4A3KK

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3kK00
3GTMK 1TWFK 2JA6K 1I3QC 3HOZK 4GZYA 3CQZK 5C3EK 4A3GC 4X6AK 3GTJK 3HKZD 4QJVB 5IYCC 2B63C 2R7ZC 2R7ZK 5IYDC 3H3VL 4A3FK 4Q5SA 3HOUK 3H3VD 3I4NC 3GTPK 1TWAC 1TWAK 2PMZL 2JA8K 4A3CK 1K83C 1TWHK 5IP9K 4A3IK 4A3MC 3GTMC 4A3KK 4A3BC 2VUMC 1SFOK 3S14C 2B63K 3S2DK 3FKIC 4XSXA 1R9TK 3GTPC 3I4MK 3M4OC 3S1QK 1TWCC 4Y7NK 2PMZD 3S2HC 4A3BK 3GTKC 2YU9K 4OINA 4A3JK 5C4XC 2E2IC 1HQMA 2E2IK 4XSZA 4A3FC 3HOUC 1WCMK 5FJ8K 2R92C 4BY1C 4A3DC 4X6AC 1YNNA 5IYCK 3RZDC 3H0GC 3S1NC 3H0GK 4LLGA 4OIQA 4LJZA 3EQLA 2NVQK 1TWHC 2A6EA 4C3HK 3S1RC 3PO3K 1XPPA 1YNJA 4G7HA 5TMFA 3FKIK 4ZH4A 1I50K 3GTLC 1I50C 3GTLK 1SMYA 1Y1VK 1Y1WK 4MEYA 2NVTC 1K83K 4A3LK 2WAQL 4BBRK 4A3IC 3PO3C 3HOVK 4BBSK 2BE5A 3HOYK 3K7AC 5IYBK 1I6VA 1SFOC 3S14K 4QJVA 3S15K 3RZOC 2R93C 4KN7A 4A3LC 1WCMC 1TWGC 4A93K 5FLMK 2A68A 4OIRA 5TMCA 4XLPA 1I3QK 3HOZC 4A3GK 3CQZC 3HKZL 5C3EC 4BY7K 4BXXC 4BXXK 5M5WK 3HOXK 3HOXC 2NVTK 4OIPA 1R9TC 2NVQC 3GTGK 3M3YC 1Y1VC 3RZDK 3S1NK 3S2DC 4A3CC 4LK0A 2NVYC 2PPBA 2O5IA 2VUMK 3PO2K 5D4DA 4A3KC 5C44K 4A3EC 2JA7K 3DXJA 2JA7C 3S16K 4MEXA 4YFNA 5C4XK 3RZOK 4QIWL 5C4JK 2R93K 2E2JC 4LK1A 4C3JK 2E2JK 3I4NK 3S1QC 2A6HA 2R92K 2JA5K 4KN4A 4XLNA 3I4MC 4YFKA 5M5YK 4NOIA 2NVXK 3K7AK 5IP7C 5IYBC 3M4OK 3WODA 3PO2C 3S16C 1TWFC 3HOVC 2O5JA 2YU9C 3GTKK 2WB1D 3S1MC 2WB1L 3S1MK 4QIWD 1IW7A 4YG2A 3GTOC 3GTOK 4Y52K 2A69A 4Y52C 4BBRC 3S1RK 2PA8L 1BDFA 4AYBL 3GTJC 5C4JC 4C2MK 2Y0SD 2JA6C 4JK1A 4C3IK 2Y0SL 4BY1K 4A3DK 5M3FK 4G7ZA 3S15C 1Y1WC 5IYDK 5IP7K 2NVYK 5M3MK 2WAQD 2JA5C 2CW0A 4BBSC 3HOYC 2PA8D 1TWCK 4AYBD 4Y7NC 3S2HK 1I6HK 2E2HK 4A3MK 2E2HC 3HOWK 4KMUA 3HOWC 5M5XK 4YFXA 5C44C 4A3EK 3S17C 4OIOA 4MQ9A 4Q4ZA 4A3JC 4BY7C 3GTQC 3GTQK 4G7OA 3GTGC 3M3YK 1ZYRA 1TWGK 4A93C 5FLMC 2NVXC 2JA8C 1I6HC 5IP9C 3S17K
chains in the Genus database with same CATH superfamily
4P5AA 2GSNA 3GDZA 4A3GC 5IYCC 5IYDC 1J6WA 1F7VA 3GTPK 2PMZL 4A3CK 1K83C 3GTMC 4A3BC 1SFOK 3TFHA 1G51A 4XSXA 4GTCA 3I4MK 4GT9A 2FQTA 4FZBA 2ZUEA 1HQMA 1GE9A 4BY1C 5CJ9A 2YU9A 4LLGA 4KDDA 1X31C 4KM9A 4C3HK 3S1RC 1XPPA 2RH6A 5IOSA 3SZZA 4ZH4A 1I50K 3GTLC 1I50C 4FM9A 1XXBA 1YX2A 1SMYA 3GTLK 1Y1VK 4BLBA 2NVTC 3GIRA 5HL8A 4A3IC 4BBRK 5L46A 