 A;  1OXX K;  3DM3 A;  4DR6 L;  1CSP A;  1UE1 A;  2R6G A;  1RIP A;  5EAY A;  4AIM A;  3KF8 B;  3HOW H;  1CKO A;  1IXR A;  1CSQ A;  4HIM A;  1QUQ A;  4P71 A;  1W2B A;  2UU9 Q;  1P8L A;  1Z9F A;  3W1B A;  1B7Y B;  1X6O A;  1X56 A;  3K8A A;  4GLX A;  1VQO A;  1ASY A;  4LF8 Q;  3G6E A;  4GNX A;  1J5E Q;  1IBK L;  1HR0 L;  1AE3 A;  3CD6 A;  4JV5 Q;  3G71 A;  4B3R Q;  1HH2 P;  4IPD A;  1MKH A;  1EQQ A;  3KFU A;  2RHQ B;  2HIV A;  2VUM H;  5JJI A;  3T1Y Q;  3Q8D A;  3PO2 H;  5ELN A;  2A19 A;  4DV2 L;  1G6P A;  2D0P A;  1KQS A;  5LMN Q;  5H1S E;  2PI2 E;  1K0R A;  1SRU A;  1NY4 A;  1SR3 A;  4OWT B;  4BBR H;  3CAM A;  4TVA B;  2ZM6 L;  1K9M C;  4JI4 L;  4YHH Q;  4OWW B;  4IO9 A;  2KEN A;  1EWI A;  1UE6 A;  4GOP B;  4O0A A;  4ALP A;  4GKJ Q;  5AJ3 L;  1XNR Q;  4KLK A;  2UUB L;  2R7F A;  4NXM Q;  3H3V I;  4BA1 I;  4LWC A;  1GM5 A;  1BBW A;  2WFW A;  4YWL A;  2Q2U A;  3GTM H;  3JAM i;  4BXX H;  4A93 G;  2ZTD A;  1K8G A;  1KHI A;  1SMX A;  1SFO H;  1PH4 A;  2JEB I;  3TRZ A;  3M7N A;  1HNX L;  4LF4 Q;  4DR5 L;  2EQS A;  3ULL A;  3PF4 A;  4POG A;  3HKS A;  3KDF B;  2YTY A;  1L0W A;  1OXT A;  4DR6 Q;  1PA6 A;  4IJL A;  4KI0 A;  1U0L A;  2CFM A; 
#chains in the Genus database with same CATH topology
 3CQZ B;  1Q8I A;  3PUZ A;  4JI8 L;  3J7Z C;  2EXZ A;  2Z6B A;  3W2D A;  3UE0 A;  3HP3 A;  1C8C A;  4EQP A;  1SNO A;  1KTK A;  2SNS A;  1HR0 Q;  3CC2 A;  1PZJ D;  1CZG A;  1DON A;  3H94 A;  2KED A;  1PH6 A;  2KEC A;  2JXM B;  4IFD H;  1EIF A;  2JA7 G;  1CKN A;  3MWY W;  1WFQ A;  3C46 A;  1HCZ A;  3RNU A;  3J80 c;  4X3K A;  4QL5 A;  1X65 A;  3K5L A;  4LAA A;  1SFO B;  5M5Y B;  1HZ9 A;  5J22 A;  2F3V A;  2R92 G;  5IYD G;  2X6G A;  1T5E A;  3ERQ A;  3TN2 A;  5ELO A;  2OQK A;  3MEF A;  4JI5 L;  1H9R A;  2KJX A;  2N49 A;  2UUB Q;  5JEA G;  1EQR A;  1EY5 A;  2NWG A;  1YJW A;  1FNW A;  5FLM H;  2IHF A;  3A8K E;  1C48 A;  4KK7 A;  4XDX A;  2F0V A;  3VYT A;  5IIF A;  5C4J B;  4HIO A;  4A3J H;  3RZO B;  3O13 A;  4CKE A;  2NN6 G;  2GVB A;  3L2P A;  3MFG A;  2SEB D;  3K5N A;  2F0F A;  2F0Q A;  2K04 A;  4NMZ A;  4K0K L;  2UUC L;  4IUU A;  4C3I B;  3K7A H;  1YJ9 A;  2EOT A;  1PRT C;  2L15 A;  2E2I B;  5DEH A;  4I65 A;  1VQI A;  2HQL A;  4DK6 C;  2EXD A;  3BYY B;  2M9V A;  1VQ7 A;  2CQA A;  4JBK A;  1G8Z D;  4C1N I;  1JMC A;  1IYJ B;  1EU4 A;  3NP8 A;  3L9A X;  4YY3 Q;  2PQA B;  3K5M A;  3RMH A;  3I4M H;  1V8Q A;  1QZH A;  3L0O A;  5IYB H;  3MXG A;  2YTX A;  2Z6K C;  4CKC A;  3PIO 3;  4JI5 Q;  3EQL C;  3HOY B;  1HR0 W;  4XQN A;  4JI3 L;  3HOU B;  4A3M H;  4O2D A;  1D5X C;  2NN6 I;  1TWH B;  1JIC A;  3W1G A;  1A63 A;  3K80 C;  3URY A;  2I0Q A;  3E0E A;  4DNR B;  4DPG A;  1JB3 A;  3GTO H;  2UXC Q;  4K0K Q;  2UUC Q;  1WVL A;  2JA6 G;  1Q46 A;  1D8L A;  3EVQ A;  2F03 A;  1E7Z A;  1NAP A;  5GAG C;  1PFB A;  4HED A;  5KEE A;  1SRO A;  1YHB A;  2UUA Q;  5HY6 A;  4K14 A;  1Y1V H;  2Q2H A;  5EKK A;  2KUM A;  5CBA E;  3CQZ H;  4QB4 A;  5IE8 A;  1CT1 D;  2F0S A;  4EQO A;  4DV4 L;  4JC0 A;  3U9O A;  3J81 L;  3KJO A;  5CC4 A;  3CRK C;  2Z4H A;  1HJP A;  2VQF L;  4FNF A;  4YWM A;  2PZT A;  1RJT A;  2ZJP A;  4KHV A;  3K57 A;  1KD1 C;  4LFC L;  4CBV A;  3WOE A;  3E9I A;  1M90 C;  4FF4 A;  2NVT B;  2EJG C;  1BVS A;  1R9T H;  2AQ2 B;  2RQX A;  5M5Y H;  3CCL A;  1BXT A;  2JSO A;  1STE A;  2LXK A;  4JI3 Q;  3BVZ A;  3GTG B;  3BYT B;  5I6Y A;  2K6A A;  1WTQ A;  3DWQ A;  1OXS C;  4GN4 B;  4UP9 A;  3KOJ A;  4DV5 L;  5G3L F;  4BBR G;  2L0C A;  2F0H A;  4PZ8 A;  2DY8 A;  3NPP A;  4RKL A;  4GKK L;  2I5M X;  2OXP A;  2WKD A;  3WOF A;  4C3I H;  4RHS A;  2WAC A;  4K2K A;  3DEP A;  3GTQ B;  2LKV A;  2VQF Q;  3SK6 A;  2RSN A;  1YEZ A;  4NKL A;  2D62 A;  2AKW B;  4S3S A;  4JCV E;  2V1C C;  1E2W A;  2HCC A;  5DAU A;  4A3L H;  3OW7 A;  3SK5 A;  2F0M A;  1ILQ A;  1MIU A;  2Y0S G;  4IFD G;  4NPS A;  2KCM A;  3M3Y H;  1KDC A;  2JJQ A;  2RA4 A;  1BR9 A;  4IUT A;  4HJ5 A;  1F77 A;  1QE6 A;  4H02 A;  4FF1 A;  2DNC A;  3SXH A;  2MP1 A;  3T1H Q;  4DV5 Q;  1SYG A;  4R4C A;  3S15 B;  3GP7 A;  1I5F A;  3ERS X;  2L1B A;  2G5D A;  4B3M L;  3TME A;  1Y1W B;  3I4O A;  4GKK Q;  2BE5 D;  1Z7T A;  3MA2 B;  4DUY L;  4ABN A;  2D0O A;  5FLM G;  4A3D G;  2PMZ B;  1IKM A;  1JJG A;  1Q3L A;  2B8F A;  1B2T A;  1ZEQ X;  2EZV A;  1RTN A;  4A3J G;  3EA6 A;  1SE8 A;  2HT1 A;  3JAM E;  5C0X J;  1BCP D;  5D65 A;  