4A3LG

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid and soaked with ampcpp
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 32
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3lG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3lG01
1QUQA 1MIUA 2CKZB 4LF6Q 4UP7A 3I4NH 2JA6G 5GAHC 3FKIH 5FLMG 4LF6L 4DR7L 1KXLA 4NPSA 2K5HA 1EWIA 4DV7L 1VQ8A 4HJAA 1K8GA 2CWPA 5JEAJ 3G4SA 2A19A 1PH5A 3CCEA 4R4CA 2V1CC 4L5SA 2WAQG 4Y52H 1YVCA 5IP9G 1YJ9A 3T1HL 4DV5Q 2GVBA 4LUOA 1LM0A 1X55A 2KHJA 1UE5A 2Q2IA 5ELOA 3S2HH 4IPDA 3CCQA 2K50A 4R4QA 1CSPA 1PH1A 4PZ8A 2L15A 3S24A 5IP7H 2ZTCA 2YU9H 3ERSX 1KL9A 2PI2A 3L2PA 3EBEA 4UY8C 3UE0A 3Q8DA 2I5LX 3KJOA 5IP9H 3PCOB 4C3IH 3ULPA 3CC4A 5C4XH 1Z9FA 4GN3B 3S15H 4A3MG 3DLLA 2AKWB 1PH9A 3KF6A 4R4OA 4MTNA 4A3GH 2ZTDA 5IYBH 3G48A 4Y7NH 1I3QH 3ULJA 1VQLA 2F3IA 4BY1H 1PVOA 2JA6H 3W5OA 4JI8L 4JI5Q 1Q81C 1IBLQ 1HNXL 2NVYH 3NENA 1VS0A 2R93H 1HJPA 4OWTB 2K75A 4GN4B 5ELNA 1QZHA 1PH7A 1T9HA 3J7ZC 1Y1WG 1J5EQ 2DGYA 3F2DA 4HJ5A 4GOPC 4JI2L 3U4ZA 1WI5A 1A63A 1IL2A 5H1SE 1YITA 1QZGA 4GKKQ 5FJ8G 4DUZQ 2N3SA 3UDXA 2YTVA 4A76A 4A93H 4JCVE 4GKKL 1YIJA 2CWAA 2JEBI 1PA6A 2UXBL 4JC0A 3HKZE 4B3ML 4DUYQ 4YWMA 2Q2HA 2VY3A 2UXBQ 4DUYL 3ZJYC 4JI0Q 4IPGA 2YV5A 1B7YB 3CAMA 4P75A 4BBSH 1A8VA 1E1TA 4A3BH 3GTPH 4IOAA 3CPFA 4UP9A 1NTGA 4A3DG 3IRBA 4DR2L 4GKJL 4B3TQ 3S1MH 3H3VH 1L1OC 4QL5A 4X6AH 4B3TL 2R7DA 3F2BA 1E22A 1NMFA 1PHJA 4IFDJ 4DV3Q 4AH6A 2ID0A 3CP0A 3M85A 1WFQA 3KJPA 3RZOH 2PNHA 4R4TA 4KI0A 2UUCL 2I5HA 4YCVA 3F2CA 1J5EL 4X64L 4JI6L 2ALYB 2HHHQ 2B3GA 4GLXA 4JI1L 4A3IG 4HIMA 5FLXc 2PI2E 5HY6A 3KOJA 4PMWA 3CCLA 3L0OA 3GTMH 4LF8Q 2WAQE 1XNRQ 3AFPA 4DPGA 5LMUL 4BA1I 4AYBG 4KLKA 3M7NA 1VQOA 3K0XA 3S1RH 3RLOA 1N9WA 1HNWL 5M3MH 2ZJQA 2E8GA 1YHBA 4LNQA 4DR1L 1XPUA 4L5QA 4BY1G 4B3RQ 1I94L 1JJCB 1EQQA 1E24A 4OO1G 1Y1VG 1N34L 2PQAB 4KHPQ 2ATWA 1L2FA 4OWXB 4HIKA 1HR0Q 4A3LG 3SGIA 3F8TA 5GAEC 2VQFQ 2JE6I 1V9PA 3A5ZB 3NELA 1Q12A 4HJ8A 4BBRH 4DR2Q 4GKJQ 3I2ZA 4X66Q 3CCUA 4GLVB 4DR5L 4AQYL 5J3BA 2UUAQ 2UUBL 4X66L 4AQYQ 1R9TH 3S14H 1KAWA 1GD7A 4UPAA 1KQSA 1FL0A 4BA2I 4JBJA 5M5WH 1EQRA 3UDFA 1VQGA 3GTJH 4APVA 3RNUA 4RG1A 4JI1Q 4LUZA 3OTOL 1JT8A 4ALPA 2ES2A 2AMCB 2LXKA 3HOVH 1U5KA 2JQOA 3ULLA 3TREA 5LMUQ 4A3FG 3PIPA 1AE3A 4PG3A 5IY0A 2JA5G 4JBKA 3EN2A 4R4IA 3AEVA 3FP9A 4IPHA 1N33L 4AIMA 4OWWB 1V1QA 2KCTA 1UE1A 4DR1Q 3F1ZA 4KHZA 1SE8A 1SN8A 5LMNQ 3H0GH 1XMQL 2UU9Q 1X56A 4DR6Q 4DV5L 5LMNL 1TWGH 4YWLA 1DGSA 1OXXK 2JA7G 4OONA 5M5YH 2C35B 1HNZL 1C0AA 4C3HH 3PUVA 4BXXH 5IYDH 3GO5A 4FDBA 3NBHB 1PH6A 1G6PA 3JC66 5C0XG 4LFBQ 1CKMA 1C7YA 2OTLA 1GKHA 1WYDA 1IZ6A 1QVGA 1OTCA 1HZBA 5GAGC 3E9HA 3KYHC 2VW9A 3CCSA 1XPOA 1MKHA 1EIYB 1PYBA 3PF4A 2D0PA 2E5LL 3HOVG 1H95A 4LW1A 1VCIA 1YZ6A 1IXRA 1E1OA 5IE8A 1PV4A 3ER0A 2JEAI 4GS3A 5DLQE 1X6OA 4YHHL 3UDIA 1VQNA 2B63H 1CKOA 3PGZA 2K52A 2VZAA 1EIFA 4YWKA 4LF4L 4LF7Q 1XMQQ 4QQBX 4LF4Q 3CMAA 4LF7L 4A3BG 2RCNA 4JV5L 2WP8J 3M4QA 3PO2G 5M3FG 2JA7H 2Z6KA 1HZCA 1Q82C 2JA8H 3M3YH 4WJ4A 4HIDA 3CF5A 3EIVA 4XIGS 5IYCG 3FHWA 1IYJB 1SR3A 3GDEA 1PH3A 2JK8A 4B3SQ 1VQMA 1Y1VH 3GTOH 2KBNA 2H5XA 4LFBL 3S17H 3D31A 2A8VA 3NEMA 5AJ3L 1L0WA 2UXCL 2Z6KC 5AJ3Q 1C9OA 1IBKL 4DV6L 2UXCQ 2ZM6L 2NVQH 3S2DH 1CKNA 4GOPB 4A3DH 1U0LA 4DK6C 3M4PA 2CCZA 4A4IA 1VQCA 2BH8A 1UWVA 2GVAA 3H0GG 3HKZG 4LF5L 4JYAQ 1S72A 1X3EA 2B63G 4DV4L 2HIXA 2LSSA 2R92H 4BY7G 2NZHA 4DV3L 2MO0A 1Q8KA 5BR8Q 4GNXA 1N8RC 4DV4Q 4JI5L 4YHHQ 5C44G 4RMFA 5BR8L 4IOCA 3CW2C 1B70B 1HNXQ 4JBMA 4DAYB 2LXJA 2UUCQ 3GTQH 5EAYA 1N32Q 4DV1L 3U50C 3T1YQ 3AYHB 1O7IA 4A3MH 1KIXA 3T1YL 3OYYA 1EOVA 4JI2Q 4JV5Q 1YHQA 3D0FA 3CXCA 4A3EG 5C0XI 5C0XJ 2FXQA 3TRZA 1Q1BA 3M4OH 