4A3KK

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3kK00
5IP9K 3M4OK 3GTGK 3S16K 1I6HC 5IYDK 4BBSK 1I3QK 4A3MK 1Y1VC 3S2HK 4Y52K 4OIOA 3GTJC 2JA8K 2CW0A 4LLGA 3I4MC 4A3GC 3FKIK 1I50C 3WODA 3H0GC 5C4XC 1XPPA 4YFNA 4YG2A 4BBRC 2B63C 3HOYC 1IW7A 4NOIA 4BY1C 2PA8D 3I4NK 1TWFK 4MEYA 3S16C 2VUMK 4A3EK 4BXXC 2A6EA 4X6AC 2NVQK 4A3CC 2PMZD 3S1NK 1WCMC 2E2JC 4MQ9A 3S1QK 3M3YC 4A93C 5C4JC 3S1RC 3GTOK 4QIWL 5C3EC 2JA7C 3PO2C 3S17C 4A3JC 1TWCK 1YNNA 4XLPA 4BY7C 2WB1D 3GTMK 2O5JA 4A3IK 3GTLK 3H3VD 5IYCC 3HOUC 5TMCA 4C3IK 2NVYK 3EQLA 3GTQC 2R93K 5FLMC 2A68A 3K7AK 2PA8L 1R9TC 3S15C 1SFOC 2PPBA 3PO3C 4A3DC 1K83C 1I6HK 3HOWC 1TWHC 2WAQD 2PMZL 3RZDK 2E2IC 2JA6C 1ZYRA 1TWGC 4Q5SA 2R92C 3GTJK 2E2HC 4OIPA 5M5YK 5C44C 3I4MK 3S14K 2Y0SD 3HOXC 3M4OC 1Y1WK 5C4XK 3GTGC 5IYBC 2NVXK 3S2DK 1HQMA 1I3QC 2A69A 1BDFA 2WB1L 3GTKK 3S1MC 4BBSC 4A3MC 3S2HC 3CQZC 2JA5K 2R7ZC 3H3VL 3HOVC 4GZYA 4BXXK 4MEXA 3FKIC 4A3CK 5M3FK 4C3HK 5M3MK 4Y7NK 4YFXA 4QJVA 5C4JK 3PO2K 5C3EK 3GTPK 4KMUA 4A3EC 4A3FK 2VUMC 2WAQL 4A3KK 2YU9C 2NVTK 2NVQC 4G7HA 3HOZK 4A3LK 4BY7K 3RZOK 5D4DA 5IP7K 3S1QC 1TWAK 5IYCK 3HOUK 2BE5A 2Y0SL 3GTOC 4C2MK 4OINA 4YFKA 1Y1VK 4KN7A 3GTMC 3I4NC 5FJ8K 3GTLC 4A3GK 1K83K 1I50K 5IP9C 5M5WK 4A3BC 3H0GK 5IYDC 2NVYC 1TWHK 4BBRK 2B63K 5TMFA 2JA6K 3HOYK 4Q4ZA 3K7AC 4BY1K 2R93C 2R92K 4Y52C 2O5IA 4XLNA 4XSXA 3HKZL 2JA8C 3HOXK 4LJZA 4X6AK 4OIRA 5IYBK 4AYBD 4KN4A 1WCMK 4LK1A 4XSZA 3RZDC 2E2JK 4LK0A 2A6HA 3S1MK 3CQZK 2R7ZK 1TWFC 3S1RK 3HKZD 4G7ZA 3HOVK 2JA7K 3M3YK 3S17K 4A93K 4A3JK 3S14C 1YNJA 4OIQA 1Y1WC 2NVXC 3S2DC 4G7OA 3S1NC 3GTKC 1I6VA 2JA5C 4JK1A 1SMYA 3GTQK 5FLMK 1TWCC 2YU9K 4ZH4A 1R9TK 3S15K 4Y7NC 5M5XK 1SFOK 4A3IC 3PO3K 4A3DK 3GTPC 3HOWK 3DXJA 4AYBL 4C3JK 4QJVB 4A3FC 4A3KC 1TWGK 2E2IK 2NVTC 3HOZC 4A3LC 2E2HK 3RZOC 5C44K 5IP7C 1TWAC 4A3BK 4QIWD
chains in the Genus database with same CATH superfamily
5IP9K 1F7UA 1I6HC 1J6WA 4OIOA 1O27A 4LLGA 3T02A 3QX3A 1XPPA 4BBRC 3I4NK 2PA8D 3GTLA 3GTPA 2A6EA 2FQTA 4PABA 4A3CC 1X31C 2PMZD 3S1QK 3GTOK 3BUEA 2P5MA 5IOQA 3VA7A 3GTLK 4C3IK 1WQGA 3EQLA 3GEIA 3TFHA 1UV7A 3K7AK 2KWAA 3S15C 2XCRB 4BLAA 2V6SA 2CFAA 4OIPA 5C44C 1BJTA 3I4MK 3AH5A 1B4BA 3A8IA 1WSVA 4BBSC 1I3QC 2A69A 3CQZC 1L0WA 3HOVC 4GFQA 