4A3JK

Rna polymerase ii initial transcribing complex with a 2nt dna-rna hybrid and soaked with gmpcpp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3jK00
4BXXC 4A3GK 3RZOC 1IW7A 3RZDK 1TWAK 1Y1WK 4LK1A 3CQZC 3PO2C 3S17C 3S16K 4A3DC 1Y1VC 5C3EK 4BBSC 3I4NK 3HKZL 1K83C 4Y52K 4QIWD 5IYDC 4A3MK 1WCMC 4A3KC 4BBSK 2NVXC 4A3LC 4G7ZA 3GTMK 3S1MC 2Y0SD 3GTLC 2R92C 3HOUK 3GTGK 3S1QK 3HOXC 3PO3K 1SFOK 2B63C 2NVYK 5C44C 4A3JK 1I50K 3GTKK 5M5XK 4A3BC 4A93C 4GZYA 3GTJK 4X6AC 3HOYC 3S16C 4A3DK 1TWGC 2NVQC 3HOWC 2BE5A 1TWFC 4BY7K 2R93C 4YFNA 3H0GC 2A6EA 1TWHK 4LJZA 5IYBC 3S1RC 2R7ZC 5IP9K 3S14C 4G7OA 5IYDK 4A3KK 1YNJA 2CW0A 4BBRC 2NVXK 4A3EK 3H3VL 5IP7K 3S1MK 4A3LK 4YFKA 5FJ8K 3GTQK 3HOUC 3S1QC 4A3FK 4XLNA 3WODA 4XSZA 4NOIA 1SFOC 1BDFA 2B63K 1I6HK 3GTOC 4KMUA 3GTPK 3K7AC 4Q5SA 3GTJC 2E2JK 3HOZK 4ZH4A 4A3CC 4BY1K 1TWGK 4C3JK 4G7HA 2E2HK 2JA8K 3M4OK 5C4XC 3H0GK 2WAQL 3DXJA 4LLGA 4C2MK 4QJVA 1R9TK 3S17K 3FKIC 1TWCC 4A3EC 5IP7C 4XLPA 3S2HK 5C4JC 4A3MC 4Q4ZA 5FLMC 1ZYRA 4KN4A 5IYCK 1I3QK 2Y0SL 4XSXA 3M3YK 4OIQA 4OIRA 3GTPC 1I6VA 3K7AK 3S2DK 3S1NC 4BXXK 3GTLK 1HQMA 3RZOK 4OIOA 4A3CK 3S14K 5D4DA 4A3GC 4BY1C 3PO3C 3CQZK 3PO2K 5M3FK 5C4XK 4OINA 2O5JA 4A3JC 3HKZD 1I50C 4YG2A 3S15C 2WAQD 2A69A 3HOYK 3I4NC 4A3IC 3FKIK 2PPBA 1TWCK 2JA6C 2A68A 4C3HK 3HOWK 4BY7C 2NVTC 2R93K 1YNNA 5TMFA 2JA5C 1TWHC 2R7ZK 4OIPA 2A6HA 4MQ9A 4Y7NC 2WB1L 5C4JK 2E2IC 3I4MC 3S2HC 2R92K 1SMYA 5FLMK 2VUMC 5IYCC 3HOVC 3M3YC 3HOXK 4LK0A 2PMZD 3S1NK 2NVYC 5C44K 3GTKC 3GTQC 4A3BK 4A93K 2YU9C 4X6AK 4A3FC 2JA7C 4QIWL 2NVQK 2PA8L 1TWFK 5M5WK 1I6HC 3S15K 2E2JC 5IYBK 4MEYA 3S1RK 5IP9C 4A3IK 3RZDC 1Y1WC 1TWAC 2JA6K 1XPPA 2E2HC 5M3MK 2JA8C 2PA8D 3M4OC 3EQLA 5TMCA 2NVTK 2JA5K 4BBRK 4KN7A 1Y1VK 4Y7NK 5C3EC 2E2IK 3I4MK 1R9TC 1K83K 2VUMK 4Y52C 2PMZL 3HOVK 1WCMK 5M5YK 4AYBL 4AYBD 2O5IA 4MEXA 3GTOK 3GTMC 2WB1D 2YU9K 4YFXA 3HOZC 4JK1A 3H3VD 2JA7K 3GTGC 4QJVB 1I3QC 4C3IK 3S2DC
chains in the Genus database with same CATH superfamily