2YTXA 2IHFA 2I5MX 4IO9A 1P16A 4NXNL 2OCEA 3RR5A 4DUZL 5IWAL 2K4KA 4B3SL 3CMEA 5GROA 5C44H 1JMCA 2ZJRA 5IWAQ 2QGQA 2XTIA 1OXVA 1NBWA 2N49A 4NB3A 1VQDA 1I94Q 1K73C 4JI0L 2RHQB 3E9IA 1BVSA 1OXUA 4MNOA 4KHPL 2YYZA 3ICEA 3S1NH 4A3LH 2VQFL 4DR3Q 1GO3E 1GVPA 3U4VA 2IX1A 1KRTA 4QGUA 4JYAL 4IFDG 4R1JA 4LF5Q 2UUBQ 1VQEA 1G291 1YI2A 2GN5A 3PSIA 1VQJA 3GD7A 2VQEQ 2JA5H 3M9BA 1EYGA 2K5NA 2OQ0A 1VQPA 1X65A 1XNQL 4DV1Q 2VQEL 1N32L 3TEHB 1RL2A 1E7ZA 3BU2A 4AYBE 1L1OB 4X64Q 2E2JH 4LFAQ 4TVAB 1FJGQ 3CQZH 2Z0SA 2HIVA 2R7FA 4A3JH 5JJKA 4LF8L 3A0JA 3A5UA 2OWOA 3AQQA 4JI4L 1Q86C 4DV0Q 3CPWA 4DKAC 4A3KG 5JJIA 2AWNA 3TS2A 1I5FA 1VQ4A 1HNWQ 3A74A 2R92G 2OTJA 4NXML 1HZAA 3J81j 1IBMQ 1FVIA 1MJCA 1Q1EA 1Q46A 1K0RA 1V43A 1X3FA 2DUDA 3W1BA 5IP7G 3I55A 1X54A 4X62L 4DV2Q 3WWVA 4MZ9A 1HR0L 1HNZQ 4X62Q 3UE1A 1L1OA 4LUVA 3RZDH 3PUZA 1XMOL 2E2IH 4A3CH 3I4NG 4GLAC 1XMOQ 1AE2A 1PYSB 4PZ7A 4YCUA 1CKNB 2IT1A 2R6GA 4YY3Q 4GOPA 1SFOH 5M3FH 1LTLA 4LF9L 1VQIA 5LMNW 1YJWA 1XNQQ 3HOUH 1AH9A 3HOYG 1A62A 2R93G 4HIOA 1KRSA 3E0EA 2IX0A 1N36L 3AFQA 1BKBA 1S40A 4H02A 1NMGA 2PMZE 1P8LA 4L5TA 1YJNA 3K81C 1VQ7A 3HKSA 2VNUD 4A3FH 2UXDQ 2QA4A 3B6YA 3KF8B 1X3GA 1FGUA 5C4JH 3CCJA 1ASYA 5IYBG 1HH2P 1UE6A 4P74A 4DV0L 2Q2TA 3I4MG 1WOCA 2BH2A 1IBLL 3PO3G 3BZCA 2JJQA 2MQHA 4OX9Q 2ASBA 3S1QH 3GTLH 4DR7Q 5C3EG 2BA1A 3PUYA 5JJLA 4EQ5A 4DAMA 4OX9L 2B29A 1KC8C 1JB7A 4NXMQ 1LUZA 3J81c 3JAMc 2I0QA 2Q2UA 1M90C 3I4OA 2UU9L 4JI7L 4DR6L 3STBC 2K5VA 1LYLA 4DV2L 4JI7Q 4BBSG 1W2BA 4GN5A 3T1HQ 1VQ5A 1PH2A 3U58A 5IYDG 2EXDA 2RHSB 3HOXH 2IY5B 4DNIA 1SMXA 4YY3L 1I6HH 1HZ9A 4WJ3M 2Y0SE 4IFDI 3RLFA 2R7ZG 4K0KQ 3KLWA 2CFMA 1VQ6A 1E3PA 4C3JH 4LWCA 4DV6Q 1TWAH 4K0KL 1XTDA 2AWOA 2IHEA 3PF5A 1QVFA 4QIWE 1B8AA 1SROA 4LFCQ 4HJ7A 1I50H 3BZKA 4LFCL 1KD1C 3TQYA 1VQBA 3PO3H 2E5LQ 3FKIG 5FLMH 3K8AA 5HGQA 4QY7A 3PIOA 4A3IH 1D7QA 3HOWG 2VUMG 5M5XH 3PUWA 3J7A5 2ZTEA 4JI8Q 2D0OA 1CUKA 1NJIC 3J81i 3HOZH 3JAMi 3TS0A 1YHAA 1WCMG 3CCMA 4JOIA 3PUXA 2KHIA 4A3GG 3K7AH 3HFZB 3J80i 1YNXA 4JG2A 1UE7A 3PO2H 5C4XG 2PQAA 2OQKA 1HR0W 2WB1G 2WFWA 1Z47A 2VS1A 4QJFA 1XPRA 3KF6B 1XNRL 2ZJPA 1W3SA 4P73A 2RF4A 5IYCH 2EIFA 3CCRA 4A75A 1VQ9A 3HOXG 1VQAA 2R7ZH 1UEBA 5C3EH 3CCVA 1VQFA 4JOIC 4ME3A 4BY7H 1EFWA 2AHOB 3GTGH 5K36G 1VQKA 3HOZG 3UDGA 1XJVA 4B3MQ 3VDYA 4IPCA 1PH8A 5IT9c 1TWCH 4GNXB 2NN6G 2NZOA 1IBKQ 5GQOA 3DM3A 3L7ZC 2ZM6Q 1GM5A 4DR4L 2BA0A 4IJHA 4P72A 4TQUS 3RN2A 2VUMH 2UUAL 4OO1I 3PV0A 4JBWA 2K14A 4DK3C 3OW2A 4A93G 2MO1A 1ASZA 3RLNA 3S16H 3H15A 2MNAA 5E7NA 3CC7A 1BBWA 5M3MG 4YCWA 4X65L 1SLJA 2YTYA 4POFA 1JJ2A 2NVXH 1TWHH 3RN5A 4X65Q 2KCMA 3G6EA 4XTCS 1K9MC 2MFIA 3CC2A 4OXPA 2JA8G 4L5RC 1SRUA 1TWFH 4POGA 1FJGL 2XGTA 4JI6Q 4JI3L 2HHHL 3HOYH 1OXSC 4PZ6A 3HOUG 1Y1WH 1D8LA 3KDFB 4HJ9A 1M1KC 3KFUA 4NXNQ 2D62A 4IJLA 4GNXC 1N33Q 2F4VL 1RIPA 3LGJA 1NY4A 2HT1A 2CQOA 1Q7YC 1A0IA 2WB1E 3MXNB 2F4VQ 2N8NA 4DV7Q 4A3CG 2KENA 2F52A 1BBUA 1JE5A 1IBML 1Y14B 3H3VI 1KHIA 3I4MH 4B3RL 2NN6I 1YEZA 1MJEA 1QUQB 4UP8A 3I56A 2QEXA 1NE3A 1PFSA 1N34Q 4DR4Q 4DR3L 1YBYA 1PH4A 5JEAG 3GTKH 4O0AA 4A3JG 1J6QA 2HQLA 1CSQA 1K8AC 1G51A 2JA9A 1TXYA 4O2DA 3STBD 4DR5Q 4A3KH 1VQHA 1X9NA 4BXXG 1JJGA 4P71A 3KDFA 3BJUA 4LF9Q 1WJJA 2N78A 4A3EH 1OXTA 3MEFA 3G71A 1EUJA 3W1GA 3J80c 3I7FA 2E2HH 1N36Q 2A1AA 5FJ8H 4BBRG 2EQSA 3K7UC 4JI3Q 2VL6A 4EX5A 4LFAL 2NVTH 3HOWH 2UXDL 2Y0SG 1QVCA 4J15A 4C2MH 3K80C 3OTOQ 1S3OA 3CD6A 1K3RA 5GADC 4JI4Q 1K83H 1WCMH
chains in the Genus database with same CATH superfamily