4MEXA 1V5VA 3LPXA 1R9TA 3PO2K 3ERED 3AD8C 2VUMC 4A3EC 2PHCB 2WAQL 1TWHA 4P5AA 5IOTA 4A3KK 3HOZK 4A3LK 2JA6A 1TWGA 5D4DA 3AQOA 4M1XA 1EI6A 5IYCK 2BE5A 5JFEA 4WJ4A 4BKWA 1AB4A 2R7ZA 1XXBA 1C0AA 5IP9C 4BBRK 1JVIA 1TWHK 2JA6K 4Q4ZA 1XZQA 4BLBA 4XLNA 4XSXA 3HKZL 4G0UA 2ZUEA 2ZUFA 3HOXK 3OPFA 4LJZA 5IYBK 4AYBD 2YU9A 4KN4A 4XSZA 3RZDC 3S1MK 2A6HA 4DDQA 2R7ZK 3I4NC 3HKZD 1F7VA 3S14C 4OIQA 3N0CA 1USMA 3G4AA 3AD7C 2YU9K 2R93A 4C3HC 2XCQA 3S15K 3GTPC 3TFIA 5HL8A 4C3IC 5C44K 1VLOA 5IP7C 2GSNA 1XXAA 1VRQC 4QIWD 4A3BK 2VUMA 4BBSK 1I3QK 2NVXA 4Y52K 3GTKA 3I4MC 4A3GC 4YFNA 4YG2A 1IW7A 3LAJA 1IBAA 2VUMK 4A3EK 1ZVUA 3M3YC 3PO2C 1TWAA 3MMLB 2GSUA 3OEPA 1HI9A 4XLPA 3N3YA 3GTJA 2EBBA 4A3IK 5IYCC 3G4CA 1WORA 1DCHA 2A68A 4WILA 2PA8L 4J3NA 1VGXA 1R9TC 1WSRA 1TWHC 2PMZL 3RZDK 2JA6C 1TWGC 3GTJK 5M5YK 3S14K 2Y0SD 3HOXC 1USOA 3M4OC 5C4XK 5IYBC 1HQMA 2XCOA 3TFJA 1BDFA 3S1MC 4A3MC 4G0WA 2R7ZC 4GZYA 1O2AA 1XZPA 4KB2A 1O25A 4C3HK 3HXAA 4QJVA 5C4JK 5C3EK 3GTPK 3A8KA 4GTFA 3FHZA 2YU9C 2R92A 2E2HA 4KM8A 5IP7K 3HOUK 4C2MK 3LAPA 1BS2A 4GTBA 1WIHA 4A3GK 4A3BC 1WOSA 1J6XA 2R93C 3GIRA 2R92K 4Y52C 4WJ3M 4OIRA 3L4JA 1IE0A 3V4GA 4LK0A 4LOWA 4O2DA 3M3YK 2CFAB 2NVXC 3S2DC 4LQYA 3GTKC 1I6VA 4GT9A 2JA5C 4JK1A 1PJ5A 1F93A 1IL2A 1DCPA 1R9TK 4Y7NC 4KARA 4XCHA 4A3IC 1G51A 4AYBL 1TWGK 2JH3A 1PJ6A 3RZOC 1DD5A 3SZZA 1TWFA 1VJEA 1TWAC 3M4OK 5IORA 3Q3QA 4A3MK 3GTJC 2JA8K 2CW0A 3BP8C 4KM9A 1WQHA 5TJ3A 1I50C 1TWCA 3H0GC 3WODA 5C4XC 2B63C 3HOYC 1TWFK 4MEYA 3T00A 1BGWA 1XZQB 4KB4A 3FOFA 4GTLA 5C4JC 3S1RC 3S17C 4QIWL 5C3EC 4A3JC 1TWCK 1Y1VA 2WB1D 5L46A 3H3VD 3HOUC 4C2MC 2R93K 3AD9C 1PJ7A 2JA5A 1SFOC 3PO3C 3ADAC 4P5BA 1EK8A 1ZYRA 4Q5SA 2R92C 2E2HC 2JA7A 3SZYA 3GTGC 2GSOA 4KC6A 2NVXK 3S2DK 3GTKK 4LR2A 3S2HC 1EQRA 5EGEA 2JA5K 1WOOA 4BXXK 3FKIC 1GE9A 5M3MK 4Y7NK 5CHPA 3JSTA 1K83A 1I50A 4KMUA 3H0GA 2B63A 2NVQC 2E2IA 4KASA 3RZOK 4BY7K 1YX2A 1TWAK 2Y0SL 4GTCA 3OREA 4KN7A 4P9SA 2D6FC 3GTMC 5FJ8K 1K83K 1I50K 5M5WK 1F9NA 3H0GK 1YCLA 2NVYC 2B63K 3HOYK 5TMFA 1J6VA 3GEEA 2O5IA 2JA8C 1IQ0A 1O2BA 4LK1A 1ZBSA 1TWFC 3S1RK 1SFOA 2RGRA 3S17K 4A3JK 3GTOA 4GTDA 4RMFA 1Y1WC 4G7OA 5IOSA 2GAHC 1SMYA 3GTGA 1TWCC 3CAGA 5JVOA 1XZPB 1SFOK 2Y3PA 3PO3K 3BP3A 3FKIA 1EFWA 3DXJA 4A3FC 4QJVB 2NVTC 