2JA6A 3GTQA 3K7AC 5IYBK 1SFOC 3S15K 4KB4A 1RU0A 4KB2A 4A3LC 1WCMC 4GTBA 4A93K 5FLMK 5IOQA 1IBAA 1AB4A 3FHZA 3HOZC 1I50A 5C3EC 4BXXC 4BXXK 4BKWA 1EH1A 3S2DC 3S16K 4A3EC 2EBBA 4QIWL 2R93K 2E2JC 3LAJA 1F9NA 4LK1A 2E2JK 2A6HA 2R92K 3T00A 5M5YK 2NVXK 5IP7C 3WODA 3PO2C 1TWFC 1O26A 5IOTA 3GTKK 2P5MA 3SZYA 3GTKA 4Y52K 4Y52C 3V4GA 2R92A 1KQ4A 3JSTA 4C2MK 2Y0SD 3TTGA 4JK1A 4C3IK 1PJ6A 2Y0SL 4C3IC 4BY1K 5M3FK 1TWAA 2PA8D 4Y7NC 3S2HK 2E2HK 2E2HC 2VUMA 1JOEA 2GSOA 4KMUA 4A3EK 4BY7C 3S0XA 4Q4ZA 4A3JC 3NUHA 1TWGK 3OEPA 2NVXC 3GTMK 1TWFK 1I3QC 4X6AK 3HKZD 4QJVB 4GTEA 1IL2A 2R7ZC 2R7ZK 1Y1WA 3H3VL 3H3VD 1J6VA 1INNA 3AH5A 1TWHK 4A3MC 3Q3QA 3GEHA 4WJ4A 4P9SA 1PJ5A 3M4OC 3S1QK 3GTOA 2YU9K 4OINA 1XXAA 4KATA 4A3FC 3HOUC 5FJ8K 2R92C 5IYCK 3OREA 3RZDC 3H0GC 3S1NC 3H0GK 4KASA 1WCMA 4LJZA 5JVOA 2V6TA 2E2IA 2JA7A 4O2DA 5EGEA 1TWHA 3FKIK 2XCQA 1WSRA 1V5VA 3ADAC 1F93A 1Y1WK 1USMA 1K83K 4A3LK 2WAQL 3PO3C 3HOVK 4BBSK 2BE5A 1WQFA 3N0BA 3AQPA 4GTDA 5TMCA 4XLPA 1XZPB 4A3GK 4BY7K 3CQZC 4AH6A 2GSUA 1R9TC 1BS2A 1J6XA 3AD7C 1Y1VC 3RZDK 1B4BA 4GTAA 3S1NK 1XZPA 2NVYC 2PPBA 2RGRA 3PO2K 1IQ0A 4A3KC 4YFNA 3RZOK 3LPXA 5C4JK 1WORA 4C3JK 4C3JC 1K83A 1YCLA 1O24A 2ZFZA 4YFKA 3K7AK 5IYBC 2NVXA 4GTFA 3FKIA 3HOVC 3H0GA 2WB1D 2WB1L 4WJ3M 4KM8A 3L4KA 3GTOC 3GTOK 2R93A 4KMAA 1WSVA 3S1RK 4WILA 2PA8L 1VH2A 3GTJC 2CFAA 1JVIA 5IYDK 5M3MK 2CFAB 1TWCK 3HOWK 2JH3A 3HOWC 4YFXA 4OIOA 3OPFA 1I3QA 3GTQC 3GTQK 3M3YK 1DCHA 1ZYRA 1J98A 2R7ZA 3TFJA 3BP8C 1IE0A 1TWHC 4A3MK 1TWFA 1Y1VA 3G4AA 2JA6K 3HOZK 3T02A 4P5BA 5C3EK 2XCRB 3GTLA 1TWGA 3TFIA 4Q5SA 1BGWA 1TWAC 1WIHA 1TWAK 1JQWA 2JA8K 2VUMC 2P8TA 3S14C 2E2HA 3GSIA 4KMDA 3A8IA 4GTLA 2B63K 1R9TK 4PABA 4J3NA 4Y7NK 3S2HC 3T01A 4PAAA 3GTKC 4A3JK 4XSZA 3MMLB 1VJEA 1HI9A 4A3DC 4X6AC 1YNNA 4OIQA 2NVQK 1O2BA 3PO3K 3HXAA 2V6SA 1XZQA 1YNJA 4G7HA 5TMFA 1O2FB 4RMFA 1VLOA 3BP3A 4M1XA 4MEYA 1B4AA 1R9TA 1O27A 3HOYK 3L4JA 3S14K 1ZXOA 4GFQA 4KN7A 2R93C 3AD9C 1XZQB 1TWGC 2A68A 3QX3A 1ISEA 1ZBSA 1C0AA 2W7VA 1WQGA 4KC6A 5M5WK 2NVTK 1F7UA 3M3YC 1WOSA 4LK0A 4A3CC 2O5IA 5D4DA 2JA7C 2JA7K 1TWCA 2KWAA 5C4XK 4C2MC 3CAGA 2JA5K 4KN4A 4XLNA 3I4MC 3S1QC 4NOIA 3BUEA 3AD8C 2YU9C 5IORA 5CHPA 3S1MC 3S1MK 2FQOA 1IW7A 3GEIA 2A69A 1O25A 3ERED 4A3DK 1ZQ1C 4G7ZA 