2PYK A;  4CDF C;  1NJI C;  4V19 0;  4J6H A;  1WCM B;  4IFD I;  3BVM A;  1EWC A;  1C0A A;  5COR A;  4C2M B;  1FL0 A;  4A3B H;  1SBB B;  1H9M A;  4DAY B;  2BDO A;  1ROD A;  5BN4 A;  5HGQ A;  2IY5 B;  1K83 B;  3A5Z B;  1B9N A;  4OO1 I;  1D5M C;  4ME3 A;  2PQA A;  1X32 A;  3A55 A;  2QEJ C;  4C3J H;  3CF5 A;  1UE5 A;  1H9K A;  1A2U A;  2JQO A;  1B3A A;  1H95 A;  3UI2 A;  4B3M Q;  4IUP A;  1G2T A;  5IYB G;  1K3R A;  2QEX A;  3W3A A;  3AB9 A;  1Q81 C;  4QF4 A;  4PMW A;  4DUY Q;  4BY7 B;  4G7H C;  3M4O H;  4FF3 A;  4LF9 Q;  1B3Q A;  5JPN C;  3GO5 A;  4A3M G;  3S1Q B;  5FO8 B;  1VQP A;  4I7Z C;  1IBM L;  3H0G H;  1XMQ Q;  2K5H A;  1EYC A;  2DUD A;  4OXP A;  2K5N A;  2E74 C;  3CKI B;  3GTK H;  3GV3 A;  4HAE A;  4IPH A;  4JI7 L;  5M5X H;  3FDT A;  1S5D D;  1D1I A;  4R4O A;  3OSO A;  1Y1V G;  1F9R A;  1B53 A;  3T16 A;  3I4N H;  2EDG A;  5EPL A;  1I4H A;  4LJZ C;  3L3O C;  1BDO A;  5CV6 A;  3OWF A;  3J81 E;  1G29 1;  1UAP A;  4QUF A;  3OW2 A;  2NVQ B;  2B2V C;  2C9O A;  2IHE A;  5EPJ A;  1PRT D;  4IJH A;  5GRO A;  2FIN B;  3J80 L;  4HMI A;  4XQJ A;  3RLN A;  1LYL A;  3ER0 A;  2KCT A;  1OXV A;  3OIP A;  1JCK B;  3UDF A;  1SAP A;  2NTS A;  5CR3 A;  5JVG 3;  1KAB A;  3D4D A;  4DR7 L;  2JYO A;  5JJZ A;  2NZO A;  1SMY C;  1IW7 C;  2A6H D;  2EY5 A;  1Q90 A;  4J1M A;  2K01 A;  3VYU A;  4RGN A;  1MSH A;  3LWE A;  2JA7 B;  2KHJ A;  1E1O A;  1M8A A;  3OMG A;  2GN5 A;  1QWY A;  1IBM Q;  2YV5 A;  4P73 A;  4DR4 L;  5EKI A;  1G51 A;  1IBL L;  4DR3 L;  2B29 A;  1I4G A;  2WII B;  1Q1B A;  2XRQ D;  5F2D A;  4DXG A;  2YYZ A;  1VQM A;  5JJK A;  1A3T A;  2A69 D;  1JOQ A;  1IL2 A;  2VQE L;  4LF6 L;  5CV5 A;  1DJR D;  1V9P A;  4C3I G;  2ZTE A;  4RH6 A;  2ENB A;  3OMC A;  1PTO F;  1VMC A;  4C2M H;  4GN3 B;  3KLW A;  3I2Z A;  3OYY A;  1K83 H;  1UEB A;  2K33 A;  1SNC A;  1TII D;  2DY7 A;  3TZD A;  2N78 A;  4LFA Q;  4KMU C;  3R3O A;  1HZC A;  1E24 A;  1CHP D;  3G6J B;  4C3H H;  1WTH A;  1WTX A;  4C56 C;  3I90 A;  4P74 A;  2PO4 A;  3T1Y L;  4K2L A;  1S3O A;  4H13 C;  2ZJQ A;  1F2M A;  2VB3 X;  4QIW E;  4DR4 Q;  3J81 j;  3B6Y A;  1IBL Q;  3S17 H;  1PH5 A;  3HOU G;  3HOZ H;  1EOV A;  4XYO A;  3J7A F;  2Y0S E;  3NTK A;  4JG2 A;  4UHV A;  4NXM L;  3DUZ A;  2VQE Q;  4LF6 Q;  3NEM A;  3PIP A;  2EYM A;  5FLX c;  3F2D A;  3S1M B;  1TS2 A;  3E6Z X;  4V0B A;  1U9R A;  1K8A C;  1B44 D;  2X69 A;  2V4D A;  4Y7N H;  2HHH Q;  4RMF A;  3GTL B;  5C3X A;  3DM3 A;  1HUM A;  1UE1 A;  2R6G A;  1RIP A;  5EAY A;  4IUR A;  4TSS A;  2XIW A;  2XWB B;  1P8L A;  4GLX A;  1ASY A;  1VQO A;  1X56 A;  1I4P A;  5CV4 A;  3BS1 A;  2JA6 B;  2E2H B;  4DAY A;  1AE3 A;  1HH2 P;  1MKH A;  3ITP A;  2RHQ B;  2VUM H;  3T1Y Q;  3PO2 H;  5ELN A;  1KQS A;  4HR7 B;  1TWG B;  2F0L A;  1R4P B;  2PI2 E;  1JOK A;  2EVB A;  1PDQ A;  2ZM6 L;  4JI4 L;  4TVA B;  4YHH Q;  4B9W A;  1SYC A;  5AJ3 L;  4NXM Q;  1EQV A;  3HRZ C;  3VA7 A;  4YWL A;  2KEE A;  2I46 A;  4OL7 A;  3JAM i;  3GTM H;  2WAQ B;  1PTO H;  1PH4 A;  2DJG C;  2JEB I;  4OGQ C;  1G6Z A;  3ULL A;  2K5D A;  3KDF B;  5CV8 A;  1U0L A;  2CFM A;  1PH9 A;  5LL6 X;  4HJ7 A;  1S40 A;  4BBR B;  1PH7 A;  2B2W A;  4JI0 L;  3CPW A;  3CME A;  1GUO A;  4A3C H;  3SR1 A;  3AMU A;  4JI6 L;  5HUR A;  1D5Z C;  5C0X G;  2A8V A;  3PF5 A;  1ASZ A;  2EY6 A;  2K52 A;  4OEM B;  4ZAI A;  2ZM6 Q;  1K0S A;  1A6X A;  3J80 E;  2HCI A;  1Q8K A;  1NBW A;  1RD9 D;  4G7O C;  1ZYR D;  2HDL A;  3TDQ A;  2HQE A;  4LUZ A;  1SJE D;  4RGT A;  4QIW B;  1QOH A;  4CHT B;  1E3P A;  3K0X A;  4PQX A;  4RFB A;  1OXU A;  2E8G A;  2Q2I A;  2AQ1 B;  1KNA A;  1JJ2 A;  2XRS D;  2F0I A;  3FEW X;  3FVQ A;  4ZLT F;  3GV6 A;  2EYO A;  4RGM A;  3G7L A;  1JJC B;  1II3 A;  3HKZ B;  3J81 i;  1QJO A;  4ID6 A;  3R93 A;  2CQO A;  1QZG A;  3K81 C;  4FP5 D;  4JI1 Q;  3ND8 A;  3BU2 A;  4LMQ D;  2DGY A;  1BBU A;  3DLL A;  1WCM G;  1W3S A;  5FJ8 H;  3K7U C;  3AQQ A;  3TS0 A;  4DUZ Q;  3KJP A;  1F2Y A;  2JK8 A;  4A3J B;  4OX9 L;  3PQI A;  5EBD A;  2R61 A;  3H91 A;  2UXD L;  5D14 A;  1UWV A;  4GS3 A;  4KD3 A;  2AQ3 B;  2ALY B;  4HJA A;  4RCN A;  3VA5 A;  4C3H G;  4DAV A;  2Z0S A;  1HUN A;  4F88 A;  2IX1 A;  3A56 A;  2E76 C;  1VQ9 A;  1H9S B;  3NK9 A;  3QWN A;  3V96 A;  2RBM A;  4BY7 G;  1TS3 A;  1S5F D;  1RKN A;  4IQZ A;  4UDU C;  2F0T A;  2MFI A;  2FMC A;  1XTC D;  1BUV T;  1FYC A;  3DWP A;  3HOZ G;  2BE5 C;  1FGU