2E2HK 1KQ4A 1O28A 3GTGK 3S16K 5IYDK 1Y1VC 4G0VA 3S2HK 2W7VA 3FKIK 1WQFA 1EH1A 2RH6A 2ZFZA 1DCOA 4NOIA 4BY1C 3GTMA 4C45A 4KDDA 4BXXC 2NVYA 4X6AC 2NVQK 5E68A 4PAAA 3S1NK 1WCMC 2E2JC 4MQ9A 4A93C 2JA7C 1O29A 1INNA 1YNNA 1WOPA 1ZXOA 4BY7C 3GTMK 2O5JA 3FOEA 1XXCA 3N0BA 5TMCA 3A8JA 2NVYK 3GTQC 1O2FB 1O24A 5FLMC 3GSIA 1Y1WA 3TTGA 4KMAA 2PPBA 4A3DC 1K83C 1I6HK 4ILDA 3HOWC 2WAQD 4KATA 4C3JC 2E2IC 1JQWA 2V6UA 3NUHA 1RU0A 3L4KA 1Y1WK 4FZBA 4GTEA 2WB1L 3GEHA 3H3VL 4A3CK 5M3FK 1O26A 4YFXA 4A3FK 4KAWX 2NVTK 4G7HA 3S0XA 3S1QC 3GTOC 2V6TA 4OINA 3IPJA 4KMDA 4YFKA 1JOEA 1J98A 1I3QA 1Y1VK 1WCMA 1ZQ1C 3CQZA 1ISEA 3GTLC 2GAGC 5IYDC 3S16C 3GDZA 3K7AC 4BY1K 5EGHA 4X6AK 3GTQA 3T01A 1WCMK 4KMHA 2E2JK 4AH6A 3CQZK 4A93K 3HOVK 4G7ZA 5CJ9A 2JA7K 1YNJA 3S1NC 2P8TA 1B4AA 1VH2A 3GTQK 4GTAA 5FLMK 1IS1A 3AQPA 4ZH4A 5M5XK 4A3DK 3HOWK 4C3JK 2E2IK 4A3KC 2FQOA 4A3LC 3HOZC 4FM9A
chains in the Genus database with same CATH topology
5IP9K 3M4OK 3GTGK 3S16K 1I6HC 5IYDK 4BBSK 1I3QK 4A3MK 1Y1VC 3S2HK 4Y52K 4OIOA 3GTJC 2JA8K 2CW0A 4LLGA 3I4MC 4A3GC 3FKIK 1I50C 3WODA 3H0GC 5C4XC 1XPPA 4YFNA 4YG2A 4BBRC 2B63C 3HOYC 1IW7A 4NOIA 4BY1C 2PA8D 3I4NK 1TWFK 4MEYA 3S16C 2VUMK 4A3EK 4BXXC 2A6EA 4X6AC 2NVQK 4A3CC 2PMZD 3S1NK 1WCMC 2E2JC 4MQ9A 3S1QK 3M3YC 4A93C 5C4JC 3S1RC 3GTOK 4QIWL 5C3EC 2JA7C 3PO2C 3S17C 4A3JC 1TWCK 1YNNA 4XLPA 4BY7C 2WB1D 3GTMK 2O5JA 4A3IK 3GTLK 3H3VD 5IYCC 3HOUC 5TMCA 4C3IK 2NVYK 3EQLA 3GTQC 2R93K 5FLMC 2A68A 3K7AK 2PA8L 1R9TC 3S15C 1SFOC 2PPBA 3PO3C 4A3DC 1K83C 1I6HK 3HOWC 1TWHC 2WAQD 2PMZL 3RZDK 2E2IC 2JA6C 1ZYRA 1TWGC 4Q5SA 2R92C 3GTJK 2E2HC 4OIPA 5M5YK 5C44C 3I4MK 3S14K 2Y0SD 3HOXC 3M4OC 1Y1WK 5C4XK 3GTGC 5IYBC 2NVXK 3S2DK 1HQMA 1I3QC 2A69A 1BDFA 2WB1L 3GTKK 3S1MC 4BBSC 4A3MC 3S2HC 3CQZC 2JA5K 2R7ZC 3H3VL 3HOVC 4GZYA 4BXXK 4MEXA 3FKIC 4A3CK 5M3FK 4C3HK 5M3MK 4Y7NK 4YFXA 4QJVA 5C4JK 3PO2K 5C3EK 3GTPK 4KMUA 4A3EC 4A3FK 2VUMC 2WAQL 4A3KK 2YU9C 2NVTK 2NVQC 4G7HA 3HOZK 4A3LK 4BY7K 3RZOK 5D4DA 5IP7K 3S1QC 1TWAK 5IYCK 3HOUK 2BE5A 2Y0SL 3GTOC 4C2MK 4OINA 4YFKA 1Y1VK 4KN7A 3GTMC 3I4NC 5FJ8K 3GTLC 4A3GK 1K83K 1I50K 5IP9C 5M5WK 4A3BC 3H0GK 5IYDC 2NVYC 1TWHK 4BBRK 2B63K 5TMFA 2JA6K 3HOYK 4Q4ZA 3K7AC 4BY1K 2R93C 2R92K 4Y52C 2O5IA 4XLNA 4XSXA 