4A3GK 3RZOC 4FM9A 1IW7A 1EFWA 2RGRA 1EI6A 1F9NA 3CQZC 3PO2C 3S17C 2GSNA 3G4CA 4A3DC 1O2BA 2FQTA 3L4KA 4G0VA 3I4NK 4KDDA 4KARA 4A3MK 3AD9C 3AD8C 4A3LC 3GTMK 3S1QK 2CFAA 1V5VA 1WOOA 4A3JK 3HOYC 1TWGA 3S16C 1EQRA 3FOFA 2NVQC 4C3HC 3G4AA 1VGXA 2O5JA 4YFNA 4BBSK 1TWHK 4BLAA 2B63A 1SFOA 1VH2A 2JA6A 2CW0A 4KM8A 5IP7K 3GTQK 5FJ8K 3HOUC 4A3FK 3LAPA 4XSZA 1SFOC 1BDFA 1XZPB 3GTOC 4ILDA 4BY1K 2JA8K 3M4OK 3T00A 1C0AA 1WORA 4GTLA 3GTOA 1XZQB 1TWCA 2XCOA 1DCPA 3Q3QA 3LPXA 4A3MC 5FLMC 5IYCK 4XSXA 2CFAB 1IBAA 4OIRA 3S2DK 4BY1C 4OINA 1WOSA 1I50C 4P9SA 1WSRA 1DCHA 3S15C 3AD7C 3FKIK 3GEIA 1TWCK 1O27A 2PHCB 3HOWK 2R93K 1TWHC 4OIPA 4MQ9A 4Y7NC 5C4JK 3TTGA 2VUMC 5FLMK 1F7UA 3FHZA 3OEPA 2R93A 4QIWL 3GDZA 1I6HC 5M5WK 3S0XA 1WIHA 5EGEA 4A3IK 3RZDC 2JA8C 3M4OC 5TMCA 2JA5K 1AB4A 4Y7NK 4DDQA 2PMZL 2O5IA 3GTOK 3H3VD 2GAHC 4C3IK 1EK8A 2RH6A 3RZDK 1WCMA 4KAWX 3S16K 1PJ7A 4BBSC 4KASA 3S1MC 2Y0SD 2R92C 3GTGK 3PO3K 1SFOK 2JH3A 3GTKK 3GEEA 5M5XK 3AH5A 4GZYA 3GTJK 4J3NA 4P5AA 4A3DK 3HOWC 1TWFC 2BE5A 5IOQA 2R93C 3S1RC 2V6SA 5IYDK 4A3KK 4A3EK 1WQHA 1TWFA 4YFKA 2E2IA 1JVIA 2W7VA 3GTPK 1PJ6A 3GTJC 2E2JK 3GTQA 3OPFA 4ZH4A 4G7HA 4KMDA 3FOEA 1O25A 4RMFA 4C2MK 4QJVA 1J6XA 1RU0A 2Y3PA 4A3EC 1XZPA 1EH1A 5C4JC 3BP3A 1I3QK 2Y0SL 3GTPA 4A3GC 3GTLK 4LQYA 3RZOK 4A3CK 3CQZK 3PO2K 1HI9A 5C4XK 3V4GA 3HOYK 4A3IC 2PPBA 2JA6C 4C3HK 1ISEA 1YNNA 2JA5C 1JQWA 2R7ZK 2WB1L 3GSIA 3I4MC 1BJTA 4KB4A 2R92K 3TFJA 3M3YC 5IYCC 3HOVC 5CJ9A 5C44K 4A93K 2NVYA 1YX2A 2YU9C 4X6AK 3H0GA 2XCQA 4GTCA 5IP9C 3S14K 2JA6K 2E2HC 2PA8D 2NVTK 1Y1VK 5C3EC 2KWAA 1R9TC 3HXAA 1K83K 4Y52C 4WJ3M 3SZZA 1WCMK 5M5YK 4GTBA 3ERED 4P5BA 2WB1D 3HOZC 1INNA 2V6UA 4QJVB 3GTGC 1R9TA 3S2DC 1Y1WK 1USOA 3CQZA 4LK1A 3GTLA 3GTGA 1Y1VA 3HKZL 1K83C 1XXBA 4QIWD 3N0CA 1WCMC 3SZYA 1VLOA 4KC6A 2NVXA 3T02A 3GTLC 3HOUK 2JA7A 4LR2A 3BP8C 1VJEA 2NVYK 4A3BC 1I50K 2P5MA 5IORA 4G0UA 1WSVA 1Y1WA 4X6AC 4KMHA 4C3JC 1B4BA 2A6EA 3H0GC 3JSTA 5IP9K 3S14C 2GSUA 1B4AA 3H3VL 3S1MK 5IOTA 1XZQA 4XLNA 3WODA 4NOIA 3N0BA 2ZUEA 1I6HK 4KMUA 3K7AC 4Q5SA 1YCLA 3HOZK 3GIRA 4A3CC 3AQPA 1TWGK 2D6FC 1XXCA 2P8TA 5C4XC 1DCOA 3H0GK 1UV7A 1F93A 3DXJA 4LLGA 1XXAA 1R9TK 4GTFA 3FKIC 1KQ4A 5IP7C 3CAGA 3TFHA 4KN4A 1K83A 3K7AK 5JVOA 1DD5A 1WOPA 3S1NC 4BXXK 1J6WA 5L46A 4OIOA 3LAJA 3MMLB 5D4DA 3GTMA 4KM9A 3PO3C 2FQOA 4GT9A 3HKZD 4A3JC 4XCHA 1F7VA 1IS1A 2GSOA 4BY7C 5TMFA 4G0WA 2A6HA 3S2HC 2E2IC 4C45A 2VUMA 3HOXK 1O2AA 3L4JA 3S1NK 2NVYC 4A3BK 1L0WA 3GTKA 3GEHA 2YU9A 4A3FC 1IL2A 3ADAC 3S15K 4MEYA 3S1RK 3AQOA 1JOEA 1XPPA 