4A3JK

Rna polymerase ii initial transcribing complex with a 2nt dna-rna hybrid and soaked with gmpcpp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3jK00
1R9TK 5IYBC 4C3JK 1R9TC 2A68A 5C3EK 3H3VD 2NVQK 4C3HK 4OINA 2PA8L 5C3EC 4JK1A 2NVQC 4QJVB 2O5IA 3K7AK 4A3EK 3K7AC 4A3EC 4C2MK 1SMYA 3GTJK 3S1RK 4X6AK 3GTJC 3S1RC 3HOYK 4X6AC 3H0GK 2VUMK 3HOYC 4A93K 4G7OA 4KMUA 3H0GC 2PA8D 4A3KK 2VUMC 2E2JK 4A93C 4BBRK 4A3KC 2E2JC 5IYDK 4BBRC 1BDFA 1I3QK 5IYDC 1I3QC 1TWHK 4A3JK 2JA7K 3GTMK 1I6HK 1TWHC 4A3JC 1K83K 2JA7C 3GTMC 3S16K 4XSXA 1I6HC 1K83C 3S16C 4LJZA 3RZDK 4QIWL 4BXXK 2Y0SL 3RZDC 4BXXC 3S15K 4BBSK 3S15C 3M4OK 4BBSC 4MQ9A 3S2HK 3M4OC 3S14K 2JA5K 4MEXA 4OIPA 3S2HC 2PPBA 4YFKA 2JA5C 4YG2A 3GTGK 4A3CK 1YNNA 3GTGC 3CQZK 4QJVA 5FJ8K 3M3YK 3HOUK 5C4XK 4OIQA 3CQZC 3M3YC 4QIWD 3HOUC 5C4XC 2Y0SD 1IW7A 3PO3K 3S1MK 3EQLA 3PO3C 3S1MC 2NVYK 2NVYC 4Y7NK 4Y7NC 1XPPA 4NOIA 4A3FK 4Q4ZA 1TWAK 4A3FC 4A3DK 2WAQL 1TWAC 2O5JA 4C3IK 4LLGA 2PMZL 4A3DC 3HOWK 3WODA 3HOWC 2CW0A 4LK0A 4KN4A 4OIOA 4YFXA 1Y1WK 1SFOK 2NVXK 4BY7K 1Y1WC 1Y1VK 5D4DA 2NVXC 1SFOC 3S1QK 4BY7C 4A3GK 1Y1VC 5M5XK 4A3GC 3S1QC 3I4NK 3GTPK 2WAQD 4MEYA 3S17K 3I4NC 1TWGK 2PMZD 3GTPC 3S17C 3S14C 1TWGC 4KN7A 4A3CC 1WCMK 5IP7K 1WCMC 4G7HA 5IP7C 3GTQK 4Y52K 4Y52C 3GTQC 1YNJA 3HOVK 4Q5SA 2YU9K 2A69A 3HOVC 4LK1A 4BY1K 3HOXK 2YU9C 4BY1C 3HOXC 3RZOK 4XSZA 3RZOC 5TMFA 3DXJA 4AYBL 4A3BK 5FLMK 1I50K 4A3BC 5FLMC 1I50C 5TMCA 3HOZK 3PO2K 3I4MK 4A3IK 2JA8K 2A6HA 2NVTK 2E2IK 3HOZC 3I4MC 4A3IC 2JA8C 2NVTC 3PO2C 2E2IC 3S2DC 2R93K 3GTLK 1I6VA 1TWCK 3S2DK 2R93C 3GTLC 1TWCC 3S1NK 2WB1L 3FKIK 4ZH4A 4XLPA 2R92K 3S1NC 5M5YK 2A6EA 3FKIC 5IYCK 4AYBD 2R92C 5IYCC 1ZYRA 4OIRA 5M3MK 2E2HK 2R7ZK 3HKZL 2E2HC 1TWFK 4A3MK 2R7ZC 2BE5A 4A3LK 1TWFC 4GZYA 4A3MC 4G7ZA 4A3LC 5IP9K 5M3FK 2B63K 3H3VL 2WB1D 5IP9C 5C44K 5C4JK 2B63C 3GTOK 3GTKK 2JA6K 5C44C 5C4JC 3GTKC 3GTOC 5M5WK 2JA6C 1HQMA 4XLNA 3HKZD 4YFNA 5IYBK
chains in the Genus database with same CATH superfamily