1Y1WC 1SFOA 5IP7K 1EK8A 2NVYK 1EFWA 2WAQD 2CW0A 4G0WA 3GTMA 4AYBD 3S17K 3N3YA 3S17C 1WOOA 4MQ9A 1EI6A 1DCPA 2ZUFA 3GTGC 2GAHC 4A93C 1VGXA 1UV7A 5FLMC 2JA8C 1I6HC 3LAPA 4GZYA 3CQZK 3GTJK 2B63C 1WOPA 4A3FK 3HOUK 3I4NC 1USOA 5JFEA 1O2AA 3S2DK 3A8JA 5IP9K 4A3IK 4LOWA 4A3KK 4KMHA 3G4CA 3FKIC 3FOFA 3A8KA 3GTPC 4KARA 1DD5A 1TWCC 2PMZD 4A3BK 5C4XC 3IPJA 2E2IC 2E2IK 1WCMK 4LQYA 1IS1A 1DCOA 3EQLA 2A6EA 4KAWX 3AQOA 2Y3PA 4G0UA 3CQZA 2B63A 1XXCA 3GTJA 1O29A 4C3HC 4DDQA 1I6VA 3GTGA 4C45A 5EGHA 3N0CA 1EQRA 4QJVA 3RZOC 3GEEA 2XCOA 4OIRA 1I3QK 5TJ3A 3HKZL 1PJ7A 4BLAA 2GAGC 2NVYA 3HOXK 1BJTA 3HOXC 4OIPA 2NVQC 3GTGK 2PHCB 1ZVUA 2VUMK 5C44K 3DXJA 1L0WA 3VA7A 4MEXA 2V6UA 3I4NK 4LR2A 1WQHA 3M4OK 2D6FC 3S16C 2JA5A 2O5JA 4ILDA 4QIWD 4YG2A 1VRQC 5E68A 4G0VA 4BBRC 1BDFA 4AYBL 5C4JC 3FOEA 2JA6C 1O28A 3GTPA 4XCHA 3S15C 2JA5C 4BBSC 3HOYC 1I6HK 5M5XK 5C44C 4G7OA 5IP9C
chains in the Genus database with same CATH topology
3GTMK 1TWFK 2JA6K 1I3QC 3HOZK 4GZYA 3CQZK 5C3EK 4A3GC 4X6AK 3GTJK 3HKZD 4QJVB 5IYCC 2B63C 2R7ZC 2R7ZK 5IYDC 3H3VL 4A3FK 4Q5SA 3HOUK 3H3VD 3I4NC 3GTPK 1TWAC 1TWAK 2PMZL 2JA8K 4A3CK 1K83C 1TWHK 5IP9K 4A3IK 4A3MC 3GTMC 4A3KK 4A3BC 2VUMC 1SFOK 3S14C 2B63K 3S2DK 3FKIC 4XSXA 1R9TK 3GTPC 3I4MK 3M4OC 3S1QK 1TWCC 4Y7NK 2PMZD 3S2HC 4A3BK 3GTKC 2YU9K 4OINA 4A3JK 5C4XC 2E2IC 1HQMA 2E2IK 4XSZA 4A3FC 3HOUC 1WCMK 5FJ8K 2R92C 4BY1C 4A3DC 4X6AC 1YNNA 5IYCK 3RZDC 3H0GC 3S1NC 3H0GK 4LLGA 4OIQA 4LJZA 3EQLA 2NVQK 1TWHC 2A6EA 4C3HK 3S1RC 3PO3K 1XPPA 1YNJA 4G7HA 5TMFA 3FKIK 4ZH4A 1I50K 3GTLC 1I50C 3GTLK 1SMYA 1Y1VK 1Y1WK 4MEYA 2NVTC 1K83K 4A3LK 2WAQL 4BBRK 4A3IC 3PO3C 3HOVK 4BBSK 2BE5A 3HOYK 3K7AC 5IYBK 1I6VA 1SFOC 3S14K 4QJVA 3S15K 3RZOC 2R93C 4KN7A 4A3LC 1WCMC 1TWGC 4A93K 5FLMK 2A68A 4OIRA 5TMCA 4XLPA 1I3QK 3HOZC 4A3GK 3CQZC 3HKZL 5C3EC 4BY7K 4BXXC 4BXXK 5M5WK 3HOXK 3HOXC 2NVTK 4OIPA 1R9TC 2NVQC 3GTGK 3M3YC 1Y1VC 3RZDK 3S1NK 3S2DC 4A3CC 4LK0A 2NVYC 2PPBA 2O5IA 2VUMK 3PO2K 5D4DA 4A3KC 5C44K 4A3EC 2JA7K 3DXJA 2JA7C 3S16K 4MEXA 4YFNA 5C4XK 3RZOK 4QIWL 5C4JK 2R93K 2E2JC 4LK1A 4C3JK 2E2JK 3I4NK 3S1QC 2A6HA 2R92K 2JA5K 4KN4A 4XLNA 3I4MC 4YFKA 5M5YK 4NOIA 2NVXK 3K7AK 5IP7C 5IYBC 3M4OK 3WODA 3PO2C 3S16C 1TWFC 3HOVC 2O5JA 2YU9C 3GTKK 2WB1D 