2TSSA 1IOVA 4CHTB 3ERQA 2G9DA 2JA6G 3MTSA 3VR3A 4RH6A 4NPSA 4DV7L 3FEWX 1VQ8A 1HUMA 1ZETA 2A19A 1ZXTA 1PH5A 2V1CC 1JXLA 1HNXH 4HSVA 1YJ9A 1SYBA 3P75A 1X55A 2KHSA 3RTXA 1UE5A 1D1IA 2PN1A 2ASJA 1WTWA 2F0FA 1A3TA 4IPDA 2VPSA 3NP8A 1PH1A 4XX0B 3GTOA 2F0NA 1E0BA 4CKCA 1Y8OB 2F0UA 2PI2A 5CMDA 4PNYA 3EBEA 4KN7C 4UAIA 3G8CA 1SDFA 2DWCA 4QWBA 4C5AA 3ETJA 3Q8DA 5LMUH 2FP4B 3KJOA 3S15H 2JYOA 5A2QL 3F2UA 1QNUA 4JI1H 4A3GH 3M4OB 1F9RA 1HPCA 2ZTDA 5IYBH 2Q8RE 5I2XA 4PDBA 1I3QH 2R92A 4BY1H 3URYA 4EFEA 3W5OA 2E2JB 1X32A 1Q81C 1LTID 1IBLQ 4YB8B 5ELNA 4GN4B 1LLRD 2QKIC 1T9HA 2NVYA 4A3GB 4JI2L 5BN3A 4JUZA 3GIKA 1EY8A 1B6SA 1A63A 4J9MA 2Q8IB 4LFBH 5J2TF 2L11A 5H1SE 1K1SA 4IALA 2V58A 4DUZQ 1KJ9A 3TINA 5JUMA 1CQVA 1S5DD 3UDXA 4A76A 2PCFB 2EYFA 4GKKL 5KT2A 2JEBI 4HQ6A 3HKZE 5CV9A 3NXWA 2VY3A 2EXZA 3G6XA 2PYKA 3DEOA 4JI0Q 4YJ2F 1ZEQX 2YV5A 1E4EA 1E1TA 4FXDA 4CGYB 3VPBA 2ICIA 5BPHA 4A3DG 2Z4HA 3KK7A 1ULZA 4DR2L 4FP5D 2R7ZB 4M9UA 5D8DA 4DV2H 1NMFA 3V2TA 4IFDJ 4C5BA 4DV3Q 4AH6A 2ID0A 1U9RA 4R4TA 2LKVA 2I5HA 3VYUA 2A6ED 1E2WA 2W9AA 4X64L 2ALYB 2LY7A 4HIMA 3OHXC 2FMCA 2PI2E 3KOJA 5FO9B 3CCLA 3GTMH 4DPGA 2VXWA 2E74C 4MTKA 4NMZA 1RYRA 2KEEA 2K7VA 4AYBG 2C28A 1F9QA 2R7KA 4KLKA 5EPKA 2FLLA 4JI3H 5F9NA 5M3MH 4RB2C 4LNQA 1IKMA 4A2BA 3E6ZX 4IUTA 5IOCA 4B3RQ 2B2UC 1E24A 5KFIA 2ATWA 2EJFC 2VUGA 5H80A 4ECSA 5GAEC 1V9PA 2YS6A 1Q12A 5JPMC 4DR2Q 1BDOA 3I2ZA 4AQYL 3HOWB 1PDQA 3FPUB 2UUBL 3GLKA 2F3VA 2JXMB 1R9TH 1PRTD 3S14H 1TWFA 3PQIA 3R5XA 1GUGA 2DPJA 2PMZB 3N44B 2QW7A 4G3IA 3GQBA 1VQGA 5I4DA 3GILA 5DQIA 5KFAA 1SFOA 4RG1A 1D5ZC 3OTOL 5KFDA 4R8IA 2D2CC 3PIP3 1JT8A 4EYHB 4PV1C 1AZPA 3HOVH 2JQOA 5M5XB 3K58A 1AE3A 1EQVA 3MXPA 1GUSA 2RCFA 5M5WB 3J80W 5EPLA 4AIMA 4ZHQF 3QOLA 5KFHA 1L0YB 2W70A 5EQ0A 3M3YB 4KHZA 3NWTA 2ZXRA 1SE8A 1SN8A 3OUUA 5KT5A 4DV5L 2AUJD 3MR2A 1DGSA 4A3JB 3NTHA 4OONA 2UU9H 3VR4A 2FLNA 4C3HH 3PUVA 3GO5A 4FDBA 1I4PA 3NBHB 4Q45A 3RUZA 2XGPA 1BGWA 2J6TA 2ICEC 2R7ZA 1S5BD 3OIPA 2C9OA 1J8IA 5KIXA 4JI6H 1GKHA 4A3IB 3WDNA 5IODA 1QVGA 4R8UB 1S0NA 1OTCA 5GAGC 1RF2D 1H9SA 1RD9D 3CCSA 5KKNB 2K05A 5CV6A 1PYBA 3SK6A 1EIYB 4TQRA 3IN5A 2W7OA 1ESRA 1H95A 2TMPA 2F0WA 4DV7H 1A9XA 5IE8A 4DV0H 3K6OA 2B63A 3ER0A 5CGKA 1DXMA 5ELDA 4YHHL 3LWUA 2YRXA 3T5HA 1RCVD 4YWKA 1EIFA 3QFFA 4LF7Q 5KFGA 1I50B 4LF4Q 3CMAA 1XMOH 1JWSD 2MHVA 2Z6KA 1HZCA 1EYZA 2ASLA 4YAKB 4Q0FA 3CF5A 3MXGA 4XIGS 5HURA 4F87A 2FK3A 3EQLC 3GTOH 2KBNA 1M6VA 4RGTA 4I65A 3D31A 3NEMA 4G7ZC 3LMLA 2UXDH 5E4XA 3VR6A 2HDLA 3ORRA 4WBNF 2J0TD 5KFTA 2V59A 2UXCQ 2NVQH 5DGAA 4OIKA 1LTSD 3CRLC 1E2VA 1U0LA 4CDCC 5KFFA 1G2SA 3M4PA 2CCZA 3LWEA 2A6HC 2RGRA 4XYOA 2WB1B 4LF5L 2HIXA 5BR8Q 3EROA 4DV4Q 3X3NA 4YHHQ 4RMFA 1LTGD 1B70B 1HNXQ 1IYUA 2UUCQ 3I4NB 5FPOA 5J22A 3AYHB 1O7IA 5EOYA 3T1YL 3PZPA 1EOVA 2F0HA 1YHQA 2EY6A 4A3EG 5C0XI 3KUPA 2YTXA 2IHFA 2I5MX 2OCEA 2RSOA 2EYMA 4MV8A 5GROA 5C44H 3TMEA 3FPPA 5IWAQ 3TQ1A 4DK1A 2YRWA 1OXVA 2R7MA 2R86A 3PR4A 4KJNA 3BDLA 1VQDA 1K73C 1D2BA 3PW0A 5I2YA 5J2UF 3E9IA 1BVSA 2NTTA 3NBHA 4KHPL 3TZUA 5KFLA 4MV4A 4APMA 3S1NH 3IFDA 4A3LH 1ICWA 5KFVA 3DMUA 3KHLA 2XWJB 4IFDG 4LF5Q 5C44B 1BBXC 1H9SB 3H4DA 1J9OA 4ECUA 3I70A 4OIJA 3PR5B 2ZDQA 2JA5H 4J0MA 4X64H 1VQPA 1DD2A 1D6EC 3Q6SA 1IW7C 4LFAQ 1YNJD 2B2WA 2PW7A 2Z0SA 2WKCA 4MAMA 2HIVA 4A3JH 4LF8L 4LFAH 1W93A 3AQQA 4ECQA 3V05A 2NVXB 5JJIA 5G3LD 2KOLA 5KG4A 3J7AF 2C2DA 4C2MA 2BOSA 3IFTA 1HNWQ 4WRDA 2VUMA 1LT5D 1CZGA 1EU3A 2VR1A 2XC9A 1MJCA 3I55A 1K0RA 4Q0YA 3OSNA 2FINB 1PZKD 3WWVA 2K5WA 1HR0L 5NUCA 1Q8IA 4RCNA 3RZDH 1L1OA 1XMOL 2E2IH 4O3QA 1N48A 1X3PA 3TP8A 4DL3A 3TP5A 5ELEA 5C0XH 2R6GA 3QO2A 3G6VA 2QCPX 5LXTF 3CRKC 4LF9L 1VQIA 5LMNW 1YJWA 2FJZA 3H0GB 1ONLA 1EL0A 4RU9A 3HOYG 1A62A 2M2LA 4P2CB 4ZUIA 3N52A 1KRSA 2QDBA 4C56C 1N36L 3KBXA 4X3UA 1NMGA 3HKSA 1FGUA 4E4TA 1ASYA 2XGQA 1PLFA 3I4MG 4P74A 4DL7A 1AZQA 1WOCA 1VBGA 2F0MA 1QILA 