5IYBC 1GE9A 4KARA 1WCMA 1DCHA 3H3VD 1WSVA 4C3HK 4JK1A 2NVQC 3ADAC 2RH6A 3GEIA 1ZXOA 3K7AK 1IL2A 4LR2A 4A3EC 3OEPA 4C2MK 4X6AK 4G7OA 4KMUA 3H0GC 4KB4A 5EGHA 3AQOA 4A3KC 2E2JC 1I3QK 1O27A 4FM9A 2V6SA 4A3JK 3GTMK 3OPFA 4GTLA 1K83C 3GSIA 4LJZA 1IBAA 2Y0SL 2R92A 5IORA 3S15K 3L4JA 1WQGA 2GSNA 1L0WA 2JA5K 2R7ZA 2PPBA 4A3CK 4QJVA 1WOPA 2CFAA 3GTKA 1YX2A 2KWAA 4XCHA 3A8JA 3S1MC 1XXBA 4M1XA 5IOSA 4NOIA 3S0XA 4A3FK 4KDDA 2P5MA 4C3IC 3GEHA 4KM8A 1ZVUA 3WODA 4LK0A 1SFOK 4BY7C 1Y1VK 5HL8A 4A3GK 3I4NK 3BP8C 2VUMA 1VJEA 3GTPK 3S17K 3GIRA 4A3CC 3GEEA 4GTAA 1BJTA 4Y52K 3N0CA 2JA7A 3GTQC 1YNJA 3HOVK 3QX3A 4Q5SA 4WJ3M 3HOXK 2YU9C 1JVIA 4XSZA 3RZOC 5TMFA 4PAAA 3CAGA 4A3BK 1RU0A 2FQTA 5FLMC 3GDZA 3I4MK 2JA8K 1JOEA 1XZQA 2E2IK 2NVYA 1DCOA 3GTLC 3S2DC 3S1NC 5IYCK 4AYBD 1F7VA 1TWAA 1XXAA 4A3MK 2BE5A 2B63K 1Y1WA 3A8IA 5C4JC 5M5WK 3NUHA 1XXCA 5IYBK 4GFQA 1F93A 1R9TC 2A68A 2NVQK 1VLOA 2PA8L 5C3EC 2ZUFA 4QJVB 4A3EK 1SMYA 4KC6A 4PABA 1ZBSA 1USMA 4KMDA 4GTFA 3GTJC 3S1RC 3H0GK 1B4BA 4A93C 4A3KK 2E2JK 4BLBA 1TWHC 1K83K 1I6HC 2R93A 1TWCA 5EGEA 3S16C 3RZDC 2V6TA 1HI9A 4BBSC 4GT9A 4MQ9A 3L4KA 2E2HA 3S2HC 3G4AA 1TWFA 4BKWA 3GTGC 5FJ8K 1VH2A 3CQZC 3T00A 3HOUC 5C4XC 2Y0SD 3AH5A 3S1MK 2JA6A 3PO3C 3LAPA 4KB2A 1UV7A 3Q3QA 1DD5A 1I50A 2WAQL 2O5JA 4C3IK 2PMZL 4A3DC 4FZBA 4BY7K 3FKIA 1XZQB 4GTBA 2NVXC 2ZUEA 3TFJA 1WOOA 1I3QA 3TTGA 1WCMC 2GSOA 5IP7C 1EQRA 3GTQK 3GTOA 3GTMA 1O25A 1VRQC 3SZYA 2YU9K 2A69A 3SZZA 3V4GA 4BY1C 4G0VA 3RZOK 4G0WA 2JA5A 1KQ4A 1ISEA 5FLMK 4GTCA 1I50C 5TMCA 2A6HA 3HOZC 3PO2C 4A3IC 2NVTC 2FQOA 1I6VA 3FHZA 3GTLK 3S2DK 1IQ0A 3FOFA 3S1NK 1PJ5A 2WB1L 1O2BA 2A6EA 3FKIC 2R92C 5M3MK 1J6VA 3HKZL 1O29A 3G4CA 2R7ZC 3LAJA 4GZYA 1F9NA 4G7ZA 3N3YA 5C4JK 1SFOA 4WJ4A 1Y1VA 3GTKC 3GTOC 1O24A 5L46A 2V6UA 4XLNA 4YFNA 3GTPA 2XCOA 1R9TK 4GTEA 4C45A 1O28A 4LQYA 5C3EK 3A8KA 4OINA 1J98A 3AD8C 3BP3A 2Y3PA 3GTJK 3S1RK 4A93K 3HOYC 2VUMC 2PA8D 4BBRC 5IYDC 1TWHK 1I6HK 2E2IA 2JA7C 3S16K 4XSXA 2EBBA 3RZDK 4QIWL 1TWGA 4BXXC 4BBSK 2JH3A 5CHPA 3S2HK 3M4OC 3S14K 1INNA 4OIPA 4MEXA 3GTGK 4YG2A 1YNNA 3CQZK 4BLAA 4KM9A 3HOUK 5C4XK 3OREA 4OIQA 3M3YC 2B63A 2CFAB 1IW7A 3PO3K 3EQLA 2GAGC 2NVYC 4Y7NC 4Q4ZA 4A3DK 1TWAC 4J3NA 1J6XA 5IOQA 3HOWC 4KN4A 4YFXA 4G0UA 2W7VA 2NVXK 2GSUA 1Y1WC 5D4DA 4KAWX 4KMHA 3VA7A 5M5XK 3S1QC 3H0GA 1X31C 2WAQD 4MEYA 3TFHA 2PMZD 3S14C 1TWGC 1PJ6A 1WCMK 3T01A 5IP7K 4G7HA 1K83A 3IPJA 4BY1K 1DCPA 1WQFA 5JFEA 1BS2A 3DXJA 1J6WA 1I50K 1EFWA 3TFIA 1WOSA 3HOZK 3PO2K 4A3IK 2NVTK 4DDQA 4KATA 2R93C 1TWCC 4XLPA 3FKIK 