4A3KK

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3kK00
4A3MC 3S2DC 4Q4ZA 2A68A 1SFOK 2VUMC 3GTOC 4KMUA 5C44K 3HOUK 3I4MC 3GTKK 4QJVA 4Y7NK 4OIRA 2R93C 4BBRC 1IW7A 3S1NK 3S2HK 4A3LK 1R9TC 3PO2C 3S14K 1SMYA 4XLNA 1K83C 4C3JK 4BXXK 5D4DA 2WB1D 3S1QK 4A3JC 5M3FK 2E2JC 2NVTK 1I50C 3K7AC 3M4OK 2NVYK 2PA8L 5FLMC 3GTMC 3S1RK 3HOYK 2B63C 2JA8C 4A3IC 4KN4A 3HOXK 3HKZD 3HOZK 3RZOK 4Q5SA 1WCMC 4MQ9A 5C4XC 3H0GK 4LK1A 5C3EK 2NVQC 3S1MC 5C4JC 4BY7C 5IYDK 1I3QK 2WB1L 3I4NC 4A93K 2E2HK 2R7ZK 2Y0SD 4OIPA 3PO3C 4QIWD 3GTQC 1Y1VC 4A3MK 3S2DK 4KN7A 1TWCC 2PA8D 3CQZC 2A6EA 5TMFA 2VUMK 3GTOK 3S17C 3HKZL 1I6HC 4LLGA 2WAQD 3M3YC 3I4MK 1HQMA 3DXJA 4X6AK 3HOWC 2CW0A 4JK1A 4YFKA 4A3FC 4A3EC 1YNNA 5M5XK 4BBRK 2JA5C 2R93K 1TWFC 2Y0SL 4NOIA 4YFNA 4XSXA 4A3KK 4QIWL 1R9TK 3S16C 4GZYA 3HOVC 1YNJA 4G7HA 1K83K 3RZDC 2YU9C 2JA7C 2E2IC 3GTGC 4BBSC 3EQLA 2JA6K 4A3JK 4OIOA 5IYBK 2E2JK 1I50K 3K7AK 3GTLK 4A3BK 2WAQL 4A3GC 5M5YK 2BE5A 5FLMK 4OIQA 3GTMK 4A3DC 5IP7K 2B63K 5C44C 2JA8K 2R92C 4A3IK 4ZH4A 4Y7NC 4A3CC 1WCMK 4MEYA 5C4XK 3FKIC 3S1MK 2NVQK 1Y1WC 3H3VD 5C4JK 4QJVB 1ZYRA 3I4NK 2PMZD 5IYCC 1TWHC 4XLPA 3PO3K 2NVXC 3GTQK 1Y1VK 1TWGC 2NVYC 1TWCK 1TWAC 3CQZK 5M5WK 3GTJC 4LJZA 2A69A 4G7ZA 5FJ8K 4BY1C 3M3YK 3S15C 4Y52C 3H3VL 4A3FK 5IP9C 3GTPC 3PO2K 5M3MK 4A3EK 2O5IA 2PMZL 4MEXA 2JA5K 1XPPA 3S16K 3HOVK 4C3HK 1SFOC 4OINA 3RZDK 2PPBA 2YU9K 2JA7K 3GTGK 4BBSK 2E2IK 4YFXA 4AYBL 2O5JA 3HOUC 4A3GK 3GTKC 4A3DK 2R92K 3S2HC 3S1NC 4A3LC 4X6AC 5TMCA 4LK0A 3S14C 4A3CK 4BY7K 3FKIK 4A3KC 1Y1WK 4BXXC 3S1QC 2NVTC 1BDFA 4C3IK 5IYCK 3M4OC 1TWHK 3S17K 3S1RC 2NVXK 2JA6C 2A6HA 5IYBC 3HOYC 4A3BC 4AYBD 1TWGK 3GTLC 1I6HK 1TWAK 4XSZA 3GTJK 3HOXC 3HOZC 3RZOC 5IP7C 3HOWK 3H0GC 4BY1K 3S15K 4YG2A 5C3EC 4Y52K 1TWFK 5IYDC 1I3QC 5IP9K 3WODA 4C2MK 3GTPK 2E2HC 4A93C 4G7OA 2R7ZC 1I6VA
chains in the Genus database with same CATH superfamily
2NVYA 3A8KA 3S2DC 1TWAA 2A68A 2VUMC 4BKWA 1C0AA 4KMUA 1IL2A 4KARA 3HOUK 3I4MC 3N0BA 3GTPA 1EK8A 4Y7NK 1ZQ1C 4BBRC 1IW7A 5EGEA 1SMYA 1K83C 3S0XA 1O2AA 5HL8A 2PA8L 3S1RK 2B63C 3LAPA 4P5AA 1B4BA 1VH2A 4Q5SA 1O2BA 3H0GK 4P9SA 1BS2A 2NVQC 5IORA 1G51A 5IYDK 1IQ0A 4GFQA 3AD9C 2E2HK 2JA6A 3IPJA 3N0CA 4QIWD 1EH1A 2PA8D 2XCRB 3AD8C 4LLGA 3M3YC 