4KV6A 2BH2A 1TWGA 2L5TA 2IL8A 1S9FA 2F4VH 4A93B 3S1QH 4FF1A 2JA6A 1M7JA 4XYMB 2W9BA 1LUZA 3T1HH 3KLRA 1M90C 3I4OA 2UU9L 4OX9H 4GZYC 4BBSG 1U4LA 1W2BA 3D8GA 2WACA 4UCUA 3UI2A 3DM1A 1U4PA 2EXDA 2SDFA 4I7ZC 4KD3A 1VAJA 2RDFA 2Z8LA 4RAYA 1B9NA 4XQQA 3LNNA 3RLFA 3F8NA 1E3PA 4J8QA 3NK9A 5KFKA 1WCMA 5K5PA 4OGQC 2IHEA 3PF5A 1HCZA 2A69D 1QVFA 2H1EA 5CV4A 4LFCQ 3BDCA 5D65A 4RNNA 3BZKA 1KD1C 3A7LA 4IUVA 3PO3H 4HAEA 5IGFA 3K8AA 1GLVA 1B4OA 2Y0SA 3W2DA 3QWNA 4A3IH 1D7QA 3HOWG 5M5XH 5JH7F 3J7A5 5L1JA 4IRKA 1DCZA 2HCCA 1CUKA 2EYLA 3TS0A 4AQYH 3CCMA 4IQZA 4JOIA 5DGBA 1NCVA 4K2KA 4A3GG 4IAJA 4JG2A 3PO2H 3GTMA 2OQKA 2YS7A 4ZKBB 2MP1A 2XCLA 1XPRA 1XNRL 3KF6B 2RF4A 5IYCH 1VQ9A 4RB3C 4FU0A 3J80L 3HOXG 1IL8A 2HD3A 3Q22A 5DNFA 4MTDA 4KJOA 2C2RA 5K36G 1KLUD 1XJVA 3AU7A 4CKEA 4X3TA 2PPBC 3VDYA 4K6LA 2PMZA 1IBMH 2NN6G 2NZOA 1IBKQ 3NPPA 3T13A 1PMRA 4IUUA 2F0OA 2ZM6Q 1B44D 1GM5A 1S4ZA 4IJHA 2R8HA 3G6JB 4JBWA 4DK3C 5K2MA 4A93G 3MC0B 1BBWA 5DM63 2A68D 2YTYA 4ZOLF 1UNSA 1TWHH 2JA8G 4X65Q 3G6EA 3CC2A 4L5RC 1SRUA 1TWFH 1FJGL 1EYDA 2CZGA 1AW7A 1V1PB 1MHWC 4PZ6A 3HOUG 1A15A 1D8LA 1O80A 3J7AV 1X3QA 2W9BB 3KFUA 4NXNQ 2D62A 4FF4A 3C1FA 1N33Q 4I55F 1RIPA 3LGJA 2HT1A 4RFBA 4JK1C 4C3IG 2N8NA 5DG7A 4TRDA 5EWFA 1IBML 1SNQA 2K04A 1Y14B 4A3EB 4JV1A 2AQ3B 3OHAA 4B3RL 1A6XA 4GC7A 4UP8A 3I56A 1PFSA 3EPGA 1PH4A 4MV7A 4O0AA 4A3JG 1J6QA 1B6RA 1CSQA 2C00A 4BXXG 2R84A 1NSNS 1JJGA 1WJJA 1DZ1A 3MWYW 1OXTA 1RHPA 3J80c 2WIIB 2PZWA 5FJ8H 1EQTA 3K7UC 4JI4H 2VL6A 3DHQA 2UXDL 4IFDH 2Y0SG 3CQZA 4IWYA 4C2MH 3OTOQ 4IWXA 3K80C 4CDEC 3Q8QB 3V4ZA 4JI4Q 1K83H 2RGVA 4EFBA 2ZXPA 1WCMH 4UP7A 2QDLA 4ED6A 4LF6L 2FFKB 3RGZA 4EVOA 4DR7L 1KXLA 2K5HA 1EWIA 5IYZF 3HG9A 2E5LH 1V8QA 2CWPA 3G4SA 1BNZA 4R4CA 1S03G 2C2EA 1ZHQA 4LMQD 5IP9G 1H9RA 1LTTD 1HA5A 4DV5Q 4JI8H 2GVBA 4LUOA 1EWHA 2IJ0A 2VQFH 2C5CA 3S2HH 3CCQA 4IN3A 2JA7A 3MFGA 2XSCA 2J4XA 2L15A 5IP7H 3KXYT 5BN5A 1I4GA 5CAEB 3ERSX 3L2PA 2MUYA 5CA1F 4UY8C 5CBAE 3HRZC 5DQHA 2W71A 2A73B 1UNNC 4GN3B 2ZDHA 5KFXA 4EBDA 4A3MG 5JAVA 4R4OA 4YIJA 1JOKA 1T5EA 2DNEA 2QF7A 2Z9HA 3G48A 3MZ5A 5I6WA 3R23A 2PZTA 1PVOA 2JA6H 4JI5Q 4JI8L 4O3RA 2F4IA 3WO1A 4Q5VA 3NENA 1I7NA 3OMGA 3GTGB 1NJIC 2K75A 3J7ZC 2OH2A 2AQ2B 2OLSA 1WD1A 5C4XB 2OEOA 3U4ZA 1HFNA 4GKKQ 1OO9B 4A93H 4JCVE 3S1NB 1JKJB 1PTOD 4JC0A 5ELFA 2Q2HA 5IGDA 2AUKA 4H44C 3ZJYC 1L2ZA 1B7YB 3RZOB 2B2UA 4BBSH 1A8VA 4EEYA 2K6AA 5M5YB 1R4QB 3GTPH 4IOAA 3RAQA 4J9KA 4GKJL 5KYLA 3HBLA 5KFWA 3FVQA 4ED0A 4QCLA 4DR5H 1JLLB 2A6HD 3T51B 1KJ8A 1ZYRD 3M85A 3KJPA 1B50A 1KEEA 4KI0A 2K1BA 2UUCL 5J1ZA 4YCVA 2I8CA 4EGJA 2IA6A 4GLXA 4MIUA 5HY6A 4PMWA 2KA7A 5C4HA 4CJ0B 3MXUA 5FD5A 2JEFA 5EWGA 1TT2A 4K2LA 4UFZA 1Y1VA 4IR9A 1T3NA 1DM0B 3U9SA 4DXFA 1VQOA 1BCPC 3RLOA 2JA7B 1EIHA 2RBMA 3Q8SB 1BNCA 1YHBA 4KHPH 3K5HA 2NU7B 2H4OA 4UDUC 4BY1G 1JJCB 4J9RA 4IURA 3ND8A 4OO1G 4KHPQ 5DM73 1L2FA 2NB0A 1IW7D 2KEDA 4CC6A 3NELA 4GKJQ 5F2DA 4BBRH 2UUAQ 2UVRA 4DR5L 5J3BA 2R6FA 4RHSA 5T1IA 4GKJH 3S1RB 4DV4H 1KAWA 4QIWA 4C3IB 5LA6F 4UPAA 4BA2I 2F0SA 2DNCA 1PK8A 5D14A 4K6DA 3RNUA 5KFEA 3S1QB 4DFAA 4JI2H 1TU2B 3K5OA 1KBLA 2ES2A 2O03A 1EYCA 3RB3A 5FLXE 2EE1A 1C30A 3ULLA 1GOZA 4J9OA 3PIPA 2JA5G 4GC6A 5IY0A 2BE5D 3FP9A 4R8UA 1KLGD 1V1QA 4OWWB 5I9PA 1GHKA 4BY7B 2VOBA 1I94H 1XMQL 3R93A 3H0GH 1LTRD 5E1FA 5C3EB 4DR6Q 4DLKA 4YWLA 1OXXK 3BJYA 3U9TA 2JA7G 4DR6H 3K0YA 4A3BB 1LABA 3HP3A 1SE3A 4BWGB 3Q2OA 1G6PA 3JC66 4ZCKA 1PFBA 2YCHA 4JI0H 1C7YA 2OTLA 2EY5A 3M4IA 2W8LA 1R4PB 2VW9A 4R8NA 2HJWA 4HNUA 1MKHA 4ZAIA 5KFOA 2F0JA 1TY0A 1STHA 5CBEE 2D0PA 3HOVG 3BABA 4RZRA 1KTKA 4LW1A 1SMYC 2GLTA 4UCTA 1PV4A 4GS3A 1IKLA 1ESFA 5DLQE 3UDIA 1VQNA 1YNND 5LHY1 5A2QW 2WV6D 4LF4L 1FGBD 