5JVOA 2R92K 2XCQA 5M5YK 5CJ9A 1ZYRA 2ZFZA 2R7ZK 2E2HC 1TWFC 3T02A 4A3LC 5M3FK 3H3VL 2WB1D 5IP9C 3GTKK 3GTOK 1YCLA 1XZPA 5C44C 3MMLB 2JA6C 2RGRA 1AB4A 4YFKA 3HKZD 1VGXA 4C3JK 5E68A 3GTQA 4C3HC 4KASA 4P9SA 2O5IA 3K7AC 1O2FB 2YU9A 3AD9C 1V5VA 4RMFA 4C2MC 1BGWA 3HOYK 4X6AC 3JSTA 2VUMK 1C0AA 1EK8A 4BBRK 5IYDK 1BDFA 1EI6A 1I3QC 2JA7K 4A3JC 3GTMC 3GTLA 1EH1A 4BXXK 1PJ7A 3S15C 4LOWA 3M4OK 3AD7C 4C3JC 4P5AA 4KMAA 2JA5C 3M3YK 2GAHC 4QIWD 3N0BA 2NVYK 4Y7NK 1XPPA 4AH6A 1R9TA 1TWAK 3HXAA 4A3FC 4LLGA 3HOWK 4P5BA 2CW0A 4OIOA 1Y1WK 3GTJA 1SFOC 3S1QK 1Y1VC 4A3GC 3I4NC 2XCRB 1TWGK 3GTPC 3S17C 4KN7A 3LPXA 1O2AA 1TWHA 1JQWA 4Y52C 1WIHA 2P8TA 3HOVC 4LK1A 1XZPB 3HOXC 5TJ3A 2PHCB 1O26A 3GTGA 1WSRA 4AYBL 3CQZA 4WILA 4A3BC 1IE0A 1B4AA 1F7UA 1IS1A 5IOTA 3I4MC 2JA8C 2R93K 2E2IC 1G51A 1TWCK 1WORA 4O2DA 4ZH4A 2D6FC 1WQHA 3FOEA 5IYCC 4OIRA 2E2HK 1TWFK 3ERED 4A3LK 1USOA 4A3MC 1ZQ1C 5IP9K 2B63C 5C44K 2NVXA 2JA6K 4ILDA 1HQMA 3BUEA 4GTDA 3AQPA
chains in the Genus database with same CATH topology
1R9TK 5IYBC 4C3JK 1R9TC 2A68A 5C3EK 3H3VD 2NVQK 4C3HK 4OINA 2PA8L 5C3EC 4JK1A 2NVQC 4QJVB 2O5IA 3K7AK 4A3EK 3K7AC 4A3EC 4C2MK 1SMYA 3GTJK 3S1RK 4X6AK 3GTJC 3S1RC 3HOYK 4X6AC 3H0GK 2VUMK 3HOYC 4A93K 4G7OA 4KMUA 3H0GC 2PA8D 4A3KK 2VUMC 2E2JK 4A93C 4BBRK 4A3KC 2E2JC 5IYDK 4BBRC 1BDFA 1I3QK 5IYDC 1I3QC 1TWHK 4A3JK 2JA7K 3GTMK 1I6HK 1TWHC 4A3JC 1K83K 2JA7C 3GTMC 3S16K 4XSXA 1I6HC 1K83C 3S16C 4LJZA 3RZDK 4QIWL 4BXXK 2Y0SL 3RZDC 4BXXC 3S15K 4BBSK 3S15C 3M4OK 4BBSC 4MQ9A 3S2HK 3M4OC 3S14K 2JA5K 4MEXA 4OIPA 3S2HC 2PPBA 4YFKA 2JA5C 4YG2A 3GTGK 4A3CK 1YNNA 3GTGC 3CQZK 4QJVA 5FJ8K 3M3YK 3HOUK 5C4XK 4OIQA 3CQZC 3M3YC 4QIWD 3HOUC 5C4XC 2Y0SD 1IW7A 3PO3K 3S1MK 3EQLA 3PO3C 3S1MC 2NVYK 2NVYC 4Y7NK 4Y7NC 1XPPA 4NOIA 4A3FK 4Q4ZA 1TWAK 4A3FC 4A3DK 2WAQL 1TWAC 2O5JA 4C3IK 4LLGA 2PMZL 4A3DC 3HOWK 3WODA 3HOWC 2CW0A 4LK0A 4KN4A 4OIOA 4YFXA 1Y1WK 1SFOK 2NVXK 4BY7K 1Y1WC 1Y1VK 5D4DA 2NVXC 1SFOC 3S1QK 4BY7C 4A3GK 1Y1VC 5M5XK 4A3GC 3S1QC 3I4NK 3GTPK 2WAQD 4MEYA 3S17K 3I4NC 1TWGK 2PMZD 3GTPC 3S17C 3S14C 1TWGC 4KN7A 4A3CC 1WCMK 5IP7K 1WCMC 4G7HA 5IP7C 3GTQK 4Y52K 4Y52C 3GTQC 1YNJA 3HOVK 4Q5SA 2YU9K 2A69A 3HOVC 4LK1A 4BY1K 3HOXK 2YU9C 4BY1C 3HOXC 3RZOK 4XSZA 3RZOC 5TMFA 3DXJA 4AYBL 4A3BK 