A;  1VCI A;  2AUK A;  1X54 A;  4K5W A;  3I4M B;  1D2B A;  2NUC A;  1WD1 A;  1IW7 D;  3HZX A;  2KBN A;  4HN7 A;  5KGU A;  4A76 A;  3NE5 B;  4JOI C;  4DK3 C;  1LV9 A;  1D7Q A;  2XN9 C;  5EQ0 A;  2B2W C;  2EY1 A;  3WWV A;  3PO3 H;  1CA6 A;  3Q6S A;  4A3M B;  1VQF A;  3CCE A;  1BCP C;  2E5L L;  3D6W A;  4OX9 Q;  3GTO B;  2AWO A;  1N8R C;  3S2D B;  1IHZ A;  4DV1 L;  1NR2 A;  4TKO B;  1TWF H;  1B70 B;  3PIP 3;  1D6E C;  1XMO Q;  2VUM G;  4RGO S;  3PO2 G;  1Y1V B;  2ID0 A;  1FNU A;  4DXF A;  4ME5 A;  2BH8 A;  2C35 B;  2VNU D;  2M00 A;  3GQB A;  3HG9 A;  2J0T D;  4CJ1 B;  1HFN A;  2CKZ B;  2F3W A;  4ZKC B;  5EKL A;  4GZY C;  5BN3 A;  4LUV A;  3QB3 A;  1KDB A;  4OO1 H;  1R9T B;  3CCS A;  4DNI A;  4L5R C;  3RLF A;  2HD3 A;  5FOB B;  1WI5 A;  4U68 A;  1QVF A;  1KL9 A;  4WRD A;  3KDF A;  1XPO A;  4A4I A;  3I55 A;  3R2T A;  2F0U A;  4G4K A;  4YWK A;  1VQD A;  4KHP L;  1X3E A;  5EPK A;  2K50 A;  2KOL A;  4DV1 Q;  5M9O A;  3RN5 A;  1KLU D;  2MO1 A;  4CJ2 C;  2DJF C;  1ONL A;  3NSW A;  1HTP A;  4MHE A;  3P7J A;  3U9S A;  4JI8 Q;  2MHV A;  2NVX H;  1I6V C;  2H1E A;  4ILW A;  4EVO A;  1STH A;  1EY7 A;  1O7Z A;  2KQ3 A;  2L55 A;  1CM9 A;  3CC7 A;  4EQ5 A;  4POF A;  4PV1 C;  2A6H C;  5ISR A;  3H3V H;  4FYD A;  5G3L D;  1G91 A;  2L4N A;  1I4Q A;  5KIX A;  3M3Y B;  5FLX L;  4OHJ A;  3QOJ A;  1TKW B;  3STB D;  1Y8P B;  3M4P A;  1U4L A;  3E0J A;  4KHP Q;  1GUT A;  1LUZ A;  4ZRZ A;  5T1I A;  4KHZ A;  1QUQ B;  2A69 C;  3PUW A;  3QIA A;  4X3S A;  2H5X A;  4GNX B;  2JEA I;  3VDY A;  4KJO A;  3J80 i;  1YIT A;  3A5U A;  1WTR A;  4XXE A;  5GAE C;  3J7A V;  3NWT A;  3S2D H;  2L5T A;  1P16 A;  3V2T A;  5IGF A;  2QDB A;  1ET9 A;  1SYE A;  2PMZ E;  3SHL A;  4MIU A;  2IT1 A;  2PI2 A;  5IGG A;  2Z4I A;  1O80 A;  2L12 A;  3FPU B;  1EIH A;  1DZ1 A;  2PCF B;  2F1M A;  3S14 B;  4A93 H;  4IUN A;  1PV4 A;  3C1E A;  1VQK A;  4A3B B;  1A0I A;  1H9S A;  1NTG A;  3S24 A;  3CCR A;  3U4V A;  1HFG A;  3NHH A;  1N36 L;  1STG A;  5I6W A;  4DV7 L;  2BCO A;  3BZD B;  3NUC A;  4C3J B;  4DAM A;  2WAQ G;  4R4Q A;  1VQE A;  4LW1 A;  1EY8 A;  1VQ4 A;  4KN4 C;  1XYI A;  2K5Q A;  1Q7Y C;  4L8J A;  3BJU A;  5IGC A;  3S2H H;  3M4O B;  3CP0 A;  3I56 A;  1HNW L;  4LK1 C;  1E1T A;  2O5I C;  3PO3 G;  1M4V A;  4RAU C;  3NEN A;  4H7B A;  3BG3 A;  2F52 A;  4JBW A;  2AUJ D;  3H0G B;  4FVM A;  3AEV A;  4QY7 A;  1LAB A;  4JW0 A;  1IYV A;  2X6L A;  4L5T A;  4DV4 Q;  1EY6 A;  4L5Q A;  3U50 C;  3GTK B;  1QG7 A;  1SN8 A;  1VQC A;  5M5X B;  3NEL A;  1CFM A;  5ELE A;  3TSS A;  5L37 A;  1HPC A;  3I4N B;  4QMG A;  1JC7 A;  1U5K A;  2QGQ A;  4LFC Q;  4O42 A;  3SE0 A;  4NXN L;  5CGK A;  1N36 Q;  2NYZ D;  1GUW A;  1EU3 A;  4DR2 L;  1VQL A;  2JA8 H;  5E4W C;  1U4M A;  1PMR A;  1WOC A;  2Q8R E;  4DFA A;  4IZ8 A;  4Q0F A;  4U67 3;  1O78 A;  4ULL A;  4OO1 G;  4KY7 A;  2OT2 A;  3BZK A;  3W5O A;  1AEX A;  4EX5 A;  3C2P A;  1GHK A;  3HKZ G;  1LTL A;  1HNW Q;  5J3B A;  3IFD A;  4A3K H;  3S16 B;  3HS0 C;  4G7Z C;  4GN5 A;  2I07 B;  4PMC A;  4OIK A;  3TP7 A;  4FXD A;  1DM0 B;  1C4Q A;  4LF7 L;  1CZW A;  2IL8 A;  4JV5 L;  4B3R L;  1FGB D;  3M85 A;  4ZKB B;  2NB0 A;  4WJW A;  3GTP H;  1VF7 A;  1VS0 A;  1RF2 D;  1SXT A;  5LMN L;  2EIF A;  2K75 A;  4NXN Q;  2EYP A;  3S14 H;  2RF4 A;  1A62 A;  1ZYR C;  4DR2 Q;  3PCO B;  3T4A C;  2N3S A;  2VL6 A;  2YU9 H;  1RTO A;  5GAH C;  1AFP A;  5IYC H;  1VQJ A;  2K7V A;  3D4W A;  3M7G A;  4I7A A;  1C7Y A;  2K14 A;  1XNR L;  2I5L X;  2MUY A;  5IOD A;  3P1H A;  1S4Z A;  4HMJ A;  1MI2 A;  1Y14 B;  5IY0 A;  4FXK C;  4C3H B;  2O4X A;  2ZXP A;  1BKB A;  3DWA A;  5ELC A;  3V05 A;  3I4M G;  4BBS H;  3S1R B;  5FLX E;  2R93 H;  2NBF A;  3LGJ A;  1OXX K;  4DR6 L;  4E6I A;  1KNE A;  1LLR D;  1AP0 A;  3C1F A;  5TSS A;  3HOW H;  3KF8 B;  1CKO A;  1CSQ A;  1QUQ A;  1FD7 D;  1W2B A;  3S17 B;  1TT2 A;  1JQY D;  1W6J A;  3HOZ B;  1EYA A;  4GNX A;  1IBK L;  3VR4 A;  4JV5 Q;  4B3R Q;  1CQF A;  1SEB D;  3KLR A;  5JJI A;  1A15 A;  4N8X 1;  1L0Y B;  2A19 A;  4DV2 L;  2F0P A;  2D0P A;  2RDG A;  5LMN Q;  1MHW C;  4B9X A;  3MEH A;  4X3T A;  2ZXO A;  3KBG A;  1SRU A;  2K32 A;  4OWT B;  3FPP A;  1JOO A;  5E1F A;  1ZKO A;  2MGS A;  1K9M C;  4Y7N B;  1B4O A;  3KLS X;  5EGT A;  4ALP A;  1SYD A;  1XNR Q;  3NXW A;  2R7F A;  3H3V I;  4DA2 A;  1TY0 A;  2WFW A;  2D9U A;  2Q2U A;  5DM7 3;  4DAP A;  4A93 G;  