1MZBA 1XMQQ 2WKDA 2CW7A 3R3OA 2UVWA 2VQDA 2RCNA 3SHLA 2WB1A 4F8MA 5M3FG 4M7EA 1XMQH 4O42A 4IUPA 3QG1A 4HIDA 4ED7A 1C4QA 3GTPB 1Z2PX 1K8OA 3FHWA 4H0LC 1SR3A 3GDEA 1EZ1A 1PH3A 1Y1VH 4MHEA 2PW5A 2A8VA 2FJ2A 1L0WA 3HOZB 2Z6KC 2UXCL 3MR5A 1H9MA 1C9OA 5AJ3Q 1M0TA 3OTOH 1B53A 1BCPD 2B2YA 3WOEA 4ZKCB 5KG3A 5C5LA 2V5AA 1CKNA 4CKBA 3I3CA 3BZDB 1F9SA 3DXJC 1U4MA 4U68A 2YYAA 2BH8A 3HKZG 5EBDA 1QWYA 2B63G 3OSPA 4DV4L 2L1BA 5DAUA 2NZHA 1UC9A 1N32H 1Q8KA 2EPBA 1Z2OX 5C4JB 1KDBA 1HRJA 4DAYB 2LXJA 4WD3A 5LP6F 3T1YQ 4A3MH 3GTQA 2B8GA 1ICFB 1Q1BA 1TWHA 4FVMA 2BQ3A 1JB3A 1RDPD 1W6KA 2GPSA 3D6CA 3MJFA 5IWAL 3CMEA 2ZXOA 2EYJA 4O4LF 2ZJRA 3G6YA 2QGQA 4J9QA 1NBWA 2BR0A 4M8AA 3TP6A 3K3PA 4DL6A 3R5FA 3N40P 2VQFL 1L0XB 2D5DA 2NUAB 3K5NA 1I4HA 3GTOB 3CQZB 1KRTA 4J9SA 2PVPA 1HTLD 1DV1A 1G291 1YI2A 1DV2A 3PSIA 1VQJA 4WJWA 1XDNA 3VPDA 1SNMA 4EGQA 1EYGA 1PRTF 2XCPA 2W9CA 2K5NA 2OQ0A 3VYRA 2NUCA 4IUNA 4ZYSA 2VQEL 2IBKA 4O2BF 5KT3A 2OF1A 1L1OB 2N88A 2E2JH 2I46A 1FJGQ 4DV1H 4ED2A 2B8FA 4JV2A 4AYBB 5JJKA 2EDGA 2HDMA 1CI3M 4DV0Q 1Q86C 4DGZA 3BQ1A 5C5MA 3WOFA 2R61A 3K3VA 4XT3B 1VQ4A 5COYA 5FK9C 2OTJA 1HZAA 1IBMQ 1FVIA 1Q46A 3W1BA 4FS2A 3W3AA 1W96A 2DUDA 3A8JE 1CM9A 2NU9B 2O5JC 5EKIA 4XQJA 2FK1A 2I87A 3T56B 1TQOA 4KY5A 4ZRZA 1AN7A 3GV6A 2O4XA 3PUZA 1TWCB 4HCSA 3T5KA 2F0DA 2JA6B 4YCUA 1CKNB 2IT1A 4YY3Q 2AGQA 1HTPA 4EQPA 3TDQA 4K8JA 2CW0C 1AH9A 1S5ED 3MFYA 2WTFA 1JWMD 2UXCH 1QOHA 2DZDA 3BVGA 3E0EA 3RUPA 1BKBA 2LMCB 4H02A 4OHJA 4L5TA 1EY4A 4B9XA 1YJNA 2VNUD 1T36A 2UXDQ 1VBHA 2W6MA 4JYAH 3B6YA 3KF8B 1X3GA 2XD4A 4ODGA 3PN1A 4X3KA 4DV0L 1WSCA 3SI8A 2Q2TA 4RNMA 3Q1KA 3PIO3 1IBLL 3BZCA 4DR4H 2MQHA 1BOSA 3NTIA 2ASBA 3S17B 1KJJA 4DR7Q 2UUCH 1EWCA 3PUYA 3A56A 4I50F 4OX9L 3HZXA 1KC8C 1JB7A 2Q2UA 1BR9A 2JA5A 3PW5A 4YHHH 1FD7D 4JI7Q 1B1ZA 3DF7A 1VQ5A 3I91A 4IZ8A 1PH2A 3U58A 2CQYA 2RHSB 4O3OA 5BMVF 4EYIB 2EVBA 4YY3L 3PW7A 4IFDI 2JEJA 1I4QA 3H3VC 1VQ6A 2CFMA 4IZOA 4LWCA 4DV6Q 1C48A 1TWAH 4K0KL 4ED8A 5JJZA 3BVZA 4X3SA 4QIWE 1BF4A 2M05A 1CHPD 1A3VA 5A2QE 2RDIA 2HVSA 2E5LQ 2J6UA 2L4NA 5DG8A 2VUMG 3EFXD 3PUWA 5F9LA 2ZTEA 4JI8Q 3J7YW 3MFHA 3C2PA 4DV5H 1HXYD 2V4DA 1YHAA 4Y8VB 1WCMG 2XIGA 4RGNA 3J80i 3HFZB 4EGVA 4O3NA 2KCNA 3GIMA 2J6SA 4I7HA 2WFWA 1KDAA 1STNA 2VS1A 2ZJPA 3CCRA 2R7ZH 3CCVA 4EQNA 3KAJA 4ME3A 2R93B 4F4XA 1EFID 4E6IA 1RJQA 4DL2A 1DOKA 2XIWA 1TWCH 3FRPB 1LV9A 5GQOA 5A35A 3BAAA 5KG6A 4G7OC 4XYLB 4RAUC 4L8JA 4OO1I 3PV0A 4KMUC 5I47A 1TS4A 4RA8A 1ASZA 3RLNA 5K36H 2MNAA 3CC7A 5KFJA 1LT4D 1ET6A 4HMIA 4X65L 1EUDB 1PYWD 1S68A 4TUYF 5KT6A 3L3OC 2XRQD 2MFIA 2A69C 3GTJA 1J5EH 2XGTA 1KJIA 2XWBB 5ISRA 3I4LA 4UCVA 1S0MA 3JAMW 1EZ6A 1VMCA 2GA4B 1WTRA 1NY4A 3J7AK 2F4VQ 3GV7B 2KENA 2F52A 4I4TF 4NXMH 5T1GA 3VMMA 2N55A 1NAPA 2QEJC 1PTOH 3D3RA 2EYOA 3TP7A 4DR3L 5IGGA 4RB0A 4C3JG 1LTBD 2VA3A 1S5FD 1I4XA 2F0EA 1G51A 4DR5Q 1TXYA 1K8AC 4J1MA 3STBD 3H4BA 1VQHA 3KDFA 2N78A 3OPOA 4A3EH 2A5HA 1ENCA 3MEFA 1EUJA 1SNOA 3GQCA 3I7FA 2E2HH 3MXNA 5IGEA 4BBRG 2EQSA 1JDEA 4EX5A 4PMCA 1M8AA 1EY9A 2RDHA 4DF7A 2NVTH 1QVCA 4J15A 3NUCA 1KJQA 4QB4A 3UQ8A 1QUQA 1MIUA 4LF6Q 5D1OB 2AQ4A 4LFCH 5FLMG 1TWFB 5KGUA 2JEIA 4FS1A 4OO1H 1PZID 3BYTB 4CJ1B 4FF2A 2W6ZA 3NQTA 5JEAJ 2AQ1B 3LP8A 2G9HD 4L5SA 3QB3A 1YVCA 3I90A 5CYUA 3T1HL 2CHBD 4EQOA 4DU9A 1DIKA 5ELOA 2NU6B 3Q23A 2HQEA 2J7ZA 2D9UA 2EZVA 3PW4A 2K50A 1ET9A 3K57A 1JOOA 2ZTCA 1SE4A 1CZWA 1KL9A 3KALA 1YNJC 4LH6A 1TVXA 3UE0A 4ZLTF 3S16B 2I5LX 4ETSA 3RB0A 5IWAH 5IP9H 4C3IH 1TWGB 3CC4A 1V51A 1CTMA 4KKUA 1SJED 2RQXA 1IHZA 2AKWB 2EYHA 1SYFA 1PZJD 3E0JA 3J80E 1MSGA 3ULJA 3N43B 2F3IA 4XXEA 3TN2A 4TV9F 4QWAA 3BYYB 3HOYB 1HNXL 4DN4M 1QNKA 1VS0A 2B2TA 4OWTB 3VYTA 2KUMA 3N6XA 