5FLMK 1I50K 4A3BC 5FLMC 1I50C 5TMCA 3HOZK 3PO2K 3I4MK 4A3IK 2JA8K 2A6HA 2NVTK 2E2IK 3HOZC 3I4MC 4A3IC 2JA8C 2NVTC 3PO2C 2E2IC 3S2DC 2R93K 3GTLK 1I6VA 1TWCK 3S2DK 2R93C 3GTLC 1TWCC 3S1NK 2WB1L 3FKIK 4ZH4A 4XLPA 2R92K 3S1NC 5M5YK 2A6EA 3FKIC 5IYCK 4AYBD 2R92C 5IYCC 1ZYRA 4OIRA 5M3MK 2E2HK 2R7ZK 3HKZL 2E2HC 1TWFK 4A3MK 2R7ZC 2BE5A 4A3LK 1TWFC 4GZYA 4A3MC 4G7ZA 4A3LC 5IP9K 5M3FK 2B63K 3H3VL 2WB1D 5IP9C 5C44K 5C4JK 2B63C 3GTOK 3GTKK 2JA6K 5C44C 5C4JC 3GTKC 3GTOC 5M5WK 2JA6C 1HQMA 4XLNA 3HKZD 4YFNA 5IYBK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R9T K;  5IYB C;  4C3J K;  1R9T C;  2A68 A;  5C3E K;  3H3V D;  2NVQ K;  4C3H K;  4OIN A;  2PA8 L;  5C3E C;  4JK1 A;  2NVQ C;  4QJV B;  2O5I A;  3K7A K;  4A3E K;  3K7A C;  4A3E C;  4C2M K;  1SMY A;  3GTJ K;  3S1R K;  4X6A K;  3GTJ C;  3S1R C;  3HOY K;  4X6A C;  3H0G K;  2VUM K;  3HOY C;  4A93 K;  4G7O A;  4KMU A;  3H0G C;  2PA8 D;  4A3K K;  2VUM C;  2E2J K;  4A93 C;  4BBR K;  4A3K C;  2E2J C;  5IYD K;  4BBR C;  1BDF A;  1I3Q K;  5IYD C;  1I3Q C;  1TWH K;  4A3J K;  2JA7 K;  3GTM K;  1I6H K;  1TWH C;  4A3J C;  1K83 K;  2JA7 C;  3GTM C;  3S16 K;  4XSX A;  1I6H C;  1K83 C;  3S16 C;  4LJZ A;  3RZD K;  4QIW L;  4BXX K;  2Y0S L;  3RZD C;  4BXX C;  3S15 K;  4BBS K;  3S15 C;  3M4O K;  4BBS C;  4MQ9 A;  3S2H K;  3M4O C;  3S14 K;  2JA5 K;  4MEX A;  4OIP A;  3S2H C;  2PPB A;  4YFK A;  2JA5 C;  4YG2 A;  3GTG K;  4A3C K;  1YNN A;  3GTG C;  3CQZ K;  4QJV A;  5FJ8 K;  3M3Y K;  3HOU K;  5C4X K;  4OIQ A;  3CQZ C;  3M3Y C;  4QIW D;  3HOU C;  5C4X C;  2Y0S D;  1IW7 A;  3PO3 K;  3S1M K;  3EQL A;  3PO3 C;  3S1M C;  2NVY K;  2NVY C;  4Y7N K;  4Y7N C;  1XPP A;  4NOI A;  4A3F K;  4Q4Z A;  1TWA K;  4A3F C;  4A3D K;  2WAQ L;  1TWA C;  2O5J A;  4C3I K;  4LLG A;  2PMZ L;  4A3D C;  3HOW K;  3WOD A;  3HOW C;  2CW0 A;  4LK0 A;  4KN4 A;  4OIO A;  4YFX A;  1Y1W K;  1SFO K;  2NVX K;  4BY7 K;  1Y1W C;  1Y1V K;  5D4D A;  2NVX C;  1SFO C;  3S1Q K;  4BY7 C;  4A3G K;  1Y1V C;  5M5X K;  4A3G C;  3S1Q C;  3I4N K;  3GTP K;  2WAQ D;  4MEY A;  3S17 K;  3I4N C;  1TWG K;  2PMZ D;  3GTP C;  3S17 C;  3S14 C;  1TWG C;  4KN7 A;  4A3C C;  1WCM K;  5IP7 K;  1WCM C;  4G7H A;  5IP7 C;  3GTQ K;  4Y52 K;  4Y52 C;  3GTQ C;  