1WOOA 4X6AK 3HOWC 4YFKA 4JK1A 3JSTA 4A3FC 2E2HA 1WQHA 2JA5C 1WSVA 4YFNA 1R9TK 3S16C 3HOVC 2V6SA 4A3BK 5IYBK 1L0WA 1I50K 2WAQL 5IP7K 1O28A 1R9TA 1GE9A 2XCOA 5C4JK 1ZYRA 3I4NK 4C3IC 1TWHC 3OREA 2Y3PA 3AH5A 1F9NA 1VRQC 1Y1VK 2NVYC 1TWAC 4KB2A 4LJZA 2A69A 3N3YA 1HI9A 2FQOA 3T00A 4Y52C 3H3VL 5IP9C 3GTPC 2PMZL 4J3NA 5EGHA 1Y1VA 1XZPB 2PPBA 4KC6A 1J6VA 2O5JA 3HOUC 4GTEA 1TWFA 1VLOA 3OEPA 4A3CK 1B4AA 4GTCA 3BP3A 2XCQA 4KM9A 5IYCK 2KWAA 3S1RC 2JA6C 4ILDA 1WIHA 3TFIA 1X31C 1J98A 3HOWK 3H0GC 4BY1K 1DCHA 5IYDC 3AD7C 5CHPA 4G7OA 2E2HC 3HOVK 4ZH4A 1SFOK 4G0WA 1O2FB 3BP8C 3GTKK 3TTGA 4OIRA 3AQOA 4KMDA 4KMAA 1R9TC 1SFOA 5D4DA 3S1QK 4C3HC 2NVTK 5M3FK 1I50C 3GTOA 2NVYK 1VJEA 3HKZD 3RZOK 1XZPA 1PJ7A 4MQ9A 5C3EK 4XCHA 1PJ6A 5C4JC 1I3QK 3I4NC 4KAWX 2Y0SD 1WORA 4OIPA 1J6XA 1Y1VC 2P5MA 3ERED 4KMHA 2A6EA 3S17C 4G0UA 1I6HC 3BUEA 4O2DA 1HQMA 3DXJA 1I3QA 2CW0A 2R93K 3NUHA 1DD5A 1RU0A 3A8JA 1TWFC 4NOIA 4GZYA 4XSXA 4QIWL 1O26A 2JA6K 2ZUEA 3GEHA 1WSRA 2BE5A 4KASA 4KATA 5TJ3A 2R93A 5C44C 4A3IK 4A3CC 1YX2A 1WCMK 4MEYA 5C4XK 4C45A 3FOFA 5IYCC 1O25A 4KB4A 3PO3K 2CFAB 3GTQK 5M5WK 3CQZK 3CAGA 1WCMA 5FJ8K 4BY1C 3GTQA 4C3HK 1SFOC 3CQZA 4OINA 3RZDK 2JA7K 2E2IK 2RH6A 4GTAA 1WQFA 3GTKC 2R92K 1V5VA 1UV7A 1KQ4A 2JA7A 2E2IA 4A3KC 3S1QC 2NVTC 4LR2A 3S17K 2NVXK 2R92A 1ZXOA 1I6HK 3GTJK 3RZOC 1EFWA 5C3EC 1TWFK 1I3QC 1XXCA 2NVXA 1I6VA 3G4AA 3GTJA 1XXBA 5C44K 4WJ4A 2GSOA 2R93C 3GDZA 1XZQB 2CFAA 3PO2C 2GSNA 3S14K 2R7ZA 4KDDA 4M1XA 4BXXK 2WB1D 3LAJA 4A3IC 3GIRA 4GTFA 1WCMC 5C4XC 4GTDA 1K83A 1YCLA 3PO3C 3GTQC 3GTLA 4A3MK 4KN7A 3CQZC 3GTOK 3HKZL 2ZFZA 1JOEA 4WILA 1USOA 4RMFA 2Y0SL 4A3KK 5IOSA 1YNJA 3RZDC 2JA7C 2E2IC 4A3JK 2E2JK 1IS1A 4BLBA 3K7AK 5IOTA 5M5YK 5FLMK 4OIQA 3GTMK 2R92C 3FHZA 2JA8K 2W7VA 3S1MK 4LOWA 4QJVB 2GSUA 3T01A 3GTMA 4XLPA 4GT9A 2NVXC 1WOPA 1JVIA 1DCPA 1TWCK 3GTJC 1XZQA 4GTLA 4G0VA 3PO2K 4A3EK 1WQGA 2O5IA 1TWCA 2YU9K 3GTGK 4BBSK 3ADAC 3A8IA 3GSIA 4AYBL 1USMA 4A3GK 1J6WA 1ISEA 4A3DK 3L4KA 2PHCB 4LK0A 3S14C 4WJ3M 2YU9A 3FKIK 3GTGA 1Y1WK 4BXXC 1BDFA 1VGXA 5CJ9A 1INNA 4GTBA 2GAHC 4AYBD 1TWGK 3GTLC 4XSZA 1EQRA 2JH3A 3FKIA 2RGRA 3S15K 1Y1WA 2GAGC 1ZBSA 3WODA 4C2MK 4KM8A 3Q3QA 1TWGA 4A3MC 4Q4ZA 3GTOC 3V4GA 1O29A 1WOSA 1JQWA 4QJVA 5JFEA 3H0GA 