3HKZL 2JA8C 3HOXK 4LJZA 4X6AK 4OIRA 5IYBK 4AYBD 4KN4A 1WCMK 4LK1A 4XSZA 3RZDC 2E2JK 4LK0A 2A6HA 3S1MK 3CQZK 2R7ZK 1TWFC 3S1RK 3HKZD 4G7ZA 3HOVK 2JA7K 3M3YK 3S17K 4A93K 4A3JK 3S14C 1YNJA 4OIQA 1Y1WC 2NVXC 3S2DC 4G7OA 3S1NC 3GTKC 1I6VA 2JA5C 4JK1A 1SMYA 3GTQK 5FLMK 1TWCC 2YU9K 4ZH4A 1R9TK 3S15K 4Y7NC 5M5XK 1SFOK 4A3IC 3PO3K 4A3DK 3GTPC 3HOWK 3DXJA 4AYBL 4C3JK 4QJVB 4A3FC 4A3KC 1TWGK 2E2IK 2NVTC 3HOZC 4A3LC 2E2HK 3RZOC 5C44K 5IP7C 1TWAC 4A3BK 4QIWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP9 K;  3M4O K;  3GTG K;  3S16 K;  1I6H C;  5IYD K;  4BBS K;  1I3Q K;  4A3M K;  1Y1V C;  3S2H K;  4Y52 K;  4OIO A;  3GTJ C;  2JA8 K;  2CW0 A;  4LLG A;  3I4M C;  4A3G C;  3FKI K;  1I50 C;  3WOD A;  3H0G C;  5C4X C;  1XPP A;  4YFN A;  4YG2 A;  4BBR C;  2B63 C;  3HOY C;  1IW7 A;  4NOI A;  4BY1 C;  2PA8 D;  3I4N K;  1TWF K;  4MEY A;  3S16 C;  2VUM K;  4A3E K;  4BXX C;  2A6E A;  4X6A C;  2NVQ K;  4A3C C;  2PMZ D;  3S1N K;  1WCM C;  2E2J C;  4MQ9 A;  3S1Q K;  3M3Y C;  4A93 C;  5C4J C;  3S1R C;  3GTO K;  4QIW L;  5C3E C;  2JA7 C;  3PO2 C;  3S17 C;  4A3J C;  1TWC K;  1YNN A;  4XLP A;  4BY7 C;  2WB1 D;  3GTM K;  2O5J A;  4A3I K;  3GTL K;  3H3V D;  5IYC C;  3HOU C;  5TMC A;  4C3I K;  2NVY K;  3EQL A;  3GTQ C;  2R93 K;  5FLM C;  2A68 A;  3K7A K;  2PA8 L;  1R9T C;  3S15 C;  1SFO C;  2PPB A;  3PO3 C;  4A3D C;  1K83 C;  1I6H K;  3HOW C;  1TWH C;  2WAQ D;  2PMZ L;  3RZD K;  2E2I C;  2JA6 C;  1ZYR A;  1TWG C;  4Q5S A;  2R92 C;  3GTJ K;  2E2H C;  4OIP A;  5M5Y K;  5C44 C;  3I4M K;  3S14 K;  2Y0S D;  3HOX C;  3M4O C;  1Y1W K;  5C4X K;  3GTG C;  5IYB C;  2NVX K;  3S2D K;  1HQM A;  1I3Q C;  2A69 A;  1BDF A;  2WB1 L;  3GTK K;  3S1M C;  4BBS C;  4A3M C;  3S2H C;  3CQZ C;  2JA5 K;  2R7Z C;  3H3V L;  3HOV C;  4GZY A;  4BXX K;  4MEX A;  3FKI C;  4A3C K;  5M3F K;  4C3H K;  5M3M K;  4Y7N K;  4YFX A;  4QJV A;  5C4J K;  3PO2 K;  5C3E K;  3GTP K;  4KMU A;  4A3E C;  4A3F K;  2VUM C;  2WAQ L;  4A3K K;  2YU9 C;  2NVT K;  2NVQ C;  4G7H A;  3HOZ K;  4A3L K;  4BY7 K;  3RZO K;  5D4D A;  5IP7 K;  3S1Q C;  1TWA K;  5IYC K;  3HOU K;  2BE5 A;  2Y0S L;  3GTO C;  4C2M K;  4OIN A;  4YFK A;  1Y1V K;  4KN7 A;  3GTM C;  3I4N C;  5FJ8 K;  3GTL C;  4A3G K;  1K83 