1YNJ A;  3HOV K;  4Q5S A;  2YU9 K;  2A69 A;  3HOV C;  4LK1 A;  4BY1 K;  3HOX K;  2YU9 C;  4BY1 C;  3HOX C;  3RZO K;  4XSZ A;  3RZO C;  5TMF A;  3DXJ A;  4AYB L;  4A3B K;  5FLM K;  1I50 K;  4A3B C;  5FLM C;  1I50 C;  5TMC A;  3HOZ K;  3PO2 K;  3I4M K;  4A3I K;  2JA8 K;  2A6H A;  2NVT K;  2E2I K;  3HOZ C;  3I4M C;  4A3I C;  2JA8 C;  2NVT C;  3PO2 C;  2E2I C;  3S2D C;  2R93 K;  3GTL K;  1I6V A;  1TWC K;  3S2D K;  2R93 C;  3GTL C;  1TWC C;  3S1N K;  2WB1 L;  3FKI K;  4ZH4 A;  4XLP A;  2R92 K;  3S1N C;  5M5Y K;  2A6E A;  3FKI C;  5IYC K;  4AYB D;  2R92 C;  5IYC C;  1ZYR A;  4OIR A;  5M3M K;  2E2H K;  2R7Z K;  3HKZ L;  2E2H C;  1TWF K;  4A3M K;  2R7Z C;  2BE5 A;  4A3L K;  1TWF C;  4GZY A;  4A3M C;  4G7Z A;  4A3L C;  5IP9 K;  5M3F K;  2B63 K;  3H3V L;  2WB1 D;  5IP9 C;  5C44 K;  5C4J K;  2B63 C;  3GTO K;  3GTK K;  2JA6 K;  5C44 C;  5C4J C;  3GTK C;  3GTO C;  5M5W K;  2JA6 C;  1HQM A;  4XLN A;  3HKZ D;  4YFN A;  5IYB K; 
#chains in the Genus database with same CATH topology
 5IYB C;  1GE9 A;  4KAR A;  1WCM A;  1DCH A;  3H3V D;  1WSV A;  4C3H K;  4JK1 A;  2NVQ C;  3ADA C;  2RH6 A;  3GEI A;  1ZXO A;  3K7A K;  1IL2 A;  4LR2 A;  4A3E C;  3OEP A;  4C2M K;  4X6A K;  4G7O A;  4KMU A;  3H0G C;  4KB4 A;  5EGH A;  3AQO A;  4A3K C;  2E2J C;  1I3Q K;  1O27 A;  4FM9 A;  2V6S A;  4A3J K;  3GTM K;  3OPF A;  4GTL A;  1K83 C;  3GSI A;  4LJZ A;  1IBA A;  2Y0S L;  2R92 A;  5IOR A;  3S15 K;  3L4J A;  1WQG A;  2GSN A;  1L0W A;  2JA5 K;  2R7Z A;  2PPB A;  4A3C K;  4QJV A;  1WOP A;  2CFA A;  3GTK A;  1YX2 A;  2KWA A;  4XCH A;  3A8J A;  3S1M C;  1XXB A;  4M1X A;  5IOS A;  4NOI A;  3S0X A;  4A3F K;  4KDD A;  2P5M A;  4C3I C;  3GEH A;  4KM8 A;  1ZVU A;  3WOD A;  4LK0 A;  1SFO K;  4BY7 C;  1Y1V K;  5HL8 A;  4A3G K;  3I4N K;  3BP8 C;  2VUM A;  1VJE A;  3GTP K;  3S17 K;  3GIR A;  4A3C C;  3GEE A;  4GTA A;  1BJT A;  4Y52 K;  3N0C A;  2JA7 A;  3GTQ C;  1YNJ A;  3HOV K;  3QX3 A;  4Q5S A;  4WJ3 M;  3HOX K;  2YU9 C;  1JVI A;  4XSZ A;  3RZO C;  5TMF A;  4PAA A;  3CAG A;  4A3B K;  1RU0 A;  2FQT A;  5FLM C;  3GDZ A;  3I4M K;  2JA8 K;  1JOE A;  1XZQ A;  2E2I K;  2NVY A;  1DCO A;  3GTL C;  3S2D C;  3S1N C;  5IYC K;  4AYB D;  1F7V A;  1TWA A;  1XXA A;  4A3M K;  2BE5 A;  2B63 K;  1Y1W A;  3A8I A;  5C4J C;  5M5W K;  3NUH A;  1XXC A;  5IYB K;  4GFQ A;  1F93 A;  1R9T C;  2A68 A;  2NVQ K;  1VLO A;  2PA8 L;  5C3E C;  2ZUF A;  4QJV B;  4A3E K;  1SMY A;  4KC6 A;  4PAB A;  1ZBS A;  1USM A;  4KMD A;  4GTF A;  3GTJ C;  3S1R C;  3H0G K;  1B4B A;  4A93 C;  4A3K K;  2E2J K;  4BLB A;  1TWH C;  1K83 K;  1I6H C;  2R93 A;  1TWC A;  5EGE A;  3S16 C;  3RZD C;  2V6T A;  1HI9 A;  4BBS C;  4GT9 A;  4MQ9 A;  3L4K A;  2E2H A;  3S2H C;  3G4A A;  1TWF A;  4BKW A;  3GTG C;  5FJ8 K;  1VH2 A;  3CQZ C;  3T00 A;  3HOU C;  5C4X C;  2Y0S D;  3AH5 A;  3S1M K;  2JA6 A;  3PO3 C;  3LAP A;  4KB2 A;  1UV7 A;  3Q3Q A;  1DD5 A;  1I50 A;  2WAQ L;  2O5J A;  4C3I K;  2PMZ L;  4A3D C;  4FZB A;  4BY7 K;  3FKI A;  1XZQ B;  4GTB A;  2NVX C;  2ZUE A;  3TFJ A;  1WOO A;  1I3Q A;  3TTG A;  1WCM C;  2GSO A;  5IP7 C;  1EQR A;  3GTQ K;  3GTO A;  3GTM A;  1O25 A;  1VRQ C;  3SZY A;  2YU9 K;  2A69 A;  3SZZ A;  3V4G A;  4BY1 C;  4G0V A;  3RZO K;  4G0W A;  2JA5 A;  1KQ4 A;  1ISE A;  5FLM K;  4GTC A;  1I50 C;  5TMC A;  2A6H A;  3HOZ C;  3PO2 C;  4A3I C;  2NVT C;  2FQO A;  1I6V A;  3FHZ A;  3GTL K;  3S2D K;  1IQ0 A;  3FOF A;  3S1N K;  1PJ5 A;  2WB1 L;  1O2B A;  2A6E A;  3FKI C;  2R92 C;  5M3M K;  1J6V A;  3HKZ L;  1O29 A;  3G4C A;  2R7Z C;  3LAJ A;  4GZY A;  1F9N A;  4G7Z A;  3N3Y A;  5C4J K;  1SFO A;  4WJ4 A;  1Y1V A;  3GTK C;  3GTO C;  1O24 A;  5L46 A;  2V6U A;  4XLN A;  4YFN A;  3GTP A;  2XCO A;  1R9T K;  4GTE A;  4C45 A;  1O28 A;  4LQY A;  5C3E K;  3A8K A;  4OIN A;  1J98 A;  3AD8 C;  3BP3 A;  2Y3P A;  3GTJ K;  3S1R K;  4A93 K;  3HOY C;  2VUM C;  2PA8 D;  4BBR C;  5IYD C;  1TWH K;  1I6H K;  2E2I A;  2JA7 C;  3S16 K;  4XSX A;  2EBB A;  3RZD K;  4QIW L;  1TWG A;  4BXX C;  4BBS K;  2JH3 A;  5CHP A;  3S2H K;  3M4O C;  3S14 K;  1INN A;  4OIP A;  4MEX A;  3GTG K;  4YG2 A;  1YNN A;  3CQZ K;  4BLA A;  4KM9 A;  3HOU K;  5C4X K;  3ORE A;  4OIQ A;  3M3Y C;  2B63 A;  2CFA B;  1IW7 A;  3PO3 K;  3EQL A;  2GAG C;  2NVY C;  4Y7N C;  4Q4Z A;  4A3D K;  1TWA C;  4J3N A;  1J6X A;  5IOQ A;  3HOW C;  4KN4 A;  4YFX A;  4G0U A;  2W7V A;  2NVX K;  2GSU A;  1Y1W C;  5D4D A;  4KAW X;  4KMH A;  3VA7 A;  5M5X K;  3S1Q C;  3H0G A;  1X31 C;  2WAQ D;  4MEY A;  