3DWQA 1BO0A 1Y1WG 4JV0A 4GOPC 5C8YF 5DQGA 1B3QA 1WI5A 3H09A 1DOLA 1ILQA 1EYAA 1TWAA 1VDZA 1YITA 3MAQA 3R5HA 2E76C 4FXGC 3PO3B 5KFSA 5FJ8G 1TAEA 3OUZA 1A2TA 2N3SA 3DEPA 2YTVA 2VUMB 1XNQH 2YZNA 1YIJA 4YWMA 1ENAA 3GTKB 2UXBQ 1XX8A 1JX4A 4RWSC 4DUYL 2F0KA 1PXUA 4IPGA 1WR2A 1QB5D 4P75A 4WORA 1Y69U 4A3BH 5D1PA 4RUAA 3PVXA 1N34H 5CB4F 4UP9A 1VMPA 3IRBA 4YP3A 2NWGA 2K01A 3S1MH 3KHGA 1RTNA 3H3VH 1L1OC 4HEDA 4X6AH 3WNZA 4B3TL 2K28A 3F2BA 1E22A 4DAPA 1NNXA 1Y1WB 1CT1D 4ED3A 3RZOH 2HHHH 4U7CA 2BE5C 1LACA 5KG1A 4R7RA 4KY7A 2HHHQ 4HN7A 5KNDA 4A3IG 5FLXc 5JQWA 3EYYA 3AB9A 4LF8Q 3RV4A 2NTSA 4RGOS 1KAAA 4BA1I 3RJ0A 2F1MA 1TWCA 4O3PA 4I7AA 1V1OA 3KLSX 5KG2A 4B3SH 1H9KA 3S1RH 1N9WA 3NHHA 5EPJA 1HNWL 2HGSA 4DR1L 1JE4A 4HR7B 1XPUA 2IW3A 3KAKA 4DNRB 2W6QA 1Y1VG 1N34L 2PQAB 3BA8A 2ZT9C 4HIKA 1HR0Q 4A3LG 2VQFQ 5JOBA 4HYKA 4HJ8A 3A5ZB 1S0OA 2NVTB 3CCUA 1HR0H 1CK1A 2K32A 3MWMA 4X66L 4DR2H 3M7GA 3X3MA 1FL0A 5M5WH 1EQRA 2B63B 3JRXA 3GTJH 4APVA 4J6HA 4LUZA 2V4QA 1RJTA 4RHRA 1MD2D 2OXPA 3BQ2A 1SMYD 2AMCB 2G5DA 2LXKA 4U6PA 3TREA 4A3FG 2IPKD 3A54A 4PG3A 3BS1A 4YR0A 3EN2A 1RJPA 4IPHA 2SCUB 1FNVA 2KCTA 3NQIA 1MSHA 4DR1Q 4MV1A 3TQTA 3MHBA 2UUBH 3DUZA 2UU9Q 3FDSA 5LMNL 4UCRA 1TWGH 5L37A 5JVH3 1CE8A 4UHVA 4C3JB 1SE2A 4RB1A 5M5YH 2C35B 1XTCD 1SSOA 3P20A 1C0AA 3OHBA 4BXXH 5IYDH 1PH6A 1RK5A 1FJGH 5C0XG 2KVMA 5FO7B 1PTOC 1WYDA 1B9MA 1GGOA 3SEBA 1IZ6A 3SE0A 3MA2B 2YW2A 3KYHC 1UAPA 5E4WC 4JPBW 1XYIA 1PRTC 1B04A 3CVZA 4B3TH 3FKIA 1HHVA 3V6JA 3ZYYX 1VCIA 1YZ6A 1EY5A 5JVDF 2FLPA 4MV6A 1GSHA 5FD6A 3H40A 4CC5A 3EA6A 5KFUA 3O13A 1CKOA 3PGZA 2VZAA 4H13C 3ETHA 2X69A 1CA6A 2XRSD 4LMYA 2R7LA 3RFCA 4ILWA 4ED1A 2WAQB 3NBIA 4A3BG 4C3HG 4JV5L 3M4QA 1DONA 4MV3A 5CA0F 5JVLA 2Z4IA 2PBZA 2JA7H 4WJ4A 3SDZA 3M3YH 4HR7A 2O5IC 2QK4A 3TSSA 1WTOA 2FPIB 4KKTA 1IYJB 3OIQA 1FNUA 4C5CA 5DEHA 1VQMA 3GTQB 1N36H 1PFNA 5L1LA 5AJ3L 1JDBB 1IBKL 1TWHB 2A6EC 4DV6L 2DLNA 2ZM6L 4A3DH 4DK6C 4A4IA 2GVAA 4JYAQ 1UWVA 3H0GG 3BA9A 5KFQA 2RDGA 1X3EA 1S72A 2LSSA 1SYDA 2R92H 1I3QA 5CC4A 2MO0A 1XWEA 4GNXA 3DWAA 1EY0A 1C8CA 3BG5A 5L1KA 2MPMA 1TWAB 4JBMA 4RKLA 3GTQH 3K5IA 4LH7A 5EAYA 1WCMB 2R7NA 4CDDC 4G4KA 1ZYRC 4JI2Q 4JV5Q 3EVQA 4MTEA 2W6PA 3ONAB 3L4JA 5IT9W 1TR5A 2L55A 3T53B 5IGCA 3M4OH 2PZUA 1KDCA 4IO9A 4NXNL 4JV5H 4ME5A 4DUZL 5KYIA 5C6AA 3RV3A 2K4KA 1Q90A 4XDXA 1JMCA 5LYJF 1I50A 2MCTA 1SNDA 2XTIA 3PO2B 4MA5A 4EBEA 1BCPB 1CQFA 2N49A 2FPPB 1I94Q 4YAJB 2ALZA 4JI0L 1STEA 4MNOA 2YYZA 1SNCA 1CQIB 1FNWA 2DJFC 1GO3E 4N8X1 2IX1A 4JYAL 3KBGA 4KK7A 1VQEA 2BQRA 2GN5A 3N6RA 3GD7A 1G8ZD 1A2UA 1JIHA 2VQEQ 4DL5A 3M9BA 3C3LA 1X65A 3TEHB 1E7ZA 4NP5A 4AYBE 4RGMA 4X64Q 3QZ8A 4TVAB 4RUCA 2FMMA 1SYEA 1I4RA 3N42B 2R7FA 5EGTA 2F0QA 2BDOA 3A0JA 4JI4L 2OWOA 5FLXL 2E2HA 4DKAC 4HCEA 4CDFC 3TS2A 2A68C 3SXHA 3RF2A 2CH4A 2ATLA 4JVZA 1EOTA 4NXML 3J81j 2YU9B 5BN4A 1X3FA 4EEQA 2FMAA 1EEID 2HCIA 3A8KE 2K5QA 4DV2Q 4CBVA 1HNZQ 4X62Q 5KFYA 1B3AA 3T16A 1HA6A 3I4NG 4GLAC 1K8MA 1ML0D 4PZ7A 4KY6A 4BY1B 4YJ3F 2EY1A 3J81L 1AFPA 1I3QB 2RVLA 1MBYA 2IP4A 1GHJA 4OL7A 3HOUH 4DXGA 4PQXA 2J9GA 4LF8H 2R93G 2IX0A 1IYVA 3AFQA 2EJMA 2PMZE 4A3MB 4ULLA 2QA4A 5C4JH 3CCJA 5IYBG 1Y8PB 3GTMB 5TSSA 3L9AX 4ECZA 1G6ZA 4TKOB 2SNMA 3PO3G 1B33N 2PO4A 3S9WA 2JJQA 5M9OA 4ECWA 4OX9Q 3GTKA 3GTLH 3T1YH 5JJLA 2BA1A 3A8IE 4NXMQ 1GJXA 3J81c 3JAMc 2I0QA 4JI7L 2KECA 3STBC 4HNVA 1LYLA 4DV2L 4EBCA 3T1HQ 3VR2A 1GYFA 3C1EA 3Q8RB 5IT9E 4DNTB 2F03A 2IY5B 1DOMA 2NVYB 1I6HH 2ZJTA 2IWHA 1XNRH 4WJ3M 2Y0SE 2UVUA 3CKIB 4O4IF 4K0KQ 3KLWA 4K8IA 4C3JH 1BXRA 2ZDGA 2AWOA 2RSNA 2W57A 4NLGA 1EEFD 1SROA 4ECTA 4V0BA 4HJ7A 1RJRA 4DR3H 5ELCA 5FKAC 1SFOB 2R8KA 3GIPA 5FLMH 3JAME 3K59A 5FO8B 2B2VA 1Z7TA 