1IBAA 4DDQA 3S2HK 3S1NK 4A3LK 4XLNA 4C3JK 2P8TA 1BGWA 4A3JC 2E2JC 3TFHA 3K7AC 3M4OK 1PJ5A 3OPFA 5FLMC 3GTMC 3HOYK 2JA8C 4KN4A 3HOXK 3GEEA 3HOZK 1AB4A 4LK1A 5E68A 3S1MC 3LPXA 1O27A 3SZZA 4BY7C 2WB1L 4A93K 2R7ZK 1O24A 3MMLB 1I50A 3VA7A 3S2DK 1TWCC 3T02A 5TMFA 2VUMK 4P5BA 3HXAA 4AH6A 2WAQD 3I4MK 3GEIA 4A3EC 1YNNA 5M5XK 4BBRK 3TFJA 1ZVUA 1F7UA 5IOQA 4FM9A 4G7HA 1K83K 2YU9C 3GTGC 5JVOA 4BBSC 2VUMA 3EQLA 2ZUFA 4OIOA 1EI6A 4PABA 3GTLK 4A3GC 4FZBA 4A3DC 2B63K 5L46A 2V6UA 4Y7NC 3QX3A 3FKIC 2NVQK 1Y1WC 3H3VD 1BJTA 2PMZD 2B63A 1TWGC 3SZYA 2FQTA 4G7ZA 1F7VA 3G4CA 3M3YK 3S15C 4A3FK 4C2MC 5M3MK 4MEXA 2JA5K 1XPPA 3S16K 4YFXA 1IE0A 1XXAA 2V6TA 2JA5A 3S2HC 3S1NC 4A3LC 4X6AC 5TMCA 4BY7K 4C3JC 3FOEA 2D6FC 4C3IK 3M4OC 1TWHK 3L4JA 4LQYA 4BLAA 4A3BC 2A6HA 5IYBC 3HOYC 3GTKA 1F93A 1TWAK 3HOXC 3HOZC 5IP7C 4PAAA 4YG2A 4Y52K 1DCOA 5IP9K 3GTPK 1TWHA 4A93C 2R7ZC 3AQPA 2EBBA
chains in the Genus database with same CATH topology
4A3MC 3S2DC 4Q4ZA 2A68A 1SFOK 2VUMC 3GTOC 4KMUA 5C44K 3HOUK 3I4MC 3GTKK 4QJVA 4Y7NK 4OIRA 2R93C 4BBRC 1IW7A 3S1NK 3S2HK 4A3LK 1R9TC 3PO2C 3S14K 1SMYA 4XLNA 1K83C 4C3JK 4BXXK 5D4DA 2WB1D 3S1QK 4A3JC 5M3FK 2E2JC 2NVTK 1I50C 3K7AC 3M4OK 2NVYK 2PA8L 5FLMC 3GTMC 3S1RK 3HOYK 2B63C 2JA8C 4A3IC 4KN4A 3HOXK 3HKZD 3HOZK 3RZOK 4Q5SA 1WCMC 4MQ9A 5C4XC 3H0GK 4LK1A 5C3EK 2NVQC 3S1MC 5C4JC 4BY7C 5IYDK 1I3QK 2WB1L 3I4NC 4A93K 2E2HK 2R7ZK 2Y0SD 4OIPA 3PO3C 4QIWD 3GTQC 1Y1VC 4A3MK 3S2DK 4KN7A 1TWCC 2PA8D 3CQZC 2A6EA 5TMFA 2VUMK 3GTOK 3S17C 3HKZL 1I6HC 4LLGA 2WAQD 3M3YC 3I4MK 1HQMA 3DXJA 4X6AK 3HOWC 2CW0A 4JK1A 4YFKA 4A3FC 4A3EC 1YNNA 5M5XK 4BBRK 2JA5C 2R93K 1TWFC 2Y0SL 4NOIA 4YFNA 4XSXA 4A3KK 4QIWL 1R9TK 3S16C 4GZYA 3HOVC 1YNJA 4G7HA 1K83K 3RZDC 2YU9C 2JA7C 2E2IC 3GTGC 4BBSC 3EQLA 2JA6K 4A3JK 4OIOA 5IYBK 2E2JK 1I50K 3K7AK 3GTLK 4A3BK 2WAQL 4A3GC 5M5YK 2BE5A 5FLMK 4OIQA 3GTMK 4A3DC 5IP7K 2B63K 5C44C 2JA8K 2R92C 4A3IK 4ZH4A 4Y7NC 4A3CC 1WCMK 4MEYA 5C4XK 3FKIC 3S1MK 2NVQK 1Y1WC 3H3VD 5C4JK 4QJVB 1ZYRA 3I4NK 2PMZD 5IYCC 1TWHC 4XLPA 3PO3K 2NVXC 3GTQK 1Y1VK 1TWGC 2NVYC 1TWCK 1TWAC 3CQZK 5M5WK 3GTJC 4LJZA 2A69A 4G7ZA 5FJ8K 4BY1C 3M3YK 3S15C 4Y52C 3H3VL 4A3FK 5IP9C 3GTPC 3PO2K 5M3MK 4A3EK 2O5IA 2PMZL 4MEXA 2JA5K 1XPPA 3S16K 3HOVK 4C3HK 