3TFH A;  2PMZ D;  3S14 C;  1TWG C;  1PJ6 A;  1WCM K;  3T01 A;  5IP7 K;  4G7H A;  1K83 A;  3IPJ A;  4BY1 K;  1DCP A;  1WQF A;  5JFE A;  1BS2 A;  3DXJ A;  1J6W A;  1I50 K;  1EFW A;  3TFI A;  1WOS A;  3HOZ K;  3PO2 K;  4A3I K;  2NVT K;  4DDQ A;  4KAT A;  2R93 C;  1TWC C;  4XLP A;  3FKI K;  5JVO A;  2R92 K;  2XCQ A;  5M5Y K;  5CJ9 A;  1ZYR A;  2ZFZ A;  2R7Z K;  2E2H C;  1TWF C;  3T02 A;  4A3L C;  5M3F K;  3H3V L;  2WB1 D;  5IP9 C;  3GTK K;  3GTO K;  1YCL A;  1XZP A;  5C44 C;  3MML B;  2JA6 C;  2RGR A;  1AB4 A;  4YFK A;  3HKZ D;  1VGX A;  4C3J K;  5E68 A;  3GTQ A;  4C3H C;  4KAS A;  4P9S A;  2O5I A;  3K7A C;  1O2F B;  2YU9 A;  3AD9 C;  1V5V A;  4RMF A;  4C2M C;  1BGW A;  3HOY K;  4X6A C;  3JST A;  2VUM K;  1C0A A;  1EK8 A;  4BBR K;  5IYD K;  1BDF A;  1EI6 A;  1I3Q C;  2JA7 K;  4A3J C;  3GTM C;  3GTL A;  1EH1 A;  4BXX K;  1PJ7 A;  3S15 C;  4LOW A;  3M4O K;  3AD7 C;  4C3J C;  4P5A A;  4KMA A;  2JA5 C;  3M3Y K;  2GAH C;  4QIW D;  3N0B A;  2NVY K;  4Y7N K;  1XPP A;  4AH6 A;  1R9T A;  1TWA K;  3HXA A;  4A3F C;  4LLG A;  3HOW K;  4P5B A;  2CW0 A;  4OIO A;  1Y1W K;  3GTJ A;  1SFO C;  3S1Q K;  1Y1V C;  4A3G C;  3I4N C;  2XCR B;  1TWG K;  3GTP C;  3S17 C;  4KN7 A;  3LPX A;  1O2A A;  1TWH A;  1JQW A;  4Y52 C;  1WIH A;  2P8T A;  3HOV C;  4LK1 A;  1XZP B;  3HOX C;  5TJ3 A;  2PHC B;  1O26 A;  3GTG A;  1WSR A;  4AYB L;  3CQZ A;  4WIL A;  4A3B C;  1IE0 A;  1B4A A;  1F7U A;  1IS1 A;  5IOT A;  3I4M C;  2JA8 C;  2R93 K;  2E2I C;  1G51 A;  1TWC K;  1WOR A;  4O2D A;  4ZH4 A;  2D6F C;  1WQH A;  3FOE A;  5IYC C;  4OIR A;  2E2H K;  1TWF K;  3ERE D;  4A3L K;  1USO A;  4A3M C;  1ZQ1 C;  5IP9 K;  2B63 C;  5C44 K;  2NVX A;  2JA6 K;  4ILD A;  1HQM A;  3BUE A;  4GTD A;  3AQP A; 
#chains in the Genus database with same CATH homology
 1R9T K;  5IYB C;  4C3J K;  1R9T C;  2A68 A;  5C3E K;  3H3V D;  2NVQ K;  4C3H K;  4OIN A;  2PA8 L;  5C3E C;  4JK1 A;  2NVQ C;  4QJV B;  2O5I A;  3K7A K;  4A3E K;  3K7A C;  4A3E C;  4C2M K;  1SMY A;  3GTJ K;  3S1R K;  4X6A K;  3GTJ C;  3S1R C;  3HOY K;  4X6A C;  3H0G K;  2VUM K;  3HOY C;  4A93 K;  4G7O A;  4KMU A;  3H0G C;  2PA8 D;  4A3K K;  2VUM C;  2E2J K;  4A93 C;  4BBR K;  4A3K C;  2E2J C;  5IYD K;  4BBR C;  1BDF A;  