4PAAA 5M3MK 3EQLA 4BBRK 2E2IK 1G51A 3N3YA 4GTEA 2ZUFA 4GFQA 1ZBSA 4AYBL 2YU9K 4JK1A 5EGHA 2ZFZA 3OREA 1ZXOA 4BXXC 1O24A 1ZVUA 1TWAK 2JA5A 1Y1VC 5C3EK 1GE9A 2GAGC 5IYDC 4Y52K 1BS2A 1BGWA 4A3KC 2NVXC 4G7ZA 1O26A 5HL8A 3TFIA 3HOXC 3BUEA 2B63C 5C44C 4A93C 3QX3A 4KB2A 1WQGA 4LOWA 1PJ5A 3NUHA 1TWGC 2XCRB 4BY7K 4LJZA 1I50A 4WILA 5IYBC 2R7ZC 4G7OA 4C2MC 5JFEA 5E68A 1O28A 4GTDA 1YNJA 4BBRC 2E2HA 2NVXK 4A3LK 3S1QC 1O2FB 2B63K 4C3JK 2E2HK 1O29A 3T01A 4C3IC 1IE0A 2WAQL 3S17K 1ZQ1C 1TWCC 4XLPA 1J6VA 1WQFA 3S2HK 4Q4ZA 3M3YK 1ZYRA 4OIQA 3GTPC 3FKIA 1I6VA 1HQMA 5M3FK 3A8KA 4YG2A 4GTAA 2WAQD 2A69A 3I4NC 1USMA 2A68A 2NVTC 4M1XA 2V6TA 2R92A 4AH6A 1TWHA 4PABA 2R7ZA 1SMYA 3A8IA 4O2DA 2EBBA 4LK0A 1VRQC 2PMZD 3GTKC 3GTQC 1X31C 2JA7C 2NVQK 1IQ0A 1TWFK 2PA8L 2E2JC 5IYBK 1Y1WC 1TWAC 5CHPA 4BLBA 5TJ3A 4BKWA 3VA7A 4KN7A 3I4MK 5IOSA 1I3QA 3IPJA 2VUMK 4WJ4A 3A8JA 3HOVK 4KATA 1TWAA 3GTJA 1J98A 4KMAA 4AYBD 4MEXA 3GTMC 4YFXA 2JA7K 1I3QC 4FZBA
chains in the Genus database with same CATH topology
4BXXC 4A3GK 3RZOC 1IW7A 3RZDK 1TWAK 1Y1WK 4LK1A 3CQZC 3PO2C 3S17C 3S16K 4A3DC 1Y1VC 5C3EK 4BBSC 3I4NK 3HKZL 1K83C 4Y52K 4QIWD 5IYDC 4A3MK 1WCMC 4A3KC 4BBSK 2NVXC 4A3LC 4G7ZA 3GTMK 3S1MC 2Y0SD 3GTLC 2R92C 3HOUK 3GTGK 3S1QK 3HOXC 3PO3K 1SFOK 2B63C 2NVYK 5C44C 4A3JK 1I50K 3GTKK 5M5XK 4A3BC 4A93C 4GZYA 3GTJK 4X6AC 3HOYC 3S16C 4A3DK 1TWGC 2NVQC 3HOWC 2BE5A 1TWFC 4BY7K 2R93C 4YFNA 3H0GC 2A6EA 1TWHK 4LJZA 5IYBC 3S1RC 2R7ZC 5IP9K 3S14C 4G7OA 5IYDK 4A3KK 1YNJA 2CW0A 4BBRC 2NVXK 4A3EK 3H3VL 5IP7K 3S1MK 4A3LK 4YFKA 5FJ8K 3GTQK 3HOUC 3S1QC 4A3FK 4XLNA 3WODA 4XSZA 4NOIA 1SFOC 1BDFA 2B63K 1I6HK 3GTOC 4KMUA 3GTPK 3K7AC 4Q5SA 3GTJC 2E2JK 3HOZK 4ZH4A 4A3CC 4BY1K 1TWGK 4C3JK 4G7HA 2E2HK 2JA8K 3M4OK 5C4XC 3H0GK 2WAQL 3DXJA 4LLGA 4C2MK 4QJVA 1R9TK 3S17K 3FKIC 1TWCC 4A3EC 5IP7C 4XLPA 3S2HK 5C4JC 4A3MC 4Q4ZA 5FLMC 1ZYRA 4KN4A 5IYCK 1I3QK 2Y0SL 4XSXA 3M3YK 4OIQA 4OIRA 3GTPC 1I6VA 3K7AK 3S2DK 3S1NC 4BXXK 3GTLK 1HQMA 3RZOK 4OIOA 4A3CK 3S14K 5D4DA 4A3GC 4BY1C 3PO3C 3CQZK 3PO2K 5M3FK 5C4XK 4OINA 2O5JA 4A3JC 3HKZD 1I50C 4YG2A 3S15C 2WAQD 2A69A 3HOYK 3I4NC 4A3IC 3FKIK 2PPBA 1TWCK 2JA6C 2A68A 4C3HK 3HOWK 4BY7C 2NVTC 2R93K 1YNNA 5TMFA 2JA5C 1TWHC 2R7ZK 4OIPA 2A6HA 4MQ9A 4Y7NC 2WB1L 