1SFOC 4OINA 3RZDK 2PPBA 2YU9K 2JA7K 3GTGK 4BBSK 2E2IK 4YFXA 4AYBL 2O5JA 3HOUC 4A3GK 3GTKC 4A3DK 2R92K 3S2HC 3S1NC 4A3LC 4X6AC 5TMCA 4LK0A 3S14C 4A3CK 4BY7K 3FKIK 4A3KC 1Y1WK 4BXXC 3S1QC 2NVTC 1BDFA 4C3IK 5IYCK 3M4OC 1TWHK 3S17K 3S1RC 2NVXK 2JA6C 2A6HA 5IYBC 3HOYC 4A3BC 4AYBD 1TWGK 3GTLC 1I6HK 1TWAK 4XSZA 3GTJK 3HOXC 3HOZC 3RZOC 5IP7C 3HOWK 3H0GC 4BY1K 3S15K 4YG2A 5C3EC 4Y52K 1TWFK 5IYDC 1I3QC 5IP9K 3WODA 4C2MK 3GTPK 2E2HC 4A93C 4G7OA 2R7ZC 1I6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3M C;  3S2D C;  4Q4Z A;  2A68 A;  1SFO K;  2VUM C;  3GTO C;  4KMU A;  5C44 K;  3HOU K;  3I4M C;  3GTK K;  4QJV A;  4Y7N K;  4OIR A;  2R93 C;  4BBR C;  1IW7 A;  3S1N K;  3S2H K;  4A3L K;  1R9T C;  3PO2 C;  3S14 K;  1SMY A;  4XLN A;  1K83 C;  4C3J K;  4BXX K;  5D4D A;  2WB1 D;  3S1Q K;  4A3J C;  5M3F K;  2E2J C;  2NVT K;  1I50 C;  3K7A C;  3M4O K;  2NVY K;  2PA8 L;  5FLM C;  3GTM C;  3S1R K;  3HOY K;  2B63 C;  2JA8 C;  4A3I C;  4KN4 A;  3HOX K;  3HKZ D;  3HOZ K;  3RZO K;  4Q5S A;  1WCM C;  4MQ9 A;  5C4X C;  3H0G K;  4LK1 A;  5C3E K;  2NVQ C;  3S1M C;  5C4J C;  4BY7 C;  5IYD K;  1I3Q K;  2WB1 L;  3I4N C;  4A93 K;  2E2H K;  2R7Z K;  2Y0S D;  4OIP A;  3PO3 C;  4QIW D;  3GTQ C;  1Y1V C;  4A3M K;  3S2D K;  4KN7 A;  1TWC C;  2PA8 D;  3CQZ C;  2A6E A;  5TMF A;  2VUM K;  3GTO K;  3S17 C;  3HKZ L;  1I6H C;  4LLG A;  2WAQ D;  3M3Y C;  3I4M K;  1HQM A;  3DXJ A;  4X6A K;  3HOW C;  2CW0 A;  4JK1 A;  4YFK A;  4A3F C;  4A3E C;  1YNN A;  5M5X K;  4BBR K;  2JA5 C;  2R93 K;  1TWF C;  2Y0S L;  4NOI A;  4YFN A;  4XSX A;  4A3K K;  4QIW L;  1R9T K;  3S16 C;  4GZY A;  3HOV C;  1YNJ A;  4G7H A;  1K83 K;  3RZD C;  2YU9 C;  2JA7 C;  2E2I C;  3GTG C;  4BBS C;  3EQL A;  2JA6 K;  4A3J K;  4OIO A;  5IYB K;  2E2J K;  1I50 K;  3K7A K;  3GTL K;  4A3B K;  2WAQ L;  4A3G C;  5M5Y K;  2BE5 A;  5FLM K;  4OIQ A;  3GTM K;  4A3D C;  5IP7 K;  2B63 K;  5C44 C;  2JA8 K;  2R92 C;  4A3I K;  4ZH4 A;  4Y7N C;  4A3C C;  1WCM K;  4MEY A;  5C4X K;  3FKI C;  3S1M K;  2NVQ K;  1Y1W C;  3H3V D;  5C4J K;  4QJV B;  1ZYR A;  3I4N K;  2PMZ D;  5IYC C;  1TWH C;  4XLP A;  3PO3 K;  2NVX C;  3GTQ K;  1Y1V K;  1TWG C;  2NVY C;  1TWC K;  1TWA C;  3CQZ K;  5M5W K;  3GTJ C;  4LJZ A;  2A69 A;  4G7Z A;  5FJ8 K;  4BY1 C;  3M3Y K;  3S15 C;  4Y52 C;  3H3V L;  4A3F K;  5IP9 C;  3GTP C;  3PO2 K;  5M3M K;  4A3E K;  2O5I A;  2PMZ L;  4MEX A;  2JA5 K;  1XPP A;  3S16 K;  3HOV K;  4C3H K;  1SFO C;  4OIN A;  3RZD K;  2PPB A;  2YU9 K;  2JA7 K;  3GTG K;  4BBS K;  2E2I K;  4YFX A;  4AYB L;  2O5J A;  3HOU C;  4A3G K;  3GTK C;  4A3D K;  2R92 K;  3S2H C;  3S1N C;  4A3L C;  4X6A C;  5TMC A;  4LK0 A;  3S14 C;  4A3C K;  4BY7 K;  3FKI K;  4A3K C;  1Y1W K;  4BXX C;  3S1Q C;  2NVT C;  1BDF A;  4C3I K;  5IYC K;  3M4O C;  1TWH K;  3S17 K;  3S1R C;  2NVX K;  2JA6 C;  2A6H A;  5IYB C;  3HOY C;  4A3B C;  4AYB D;  1TWG K;  3GTL C;  1I6H K;  1TWA K;  4XSZ A;  3GTJ K;  3HOX C;  3HOZ C;  3RZO C;  5IP7 C;  3HOW K;  3H0G C;  4BY1 K;  3S15 K;  4YG2 A;  5C3E C;  4Y52 K;  1TWF K;  5IYD C;  1I3Q C;  5IP9 K;  3WOD A;  4C2M K;  3GTP K;  2E2H C;  4A93 C;  4G7O A;  2R7Z C;  1I6V A; 
#chains in the Genus database with same CATH topology
 2NVY A;  3A8K A;  3S2D C;  1TWA A;  2A68 A;  2VUM C;  4BKW A;  1C0A A;  4KMU A;  1IL2 A;  4KAR A;  3HOU K;  3I4M C;  3N0B A;  3GTP A;  1EK8 A;  4Y7N K;  1ZQ1 C;  4BBR C;  1IW7 A;  5EGE A;  1SMY A;  1K83 C;  3S0X A;  1O2A A;  5HL8 A;  2PA8 L;  3S1R K;  2B63 C;  3LAP A;  4P5A A;  1B4B A;  1VH2 A;  4Q5S A;  1O2B A;  3H0G K;  4P9S A;  1BS2 A;  2NVQ C;  5IOR A;  1G51 A;  5IYD K;  1IQ0 A;  4GFQ A;  3AD9 C;  2E2H K;  2JA6 A;  3IPJ A;  3N0C A;  4QIW D;  1EH1 A;  2PA8 D;  2XCR B;  3AD8 C;  4LLG A;  3M3Y C;  1WOO A;  4X6A K;  3HOW C;  4YFK A;  4JK1 A;  3JST A;  4A3F C;  2E2H A;  1WQH A;  2JA5 C;  1WSV A;  4YFN A;  1R9T K;  3S16 C;  3HOV C;  2V6S A;  4A3B K;  5IYB K;  1L0W A;  1I50 K;  2WAQ L;  5IP7 K;  1O28 A;  1R9T A;  1GE9 A;  2XCO A;  5C4J K;  1ZYR A;  3I4N K;  4C3I C;  1TWH C;  3ORE A;  2Y3P A;  3AH5 A;  1F9N A;  1VRQ C;  1Y1V K;  2NVY C;  1TWA C;  4KB2 A;  4LJZ A;  2A69 A;  3N3Y A;  1HI9 A;  2FQO A;  3T00 A;  4Y52 C;  3H3V L;  5IP9 C;  3GTP C;  2PMZ L;  4J3N A;  5EGH A;  1Y1V A;  1XZP B;  2PPB A;  4KC6 A;  1J6V A;  2O5J A;  3HOU C;  4GTE A;  1TWF A;  1VLO A;  3OEP A;  4A3C K;  1B4A A;  4GTC A;  3BP3 A;  2XCQ A;  4KM9 A;  5IYC K;  2KWA A;  3S1R C;  2JA6 C;  4ILD A;  1WIH A;  3TFI A;  1X31 C;  