1CQJB 1RK6A 3E3XA 3HOZH 3J81i 1ZQ7A 3JAMi 4X66H 4HMJA 1KC7A 1Z2NX 1EUCB 3PUXA 2VA2A 1HFGA 1WVLA 4HNTA 3GIDA 4DL4A 1UE7A 4G57A 5C4XG 5GONF 2PQAA 1HR0W 4IR1A 1M0WA 1U4RA 4ZQIA 1I6UA 2EIFA 1HUNA 1VQAA 3HKZB 1UEBA 2CH4W 2F0LA 2EY2A 3HXLA 1VQFA 1E4GT 1EFWA 2AHOB 4LJZC 4ECXA 1F2LA 4UCOA 2LS01 2AU0A 2SNSA 3NTKA 4XQNA 3GTGA 4IPCA 1PH8A 4UCSA 1F9PA 5HGTA 2X6GA 2E2IB 2KJXA 4DAVA 3L7ZC 3HOXB 2X0SA 1S97A 4DR4L 4DAYA 1ENFA 3D6WA 4O4HF 3TIIA 1KNEA 3RAXA 1IBLH 4P72A 3RN2A 1Z6HA 2UUAL 1VKZA 4ZK9B 4ECRA 2B2YC 3S16H 3CU7A 5E7NA 2F0TA 4YCWA 1SLJA 4POFA 3RGXA 2NVXH 2KCMA 2Z1CA 1K9MC 1R9TA 3Q0AA 4V190 4FM9A 3GV3A 3M9NB 4X65H 4JI3L 1GSOA 3KHRA 2HHHL 3RB6A 1N33H 5FPRA 1Y1WH 3KDFB 1M1KC 2K33A 3HEJA 4DUZH 4KTAA 2F4VL 3E5SA 1AUVA 4ECVA 3NGDA 3MXNB 4F88A 4A3CG 5LL6b 4DR7H 2UXBH 2OT2A 1FKAH 3H20A 5LOVF 1BBUA 3H0GA 3I8ZA 3OOCA 1O78A 3H3VI 1KHIA 3I4MH 4H7BA 4O2AF 3TIGA 2NN6I 1DJRD 1QUQB 5LL6X 2QEXA 1N34Q 1MJEA 4DR4Q 3Q8PB 4FBTA 1YBYA 5BR8H 5KT7A 3GTKH 4TV8F 3IL8A 2HQLA 5BPFA 2JN4A 5KG0A 2JA9A 2WYOA 4P71A 3BJUA 4FXKC 5C4ZA 4TSSA 2ENBA 2I07B 2R8IA 3W1GA 2M00A 3I73A 1STAA 2L12A 1N56A 1SNPA 5CV5A 2AGOA 3S1MB 4LFAL 4JI3Q 3CD6A 4XYQA 1S3OA 3BQ0A 1K3RA 4C3HB 3E5NA 4ZQ3A 5EDWA 3K5LA 4B3RH 1JR0D 2CKZB 3I4NH 5KFRA 5GAHC 3FKIH 4QIWB 5KFNA 1AEXA 1SAPA 4KN4C 4ZUJA 4EG0A 1V4YA 1MGSA 1STBA 4HJAA 1QE6A 3BDOA 3HOUB 1K8GA 2F0PA 4QWCA 3CCEA 4Y52H 2WAQG 3NWSA 3QIAA 4BBSB 4Z9CB 1LM0A 2KHJA 2Q2IA 2NVQB 1EY7A 4PMBA 3TBIB 2VQEH 3HOVB 4QF4A 4KD4A 5T14A 4R4QA 1CSPA 4PZ8A 4Q44A 3S24A 3JSNA 2DIKA 4DA2A 2YU9H 1OWTA 2XNAC 3P7JA 4C1NI 5JVG3 4S3SA 2Z6BA 3PCOB 3ULPA 5C4XH 1Z9FA 2R8GA 1R9TB 3S14B 4ABNA 3DLLA 1GUWA 2DJGC 4B3MH 1PH9A 3KF6A 4MTNA 3GV5B 1F2ZA 3VYSA 4Y7NH 4XZ3B 2B2VC 5M3FB 2NN6H 1VQLA 2XCAA 2W9CB 1SXTA 3J81E 2NBFA 3IKJA 1YNNC 2NVYH 2R93H 1HJPA 1PH7A 2NVXA 1QZHA 4JI5H 3L4KA 1J5EQ 2DGYA 3F2DA 4HJ5A 4X62H 2KQ3A 2MGSA 5KFPA 4GKKH 3LX0A 4QWEA 2NU8B 3V6HA 2W7PA 3OSOA 3SK4A 4U673 5CORA 4F7XA 1IL2A 1VF7A 4CJ2C 1QZGA 4YQWA 1Y1WA 4KKSA 3S2DB 1LT3D 2FHTA 1SYGA 3EJIA 5L9XA 2UXBL 2CWAA 1PA6A 1F77A 1JWUD 4B3ML 1STYA 4DUYQ 1SCUB 1K0SA 3R8BA 3S2HB 5JEAH 4FF3A 3CAMA 3LWBA 4MA0A 1JOQA 1WTPA 1O7LA 1IOWA 1E4FT 1PFMA 5L1IA 3CPFA 4IHJF 1NTGA 4NDXA 4RKBA 1UUPA 3MR3A 4J9LA 3RMHA 4B3TQ 4LF7H 3OMCA 1JCKB 4QL5A 2E2HB 2R7DA 4HSPA 4IRCA 3K5MA 1PHJA 3CP0A 1K83B 1WFQA 4J9NA 5I6YA 2PNHA 5IIFA 1PRTB 4YY3H 3MEHA 3F2CA 1J5EL 2SEBD 4JI6L 2CVRA 2YU9A 2B3GA 1WTQA 4JI1L 2F0IA 2DY7A 1CFMA 3L0OA 2WAQE 1XNRQ 2WE6A 3AFPA 1LO5D 1PTOB 4DK0A 4QUFA 3R2TA 5LMUL 3WO0A 2RA4A 1NUCA 3M7NA 5DLFA 1SBBB 2PQEA 1F2MA 3K0XA 1D5XC 5C1OA 3JSLA 2ZJQA 2E8GA 4KHVA 1O7ZA 1CA5A 5EKKA 4L5QA 1I94L 1EY6A 1EQQA 3OWEB 4LF6H 4LSXA 4FYDA 5EZYF 4OWXB 3SGIA 3F8TA 2FK2A 2JE6I 4B9WA 4C2MB 4QUCA 4X66Q 4GLVB 1FYCA 3FMCA 2HVQA 4AQYQ 2QILA 5M3MB 3EPIA 2LFNA 1GD7A 3S15B 1HQRD 1UEAB 1KQSA 1RODA 4JBJA 4K5WA 4OEMB 3UDFA 5C1PA 2R82A 2V4RA 3GTLB 4XT1B 4ID6A 4JI1Q 4DV6H 3TZDA 2E75C 4ALPA 3RBEA 1U5KA 1RKNA 5LMUQ 4MV9A 4JBKA 1S10A 4R4IA 3M4YA 3AEVA 1N33L 3VR5A 5ELBA 2CQAA 2V9WA 1K3BC 1UE1A 2ZM6H 1AP0A 2RKSA 3F1ZA 3G7LA 5LMNQ 1X56A 3IAYA 3D4RA 2EJGC 4NW2A 4IRDA 1HNZL 3M9OB 2R93A 2R87A 4Q8FA 5DG9A 4LFBQ 2WAQA 1CKMA 4Q43A 1M4VA 2YZMA 1G2TA 5D1OA 1K83A 3BVMA 3T5JA 1HZBA 3E9HA 2FPGB 1XPOA 3PF4A 3V6KA 2DPIA 3C0FB 1H9JA 2E5LL 3NE5B 4N9PA 2X6LA 1IXRA 1E1OA 1D1KA 1UC8A 3UFXB 1G91A 3HKZA 1SEBD 3H94A 4F4WA 3A7AB 2JEAI 3SR1A 1X6OA 3GTJB 2B2TC 1WTHA 1II3A 1O7YA 2B63H 1S5CD 2K52A 3VA5A 1HNZH 5D3IB 4QQBX 4LF7L 2O2LD 1B2TA 2WP8J 3P1HA 4DV3H 3PO2G 1TIID 2JA8H 5CV8A 5KEEA 1Q82C 1TA8A 3GV8B 1RYSA 1GUNA 3KF8A 1CS0A 3EIVA 5IYCG 3Q24A 1ZKOA 5DLGA 4B3SQ 2JK8A 2XN9C 4PWQA 1BXTA 