4BXX H;  2ZTD A;  3I4L A;  5D3I B;  1KHI A;  2H4O A;  1DD2 A;  1LTA D;  1EY0 A;  2VUM B;  3PF4 A;  3PO2 B;  2YTY A;  4XYQ A;  4DR6 Q;  3M4Y A;  4KI0 A;  1GHJ A;  4A3E B;  1GOZ A;  1LTI D;  4QCL A;  4R8I A;  4B08 A;  3S16 H;  2A74 C;  2AHO B;  4HSV A;  1STN A;  1JR0 D;  3K58 A;  4DV2 Q;  4KN7 C;  1TS5 A;  3GTM B;  1PTO B;  2WAQ E;  4JI7 Q;  2SDF A;  2K05 A;  1TU2 B;  1SNQ A;  2ES2 A;  1L1O B;  4ZCK A;  3MHB A;  3CPF A;  2CW0 C;  4X66 L;  5I9P A;  2MJ8 A;  1DOM A;  5CBE E;  1EFI D;  1N9W A;  2A1A A;  1EIY B;  3BDO A;  1GJX A;  1FVI A;  2I5H A;  3ULP A;  1TXY A;  1F2Z A;  1TWA B;  3Q23 A;  1T5X D;  1DOK A;  2QF7 A;  5AFW A;  5LMN W;  1I3Q H;  3RZD H;  4A3L G;  1TWC H;  4NB3 A;  3DM1 A;  1AZQ A;  4TRD A;  2F3I A;  4DR7 Q;  3PSI A;  4PNY A;  2TSS A;  3S1R H;  3DHQ A;  4M1U B;  1JWM D;  4LFB L;  4DV6 L;  1QNU A;  3GDE A;  1O7Y A;  3PUX A;  4MN3 A;  4JI2 L;  4A3G H;  3RN2 A;  4DR3 Q;  3HOX H;  4A3K G;  1VQB A;  2EJF C;  1ZXT A;  2YTV A;  5C4H A;  2BA1 A;  3JAM c;  5K36 H;  3NBI A;  1STB A;  4X66 Q;  1PH1 A;  2F4V L;  1LTG D;  1LT6 D;  1E0B A;  2CHB D;  3LWU A;  4MTK A;  1CA5 A;  3HFZ B;  5K5P A;  1EFW A;  1LTR D;  1QVG A;  2HIX A;  4MNO A;  3HKZ E;  1PRT F;  1DXM A;  2A68 D;  1WTO A;  4KY5 A;  4NDX A;  4KKT A;  1AE2 A;  1I94 L;  1GUN A;  3N52 A;  1BBX C;  1GXD C;  1PYW D;  3EFX D;  2BDN A;  3FKI H;  1VQ6 A;  3H15 A;  4A3B G;  4XTC S;  5IGD A;  2N8N A;  3RUZ A;  5IYC G;  1N34 L;  4A3I B;  1TR5 A;  5JVH 3;  3T51 B;  1HZA A;  1XNQ L;  2R7D A;  4LFB Q;  4K8J A;  1F9P A;  4C3J G;  5D3D A;  4A3E H;  1I50 H;  4JI2 Q;  1A3U A;  1U4R A;  3FHW A;  4ZYS A;  2EYL A;  5DLQ E;  3RD4 A;  1VQH A;  3CXC A;  3K59 A;  1LTT D;  3EJI A;  2R93 G;  3IRB A;  3STB C;  4AYB E;  2F0O A;  3KF8 A;  3HOW G;  1S5C D;  1XXG A;  1O7I A;  1RCV D;  4LUO A;  4JBM A;  1XX8 A;  5IGE A;  2CWA A;  3H0G G;  4BWG B;  1XPR A;  4L6T B;  2K03 A;  4PMB A;  3J81 c;  1CI3 M;  1I94 Q;  3TP8 A;  1QCB D;  4OIJ A;  1X55 A;  1ICW A;  2LSS A;  3I73 A;  4DV0 L;  3CHB D;  3PO3 B;  1QVC A;  5KYI A;  2PPB C;  1TWA H;  4YIJ A;  1LO5 D;  4KJN A;  4UY8 C;  3PUY A;  3I4N G;  3OHX C;  1XNQ Q;  1KAA A;  4DV3 L;  5NUC A;  3ULJ A;  2FHT A;  2L11 A;  1BNZ A;  1F9Q A;  4JI4 Q;  1SYB A;  1TWF B;  4A75 A;  3IKJ A;  1LAC A;  4XIG S;  2IJ0 A;  3X3N A;  2ZXR A;  1Q12 A;  1L2F A;  1ENA A;  5EBC A;  5AJ3 Q;  1Z6H A;  3KLS A;  1XPU A;  3HGB A;  1BO0 A;  3OTO L;  4DK1 A;  4ZUJ A;  1N32 L;  1ENC A;  2EE1 A;  2EJM A;  1VQ8 A;  3J7A 5;  1HZB A;  2GVA A;  2K5W A;  2PW7 A;  1RL2 A;  2Q8I B;  1YZ6 A;  2LY7 A;  4ZUI A;  3D31 A;  2PW5 A;  3PV0 A;  5FO7 B;  3CC4 A;  3CCJ A;  1SNM A;  1VQN A;  3A0J A;  3K6O A;  2KCC A;  4JI0 Q;  1AW7 A;  2VW9 A;  1J6Q A;  5IGB A;  1L1O A;  3I3C A;  3A8I E;  4EQN A;  3MXN B;  3VR2 A;  4JI6 Q;  3MFY A;  3IL8 A;  3BZC A;  3TP5 A;  1Q82 C;  2O2L D;  1BF4 A;  2C5C A;  3R2I A;  2B63 H;  1NUC A;  4A3I H;  5C3E H;  1PFN A;  4IOA A;  1A3V A;  3FMC A;  1A8V A;  1HXY D;  4F87 A;  1MGS A;  2NVX B;  1KRS A;  3OTO Q;  4DN4 M;  1IL8 A;  3WDN A;  3AYH B;  4JK1 C;  1EY9 A;  2KVM A;  4L5S A;  3A54 A;  5C5M A;  1YBY A;  2RDH A;  4AYB B;  5I9O A;  5M3M B;  2HUG A;  2JP1 A;  3NQI A;  4A3G G;  3F2C A;  3HOX G;  2F0N A;  1CQV A;  2R3Z A;  4CKB A;  3LNN A;  3FRP B;  1NE3 A;  1R4Q B;  3KBX A;  3M9B A;  1K73 C;  5K36 G;  1TS4 A;  1F2L A;  2CWP A;  3UDX A;  2QCP X;  2Q2T A;  1S5E D;  1V1Q A;  1DCZ A;  1JOR A;  1NMF A;  1PH3 A;  1W6K A;  3ND9 A;  4UP8 A;  1KDA A;  1KLG D;  2B2T A;  4R4I A;  1GVP A;  1QB5 D;  2UXD Q;  1EIG A;  4LF5 L;  2CH4 W;  1KAW A;  3CCQ A;  3NQT A;  2CW0 D;  3CMA A;  2Z6K A;  3HEJ A;  2L9H A;  2RSO A;  3FKI G;  3TQY A;  2RVL A;  2Z8L A;  1T9H A;  4GLV B;  5C4Z A;  5I2Y A;  2OQ0 A;  2MQH A;  1MJC A;  2A5H A;  3E5S A;  4XQQ A;  2VY3 A;  4A3E G;  3F2U A;  4UPA A;  1TY2 A;  3M4Q A;  4KTA A;  4BY1 H;  2F0K A;  4DR1 L;  1NSN S;  4A93 B;  1V43 A;  4UAI A;  3ZJY C;  1WJJ A;  4KKS A;  1TQO A;  3K0Y A;  3P20 A;  4G57 A;  4RKB A;  2F0G A;  2VZA A;  3E3X A;  2OEO A;  2K4K A;  5I2X A;  1HNZ L;  1Q1E A;  2WV6 D;  5KNC A;  1PTO C;  2B39 A;  2ZT9 C;  1E22 A;  2SNM A;  2WIN B;  1L1O C;  4OON A;  2E5L Q;  3TP6 A;  2A73 B;  3D0F A;  2PNH A;  4LF5 Q;  1VQ5 A;  5E4X A;  3S2H B;  3KF6 B;  2BOS A;  3I7F A;  4YY3 L;  3SK8 A;  3TBI B;  2B2Y A;  2E2J H;  4A3C G;  2OWO A;  1LTS D;  4IAL A;  3U4Z A;  1X3G