5C4JK 2E2IC 3I4MC 3S2HC 2R92K 1SMYA 5FLMK 2VUMC 5IYCC 3HOVC 3M3YC 3HOXK 4LK0A 2PMZD 3S1NK 2NVYC 5C44K 3GTKC 3GTQC 4A3BK 4A93K 2YU9C 4X6AK 4A3FC 2JA7C 4QIWL 2NVQK 2PA8L 1TWFK 5M5WK 1I6HC 3S15K 2E2JC 5IYBK 4MEYA 3S1RK 5IP9C 4A3IK 3RZDC 1Y1WC 1TWAC 2JA6K 1XPPA 2E2HC 5M3MK 2JA8C 2PA8D 3M4OC 3EQLA 5TMCA 2NVTK 2JA5K 4BBRK 4KN7A 1Y1VK 4Y7NK 5C3EC 2E2IK 3I4MK 1R9TC 1K83K 2VUMK 4Y52C 2PMZL 3HOVK 1WCMK 5M5YK 4AYBL 4AYBD 2O5IA 4MEXA 3GTOK 3GTMC 2WB1D 2YU9K 4YFXA 3HOZC 4JK1A 3H3VD 2JA7K 3GTGC 4QJVB 1I3QC 4C3IK 3S2DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BXX C;  4A3G K;  3RZO C;  1IW7 A;  3RZD K;  1TWA K;  1Y1W K;  4LK1 A;  3CQZ C;  3PO2 C;  3S17 C;  3S16 K;  4A3D C;  1Y1V C;  5C3E K;  4BBS C;  3I4N K;  3HKZ L;  1K83 C;  4Y52 K;  4QIW D;  5IYD C;  4A3M K;  1WCM C;  4A3K C;  4BBS K;  2NVX C;  4A3L C;  4G7Z A;  3GTM K;  3S1M C;  2Y0S D;  3GTL C;  2R92 C;  3HOU K;  3GTG K;  3S1Q K;  3HOX C;  3PO3 K;  1SFO K;  2B63 C;  2NVY K;  5C44 C;  4A3J K;  1I50 K;  3GTK K;  5M5X K;  4A3B C;  4A93 C;  4GZY A;  3GTJ K;  4X6A C;  3HOY C;  3S16 C;  4A3D K;  1TWG C;  2NVQ C;  3HOW C;  2BE5 A;  1TWF C;  4BY7 K;  2R93 C;  4YFN A;  3H0G C;  2A6E A;  1TWH K;  4LJZ A;  5IYB C;  3S1R C;  2R7Z C;  5IP9 K;  3S14 C;  4G7O A;  5IYD K;  4A3K K;  1YNJ A;  2CW0 A;  4BBR C;  2NVX K;  4A3E K;  3H3V L;  5IP7 K;  3S1M K;  4A3L K;  4YFK A;  5FJ8 K;  3GTQ K;  3HOU C;  3S1Q C;  4A3F K;  4XLN A;  3WOD A;  4XSZ A;  4NOI A;  1SFO C;  1BDF A;  2B63 K;  1I6H K;  3GTO C;  4KMU A;  3GTP K;  3K7A C;  4Q5S A;  3GTJ C;  2E2J K;  3HOZ K;  4ZH4 A;  4A3C C;  4BY1 K;  1TWG K;  4C3J K;  4G7H A;  2E2H K;  2JA8 K;  3M4O K;  5C4X C;  3H0G K;  2WAQ L;  3DXJ A;  4LLG A;  4C2M K;  4QJV A;  1R9T K;  3S17 K;  3FKI C;  1TWC C;  4A3E C;  5IP7 C;  4XLP A;  3S2H K;  5C4J C;  4A3M C;  4Q4Z A;  5FLM C;  1ZYR A;  4KN4 A;  5IYC K;  1I3Q K;  2Y0S L;  4XSX A;  3M3Y K;  4OIQ A;  4OIR A;  3GTP C;  1I6V A;  3K7A K;  3S2D K;  3S1N C;  4BXX K;  3GTL K;  1HQM A;  3RZO K;  4OIO A;  4A3C K;  3S14 K;  5D4D A;  4A3G C;  4BY1 C;  3PO3 C;  3CQZ K;  3PO2 K;  5M3F K;  5C4X K;  4OIN A;  2O5J A;  4A3J C;  3HKZ D;  1I50 C;  4YG2 A;  3S15 C;  2WAQ D;  2A69 A;  3HOY K;  3I4N C;  4A3I C;  3FKI K;  2PPB A;  