3S1MC 2WB1L 3S1MK 4QIWD 1IW7A 4YG2A 3GTOC 3GTOK 4Y52K 2A69A 4Y52C 4BBRC 3S1RK 2PA8L 1BDFA 4AYBL 3GTJC 5C4JC 4C2MK 2Y0SD 2JA6C 4JK1A 4C3IK 2Y0SL 4BY1K 4A3DK 5M3FK 4G7ZA 3S15C 1Y1WC 5IYDK 5IP7K 2NVYK 5M3MK 2WAQD 2JA5C 2CW0A 4BBSC 3HOYC 2PA8D 1TWCK 4AYBD 4Y7NC 3S2HK 1I6HK 2E2HK 4A3MK 2E2HC 3HOWK 4KMUA 3HOWC 5M5XK 4YFXA 5C44C 4A3EK 3S17C 4OIOA 4MQ9A 4Q4ZA 4A3JC 4BY7C 3GTQC 3GTQK 4G7OA 3GTGC 3M3YK 1ZYRA 1TWGK 4A93C 5FLMC 2NVXC 2JA8C 1I6HC 5IP9C 3S17K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTM K;  1TWF K;  2JA6 K;  1I3Q C;  3HOZ K;  4GZY A;  3CQZ K;  5C3E K;  4A3G C;  4X6A K;  3GTJ K;  3HKZ D;  4QJV B;  5IYC C;  2B63 C;  2R7Z C;  2R7Z K;  5IYD C;  3H3V L;  4A3F K;  4Q5S A;  3HOU K;  3H3V D;  3I4N C;  3GTP K;  1TWA C;  1TWA K;  2PMZ L;  2JA8 K;  4A3C K;  1K83 C;  1TWH K;  5IP9 K;  4A3I K;  4A3M C;  3GTM C;  4A3K K;  4A3B C;  2VUM C;  1SFO K;  3S14 C;  2B63 K;  3S2D K;  3FKI C;  4XSX A;  1R9T K;  3GTP C;  3I4M K;  3M4O C;  3S1Q K;  1TWC C;  4Y7N K;  2PMZ D;  3S2H C;  4A3B K;  3GTK C;  2YU9 K;  4OIN A;  4A3J K;  5C4X C;  2E2I C;  1HQM A;  2E2I K;  4XSZ A;  4A3F C;  3HOU C;  1WCM K;  5FJ8 K;  2R92 C;  4BY1 C;  4A3D C;  4X6A C;  1YNN A;  5IYC K;  3RZD C;  3H0G C;  3S1N C;  3H0G K;  4LLG A;  4OIQ A;  4LJZ A;  3EQL A;  2NVQ K;  1TWH C;  2A6E A;  4C3H K;  3S1R C;  3PO3 K;  1XPP A;  1YNJ A;  4G7H A;  5TMF A;  3FKI K;  4ZH4 A;  1I50 K;  3GTL C;  1I50 C;  3GTL K;  1SMY A;  1Y1V K;  1Y1W K;  4MEY A;  2NVT C;  1K83 K;  4A3L K;  2WAQ L;  4BBR K;  4A3I C;  3PO3 C;  3HOV K;  4BBS K;  2BE5 A;  3HOY K;  3K7A C;  5IYB K;  1I6V A;  1SFO C;  3S14 K;  4QJV A;  3S15 K;  3RZO C;  2R93 C;  4KN7 A;  4A3L C;  1WCM C;  1TWG C;  4A93 K;  5FLM K;  2A68 A;  4OIR A;  5TMC A;  4XLP A;  1I3Q K;  3HOZ C;  4A3G K;  3CQZ C;  3HKZ L;  5C3E C;  4BY7 K;  4BXX C;  4BXX K;  5M5W K;  3HOX K;  3HOX C;  2NVT K;  4OIP A;  1R9T C;  2NVQ C;  3GTG K;  3M3Y C;  1Y1V C;  3RZD K;  3S1N K;  3S2D C;  4A3C C;  4LK0 A;  2NVY C;  2PPB A;  2O5I A;  2VUM K;  3PO2 K;  5D4D A;  4A3K C;  5C44 K;  4A3E C;  2JA7 K;  3DXJ A;  2JA7 C;  3S16 K;  4MEX A;  4YFN A;  5C4X K;  3RZO K;  4QIW L;  5C4J K;  2R93 K;  2E2J C;  4LK1 A;  4C3J K;  2E2J K;  3I4N K;  3S1Q C;  2A6H