A;  2VXW A;  1SLJ A;  2B8G A;  4K8I A;  1OTC A;  1EWH A;  1MBY A;  4PG3 A;  3Q0A A;  4DR1 Q;  2O5J C;  3UE1 A;  4K5V A;  5JAV A;  3TZU A;  5M3M H;  1X3P A;  4A3D H;  2IX3 A;  3DMU A;  1PZK D;  2GA4 B;  4XT1 B;  4C1N K;  2UU9 L;  4QGU A;  1HNZ Q;  2JA8 B;  2UXC L;  2D5D A;  3JAM L;  1J5E L;  2RHS B;  3MXU A;  1IKL A;  1EL0 A;  1DGS A;  1NMG A;  3MTS A;  3G4S A;  4OEL B;  2FJ2 A;  2OCE A;  1GUS A;  5JOB A;  1BQQ T;  4PZ7 A;  2FFK B;  2UUA L;  5IT9 c;  1NCV A;  5FKA C;  4HIK A;  1CK1 A;  1J8I A;  4A3K B;  1LT4 D;  3MXN A;  5CMD A;  4K6D A;  4RA8 A;  1I6H H;  1V1P B;  4WFN 3;  1PFM A;  4GKJ L;  2B2T C;  1GD7 A;  4RCO A;  2DN8 A;  4QJF A;  5FJ8 G;  4K5X A;  3S1N H;  2B63 G;  4A3I G;  5C3E G;  4H0L C;  4LF4 L;  1UNS A;  2P5Z X;  2VB2 X;  2LS0 1;  1CSP A;  3GTP B;  3IFT A;  3OWE B;  2UU9 Q;  4HIM A;  3W1B A;  2QIL A;  1B7Y B;  3K8A A;  2XVS A;  2YU9 B;  1J5E Q;  1ICF B;  1A2T A;  3CD6 A;  4CDC C;  3G71 A;  4IPD A;  1EQQ A;  3MC0 B;  4RWS C;  2HIV A;  3A7A B;  3Q8D A;  4BS9 A;  4X3U A;  1NNX A;  2K1B A;  4CJ0 B;  5BN5 A;  3GTJ B;  1LT3 D;  2NZ1 D;  5H1S E;  2R7Z B;  2RDF A;  4KY6 A;  1K0R A;  2KCN A;  1CTM A;  3PMF A;  4BBS B;  2R93 B;  4IO9 A;  2A6E D;  1B1Z A;  1UE6 A;  4GOP B;  4O0A A;  4GKJ Q;  5LL6 S;  1VMP A;  3A8J E;  4KLK A;  3HOW B;  3P75 A;  1PZI D;  3D4R A;  2A68 C;  2SOB A;  1K8G A;  1SFO H;  1SMX A;  2B2Y C;  1HRJ A;  1HNX L;  4LF4 Q;  4DR5 L;  5DM6 3;  4POG A;  1L0W A;  2IWH A;  4DGZ A;  1YNN C;  2JA5 B;  1SYF A;  4KV6 A;  1HTL D;  1PYB A;  4A3F B;  3T1H L;  1C9O A;  4FDB A;  1ESF A;  2OTJ A;  1AZP A;  4JYA L;  1PXU A;  1EY4 A;  5GAD C;  3F2B A;  2ZTC A;  2PZW A;  5C4J H;  1Y8N B;  1PHJ A;  4DV7 Q;  4WJ3 M;  3Q24 A;  4BY1 G;  3RZO H;  1B9M A;  4P2C B;  1UEA B;  4NP5 A;  1YIJ A;  2QA4 A;  3CW2 C;  4YCV A;  1N33 L;  5IWA L;  2E2I H;  2ZJR A;  5E7N A;  2JA9 A;  3AFQ A;  1JWU D;  4J15 A;  2IX0 A;  1UE7 A;  2MPM A;  1GO3 E;  3AFP A;  2MO0 A;  3H6M A;  2ATW A;  3TRE A;  2B2V A;  5C44 B;  2RCN A;  1HNX Q;  4DR5 Q;  1XJV A;  5KYL A;  3KF6 A;  3KUP A;  4O1N A;  2IW3 A;  3T56 B;  4J8Q A;  2LXJ A;  1QNK A;  3CCM A;  3HOY H;  3MVV A;  1EZ6 A;  4LNQ A;  4M8A A;  4JYA Q;  3G48 A;  3HOU H;  3U58 A;  3H09 A;  4Z9C B;  1TWH H;  4GLA C;  5CV7 A;  4AH6 A;  3PGZ A;  1Y69 U;  4AYB G;  4LF9 L;  5DNF A;  5IP9 H;  1YNJ C;  5M3M G;  5M3F B;  2KHS A;  3MXP A;  1BOS A;  5BR8 L;  4HCS A;  1N33 Q;  5IWA Q;  4HTH A;  3RLO A;  1XWE A;  3SVM A;  4X6A H;  1YI2 A;  1I3Q B;  5C4X B;  3RZD B;  3GTJ H;  1XMQ L;  1GUG A;  1TWC B;  2R7Z H;  3H3V C;  4YCU A;  3HOV B;  1YJN A;  4AQY L;  2AMC B;  4IUV A;  2B2U A;  1QIL A;  4RG1 A;  3FP9 A;  1MD2 D;  5LHY 1;  3NTI A;  3TS2 A;  1VDZ A;  3IAY A;  2KA7 A;  3SEB A;  4A3G B;  2E2D C;  3VR6 A;  3HOX B;  1JWS D;  4LF7 Q;  2NVT H;  5FO9 B;  1PTO D;  1V1P A;  4XT3 B;  1ENF A;  4FXG C;  3N6R A;  1EUJ A;  3GTG H;  1LT5 D;  2JA5 H;  5C3W A;  2BH2 A;  4CDD C;  2NTT A;  4A3F H;  1WYD A;  1EQT A;  2EY2 A;  4DF7 A;  2WB1 G;  1PFS A;  1RHP A;  3NWS A;  5KRU A;  5BR8 Q;  2G9D A;  3JC6 6;  5JJL A;  2D2C C;  3GD7 A;  4R4T A;  2JE6 I;  5IP7 H;  2FXQ A;  2EYJ A;  3FKI B;  1MSG A;  1LM0 A;  4AQY Q;  1FJG L;  3I72 A;  3F8T A;  1WTV A;  3GTQ H;  5KND A;  5LMU L;  3C3L A;  1I50 B;  1YVC A;  3CCU A;  1BCP B;  2PQE A;  1PLF A;  2CVR A;  1PH8 A;  2N88 A;  5T1G A;  1YNX A;  5C0X H;  1IBK Q;  2XTI A;  1G2S A;  1I4X A;  4L63 B;  4GOP A;  2CH4 A;  5C44 H;  1LTB D;  3ERO A;  1SE3 A;  2QDL A;  1BCP F;  2EYF A;  4MTN A;  4HJ9 A;  2F0W A;  4LFA L;  1K8O A;  2XSC A;  4KD4 A;  1EYG A;  3QR8 A;  3S15 H;  4JVZ A;  1SSO A;  3QJY A;  5ELB A;  1Q86 C;  1YHA A;  4QQB X;  3BDC A;  4N8F A;  2K28 A;  3QG1 A;  2F4I A;  3NBH B;  4X62 L;  1Y1W H;  2NVY B;  1B50 A;  1NR4 A;  1EEF D;  1FNV A;  3D6C A;  3T13 A;  1JE5 A;  4APV A;  4DK0 A;  5M3F H;  3VR3 A;  4DNT B;  1KXL A;  1FJG Q;  4CDE C;  3OIQ A;  3CCV A;  5C4X H;  5LMU Q;  2R92 B;  2XWJ B;  3X3M A;  3UDI A;  1EEI D;  1S5B D;  2JA8 G;  5M5W B;  3SGI A;  3HOV H;  1M1K C;  3DEO A;  3BVG A;  1WCM H;  2Q8T A;  5IT9 L;  2WP8 J;  2B2U C;  5KNB A;  4X64 L;  2FMM A;  2HHH L;  1K3B C;  1GKH A;  4JBJ A;  5E3F A;  4IN3 A;  2NZH A;  4UP7 A;  4EGV A;  1PYS B;  5ELD A;  1AN8 A;  4TQU S;  1TVX A;  1AH9 A;  2ASB A;  4GNX C;  3I91 A;  4ZK9 B;  1PVO A;  1ET6 A;  4P72 A;  1PRT B;  1B8A A;  1K8M A;  3I8Z A;  5CYU A;  