1J98 A;  3HOW K;  3H0G C;  4BY1 K;  1DCH A;  5IYD C;  3AD7 C;  5CHP A;  4G7O A;  2E2H C;  3HOV K;  4ZH4 A;  1SFO K;  4G0W A;  1O2F B;  3BP8 C;  3GTK K;  3TTG A;  4OIR A;  3AQO A;  4KMD A;  4KMA A;  1R9T C;  1SFO A;  5D4D A;  3S1Q K;  4C3H C;  2NVT K;  5M3F K;  1I50 C;  3GTO A;  2NVY K;  1VJE A;  3HKZ D;  3RZO K;  1XZP A;  1PJ7 A;  4MQ9 A;  5C3E K;  4XCH A;  1PJ6 A;  5C4J C;  1I3Q K;  3I4N C;  4KAW X;  2Y0S D;  1WOR A;  4OIP A;  1J6X A;  1Y1V C;  2P5M A;  3ERE D;  4KMH A;  2A6E A;  3S17 C;  4G0U A;  1I6H C;  3BUE A;  4O2D A;  1HQM A;  3DXJ A;  1I3Q A;  2CW0 A;  2R93 K;  3NUH A;  1DD5 A;  1RU0 A;  3A8J A;  1TWF C;  4NOI A;  4GZY A;  4XSX A;  4QIW L;  1O26 A;  2JA6 K;  2ZUE A;  3GEH A;  1WSR A;  2BE5 A;  4KAS A;  4KAT A;  5TJ3 A;  2R93 A;  5C44 C;  4A3I K;  4A3C C;  1YX2 A;  1WCM K;  4MEY A;  5C4X K;  4C45 A;  3FOF A;  5IYC C;  1O25 A;  4KB4 A;  3PO3 K;  2CFA B;  3GTQ K;  5M5W K;  3CQZ K;  3CAG A;  1WCM A;  5FJ8 K;  4BY1 C;  3GTQ A;  4C3H K;  1SFO C;  3CQZ A;  4OIN A;  3RZD K;  2JA7 K;  2E2I K;  2RH6 A;  4GTA A;  1WQF A;  3GTK C;  2R92 K;  1V5V A;  1UV7 A;  1KQ4 A;  2JA7 A;  2E2I A;  4A3K C;  3S1Q C;  2NVT C;  4LR2 A;  3S17 K;  2NVX K;  2R92 A;  1ZXO A;  1I6H K;  3GTJ K;  3RZO C;  1EFW A;  5C3E C;  1TWF K;  1I3Q C;  1XXC A;  2NVX A;  1I6V A;  3G4A A;  3GTJ A;  1XXB A;  5C44 K;  4WJ4 A;  2GSO A;  2R93 C;  3GDZ A;  1XZQ B;  2CFA A;  3PO2 C;  2GSN A;  3S14 K;  2R7Z A;  4KDD A;  4M1X A;  4BXX K;  2WB1 D;  3LAJ A;  4A3I C;  3GIR A;  4GTF A;  1WCM C;  5C4X C;  4GTD A;  1K83 A;  1YCL A;  3PO3 C;  3GTQ C;  3GTL A;  4A3M K;  4KN7 A;  3CQZ C;  3GTO K;  3HKZ L;  2ZFZ A;  1JOE A;  4WIL A;  1USO A;  4RMF A;  2Y0S L;  4A3K K;  5IOS A;  1YNJ A;  3RZD C;  2JA7 C;  2E2I C;  4A3J K;  2E2J K;  1IS1 A;  4BLB A;  3K7A K;  5IOT A;  5M5Y K;  5FLM K;  4OIQ A;  3GTM K;  2R92 C;  3FHZ A;  2JA8 K;  2W7V A;  3S1M K;  4LOW A;  4QJV B;  2GSU A;  3T01 A;  3GTM A;  4XLP A;  4GT9 A;  2NVX C;  1WOP A;  1JVI A;  1DCP A;  1TWC K;  3GTJ C;  1XZQ A;  4GTL A;  4G0V A;  3PO2 K;  4A3E K;  1WQG A;  2O5I A;  1TWC A;  2YU9 K;  3GTG K;  4BBS K;  3ADA C;  3A8I A;  3GSI A;  4AYB L;  1USM A;  4A3G K;  1J6W A;  1ISE A;  4A3D K;  3L4K A;  2PHC B;  4LK0 