K;  1I50 K;  5IP9 C;  5M5W K;  4A3B C;  3H0G K;  5IYD C;  2NVY C;  1TWH K;  4BBR K;  2B63 K;  5TMF A;  2JA6 K;  3HOY K;  4Q4Z A;  3K7A C;  4BY1 K;  2R93 C;  2R92 K;  4Y52 C;  2O5I A;  4XLN A;  4XSX A;  3HKZ L;  2JA8 C;  3HOX K;  4LJZ A;  4X6A K;  4OIR A;  5IYB K;  4AYB D;  4KN4 A;  1WCM K;  4LK1 A;  4XSZ A;  3RZD C;  2E2J K;  4LK0 A;  2A6H A;  3S1M K;  3CQZ K;  2R7Z K;  1TWF C;  3S1R K;  3HKZ D;  4G7Z A;  3HOV K;  2JA7 K;  3M3Y K;  3S17 K;  4A93 K;  4A3J K;  3S14 C;  1YNJ A;  4OIQ A;  1Y1W C;  2NVX C;  3S2D C;  4G7O A;  3S1N C;  3GTK C;  1I6V A;  2JA5 C;  4JK1 A;  1SMY A;  3GTQ K;  5FLM K;  1TWC C;  2YU9 K;  4ZH4 A;  1R9T K;  3S15 K;  4Y7N C;  5M5X K;  1SFO K;  4A3I C;  3PO3 K;  4A3D K;  3GTP C;  3HOW K;  3DXJ A;  4AYB L;  4C3J K;  4QJV B;  4A3F C;  4A3K C;  1TWG K;  2E2I K;  2NVT C;  3HOZ C;  4A3L C;  2E2H K;  3RZO C;  5C44 K;  5IP7 C;  1TWA C;  4A3B K;  4QIW D; 
#chains in the Genus database with same CATH topology
 5IP9 K;  1F7U A;  1I6H C;  1J6W A;  4OIO A;  1O27 A;  4LLG A;  3T02 A;  3QX3 A;  1XPP A;  4BBR C;  3I4N K;  2PA8 D;  3GTL A;  3GTP A;  2A6E A;  2FQT A;  4PAB A;  4A3C C;  1X31 C;  2PMZ D;  3S1Q K;  3GTO K;  3BUE A;  2P5M A;  5IOQ A;  3VA7 A;  3GTL K;  4C3I K;  1WQG A;  3EQL A;  3GEI A;  3TFH A;  1UV7 A;  3K7A K;  2KWA A;  3S15 C;  2XCR B;  4BLA A;  2V6S A;  2CFA A;  4OIP A;  5C44 C;  1BJT A;  3I4M K;  3AH5 A;  1B4B A;  3A8I A;  1WSV A;  4BBS C;  1I3Q C;  2A69 A;  3CQZ C;  1L0W A;  3HOV C;  4GFQ A;  4MEX A;  1V5V A;  3LPX A;  1R9T A;  3PO2 K;  3ERE D;  3AD8 C;  2VUM C;  4A3E C;  2PHC B;  2WAQ L;  1TWH A;  4P5A A;  5IOT A;  4A3K K;  3HOZ K;  4A3L K;  2JA6 A;  1TWG A;  5D4D A;  3AQO A;  4M1X A;  1EI6 A;  5IYC K;  2BE5 A;  5JFE A;  4WJ4 A;  4BKW A;  1AB4 A;  2R7Z A;  1XXB A;  1C0A A;  5IP9 C;  4BBR K;  1JVI A;  1TWH K;  2JA6 K;  4Q4Z A;  1XZQ A;  4BLB A;  4XLN A;  4XSX A;  3HKZ L;  4G0U A;  2ZUE A;  2ZUF A;  3HOX K;  3OPF A;  4LJZ A;  5IYB K;  4AYB D;  2YU9 A;  4KN4 A;  4XSZ A;  3RZD C;  3S1M K;  2A6H A;  4DDQ A;  2R7Z K;  3I4N C;  3HKZ D;  1F7V A;  3S14 C;  4OIQ A;  3N0C A;  1USM A;  3G4A A;  3AD7 C;  2YU9 K;  2R93 A;  4C3H C;  2XCQ A;  3S15 K;  3GTP C;  3TFI A;  5HL8 A;  4C3I C;  5C44 K;  