1TWC K;  2JA6 C;  2A68 A;  4C3H K;  3HOW K;  4BY7 C;  2NVT C;  2R93 K;  1YNN A;  5TMF A;  2JA5 C;  1TWH C;  2R7Z K;  4OIP A;  2A6H A;  4MQ9 A;  4Y7N C;  2WB1 L;  5C4J K;  2E2I C;  3I4M C;  3S2H C;  2R92 K;  1SMY A;  5FLM K;  2VUM C;  5IYC C;  3HOV C;  3M3Y C;  3HOX K;  4LK0 A;  2PMZ D;  3S1N K;  2NVY C;  5C44 K;  3GTK C;  3GTQ C;  4A3B K;  4A93 K;  2YU9 C;  4X6A K;  4A3F C;  2JA7 C;  4QIW L;  2NVQ K;  2PA8 L;  1TWF K;  5M5W K;  1I6H C;  3S15 K;  2E2J C;  5IYB K;  4MEY A;  3S1R K;  5IP9 C;  4A3I K;  3RZD C;  1Y1W C;  1TWA C;  2JA6 K;  1XPP A;  2E2H C;  5M3M K;  2JA8 C;  2PA8 D;  3M4O C;  3EQL A;  5TMC A;  2NVT K;  2JA5 K;  4BBR K;  4KN7 A;  1Y1V K;  4Y7N K;  5C3E C;  2E2I K;  3I4M K;  1R9T C;  1K83 K;  2VUM K;  4Y52 C;  2PMZ L;  3HOV K;  1WCM K;  5M5Y K;  4AYB L;  4AYB D;  2O5I A;  4MEX A;  3GTO K;  3GTM C;  2WB1 D;  2YU9 K;  4YFX A;  3HOZ C;  4JK1 A;  3H3V D;  2JA7 K;  3GTG C;  4QJV B;  1I3Q C;  4C3I K;  3S2D C; 
#chains in the Genus database with same CATH topology
 4A3G K;  3RZO C;  4FM9 A;  1IW7 A;  1EFW A;  2RGR A;  1EI6 A;  1F9N A;  3CQZ C;  3PO2 C;  3S17 C;  2GSN A;  3G4C A;  4A3D C;  1O2B A;  2FQT A;  3L4K A;  4G0V A;  3I4N K;  4KDD A;  4KAR A;  4A3M K;  3AD9 C;  3AD8 C;  4A3L C;  3GTM K;  3S1Q K;  2CFA A;  1V5V A;  1WOO A;  4A3J K;  3HOY C;  1TWG A;  3S16 C;  1EQR A;  3FOF A;  2NVQ C;  4C3H C;  3G4A A;  1VGX A;  2O5J A;  4YFN A;  4BBS K;  1TWH K;  4BLA A;  2B63 A;  1SFO A;  1VH2 A;  2JA6 A;  2CW0 A;  4KM8 A;  5IP7 K;  3GTQ K;  5FJ8 K;  3HOU C;  4A3F K;  3LAP A;  4XSZ A;  1SFO C;  1BDF A;  1XZP B;  3GTO C;  4ILD A;  4BY1 K;  2JA8 K;  3M4O K;  3T00 A;  1C0A A;  1WOR A;  4GTL A;  3GTO A;  1XZQ B;  1TWC A;  2XCO A;  1DCP A;  3Q3Q A;  3LPX A;  4A3M C;  5FLM C;  5IYC K;  4XSX A;  2CFA B;  1IBA A;  4OIR A;  3S2D K;  4BY1 C;  4OIN A;  1WOS A;  1I50 C;  4P9S A;  1WSR A;  1DCH A;  3S15 C;  3AD7 C;  3FKI K;  3GEI A;  1TWC K;  1O27 A;  2PHC B;  3HOW K;  2R93 K;  1TWH C;  4OIP A;  4MQ9 A;  4Y7N C;  5C4J K;  3TTG A;  2VUM C;  5FLM K;  1F7U A;  3FHZ A;  3OEP A;  2R93 A;  4QIW L;  3GDZ A;  1I6H C;  5M5W K;  3S0X A;  1WIH A;  5EGE A;  4A3I K;  3RZD C;  2JA8 C;  3M4O C;  5TMC A;  2JA5 K;  1AB4 A;  4Y7N K;  4DDQ A;  2PMZ L;  