1I3Q K;  5IYD C;  1I3Q C;  1TWH K;  4A3J K;  2JA7 K;  3GTM K;  1I6H K;  1TWH C;  4A3J C;  1K83 K;  2JA7 C;  3GTM C;  3S16 K;  4XSX A;  1I6H C;  1K83 C;  3S16 C;  4LJZ A;  3RZD K;  4QIW L;  4BXX K;  2Y0S L;  3RZD C;  4BXX C;  3S15 K;  4BBS K;  3S15 C;  3M4O K;  4BBS C;  4MQ9 A;  3S2H K;  3M4O C;  3S14 K;  2JA5 K;  4MEX A;  4OIP A;  3S2H C;  2PPB A;  4YFK A;  2JA5 C;  4YG2 A;  3GTG K;  4A3C K;  1YNN A;  3GTG C;  3CQZ K;  4QJV A;  5FJ8 K;  3M3Y K;  3HOU K;  5C4X K;  4OIQ A;  3CQZ C;  3M3Y C;  4QIW D;  3HOU C;  5C4X C;  2Y0S D;  1IW7 A;  3PO3 K;  3S1M K;  3EQL A;  3PO3 C;  3S1M C;  2NVY K;  2NVY C;  4Y7N K;  4Y7N C;  1XPP A;  4NOI A;  4A3F K;  4Q4Z A;  1TWA K;  4A3F C;  4A3D K;  2WAQ L;  1TWA C;  2O5J A;  4C3I K;  4LLG A;  2PMZ L;  4A3D C;  3HOW K;  3WOD A;  3HOW C;  2CW0 A;  4LK0 A;  4KN4 A;  4OIO A;  4YFX A;  1Y1W K;  1SFO K;  2NVX K;  4BY7 K;  1Y1W C;  1Y1V K;  5D4D A;  2NVX C;  1SFO C;  3S1Q K;  4BY7 C;  4A3G K;  1Y1V C;  5M5X K;  4A3G C;  3S1Q C;  3I4N K;  3GTP K;  2WAQ D;  4MEY A;  3S17 K;  3I4N C;  1TWG K;  2PMZ D;  3GTP C;  3S17 C;  3S14 C;  1TWG C;  4KN7 A;  4A3C C;  1WCM K;  5IP7 K;  1WCM C;  4G7H A;  5IP7 C;  3GTQ K;  4Y52 K;  4Y52 C;  3GTQ C;  1YNJ A;  3HOV K;  4Q5S A;  2YU9 K;  2A69 A;  3HOV C;  4LK1 A;  4BY1 K;  3HOX K;  2YU9 C;  4BY1 C;  3HOX C;  3RZO K;  4XSZ A;  3RZO C;  5TMF A;  3DXJ A;  4AYB L;  4A3B K;  5FLM K;  1I50 K;  4A3B C;  5FLM C;  1I50 C;  5TMC A;  3HOZ K;  3PO2 K;  3I4M K;  4A3I K;  2JA8 K;  2A6H A;  2NVT K;  2E2I K;  3HOZ C;  3I4M C;  4A3I C;  2JA8 C;  2NVT C;  3PO2 C;  2E2I C;  3S2D C;  2R93 K;  3GTL K;  1I6V A;  1TWC K;  3S2D K;  2R93 C;  3GTL C;  1TWC C;  3S1N K;  2WB1 L;  3FKI K;  4ZH4 A;  4XLP A;  2R92 K;  3S1N C;  5M5Y K;  2A6E A;  3FKI C;  5IYC K;  4AYB D;  2R92 C;  5IYC C;  1ZYR A;  4OIR A;  5M3M K;  2E2H K;  2R7Z K;  3HKZ L;  2E2H C;  1TWF K;  4A3M K;  2R7Z C;  2BE5 A;  4A3L K;  1TWF C;  4GZY A;  4A3M C;  4G7Z A;  4A3L C;  5IP9 K;  5M3F K;  2B63 K;  3H3V L;  2WB1 D;  5IP9 C;  5C44 K;  5C4J K;  2B63 C;  3GTO K;  3GTK K;  2JA6 K;  5C44 C;  5C4J C;  3GTK C;  3GTO C;  5M5W K;  2JA6 C;  1HQM A;  4XLN A;  3HKZ D;  4YFN A;  5IYB K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...