A;  2R92 K;  2JA5 K;  4KN4 A;  4XLN A;  3I4M C;  4YFK A;  5M5Y K;  4NOI A;  2NVX K;  3K7A K;  5IP7 C;  5IYB C;  3M4O K;  3WOD A;  3PO2 C;  3S16 C;  1TWF C;  3HOV C;  2O5J A;  2YU9 C;  3GTK K;  2WB1 D;  3S1M C;  2WB1 L;  3S1M K;  4QIW D;  1IW7 A;  4YG2 A;  3GTO C;  3GTO K;  4Y52 K;  2A69 A;  4Y52 C;  4BBR C;  3S1R K;  2PA8 L;  1BDF A;  4AYB L;  3GTJ C;  5C4J C;  4C2M K;  2Y0S D;  2JA6 C;  4JK1 A;  4C3I K;  2Y0S L;  4BY1 K;  4A3D K;  5M3F K;  4G7Z A;  3S15 C;  1Y1W C;  5IYD K;  5IP7 K;  2NVY K;  5M3M K;  2WAQ D;  2JA5 C;  2CW0 A;  4BBS C;  3HOY C;  2PA8 D;  1TWC K;  4AYB D;  4Y7N C;  3S2H K;  1I6H K;  2E2H K;  4A3M K;  2E2H C;  3HOW K;  4KMU A;  3HOW C;  5M5X K;  4YFX A;  5C44 C;  4A3E K;  3S17 C;  4OIO A;  4MQ9 A;  4Q4Z A;  4A3J C;  4BY7 C;  3GTQ C;  3GTQ K;  4G7O A;  3GTG C;  3M3Y K;  1ZYR A;  1TWG K;  4A93 C;  5FLM C;  2NVX C;  2JA8 C;  1I6H C;  5IP9 C;  3S17 K; 
#chains in the Genus database with same CATH topology
 4P5A A;  2GSN A;  3GDZ A;  4A3G C;  5IYC C;  5IYD C;  1J6W A;  1F7V A;  3GTP K;  2PMZ L;  4A3C K;  1K83 C;  3GTM C;  4A3B C;  1SFO K;  3TFH A;  1G51 A;  4XSX A;  4GTC A;  3I4M K;  4GT9 A;  2FQT A;  4FZB A;  2ZUE A;  1HQM A;  1GE9 A;  4BY1 C;  5CJ9 A;  2YU9 A;  4LLG A;  4KDD A;  1X31 C;  4KM9 A;  4C3H K;  3S1R C;  1XPP A;  2RH6 A;  5IOS A;  3SZZ A;  4ZH4 A;  1I50 K;  3GTL C;  1I50 C;  4FM9 A;  1XXB A;  1YX2 A;  1SMY A;  3GTL K;  1Y1V K;  4BLB A;  2NVT C;  3GIR A;  5HL8 A;  4A3I C;  4BBR K;  5L46 A;  2JA6 A;  3GTQ A;  3K7A C;  5IYB K;  1SFO C;  3S15 K;  4KB4 A;  1RU0 A;  4KB2 A;  4A3L C;  1WCM C;  4GTB A;  4A93 K;  5FLM K;  5IOQ A;  1IBA A;  1AB4 A;  3FHZ A;  3HOZ C;  1I50 A;  5C3E C;  4BXX C;  4BXX K;  4BKW A;  1EH1 A;  3S2D C;  3S16 K;  4A3E C;  2EBB A;  4QIW L;  2R93 K;  2E2J C;  3LAJ A;  1F9N A;  4LK1 A;  2E2J K;  2A6H A;  2R92 K;  3T00 A;  5M5Y K;  2NVX K;  5IP7 C;  3WOD A;  3PO2 C;  1TWF C;  1O26 A;  5IOT A;  3GTK K;  2P5M A;  3SZY A;  3GTK A;  4Y52 K;  4Y52 C;  3V4G A;  2R92 A;  1KQ4 A;  3JST A;  4C2M K;  2Y0S D;  3TTG A;  4JK1 A;  4C3I K;  1PJ6 A;  2Y0S L;  4C3I C;  4BY1 K;  5M3F K;  1TWA A;  2PA8 D;  4Y7N C;  3S2H K;  2E2H K;  2E2H C;  2VUM A;  1JOE A;  2GSO A;  4KMU A;  4A3E K;  