2O5I A;  3GTO K;  3H3V D;  2GAH C;  4C3I K;  1EK8 A;  2RH6 A;  3RZD K;  1WCM A;  4KAW X;  3S16 K;  1PJ7 A;  4BBS C;  4KAS A;  3S1M C;  2Y0S D;  2R92 C;  3GTG K;  3PO3 K;  1SFO K;  2JH3 A;  3GTK K;  3GEE A;  5M5X K;  3AH5 A;  4GZY A;  3GTJ K;  4J3N A;  4P5A A;  4A3D K;  3HOW C;  1TWF C;  2BE5 A;  5IOQ A;  2R93 C;  3S1R C;  2V6S A;  5IYD K;  4A3K K;  4A3E K;  1WQH A;  1TWF A;  4YFK A;  2E2I A;  1JVI A;  2W7V A;  3GTP K;  1PJ6 A;  3GTJ C;  2E2J K;  3GTQ A;  3OPF A;  4ZH4 A;  4G7H A;  4KMD A;  3FOE A;  1O25 A;  4RMF A;  4C2M K;  4QJV A;  1J6X A;  1RU0 A;  2Y3P A;  4A3E C;  1XZP A;  1EH1 A;  5C4J C;  3BP3 A;  1I3Q K;  2Y0S L;  3GTP A;  4A3G C;  3GTL K;  4LQY A;  3RZO K;  4A3C K;  3CQZ K;  3PO2 K;  1HI9 A;  5C4X K;  3V4G A;  3HOY K;  4A3I C;  2PPB A;  2JA6 C;  4C3H K;  1ISE A;  1YNN A;  2JA5 C;  1JQW A;  2R7Z K;  2WB1 L;  3GSI A;  3I4M C;  1BJT A;  4KB4 A;  2R92 K;  3TFJ A;  3M3Y C;  5IYC C;  3HOV C;  5CJ9 A;  5C44 K;  4A93 K;  2NVY A;  1YX2 A;  2YU9 C;  4X6A K;  3H0G A;  2XCQ A;  4GTC A;  5IP9 C;  3S14 K;  2JA6 K;  2E2H C;  2PA8 D;  2NVT K;  1Y1V K;  5C3E C;  2KWA A;  1R9T C;  3HXA A;  1K83 K;  4Y52 C;  4WJ3 M;  3SZZ A;  1WCM K;  5M5Y K;  4GTB A;  3ERE D;  4P5B A;  2WB1 D;  3HOZ C;  1INN A;  2V6U A;  4QJV B;  3GTG C;  1R9T A;  3S2D C;  1Y1W K;  1USO A;  3CQZ A;  4LK1 A;  3GTL A;  3GTG A;  1Y1V A;  3HKZ L;  1K83 C;  1XXB A;  4QIW D;  3N0C A;  1WCM C;  3SZY A;  1VLO A;  4KC6 A;  2NVX A;  3T02 A;  3GTL C;  3HOU K;  2JA7 A;  4LR2 A;  3BP8 C;  1VJE A;  2NVY K;  4A3B C;  1I50 K;  2P5M A;  5IOR A;  4G0U A;  1WSV A;  1Y1W A;  4X6A C;  4KMH A;  4C3J C;  1B4B A;  2A6E A;  3H0G C;  3JST A;  5IP9 K;  3S14 C;  2GSU A;  1B4A A;  3H3V L;  3S1M K;  5IOT A;  1XZQ A;  4XLN A;  3WOD A;  4NOI A;  3N0B A;  2ZUE A;  1I6H K;  4KMU A;  3K7A C;  4Q5S A;  1YCL A;  3HOZ K;  3GIR A;  4A3C C;  3AQP A;  1TWG K;  2D6F C;  1XXC A;  2P8T A;  5C4X C;  1DCO A;  3H0G K;  1UV7 A;  1F93 A;  3DXJ A;  4LLG A;  1XXA A;  1R9T K;  4GTF A;  3FKI C;  1KQ4 A;  5IP7 C;  3CAG A;  3TFH A;  4KN4 A;  1K83 A;  3K7A K;  5JVO A;  1DD5 A;  1WOP A;  3S1N C;  4BXX K;  1J6W A;  5L46 A;  4OIO A;  3LAJ A;  3MML B;  5D4D A;  3GTM A;  4KM9 A;  3PO3 C;  2FQO A;  4GT9 A;  3HKZ D;  