A;  3S14 C;  4WJ3 M;  2YU9 A;  3FKI K;  3GTG A;  1Y1W K;  4BXX C;  1BDF A;  1VGX A;  5CJ9 A;  1INN A;  4GTB A;  2GAH C;  4AYB D;  1TWG K;  3GTL C;  4XSZ A;  1EQR A;  2JH3 A;  3FKI A;  2RGR A;  3S15 K;  1Y1W A;  2GAG C;  1ZBS A;  3WOD A;  4C2M K;  4KM8 A;  3Q3Q A;  1TWG A;  4A3M C;  4Q4Z A;  3GTO C;  3V4G A;  1O29 A;  1WOS A;  1JQW A;  4QJV A;  5JFE A;  3H0G A;  1IBA A;  4DDQ A;  3S2H K;  3S1N K;  4A3L K;  4XLN A;  4C3J K;  2P8T A;  1BGW A;  4A3J C;  2E2J C;  3TFH A;  3K7A C;  3M4O K;  1PJ5 A;  3OPF A;  5FLM C;  3GTM C;  3HOY K;  2JA8 C;  4KN4 A;  3HOX K;  3GEE A;  3HOZ K;  1AB4 A;  4LK1 A;  5E68 A;  3S1M C;  3LPX A;  1O27 A;  3SZZ A;  4BY7 C;  2WB1 L;  4A93 K;  2R7Z K;  1O24 A;  3MML B;  1I50 A;  3VA7 A;  3S2D K;  1TWC C;  3T02 A;  5TMF A;  2VUM K;  4P5B A;  3HXA A;  4AH6 A;  2WAQ D;  3I4M K;  3GEI A;  4A3E C;  1YNN A;  5M5X K;  4BBR K;  3TFJ A;  1ZVU A;  1F7U A;  5IOQ A;  4FM9 A;  4G7H A;  1K83 K;  2YU9 C;  3GTG C;  5JVO A;  4BBS C;  2VUM A;  3EQL A;  2ZUF A;  4OIO A;  1EI6 A;  4PAB A;  3GTL K;  4A3G C;  4FZB A;  4A3D C;  2B63 K;  5L46 A;  2V6U A;  4Y7N C;  3QX3 A;  3FKI C;  2NVQ K;  1Y1W C;  3H3V D;  1BJT A;  2PMZ D;  2B63 A;  1TWG C;  3SZY A;  2FQT A;  4G7Z A;  1F7V A;  3G4C A;  3M3Y K;  3S15 C;  4A3F K;  4C2M C;  5M3M K;  4MEX A;  2JA5 K;  1XPP A;  3S16 K;  4YFX A;  1IE0 A;  1XXA A;  2V6T A;  2JA5 A;  3S2H C;  3S1N C;  4A3L C;  4X6A C;  5TMC A;  4BY7 K;  4C3J C;  3FOE A;  2D6F C;  4C3I K;  3M4O C;  1TWH K;  3L4J A;  4LQY A;  4BLA A;  4A3B C;  2A6H A;  5IYB C;  3HOY C;  3GTK A;  1F93 A;  1TWA K;  3HOX C;  3HOZ C;  5IP7 C;  4PAA A;  4YG2 A;  4Y52 K;  1DCO A;  5IP9 K;  3GTP K;  1TWH A;  4A93 C;  2R7Z C;  3AQP A;  2EBB A; 
#chains in the Genus database with same CATH homology
 4A3M C;  3S2D C;  4Q4Z A;  2A68 A;  1SFO K;  2VUM C;  3GTO C;  4KMU A;  5C44 K;  3HOU K;  3I4M C;  3GTK K;  4QJV A;  4Y7N K;  4OIR A;  2R93 C;  4BBR C;  1IW7 A;  3S1N K;  3S2H K;  4A3L K;  1R9T C;  3PO2 C;  3S14 K;  1SMY A;  4XLN A;  1K83 C;  4C3J K;  4BXX K;  5D4D A;  2WB1 D;  3S1Q K;  4A3J C;  5M3F K;  2E2J C;  2NVT K;  1I50 C;  3K7A C;  3M4O K;  2NVY K;  2PA8 L;  5FLM C;  3GTM C;  3S1R K;  3HOY K;  2B63 C;  2JA8 C;  4A3I C;  