4BY7 C;  3S0X A;  4Q4Z A;  4A3J C;  3NUH A;  1TWG K;  3OEP A;  2NVX C;  3GTM K;  1TWF K;  1I3Q C;  4X6A K;  3HKZ D;  4QJV B;  4GTE A;  1IL2 A;  2R7Z C;  2R7Z K;  1Y1W A;  3H3V L;  3H3V D;  1J6V A;  1INN A;  3AH5 A;  1TWH K;  4A3M C;  3Q3Q A;  3GEH A;  4WJ4 A;  4P9S A;  1PJ5 A;  3M4O C;  3S1Q K;  3GTO A;  2YU9 K;  4OIN A;  1XXA A;  4KAT A;  4A3F C;  3HOU C;  5FJ8 K;  2R92 C;  5IYC K;  3ORE A;  3RZD C;  3H0G C;  3S1N C;  3H0G K;  4KAS A;  1WCM A;  4LJZ A;  5JVO A;  2V6T A;  2E2I A;  2JA7 A;  4O2D A;  5EGE A;  1TWH A;  3FKI K;  2XCQ A;  1WSR A;  1V5V A;  3ADA C;  1F93 A;  1Y1W K;  1USM A;  1K83 K;  4A3L K;  2WAQ L;  3PO3 C;  3HOV K;  4BBS K;  2BE5 A;  1WQF A;  3N0B A;  3AQP A;  4GTD A;  5TMC A;  4XLP A;  1XZP B;  4A3G K;  4BY7 K;  3CQZ C;  4AH6 A;  2GSU A;  1R9T C;  1BS2 A;  1J6X A;  3AD7 C;  1Y1V C;  3RZD K;  1B4B A;  4GTA A;  3S1N K;  1XZP A;  2NVY C;  2PPB A;  2RGR A;  3PO2 K;  1IQ0 A;  4A3K C;  4YFN A;  3RZO K;  3LPX A;  5C4J K;  1WOR A;  4C3J K;  4C3J C;  1K83 A;  1YCL A;  1O24 A;  2ZFZ A;  4YFK A;  3K7A K;  5IYB C;  2NVX A;  4GTF A;  3FKI A;  3HOV C;  3H0G A;  2WB1 D;  2WB1 L;  4WJ3 M;  4KM8 A;  3L4K A;  3GTO C;  3GTO K;  2R93 A;  4KMA A;  1WSV A;  3S1R K;  4WIL A;  2PA8 L;  1VH2 A;  3GTJ C;  2CFA A;  1JVI A;  5IYD K;  5M3M K;  2CFA B;  1TWC K;  3HOW K;  2JH3 A;  3HOW C;  4YFX A;  4OIO A;  3OPF A;  1I3Q A;  3GTQ C;  3GTQ K;  3M3Y K;  1DCH A;  1ZYR A;  1J98 A;  2R7Z A;  3TFJ A;  3BP8 C;  1IE0 A;  1TWH C;  4A3M K;  1TWF A;  1Y1V A;  3G4A A;  2JA6 K;  3HOZ K;  3T02 A;  4P5B A;  5C3E K;  2XCR B;  3GTL A;  1TWG A;  3TFI A;  4Q5S A;  1BGW A;  1TWA C;  1WIH A;  1TWA K;  1JQW A;  2JA8 K;  2VUM C;  2P8T A;  3S14 C;  2E2H A;  3GSI A;  4KMD A;  3A8I A;  4GTL A;  2B63 K;  1R9T K;  4PAB A;  4J3N A;  4Y7N K;  3S2H C;  3T01 A;  4PAA A;  3GTK C;  4A3J K;  4XSZ A;  3MML B;  1VJE A;  1HI9 A;  4A3D C;  4X6A C;  1YNN A;  4OIQ A;  2NVQ K;  1O2B A;  3PO3 K;  3HXA A;  2V6S A;  1XZQ A;  1YNJ A;  4G7H A;  5TMF A;  1O2F B;  4RMF A;  1VLO A;  3BP3 A;  4M1X A;  4MEY A;  1B4A A;  1R9T A;  1O27 A;  3HOY K;  3L4J A;  3S14 K;  1ZXO A;  4GFQ A;  4KN7 A;  2R93 C;  3AD9 C;  1XZQ B;  1TWG C;  2A68 A;  3QX3 A;  1ISE A;  1ZBS A;  1C0A