4A3J C;  4XCH A;  1F7V A;  1IS1 A;  2GSO A;  4BY7 C;  5TMF A;  4G0W A;  2A6H A;  3S2H C;  2E2I C;  4C45 A;  2VUM A;  3HOX K;  1O2A A;  3L4J A;  3S1N K;  2NVY C;  4A3B K;  1L0W A;  3GTK A;  3GEH A;  2YU9 A;  4A3F C;  1IL2 A;  3ADA C;  3S15 K;  4MEY A;  3S1R K;  3AQO A;  1JOE A;  1XPP A;  4PAA A;  5M3M K;  3EQL A;  4BBR K;  2E2I K;  1G51 A;  3N3Y A;  4GTE A;  2ZUF A;  4GFQ A;  1ZBS A;  4AYB L;  2YU9 K;  4JK1 A;  5EGH A;  2ZFZ A;  3ORE A;  1ZXO A;  4BXX C;  1O24 A;  1ZVU A;  1TWA K;  2JA5 A;  1Y1V C;  5C3E K;  1GE9 A;  2GAG C;  5IYD C;  4Y52 K;  1BS2 A;  1BGW A;  4A3K C;  2NVX C;  4G7Z A;  1O26 A;  5HL8 A;  3TFI A;  3HOX C;  3BUE A;  2B63 C;  5C44 C;  4A93 C;  3QX3 A;  4KB2 A;  1WQG A;  4LOW A;  1PJ5 A;  3NUH A;  1TWG C;  2XCR B;  4BY7 K;  4LJZ A;  1I50 A;  4WIL A;  5IYB C;  2R7Z C;  4G7O A;  4C2M C;  5JFE A;  5E68 A;  1O28 A;  4GTD A;  1YNJ A;  4BBR C;  2E2H A;  2NVX K;  4A3L K;  3S1Q C;  1O2F B;  2B63 K;  4C3J K;  2E2H K;  1O29 A;  3T01 A;  4C3I C;  1IE0 A;  2WAQ L;  3S17 K;  1ZQ1 C;  1TWC C;  4XLP A;  1J6V A;  1WQF A;  3S2H K;  4Q4Z A;  3M3Y K;  1ZYR A;  4OIQ A;  3GTP C;  3FKI A;  1I6V A;  1HQM A;  5M3F K;  3A8K A;  4YG2 A;  4GTA A;  2WAQ D;  2A69 A;  3I4N C;  1USM A;  2A68 A;  2NVT C;  4M1X A;  2V6T A;  2R92 A;  4AH6 A;  1TWH A;  4PAB A;  2R7Z A;  1SMY A;  3A8I A;  4O2D A;  2EBB A;  4LK0 A;  1VRQ C;  2PMZ D;  3GTK C;  3GTQ C;  1X31 C;  2JA7 C;  2NVQ K;  1IQ0 A;  1TWF K;  2PA8 L;  2E2J C;  5IYB K;  1Y1W C;  1TWA C;  5CHP A;  4BLB A;  5TJ3 A;  4BKW A;  3VA7 A;  4KN7 A;  3I4M K;  5IOS A;  1I3Q A;  3IPJ A;  2VUM K;  4WJ4 A;  3A8J A;  3HOV K;  4KAT A;  1TWA A;  3GTJ A;  1J98 A;  4KMA A;  4AYB D;  4MEX A;  3GTM C;  4YFX A;  2JA7 K;  1I3Q C;  4FZB A; 
#chains in the Genus database with same CATH homology
 4BXX C;  4A3G K;  3RZO C;  1IW7 A;  3RZD K;  1TWA K;  1Y1W K;  4LK1 A;  3CQZ C;  3PO2 C;  3S17 C;  3S16 K;  4A3D C;  1Y1V C;  5C3E K;  4BBS C;  3I4N K;  3HKZ L;  1K83 C;  4Y52 K;  4QIW D;  5IYD C;  4A3M K;  1WCM C;  4A3K C;  4BBS K;  2NVX C;  4A3L C;  4G7Z A;  3GTM K;  3S1M C;  2Y0S D;  3GTL C;  2R92 C;  3HOU K;  3GTG K;  3S1Q K;  3HOX C;  3PO3 K;  1SFO K;  2B63 C;  2NVY K;  5C44 C;  4A3J K;  1I50 K;  3GTK K;  5M5X