1STA A;  2JN4 A;  4IOC A;  1VQG A;  5J1Z A;  2UXB L;  1HQR D;  4K6L A;  4YCW A;  1SE2 A;  4X62 Q;  1KRT A;  1JB7 A;  2CCZ A;  4MZ9 A;  4Y52 H;  1YHQ A;  3HOY G;  4BY7 H;  3VR5 A;  4ZQ3 A;  4R1J A;  4YHH L;  3OOC A;  2AWN A;  4H44 C;  3F1Z A;  2RKS A;  3S1Q H;  1SNP A;  4PZ6 A;  1H9J A;  1VQA A;  1K28 A;  5JEA J;  3VYS A;  1YNN D;  1ML0 D;  4Q5V A;  2MNA A;  3EN2 A;  5IP9 G;  2B63 B;  4BA2 I;  2RCF A;  3MAQ A;  2PZU A;  1X3F A;  5C3E B;  3SK4 A;  5A2Q L;  4DV6 Q;  4X64 Q;  4N9T A;  4RHR A;  1SJH D;  1HHV A;  1SE4 A;  1JE4 A;  2R7Z G;  3ICE A;  1IZ6 A;  3RR5 A;  2VS1 A;  4KKU A;  2WKC A;  4BBS G;  2NVQ H;  2J4X A;  2EYH A;  4R9W A;  4GOP C;  1CUK A;  3D8G A;  4HCE A;  3EIV A;  4HSP A;  2LFN A;  3CU7 A;  4DKA C;  3KK7 A;  2UXB Q;  2HDM A;  3VYR A;  4JPB W;  5J39 A;  1U4P A;  2F4V Q;  2TMP A;  3KYH C;  2QW7 A;  1UUP A;  1XTD A;  4B3T L;  2B3G A;  5ELF A;  2NVY H;  3UDG A;  2JA7 H;  2JA5 G;  2K5V A;  4NW2 A;  1CKN B;  3BDL A;  1Z47 A;  4A3F G;  5C5L A;  4QUC A;  3NTH A;  1DOL A;  1N34 Q;  2KHI A;  3PUV A;  4B3S L;  1ILP A;  4OWX B;  2Z9H A;  2R92 H;  1X9N A;  5IYD H;  1J9O A;  3TEH B;  1HA5 A;  1STY A;  5M5W H;  1FR3 A;  5IP7 G;  4BXX G;  4HID A;  4JOI A;  5JEA H;  3MZ5 A;  1D1K A;  4F8M A;  2F0J A;  1L0X B;  3K5O A;  2F0D A;  3A74 A;  4R8N A;  1YNJ D;  2WB1 E;  4X65 L;  2M2L A;  4WJ4 A;  1Y8O B;  1SDF A;  4JI1 L;  5HGT A;  3Q22 A;  1IYU A;  4BY1 B;  2NN6 H;  1HQM C;  4P75 A;  3LX0 A;  2A6E C;  3ONA B;  1WD0 A;  5EJW A;  5C44 G;  4IPC A;  1ESR A;  2QKI C;  4DUZ L;  3PIO A;  4B3T Q;  3S9W A;  2IPK D;  4HJ8 A;  2DNE A;  1VF5 C;  3D3R A;  1S72 A;  4DV0 Q;  1F9S A;  3NBH A;  4B3S Q;  3EBE A;  4IPG A;  3T53 B;  2Y0S B;  1Y1W G;  4DV3 Q;  2BA0 A;  5COY A;  2ICI A;  3R8B A;  4LF8 L;  3S1M H;  5M3F G;  4DU9 A;  2OTL A;  2E2J B;  2XGT A;  5C4X G;  3GTL H;  3DXJ C;  1MJE A;  2PNR C;  4X65 Q;  5C6A A;  3HOV G;  5C0X I;  1N32 Q;  3ZYY X;  2E75 C;  3OPO A;  5IT9 E;  2JA6 H;  1RDP D;  5GQO A;  4IUQ A;  2E2H H;  3I70 A;  4A3D B;  1KIX A;  1EOT A;  1JT8 A;  1OO9 B;  3J7Y W;  1O7L A;  2Z1C A;  1TWG H;  4CGY B;  3L7Z C;  3E9H A;  1I4R A;  3AU7 A;  3K7A B;  1KC8 C;  1CKM A;  2OF1 A;  4IFD J;  1SND A;  1E2V A;  1XMO L;  1PH2 A;  1DYQ A;  4N9P A;  2F0E A;  4AIM A;  4FF2 A;  4ODG A;  1IXR A;  2G9H D;  4FO2 A;  2XNA C;  3A7L A;  4P71 A;  1E2Z A;  1Z9F A;  1X6O A;  4LF8 Q;  1CHQ D;  3G6E A;  3QO2 A;  3SDZ A;  5I4D A;  1I6H B;  1HR0 L;  1EZ8 A;  2N55 A;  3KFU A;  4WOR A;  1SMY D;  2EPB A;  3QOL A;  1G6P A;  3S1N B;  1EYD A;  5FK9 C;  2LMC B;  4BBR H;  1NY4 A;  1SR3 A;  5A35 A;  5IOC A;  3CAM A;  5JPM C;  5A2Q E;  2WB1 B;  4OWW B;  2KEN A;  1EWI A;  2J7Z A;  2UUB L;  4BA1 I;  1HA6 A;  4LWC A;  1WTW A;  5CV9 A;  1GM5 A;  1BBW A;  3CRL C;  1V1O A;  3TRZ A;  3M7N A;  1X3Q A;  2EQS A;  3HKS A;  1OXT A;  4F7X A;  1PA6 A;  1WTP A;  4IJL A;  2ICE C; 
#chains in the Genus database with same CATH homology
 1PH9 A;  3PUZ A;  4JI8 L;  4HJ7 A;  1S40 A;  1PYB A;  3J7Z C;  1PH7 A;  3T1H L;  1C9O A;  4FDB A;  3UE0 A;  2OTJ A;  4JI0 L;  3CPW A;  3S16 H;  4JYA L;  3CC2 A;  1HR0 Q;  2AHO B;  1PH6 A;  3CME A;  1EIF A;  2JA7 G;  4A3C H;  1CKN A;  5GAD C;  3F2B A;  1WFQ A;  2ZTC A;  5C4J H;  1PHJ A;  4DV7 Q;  4JI6 L;  4WJ3 M;  3RNU A;  4BY1 G;  3RZO H;  3J80 c;  4DV2 Q;  4QL5 A;  5C0X G;  2A8V A;  1X65 A;  3PF5 A;  1ASZ A;  2K52 A;  1YIJ A;  2QA4 A;  2ZM6 Q;  2WAQ E;  3CW2 C;  4JI7 Q;  4YCV A;  1N33 L;  5IWA L;  2E2I H;  1HZ9 A;  1NBW A;  1Q8K A;  5E7N A;  2ZJR A;  2ES2 A;  2JA9 A;  5IYD G;  3AFQ A;  1L1O B;  4J15 A;  2R92 G;  2IX0 A;  5ELO A;  2OQK A;  3CPF A;  4LUZ A;  4X66 L;  3MEF A;  1UE7 A;  4JI5 L;  2N49 A;  2UUB Q;  5JEA G;  1E3P A;  1EQR A;  3K0X A;  1GO3 E;  1OXU A;  2E8G A;  3AFP A;  1N9W A;  2A1A A;  2Q2I A;  1EIY B;  2MO0 A;  1FVI A;  1YJW A;  3TRE A;  5FLM H;  2I5H A;  2IHF A;  2ATW A;  3ULP A;  1TXY A;  1JJ2 A;  2RCN A;  1HNX Q;  4DR5 Q;  1XJV A;  4HIO A;  5LMN W;  4A3J H;  1I3Q H;  3KF6 A;  3RZD H;  2NN6 G;  2GVB A;  3L2P A;  4A3L G;  1TWC H;  2LXJ A;  4NB3 A;  4K0K L;  2UUC L;  3K7A H;  3CCM A;  1YJ9 A;  2F3I A;  3HOY H;  4DR7 Q;  3PSI A;  1JJC B;  4LNQ A;  2L15 A;  3J81 i;  3S1R H;  4JYA Q;  3G48 A;  4LFB L;  4DV6 L;  2CQO A;  1VQI A;  1QZG A;  2HQL A;  3K81 C;  4DK6 C;  3U58 A;  3GDE A;  3PUX A;  2EXD A;  3HOU H;  4JI1 Q;  1TWH H;  4GLA C;  1VQ7 