A;  2W7V A;  1WQG A;  4KC6 A;  5M5W K;  2NVT K;  1F7U A;  3M3Y C;  1WOS A;  4LK0 A;  4A3C C;  2O5I A;  5D4D A;  2JA7 C;  2JA7 K;  1TWC A;  2KWA A;  5C4X K;  4C2M C;  3CAG A;  2JA5 K;  4KN4 A;  4XLN A;  3I4M C;  3S1Q C;  4NOI A;  3BUE A;  3AD8 C;  2YU9 C;  5IOR A;  5CHP A;  3S1M C;  3S1M K;  2FQO A;  1IW7 A;  3GEI A;  2A69 A;  1O25 A;  3ERE D;  4A3D K;  1ZQ1 C;  4G7Z A;  1Y1W C;  1SFO A;  5IP7 K;  1EK8 A;  2NVY K;  1EFW A;  2WAQ D;  2CW0 A;  4G0W A;  3GTM A;  4AYB D;  3S17 K;  3N3Y A;  3S17 C;  1WOO A;  4MQ9 A;  1EI6 A;  1DCP A;  2ZUF A;  3GTG C;  2GAH C;  4A93 C;  1VGX A;  1UV7 A;  5FLM C;  2JA8 C;  1I6H C;  3LAP A;  4GZY A;  3CQZ K;  3GTJ K;  2B63 C;  1WOP A;  4A3F K;  3HOU K;  3I4N C;  1USO A;  5JFE A;  1O2A A;  3S2D K;  3A8J A;  5IP9 K;  4A3I K;  4LOW A;  4A3K K;  4KMH A;  3G4C A;  3FKI C;  3FOF A;  3A8K A;  3GTP C;  4KAR A;  1DD5 A;  1TWC C;  2PMZ D;  4A3B K;  5C4X C;  3IPJ A;  2E2I C;  2E2I K;  1WCM K;  4LQY A;  1IS1 A;  1DCO A;  3EQL A;  2A6E A;  4KAW X;  3AQO A;  2Y3P A;  4G0U A;  3CQZ A;  2B63 A;  1XXC A;  3GTJ A;  1O29 A;  4C3H C;  4DDQ A;  1I6V A;  3GTG A;  4C45 A;  5EGH A;  3N0C A;  1EQR A;  4QJV A;  3RZO C;  3GEE A;  2XCO A;  4OIR A;  1I3Q K;  5TJ3 A;  3HKZ L;  1PJ7 A;  4BLA A;  2GAG C;  2NVY A;  3HOX K;  1BJT A;  3HOX C;  4OIP A;  2NVQ C;  3GTG K;  2PHC B;  1ZVU A;  2VUM K;  5C44 K;  3DXJ A;  1L0W A;  3VA7 A;  4MEX A;  2V6U A;  3I4N K;  4LR2 A;  1WQH A;  3M4O K;  2D6F C;  3S16 C;  2JA5 A;  2O5J A;  4ILD A;  4QIW D;  4YG2 A;  1VRQ C;  5E68 A;  4G0V A;  4BBR C;  1BDF A;  4AYB L;  5C4J C;  3FOE A;  2JA6 C;  1O28 A;  3GTP A;  4XCH A;  3S15 C;  2JA5 C;  4BBS C;  3HOY C;  1I6H K;  5M5X K;  5C44 C;  4G7O A;  5IP9 C; 
#chains in the Genus database with same CATH homology
 3GTM K;  1TWF K;  2JA6 K;  1I3Q C;  3HOZ K;  4GZY A;  3CQZ K;  5C3E K;  4A3G C;  4X6A K;  3GTJ K;  3HKZ D;  4QJV B;  5IYC C;  2B63 C;  2R7Z C;  2R7Z K;  5IYD C;  3H3V L;  4A3F K;  4Q5S A;  3HOU K;  3H3V D;  3I4N C;  3GTP K;  1TWA C;  1TWA K;  2PMZ L;  2JA8 K;  4A3C K;  1K83 C;  1TWH K;  5IP9 K;  4A3I K;  4A3M C;  3GTM C;  4A3K K;  4A3B C;  2VUM C;  1SFO K;  3S14 C;  2B63 K;  3S2D K;  3FKI C;  4XSX A;  1R9T K;  3GTP C;  3I4M K;  