K;  4A3B C;  4A93 C;  4GZY A;  3GTJ K;  4X6A C;  3HOY C;  3S16 C;  4A3D K;  1TWG C;  2NVQ C;  3HOW C;  2BE5 A;  1TWF C;  4BY7 K;  2R93 C;  4YFN A;  3H0G C;  2A6E A;  1TWH K;  4LJZ A;  5IYB C;  3S1R C;  2R7Z C;  5IP9 K;  3S14 C;  4G7O A;  5IYD K;  4A3K K;  1YNJ A;  2CW0 A;  4BBR C;  2NVX K;  4A3E K;  3H3V L;  5IP7 K;  3S1M K;  4A3L K;  4YFK A;  5FJ8 K;  3GTQ K;  3HOU C;  3S1Q C;  4A3F K;  4XLN A;  3WOD A;  4XSZ A;  4NOI A;  1SFO C;  1BDF A;  2B63 K;  1I6H K;  3GTO C;  4KMU A;  3GTP K;  3K7A C;  4Q5S A;  3GTJ C;  2E2J K;  3HOZ K;  4ZH4 A;  4A3C C;  4BY1 K;  1TWG K;  4C3J K;  4G7H A;  2E2H K;  2JA8 K;  3M4O K;  5C4X C;  3H0G K;  2WAQ L;  3DXJ A;  4LLG A;  4C2M K;  4QJV A;  1R9T K;  3S17 K;  3FKI C;  1TWC C;  4A3E C;  5IP7 C;  4XLP A;  3S2H K;  5C4J C;  4A3M C;  4Q4Z A;  5FLM C;  1ZYR A;  4KN4 A;  5IYC K;  1I3Q K;  2Y0S L;  4XSX A;  3M3Y K;  4OIQ A;  4OIR A;  3GTP C;  1I6V A;  3K7A K;  3S2D K;  3S1N C;  4BXX K;  3GTL K;  1HQM A;  3RZO K;  4OIO A;  4A3C K;  3S14 K;  5D4D A;  4A3G C;  4BY1 C;  3PO3 C;  3CQZ K;  3PO2 K;  5M3F K;  5C4X K;  4OIN A;  2O5J A;  4A3J C;  3HKZ D;  1I50 C;  4YG2 A;  3S15 C;  2WAQ D;  2A69 A;  3HOY K;  3I4N C;  4A3I C;  3FKI K;  2PPB A;  1TWC K;  2JA6 C;  2A68 A;  4C3H K;  3HOW K;  4BY7 C;  2NVT C;  2R93 K;  1YNN A;  5TMF A;  2JA5 C;  1TWH C;  2R7Z K;  4OIP A;  2A6H A;  4MQ9 A;  4Y7N C;  2WB1 L;  5C4J K;  2E2I C;  3I4M C;  3S2H C;  2R92 K;  1SMY A;  5FLM K;  2VUM C;  5IYC C;  3HOV C;  3M3Y C;  3HOX K;  4LK0 A;  2PMZ D;  3S1N K;  2NVY C;  5C44 K;  3GTK C;  3GTQ C;  4A3B K;  4A93 K;  2YU9 C;  4X6A K;  4A3F C;  2JA7 C;  4QIW L;  2NVQ K;  2PA8 L;  1TWF K;  5M5W K;  1I6H C;  3S15 K;  2E2J C;  5IYB K;  4MEY A;  3S1R K;  5IP9 C;  4A3I K;  3RZD C;  1Y1W C;  1TWA C;  2JA6 K;  1XPP A;  2E2H C;  5M3M K;  2JA8 C;  2PA8 D;  3M4O C;  3EQL A;  5TMC A;  2NVT K;  2JA5 K;  4BBR K;  4KN7 A;  1Y1V K;  4Y7N K;  5C3E C;  2E2I K;  3I4M K;  1R9T C;  1K83 K;  2VUM K;  4Y52 C;  2PMZ L;  3HOV K;  1WCM K;  5M5Y K;  4AYB L;  4AYB D;  2O5I A;  4MEX A;  3GTO K;  3GTM C;  2WB1 D;  2YU9 K;  4YFX A;  3HOZ C;  4JK1 A;  3H3V D;  2JA7 K;  3GTG C;  4QJV B;  1I3Q C;  4C3I K;  3S2D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...