A;  3BU2 A;  4JBK A;  4JI2 L;  2DGY A;  1JMC A;  1IYJ B;  1BBU A;  3DLL A;  3RN2 A;  4DR3 Q;  1WCM G;  3HOX H;  4A3G H;  1W3S A;  4AH6 A;  5FJ8 H;  3PGZ A;  4AYB G;  2PQA B;  4YY3 Q;  3K7U C;  4LF9 L;  5IP9 H;  1VQB A;  3AQQ A;  5M3M G;  3TS0 A;  4DUZ Q;  4A3K G;  5BR8 L;  2YTV A;  3KJP A;  1N33 Q;  5IWA Q;  2BA1 A;  2JK8 A;  3JAM c;  3RLO A;  3I4M H;  1QZH A;  4X6A H;  1YI2 A;  4OX9 L;  3L0O A;  2UXD L;  5IYB H;  2YTX A;  3GTJ H;  1UWV A;  4GS3 A;  4X66 Q;  2Z6K C;  1XMQ L;  1PH1 A;  4JI5 Q;  2R7Z H;  2F4V L;  4YCU A;  2ALY B;  4HJA A;  3HFZ B;  1EFW A;  1YJN A;  4AQY L;  1HR0 W;  2AMC B;  1QVG A;  2HIX A;  2Z0S A;  4MNO A;  3FP9 A;  3HKZ E;  4RG1 A;  4JI3 L;  2IX1 A;  4A3M H;  4O2D A;  1VQ9 A;  2NN6 I;  3TS2 A;  1AE2 A;  1I94 L;  3W1G A;  1A63 A;  3K80 C;  2I0Q A;  4BY7 G;  3E0E A;  4DPG A;  3GTO H;  2UXC Q;  4K0K Q;  4LF7 Q;  2NVT H;  2UUC Q;  2MFI A;  3FKI H;  1VQ6 A;  3H15 A;  1Q46 A;  2JA6 G;  4A3B G;  1D8L A;  4XTC S;  3HOZ G;  2N8N A;  1E7Z A;  5IYC G;  1N34 L;  5GAG C;  1FGU A;  1HZA A;  1VCI A;  1X54 A;  1XNQ L;  1EUJ A;  2R7D A;  1SRO A;  1YHB A;  2UUA Q;  3GTG H;  4LFB Q;  2KBN A;  5HY6 A;  1Y1V H;  2Q2H A;  4A3E H;  2JA5 H;  4A76 A;  2BH2 A;  3CQZ H;  1I50 H;  4JOI C;  5IE8 A;  4JI2 Q;  4DK3 C;  4A3F H;  1WYD A;  3FHW A;  5DLQ E;  1VQH A;  4DV4 L;  4JC0 A;  1D7Q A;  3KJO A;  2WB1 G;  3CXC A;  1PFS A;  3WWV A;  3PO3 H;  2VQF L;  1HJP A;  2R93 G;  5BR8 Q;  1VQF A;  3IRB A;  4YWM A;  3STB C;  4AYB E;  3CCE A;  2E5L L;  3JC6 6;  2ZJP A;  1KD1 C;  4OX9 Q;  3HOW G;  5JJL A;  4LFC L;  4R4T A;  1O7I A;  2AWO A;  3GD7 A;  2JE6 I;  3E9I A;  5IP7 H;  2FXQ A;  1N8R C;  1M90 C;  4DV1 L;  1BVS A;  1R9T H;  5M5Y H;  1LM0 A;  4AQY Q;  3CCL A;  1TWF H;  1B70 B;  1FJG L;  4LUO A;  4JBM A;  3F8T A;  1XMO Q;  3GTQ H;  2LXK A;  4JI3 Q;  2CWA A;  3H0G G;  5LMU L;  1XPR A;  2VUM G;  3PO2 G;  2ID0 A;  3J81 c;  1OXS C;  1YVC A;  4GN4 B;  4UP9 A;  3CCU A;  1I94 Q;  3KOJ A;  2BH8 A;  2C35 B;  2VNU D;  1PH8 A;  4DV5 L;  4BBR G;  1X55 A;  2LSS A;  4DV0 L;  2CKZ B;  1YNX A;  1IBK Q;  2XTI A;  1QVC A;  1TWA H;  5C44 H;  4GOP A;  4PZ8 A;  3I4N G;  4UY8 C;  3PUY A;  1XNQ Q;  4GKK L;  4DV3 L;  4LUV A;  4MTN A;  2I5M X;  3ULJ A;  4HJ9 A;  4LFA L;  4C3I H;  3CCS A;  4DNI A;  4L5R C;  4JI4 Q;  3RLF A;  1WI5 A;  1EYG A;  4A75 A;  3S15 H;  1QVF A;  1KL9 A;  3KDF A;  1Q86 C;  1YHA A;  4XIG S;  2VQF Q;  1XPO A;  4QQB X;  1Q12 A;  1L2F A;  1YEZ A;  3NBH B;  4A4I A;  4X62 L;  5AJ3 Q;  3I55 A;  1Y1W H;  1XPU A;  2D62 A;  2AKW B;  4YWK A;  3OTO L;  1VQD A;  4KHP L;  1X3E A;  4JCV E;  2K50 A;  1N32 L;  2V1C C;  1JE5 A;  4DV1 Q;  4A3L H;  4APV A;  5M3F H;  1VQ8 A;  3RN5 A;  3J7A 5;  1HZB A;  2GVA A;  1KXL A;  1MIU A;  2Y0S G;  1FJG Q;  4IFD G;  4NPS A;  3CCV A;  2MO1 A;  2KCM A;  3M3Y H;  1RL2 A;  5C4X H;  1YZ6 A;  2JJQ A;  5LMU Q;  3D31 A;  4HJ5 A;  3PV0 A;  3UDI A;  4H02 A;  3CC4 A;  2JA8 G;  3CCJ A;  4JI8 Q;  2NVX H;  3SGI A;  1VQN A;  3HOV H;  3A0J A;  1M1K C;  3T1H Q;  4DV5 Q;  4R4C A;  4JI0 Q;  2VW9 A;  1J6Q A;  1WCM H;  1L1O A;  2WP8 J;  1I5F A;  4X64 L;  3ERS X;  2HHH L;  4B3M L;  3MXN B;  3I4O A;  3CC7 A;  4GKK Q;  4JI6 Q;  1GKH A;  4EQ5 A;  4POF A;  3BZC A;  4JBJ A;  2NZH A;  4UP7 A;  1PYS B;  4DUY L;  1Q82 C;  4TQU S;  2D0O A;  1AH9 A;  2ASB A;  3H3V H;  5FLM G;  4GNX C;  4A3D G;  2B63 H;  1PVO A;  1JJG A;  4P72 A;  4A3I H;  5C3E H;  1B8A A;  4IOA A;  4IOC A;  4A3J G;  1VQG A;  1A8V A;  2UXB L;  4YCW A;  4X62 Q;  1SE8 A;  1KRT A;  1JB7 A;  2HT1 A;  1KRS A;  3STB D;  2CCZ A;  5C0X J;  4MZ9 A;  3OTO Q;  3M4P A;  4KHP Q;  1LUZ A;  1NJI C;  4Y52 H;  3AYH B;  1YHQ A;  3HOY G;  4L5S A;  4BY7 H;  4IFD I;  4KHZ A;  1QUQ B;  3PUW A;  1YBY A;  1C0A A;  4R1J A;  4YHH L;  1FL0 A;  4A3B H;  2H5X A;  2AWN A;  4GNX B;  4DAY B;  2JEA I;  3F1Z A;  3S1Q H;  3VDY A;  5HGQ A;  1YIT A;  3J80 i;  3A5Z B;  4PZ6 A;  3A5U A;  2IY5 B;  4OO1 I;  1VQA A;  5GAE C;  4ME3 A;  5JEA J;  4A3G G;  3F2C A;  3HOX G;  2PQA A;  3S2D H;  4C3J H;  3CF5 A;  1P16 A;  1UE5 A;  2MNA A;  3EN2 A;  5IP9 G;  4BA2 I;  1NE3 A;  1X3F A;  2PMZ E;  2JQO A;  1H95 A;  3M9B A;  1K73 C;  4DV6 Q;  4X64 Q;  5K36 G;  2IT1 A;  2PI2 A;  2CWP A;  4B3M Q;  5IYB G;  1K3R A;  2QEX A;  2R7Z G;  3UDX A;  1Q81 C;  2Q2T A;  1V1Q A;  3ICE A;  1IZ6 A;  4PMW A;  4DUY Q;  1NMF A;  2VS1 A;  3RR5 A;  1PH3 A;  