3M4O C;  3S1Q K;  1TWC C;  4Y7N K;  2PMZ D;  3S2H C;  4A3B K;  3GTK C;  2YU9 K;  4OIN A;  4A3J K;  5C4X C;  2E2I C;  1HQM A;  2E2I K;  4XSZ A;  4A3F C;  3HOU C;  1WCM K;  5FJ8 K;  2R92 C;  4BY1 C;  4A3D C;  4X6A C;  1YNN A;  5IYC K;  3RZD C;  3H0G C;  3S1N C;  3H0G K;  4LLG A;  4OIQ A;  4LJZ A;  3EQL A;  2NVQ K;  1TWH C;  2A6E A;  4C3H K;  3S1R C;  3PO3 K;  1XPP A;  1YNJ A;  4G7H A;  5TMF A;  3FKI K;  4ZH4 A;  1I50 K;  3GTL C;  1I50 C;  3GTL K;  1SMY A;  1Y1V K;  1Y1W K;  4MEY A;  2NVT C;  1K83 K;  4A3L K;  2WAQ L;  4BBR K;  4A3I C;  3PO3 C;  3HOV K;  4BBS K;  2BE5 A;  3HOY K;  3K7A C;  5IYB K;  1I6V A;  1SFO C;  3S14 K;  4QJV A;  3S15 K;  3RZO C;  2R93 C;  4KN7 A;  4A3L C;  1WCM C;  1TWG C;  4A93 K;  5FLM K;  2A68 A;  4OIR A;  5TMC A;  4XLP A;  1I3Q K;  3HOZ C;  4A3G K;  3CQZ C;  3HKZ L;  5C3E C;  4BY7 K;  4BXX C;  4BXX K;  5M5W K;  3HOX K;  3HOX C;  2NVT K;  4OIP A;  1R9T C;  2NVQ C;  3GTG K;  3M3Y C;  1Y1V C;  3RZD K;  3S1N K;  3S2D C;  4A3C C;  4LK0 A;  2NVY C;  2PPB A;  2O5I A;  2VUM K;  3PO2 K;  5D4D A;  4A3K C;  5C44 K;  4A3E C;  2JA7 K;  3DXJ A;  2JA7 C;  3S16 K;  4MEX A;  4YFN A;  5C4X K;  3RZO K;  4QIW L;  5C4J K;  2R93 K;  2E2J C;  4LK1 A;  4C3J K;  2E2J K;  3I4N K;  3S1Q C;  2A6H A;  2R92 K;  2JA5 K;  4KN4 A;  4XLN A;  3I4M C;  4YFK A;  5M5Y K;  4NOI A;  2NVX K;  3K7A K;  5IP7 C;  5IYB C;  3M4O K;  3WOD A;  3PO2 C;  3S16 C;  1TWF C;  3HOV C;  2O5J A;  2YU9 C;  3GTK K;  2WB1 D;  3S1M C;  2WB1 L;  3S1M K;  4QIW D;  1IW7 A;  4YG2 A;  3GTO C;  3GTO K;  4Y52 K;  2A69 A;  4Y52 C;  4BBR C;  3S1R K;  2PA8 L;  1BDF A;  4AYB L;  3GTJ C;  5C4J C;  4C2M K;  2Y0S D;  2JA6 C;  4JK1 A;  4C3I K;  2Y0S L;  4BY1 K;  4A3D K;  5M3F K;  4G7Z A;  3S15 C;  1Y1W C;  5IYD K;  5IP7 K;  2NVY K;  5M3M K;  2WAQ D;  2JA5 C;  2CW0 A;  4BBS C;  3HOY C;  2PA8 D;  1TWC K;  4AYB D;  4Y7N C;  3S2H K;  1I6H K;  2E2H K;  4A3M K;  2E2H C;  3HOW K;  4KMU A;  3HOW C;  5M5X K;  4YFX A;  5C44 C;  4A3E K;  3S17 C;  4OIO A;  4MQ9 A;  4Q4Z A;  4A3J C;  4BY7 C;  3GTQ C;  3GTQ K;  4G7O A;  3GTG C;  3M3Y K;  1ZYR A;  1TWG K;  4A93 C;  5FLM C;  2NVX C;  2JA8 C;  1I6H C;  5IP9 C;  3S17 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...