4KN4 A;  3HOX K;  3HKZ D;  3HOZ K;  3RZO K;  4Q5S A;  1WCM C;  4MQ9 A;  5C4X C;  3H0G K;  4LK1 A;  5C3E K;  2NVQ C;  3S1M C;  5C4J C;  4BY7 C;  5IYD K;  1I3Q K;  2WB1 L;  3I4N C;  4A93 K;  2E2H K;  2R7Z K;  2Y0S D;  4OIP A;  3PO3 C;  4QIW D;  3GTQ C;  1Y1V C;  4A3M K;  3S2D K;  4KN7 A;  1TWC C;  2PA8 D;  3CQZ C;  2A6E A;  5TMF A;  2VUM K;  3GTO K;  3S17 C;  3HKZ L;  1I6H C;  4LLG A;  2WAQ D;  3M3Y C;  3I4M K;  1HQM A;  3DXJ A;  4X6A K;  3HOW C;  2CW0 A;  4JK1 A;  4YFK A;  4A3F C;  4A3E C;  1YNN A;  5M5X K;  4BBR K;  2JA5 C;  2R93 K;  1TWF C;  2Y0S L;  4NOI A;  4YFN A;  4XSX A;  4A3K K;  4QIW L;  1R9T K;  3S16 C;  4GZY A;  3HOV C;  1YNJ A;  4G7H A;  1K83 K;  3RZD C;  2YU9 C;  2JA7 C;  2E2I C;  3GTG C;  4BBS C;  3EQL A;  2JA6 K;  4A3J K;  4OIO A;  5IYB K;  2E2J K;  1I50 K;  3K7A K;  3GTL K;  4A3B K;  2WAQ L;  4A3G C;  5M5Y K;  2BE5 A;  5FLM K;  4OIQ A;  3GTM K;  4A3D C;  5IP7 K;  2B63 K;  5C44 C;  2JA8 K;  2R92 C;  4A3I K;  4ZH4 A;  4Y7N C;  4A3C C;  1WCM K;  4MEY A;  5C4X K;  3FKI C;  3S1M K;  2NVQ K;  1Y1W C;  3H3V D;  5C4J K;  4QJV B;  1ZYR A;  3I4N K;  2PMZ D;  5IYC C;  1TWH C;  4XLP A;  3PO3 K;  2NVX C;  3GTQ K;  1Y1V K;  1TWG C;  2NVY C;  1TWC K;  1TWA C;  3CQZ K;  5M5W K;  3GTJ C;  4LJZ A;  2A69 A;  4G7Z A;  5FJ8 K;  4BY1 C;  3M3Y K;  3S15 C;  4Y52 C;  3H3V L;  4A3F K;  5IP9 C;  3GTP C;  3PO2 K;  5M3M K;  4A3E K;  2O5I A;  2PMZ L;  4MEX A;  2JA5 K;  1XPP A;  3S16 K;  3HOV K;  4C3H K;  1SFO C;  4OIN A;  3RZD K;  2PPB A;  2YU9 K;  2JA7 K;  3GTG K;  4BBS K;  2E2I K;  4YFX A;  4AYB L;  2O5J A;  3HOU C;  4A3G K;  3GTK C;  4A3D K;  2R92 K;  3S2H C;  3S1N C;  4A3L C;  4X6A C;  5TMC A;  4LK0 A;  3S14 C;  4A3C K;  4BY7 K;  3FKI K;  4A3K C;  1Y1W K;  4BXX C;  3S1Q C;  2NVT C;  1BDF A;  4C3I K;  5IYC K;  3M4O C;  1TWH K;  3S17 K;  3S1R C;  2NVX K;  2JA6 C;  2A6H A;  5IYB C;  3HOY C;  4A3B C;  4AYB D;  1TWG K;  3GTL C;  1I6H K;  1TWA K;  4XSZ A;  3GTJ K;  3HOX C;  3HOZ C;  3RZO C;  5IP7 C;  3HOW K;  3H0G C;  4BY1 K;  3S15 K;  4YG2 A;  5C3E C;  4Y52 K;  1TWF K;  5IYD C;  1I3Q C;  5IP9 K;  3WOD A;  4C2M K;  3GTP K;  2E2H C;  4A93 C;  4G7O A;  2R7Z C;  1I6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...