1VLO A;  5IP7 C;  2GSN A;  1XXA A;  1VRQ C;  4QIW D;  4A3B K;  2VUM A;  4BBS K;  1I3Q K;  2NVX A;  4Y52 K;  3GTK A;  3I4M C;  4A3G C;  4YFN A;  4YG2 A;  1IW7 A;  3LAJ A;  1IBA A;  2VUM K;  4A3E K;  1ZVU A;  3M3Y C;  3PO2 C;  1TWA A;  3MML B;  2GSU A;  3OEP A;  1HI9 A;  4XLP A;  3N3Y A;  3GTJ A;  2EBB A;  4A3I K;  5IYC C;  3G4C A;  1WOR A;  1DCH A;  2A68 A;  4WIL A;  2PA8 L;  4J3N A;  1VGX A;  1R9T C;  1WSR A;  1TWH C;  2PMZ L;  3RZD K;  2JA6 C;  1TWG C;  3GTJ K;  5M5Y K;  3S14 K;  2Y0S D;  3HOX C;  1USO A;  3M4O C;  5C4X K;  5IYB C;  1HQM A;  2XCO A;  3TFJ A;  1BDF A;  3S1M C;  4A3M C;  4G0W A;  2R7Z C;  4GZY A;  1O2A A;  1XZP A;  4KB2 A;  1O25 A;  4C3H K;  3HXA A;  4QJV A;  5C4J K;  5C3E K;  3GTP K;  3A8K A;  4GTF A;  3FHZ A;  2YU9 C;  2R92 A;  2E2H A;  4KM8 A;  5IP7 K;  3HOU K;  4C2M K;  3LAP A;  1BS2 A;  4GTB A;  1WIH A;  4A3G K;  4A3B C;  1WOS A;  1J6X A;  2R93 C;  3GIR A;  2R92 K;  4Y52 C;  4WJ3 M;  4OIR A;  3L4J A;  1IE0 A;  3V4G A;  4LK0 A;  4LOW A;  4O2D A;  3M3Y K;  2CFA B;  2NVX C;  3S2D C;  4LQY A;  3GTK C;  1I6V A;  4GT9 A;  2JA5 C;  4JK1 A;  1PJ5 A;  1F93 A;  1IL2 A;  1DCP A;  1R9T K;  4Y7N C;  4KAR A;  4XCH A;  4A3I C;  1G51 A;  4AYB L;  1TWG K;  2JH3 A;  1PJ6 A;  3RZO C;  1DD5 A;  3SZZ A;  1TWF A;  1VJE A;  1TWA C;  3M4O K;  5IOR A;  3Q3Q A;  4A3M K;  3GTJ C;  2JA8 K;  2CW0 A;  3BP8 C;  4KM9 A;  1WQH A;  5TJ3 A;  1I50 C;  1TWC A;  3H0G C;  3WOD A;  5C4X C;  2B63 C;  3HOY C;  1TWF K;  4MEY A;  3T00 A;  1BGW A;  1XZQ B;  4KB4 A;  3FOF A;  4GTL A;  5C4J C;  3S1R C;  3S17 C;  4QIW L;  5C3E C;  4A3J C;  1TWC K;  1Y1V A;  2WB1 D;  5L46 A;  3H3V D;  3HOU C;  4C2M C;  2R93 K;  3AD9 C;  1PJ7 A;  2JA5 A;  1SFO C;  3PO3 C;  3ADA C;  4P5B A;  1EK8 A;  1ZYR A;  4Q5S A;  2R92 C;  2E2H C;  2JA7 A;  3SZY A;  3GTG C;  2GSO A;  4KC6 A;  2NVX K;  3S2D K;  3GTK K;  4LR2 A;  3S2H C;  1EQR A;  5EGE A;  2JA5 K;  1WOO A;  4BXX K;  3FKI C;  1GE9 A;  5M3M K;  4Y7N K;  5CHP A;  3JST A;  1K83 A;  1I50 A;  4KMU A;  3H0G A;  2B63 A;  2NVQ C;  2E2I A;  4KAS A;  3RZO K;  4BY7 K;  1YX2 A;  1TWA K;  2Y0S L;  4GTC A;  3ORE A;  4KN7 A;  4P9S A;  2D6F C;  3GTM C;  5FJ8 K;  1K83 K;  1I50 K;  5M5W K;  1F9N A;  3H0G K;  1YCL