3M4O H;  4BBS G;  4LF9 Q;  4A93 H;  1PV4 A;  2NVQ H;  1VQK A;  1A0I A;  3GO5 A;  1NTG A;  3S24 A;  1CUK A;  4UP8 A;  4GOP C;  3CCR A;  4A3M G;  4R4I A;  3U4V A;  3EIV A;  1GVP A;  2UXD Q;  1VQP A;  4DKA C;  1IBM L;  3H0G H;  1XMQ Q;  2K5H A;  1N36 L;  4LF5 L;  2UXB Q;  1KAW A;  2DUD A;  4OXP A;  3CCQ A;  4DV7 L;  3CMA A;  2K5N A;  2Z6K A;  3KYH C;  2F4V Q;  4DAM A;  2WAQ G;  3FKI G;  3TQY A;  4R4Q A;  1XTD A;  1T9H A;  1VQE A;  3GTK H;  4GLV B;  4IPH A;  4JI7 L;  5M5X H;  2OQ0 A;  4LW1 A;  4B3T L;  2MQH A;  1MJC A;  2B3G A;  2VY3 A;  4R4O A;  1VQ4 A;  2NVY H;  3UDG A;  1Y1V G;  2JA7 H;  4A3E G;  2JA5 G;  3I4N H;  2K5V A;  4UPA A;  1CKN B;  3M4Q A;  1Z47 A;  1Q7Y C;  4A3F G;  4BY1 H;  4DR1 L;  3BJU A;  3S2H H;  1G29 1;  1HNW L;  3CP0 A;  3I56 A;  3OW2 A;  1V43 A;  1E1T A;  3PO3 G;  1N34 Q;  2KHI A;  3ZJY C;  2IHE A;  3PUV A;  4B3S L;  3NEN A;  4IJH A;  1WJJ A;  4OWX B;  5GRO A;  2F52 A;  4JBW A;  1X9N A;  2R92 H;  5IYD H;  3RLN A;  1LYL A;  2KCT A;  3ER0 A;  2VZA A;  1OXV A;  3TEH B;  5M5W H;  3UDF A;  3AEV A;  2K4K A;  4QY7 A;  1HNZ L;  5IP7 G;  4BXX G;  1Q1E A;  4HID A;  4JOI A;  4L5T A;  4DV4 Q;  3U50 C;  4L5Q A;  1SN8 A;  1E22 A;  1VQC A;  4DR7 L;  2NZO A;  3NEL A;  3A74 A;  1L1O C;  4OON A;  2WB1 E;  2E5L Q;  4X65 L;  4WJ4 A;  2KHJ A;  1E1O A;  3D0F A;  2GN5 A;  1U5K A;  2PNH A;  2QGQ A;  4JI1 L;  4LFC Q;  1IBM Q;  2YV5 A;  4P73 A;  4NXN L;  1N36 Q;  1VQ5 A;  4LF5 Q;  4DR4 L;  3KF6 B;  1G51 A;  4P75 A;  1IBL L;  4DR3 L;  4DR2 L;  3I7F A;  1VQL A;  2JA8 H;  2B29 A;  4YY3 L;  5C44 G;  4IPC A;  1Q1B A;  2E2J H;  2OWO A;  4DUZ L;  4A3C G;  1WOC A;  3PIO A;  4B3T Q;  2YYZ A;  1VQM A;  5JJK A;  3U4Z A;  1IL2 A;  1X3G A;  2VQE L;  4LF6 L;  1SLJ A;  4OO1 G;  4HJ8 A;  1V9P A;  3BZK A;  3W5O A;  4EX5 A;  1OTC A;  1S72 A;  2ZTE A;  4PG3 A;  4DV0 Q;  4DR1 Q;  3HKZ G;  3UE1 A;  1LTL A;  1HNW Q;  5J3B A;  4C2M H;  4GN3 B;  5M3M H;  4A3K H;  3KLW A;  3I2Z A;  4B3S Q;  3EBE A;  3OYY A;  4IPG A;  4A3D H;  1K83 H;  1UEB A;  1Y1W G;  4DV3 Q;  4GN5 A;  2BA0 A;  2N78 A;  4QGU A;  2UU9 L;  4LFA Q;  1HNZ Q;  4LF8 L;  2UXC L;  3S1M H;  1HZC A;  5M3F G;  4LF7 L;  1E24 A;  4C3H H;  1J5E L;  2OTL A;  2RHS B;  2XGT A;  4JV5 L;  1DGS A;  1NMG A;  3G4S A;  4B3R L;  3M85 A;  5C4X G;  2OCE A;  4P74 A;  3GTL H;  3T1Y L;  1S3O A;  4PZ7 A;  1MJE A;  4X65 Q;  5IT9 c;  2UUA L;  3GTP H;  1VS0 A;  4HIK A;  5LMN L;  3HOV G;  5C0X I;  2ZJQ A;  2EIF A;  2K75 A;  4NXN Q;  1N32 Q;  4QIW E;  3S14 H;  2RF4 A;  3J81 j;  4DR4 Q;  3B6Y A;  1IBL Q;  1A62 A;  4DR2 Q;  3S17 H;  1PH5 A;  3PCO B;  2JA6 H;  2N3S A;  2VL6 A;  3HOU G;  5GQO A;  2E2H H;  1EOV A;  5GAH C;  2YU9 H;  3HOZ H;  1I6H H;  5IYC H;  1KIX A;  1VQJ A;  2Y0S E;  4GKJ L;  1JT8 A;  1GD7 A;  1C7Y A;  2K14 A;  1XNR L;  4JG2 A;  4NXM L;  2I5L X;  4QJF A;  2VQE Q;  5FJ8 G;  4LF6 Q;  3NEM A;  3PIP A;  5FLX c;  3F2D A;  1Y14 B;  1TWG H;  3S1N H;  3L7Z C;  3E9H A;  5IY0 A;  1K8A C;  2B63 G;  1BKB A;  1KC8 C;  4A3I G;  1CKM A;  5C3E G;  3I4M G;  4BBS H;  4IFD J;  4Y7N H;  4LF4 L;  2HHH Q;  4RMF A;  1XMO L;  2R93 H;  3LGJ A;  1PH2 A;  1OXX K;  3DM3 A;  4DR6 L;  1CSP A;  1UE1 A;  2R6G A;  1RIP A;  5EAY A;  4AIM A;  3KF8 B;  3HOW H;  1CKO A;  1IXR A;  1CSQ A;  4HIM A;  1QUQ A;  4P71 A;  1W2B A;  2UU9 Q;  1P8L A;  1Z9F A;  3W1B A;  1B7Y B;  1X6O A;  1X56 A;  3K8A A;  4GLX A;  1VQO A;  1ASY A;  4LF8 Q;  3G6E A;  4GNX A;  1J5E Q;  1IBK L;  1HR0 L;  1AE3 A;  3CD6 A;  4JV5 Q;  3G71 A;  4B3R Q;  1HH2 P;  4IPD A;  1MKH A;  1EQQ A;  3KFU A;  2RHQ B;  2HIV A;  2VUM H;  5JJI A;  3T1Y Q;  3Q8D A;  3PO2 H;  5ELN A;  2A19 A;  4DV2 L;  1G6P A;  2D0P A;  1KQS A;  5LMN Q;  5H1S E;  2PI2 E;  1K0R A;  1SRU A;  1NY4 A;  1SR3 A;  4OWT B;  4BBR H;  3CAM A;  4TVA B;  2ZM6 L;  1K9M C;  4JI4 L;  4YHH Q;  4OWW B;  4IO9 A;  2KEN A;  1EWI A;  1UE6 A;  4GOP B;  4O0A A;  4ALP A;  4GKJ Q;  5AJ3 L;  1XNR Q;  4KLK A;  2UUB L;  2R7F A;  4NXM Q;  3H3V I;  4BA1 I;  4LWC A;  1GM5 A;  1BBW A;  2WFW A;  4YWL A;  2Q2U A;  3GTM H;  3JAM i;  4BXX H;  4A93 G;  2ZTD A;  1K8G A;  1KHI A;  1SMX A;  1SFO H;  1PH4 A;  2JEB I;  3TRZ A;  3M7N A;  1HNX L;  4LF4 Q;  4DR5 L;  2EQS A;  3ULL A;  3PF4 A;  4POG A;  3HKS A;  3KDF B;  2YTY A;  1L0W A;  1OXT A;  4DR6 Q;  1PA6 A;  4IJL A;  4KI0 A;  1U0L A;  2CFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...