A;  2NVY C;  2B63 K;  3HOY K;  5TMF A;  1J6V A;  3GEE A;  2O5I A;  2JA8 C;  1IQ0 A;  1O2B A;  4LK1 A;  1ZBS A;  1TWF C;  3S1R K;  1SFO A;  2RGR A;  3S17 K;  4A3J K;  3GTO A;  4GTD A;  4RMF A;  1Y1W C;  4G7O A;  5IOS A;  2GAH C;  1SMY A;  3GTG A;  1TWC C;  3CAG A;  5JVO A;  1XZP B;  1SFO K;  2Y3P A;  3PO3 K;  3BP3 A;  3FKI A;  1EFW A;  3DXJ A;  4A3F C;  4QJV B;  2NVT C;  2E2H K;  1KQ4 A;  1O28 A;  3GTG K;  3S16 K;  5IYD K;  1Y1V C;  4G0V A;  3S2H K;  2W7V A;  3FKI K;  1WQF A;  1EH1 A;  2RH6 A;  2ZFZ A;  1DCO A;  4NOI A;  4BY1 C;  3GTM A;  4C45 A;  4KDD A;  4BXX C;  2NVY A;  4X6A C;  2NVQ K;  5E68 A;  4PAA A;  3S1N K;  1WCM C;  2E2J C;  4MQ9 A;  4A93 C;  2JA7 C;  1O29 A;  1INN A;  1YNN A;  1WOP A;  1ZXO A;  4BY7 C;  3GTM K;  2O5J A;  3FOE A;  1XXC A;  3N0B A;  5TMC A;  3A8J A;  2NVY K;  3GTQ C;  1O2F B;  1O24 A;  5FLM C;  3GSI A;  1Y1W A;  3TTG A;  4KMA A;  2PPB A;  4A3D C;  1K83 C;  1I6H K;  4ILD A;  3HOW C;  2WAQ D;  4KAT A;  4C3J C;  2E2I C;  1JQW A;  2V6U A;  3NUH A;  1RU0 A;  3L4K A;  1Y1W K;  4FZB A;  4GTE A;  2WB1 L;  3GEH A;  3H3V L;  4A3C K;  5M3F K;  1O26 A;  4YFX A;  4A3F K;  4KAW X;  2NVT K;  4G7H A;  3S0X A;  3S1Q C;  3GTO C;  2V6T A;  4OIN A;  3IPJ A;  4KMD A;  4YFK A;  1JOE A;  1J98 A;  1I3Q A;  1Y1V K;  1WCM A;  1ZQ1 C;  3CQZ A;  1ISE A;  3GTL C;  2GAG C;  5IYD C;  3S16 C;  3GDZ A;  3K7A C;  4BY1 K;  5EGH A;  4X6A K;  3GTQ A;  3T01 A;  1WCM K;  4KMH A;  2E2J K;  4AH6 A;  3CQZ K;  4A93 K;  3HOV K;  4G7Z A;  5CJ9 A;  2JA7 K;  1YNJ A;  3S1N C;  2P8T A;  1B4A A;  1VH2 A;  3GTQ K;  4GTA A;  5FLM K;  1IS1 A;  3AQP A;  4ZH4 A;  5M5X K;  4A3D K;  3HOW K;  4C3J K;  2E2I K;  4A3K C;  2FQO A;  4A3L C;  3HOZ C;  4FM9 A; 
#chains in the Genus database with same CATH homology
 5IP9 K;  3M4O K;  3GTG K;  3S16 K;  1I6H C;  5IYD K;  4BBS K;  1I3Q K;  4A3M K;  1Y1V C;  3S2H K;  4Y52 K;  4OIO A;  3GTJ C;  2JA8 K;  2CW0 A;  4LLG A;  3I4M C;  4A3G C;  3FKI K;  1I50 C;  3WOD A;  3H0G C;  5C4X C;  1XPP A;  4YFN A;  4YG2 A;  4BBR C;  2B63 C;  3HOY C;  1IW7 A;  4NOI A;  4BY1 C;  2PA8 D;  3I4N K;  1TWF K;  4MEY A;  3S16 C;  2VUM K;  4A3E K;  4BXX C;  2A6E A;  4X6A C;  2NVQ K;  4A3C C;  2PMZ D;  3S1N K;  1WCM C;  2E2J C;  4MQ9 A;  3S1Q K;  3M3Y C;  4A93 C;  5C4J C;  3S1R C;  3GTO K;  4QIW L;  5C3E C;  2JA7 C;  3PO2 C;  3S17 C;  4A3J C;  1TWC K;  1YNN A;  4XLP A;  4BY7 C;  2WB1 D;  3GTM K;  2O5J A;  4A3I K;  3GTL K;  3H3V D;  5IYC C;  3HOU C;  5TMC A;  4C3I K;  2NVY K;  3EQL A;  3GTQ C;  2R93 K;  5FLM C;  2A68 A;  3K7A K;  2PA8 L;  1R9T C;  3S15 C;  1SFO C;  2PPB A;  3PO3 C;  4A3D C;  1K83 C;  1I6H K;  3HOW C;  1TWH C;  2WAQ D;  2PMZ L;  3RZD K;  2E2I C;  2JA6 C;  1ZYR A;  1TWG C;  4Q5S A;  2R92 C;  3GTJ K;  2E2H C;  4OIP A;  5M5Y K;  5C44 C;  3I4M K;  3S14 K;  2Y0S D;  3HOX C;  3M4O C;  1Y1W K;  5C4X K;  3GTG C;  5IYB C;  2NVX K;  3S2D K;  1HQM A;  1I3Q C;  2A69 A;  1BDF A;  2WB1 L;  3GTK K;  3S1M C;  4BBS C;  4A3M C;  3S2H C;  3CQZ C;  2JA5 K;  2R7Z C;  3H3V L;  3HOV C;  4GZY A;  4BXX K;  4MEX A;  3FKI C;  4A3C K;  5M3F K;  4C3H K;  5M3M K;  4Y7N K;  4YFX A;  4QJV A;  5C4J K;  3PO2 K;  5C3E K;  3GTP K;  4KMU A;  4A3E C;  4A3F K;  2VUM C;  2WAQ L;  4A3K K;  2YU9 C;  2NVT K;  2NVQ C;  4G7H A;  3HOZ K;  4A3L K;  4BY7 K;  3RZO K;  5D4D A;  5IP7 K;  3S1Q C;  1TWA K;  5IYC K;  3HOU K;  2BE5 A;  2Y0S L;  3GTO C;  4C2M K;  4OIN A;  4YFK A;  1Y1V K;  4KN7 A;  3GTM C;  3I4N C;  5FJ8 K;  3GTL C;  4A3G K;  1K83 K;  1I50 K;  5IP9 C;  5M5W K;  4A3B C;  3H0G K;  5IYD C;  2NVY C;  1TWH K;  4BBR K;  2B63 K;  5TMF A;  2JA6 K;  3HOY K;  4Q4Z A;  3K7A C;  4BY1 K;  2R93 C;  2R92 K;  4Y52 C;  2O5I A;  4XLN A;  4XSX A;  3HKZ L;  2JA8 C;  3HOX K;  4LJZ A;  4X6A K;  4OIR A;  5IYB K;  4AYB D;  4KN4 A;  1WCM K;  4LK1 A;  4XSZ A;  3RZD C;  2E2J K;  4LK0 A;  2A6H A;  3S1M K;  3CQZ K;  2R7Z K;  1TWF C;  3S1R K;  3HKZ D;  4G7Z A;  3HOV K;  2JA7 K;  3M3Y K;  3S17 K;  4A93 K;  4A3J K;  3S14 C;  1YNJ A;  4OIQ A;  1Y1W C;  2NVX C;  3S2D C;  4G7O A;  3S1N C;  3GTK C;  1I6V A;  2JA5 C;  4JK1 A;  1SMY A;  3GTQ K;  5FLM K;  1TWC C;  2YU9 K;  4ZH4 A;  1R9T K;  3S15 K;  4Y7N C;  5M5X K;  1SFO K;  4A3I C;  3PO3 K;  4A3D K;  3GTP C;  3HOW K;  3DXJ A;  4AYB L;  4C3J K;  4QJV B;  4A3F C;  4A3K C;  1TWG K;  2E2I K;  2NVT C;  3HOZ C;  4A3L C;  2E2H K;  3RZO C;  5C44 K;  5IP7 C;  1TWA C;  4A3B K;  4QIW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...