2H5XA 4LFBL 3S17H 4K5VA 2BDNA 3IG0A 1F2YA 3BG3A 4QW8A 3SK5A 5HV6A 1T94A 5KFZA 3S2DH 4GOPB 5KG7A 3C46A 1EU4A 2HUGA 3GTLA 5C3WA 2K03A 1QCBD 4HTHA 1WD0A 1VQCA 4QWDA 4FBUA 4BY7G 5KT4A 4DV3L 1N8RC 3KTMA 5C5JA 1W6JA 4JI5L 2NYZD 1Q3LA 5C44G 5BR8L 5EBCA 4IOCA 3CW2C 1N32Q 4DV1L 3U50C 1WH2A 3MR6A 4C1NK 2IX3A 3M9MB 3QR8A 4OELB 1KIXA 2UVVA 3OYYA 3GIJA 2F0GA 4FO2A 3D0FA 3CXCA 5C0XJ 2FXQA 3TRZA 1CHQD 2R92B 1P16A 3RR5A 3SE7A 2F0VA 4B3SL 1SJHD 1A3UA 4A3KB 1K1QA 3N41B 3H91A 4NB3A 5LL6S 1KABA 1NR4A 1V1PA 1FR3A 3MFIA 2RHQB 1OXUA 1GXDC 2VB3X 3ICEA 5KG5A 4DR3Q 3FMAA 3U4VA 1GVPA 2DY8A 3GIIA 1GUTA 4QGUA 4IUQA 2KSWA 1I6VC 4R1JA 2UUBQ 4BWSC 1SYXB 1AN8A 2EYPA 3MWDA 2PNRC 1PX2A 2WDTA 3PMFA 1STGA 1N32L 1XNQL 4DV1Q 4A2AA 5CR3A 2WINB 1RL2A 3FDTA 3NSWA 3BU2A 2JEGA 5CV7A 1SYCA 1WTXA 1Y8NB 4FNFA 3CQZH 2M9VA 1PTOF 4YR2A 2A74C 4JW0A 3HB9A 5KFBA 3A5UA 4DUYH 2DN8A 2JA5B 3CPWA 2JSOA 4A3KG 1QJOA 4N9TA 2YL2A 1BUVT 2AWNA 1I5FA 2I80A 5J39A 2FKLA 3A74A 5KFMA 1HQMC 1TS3A 2R92G 3V96A 5EJWA 3QJYA 1Q1EA 3PW2A 4MN3A 1V43A 5IP7G 4YR3A 1IBKH 1X54A 3ND9A 4X62L 1XXGA 2RDJA 4MZ9A 2Q8TA 2GPWA 2L9HA 3UE1A 4LUVA 2P0AA 4RNOA 2VB2X 4A3CH 4A3FB 1XMOQ 1AE2A 4LF4H 1PYSB 4GOPA 1SFOH 2XVSA 3KLSA 2BCOA 3D4DA 5M3FH 1LTLA 1KNAA 2SOBA 4M1UB 3U9OA 1XNQQ 5KX5F 2ASDA 2CW8A 2JP1A 3HGBA 4L63B 4HIOA 3J81W 1DYQA 1JQYD 1S40A 1VQ7A 3I72A 1P8LA 3K81C 4RCOA 4A3FH 5C3XA 3GTPA 5IT9L 1GSAA 1HH2P 1UE6A 1BJTA 4F4ZA 4NXNH 1EIGA 5KFCA 1TS2A 5C3EG 1Y1VB 3A55A 3OW7A 2FB9A 4EQ5A 4DAMA 5EWEA 2B29A 4JI7H 1E2ZA 4DR6L 2K5VA 5IGBA 2C22A 2UUAH 2YZGA 4GN5A 2P5ZX 5KNCA 4N8FA 1TKWB 2B2WC 5IYDG 2W6NA 3ORQA 3HOXH 1BQQT 2EOTA 1LT6D 4DNIA 4LSAA 1SMXA 3CHBD 3GP7A 1HZ9A 3T4AC 3RIZA 1TY2A 2R7ZG 2FE3A 4L1KA 3QOJA 5EKLA 3RZDB 1EHIA 1XTDA 1B8AA 2QYZA 2AGPA 3H6MA 3ITPA 3RD4A 1I50H 4LFCL 1JICA 1VQBA 3TQYA 1MI2A 3I12A 5FLXW 4J9PA 3FKIG 4F4YA 5HGQA 4B08A 4O1NA 4QY7A 3PIOA 1D5MC 5LMNH 2E2IA 2E2DC 2D0OA 2L0CA 1ZHSA 4QMGA 4QW9A 3HS0C 2K5DA 2F3WA 4LF5H 2KHIA 2IMWP 3K7AH 4G7HC 3N8DA 1YNXA 3MWEA 4BS9A 3I4MB 4R9WA 2WB1G 1Z47A 1WTVA 4QJFA 3JZIA 3VPCA 1W3SA 4P73A 4Y7NB 3AMUA 1RTOA 4A75A 4F50A 5C3EH 3MVVA 1SEIA 5AFWA 2CW0D 4JOIC 5KNBA 4BY7H 1JORA 4Q8EA 3GTGH 4BBRB 1VQKA 3HOZG 3UDGA 1T5XD 4B3MQ 4LAAA 1C3OA 2Y0SB 5E3FA 5IT9c 5G3LF 4GNXB 3SVMA 3K7AB 1I6HB 1O75A 1K28A 2R3ZA 3DM3A 4YBZB 4K5XA 4DR1H 1QG7A 2W8KA 2BQUA 1LTAD 2BA0A 4AYBA 4TQSA 4TQUS 1HNWH 1AUXA 2VUMH 2K14A 3OW2A 1JC7A 2MO1A 3H15A 3VA7A 5M3MG 3JRWA 1JJ2A 4O3SA 3RN5A 4XTCS 4OXPA 3T5LA 4POGA 2HVRA 3FKIB 4JI6Q 1ILPA 3HOYH 1OXSC 4HJ9A 4NKLA 3DWPA 4IJLA 4GNXC 4LK1C 2JA8B 5JPNC 1BCPF 2CQOA 1Q7YC 1A0IA 2WB1E 5D3DA 3GIQA 4ECYA 4DV7Q 2NZ1D 5I9OA 2R85A 1JE5A 2W6OA 1YEZA 1NE3A 1I7LA 1VF5C 2B39A 5JEAG 3OWFA 4WFN3 4LF9H 2MJ8A 1GUOA 4O2DA 3SK8A 4A3KH 1X9NA 4ZI7F 3JAML 4LF9Q 4A3DB 1E4EB 5HBRB 4K14A 4ME6A 4RAZA 2KCCA 3G71A 3V4SA 4L6TB 1NR2A 3QZ7A 1N36Q 2A1AA 4RZQA 3KHHA 3RBDA 5FOBB 1EZ8A 3R2IA 5KRUA 3HOWH 3RB4A 4K0KH 3D4WA 2VPQA 2R8JA 5GADC 1TS5A
chains in the Genus database with same CATH topology
1QUQA 1MIUA 2CKZB 4LF6Q 4UP7A 3I4NH 2JA6G 5GAHC 3FKIH 5FLMG 4LF6L 4DR7L 1KXLA 4NPSA 2K5HA 1EWIA 4DV7L 1VQ8A 4HJAA 1K8GA 2CWPA 5JEAJ 3G4SA 2A19A 1PH5A 3CCEA 4R4CA 2V1CC 4L5SA 2WAQG 4Y52H 1YVCA 5IP9G 1YJ9A 3T1HL 4DV5Q 2GVBA 4LUOA 1LM0A 1X55A 2KHJA 1UE5A 2Q2IA 5ELOA 3S2HH 4IPDA 3CCQA 2K50A 4R4QA 1CSPA 1PH1A 4PZ8A 2L15A 3S24A 5IP7H 2ZTCA 2YU9H 3ERSX 1KL9A 2PI2A 3L2PA 3EBEA 4UY8C 3UE0A 3Q8DA 2I5LX 3KJOA 5IP9H 3PCOB 4C3IH 3ULPA 3CC4A 5C4XH 1Z9FA 4GN3B 3S15H 4A3MG 3DLLA 2AKWB 1PH9A 3KF6A 4R4OA 4MTNA 4A3GH 2ZTDA 5IYBH 3G48A 4Y7NH 1I3QH 3ULJA 1VQLA 2F3IA 4BY1H 1PVOA 2JA6H 3W5OA 4JI8L 4JI5Q 1Q81C 1IBLQ 1HNXL 2NVYH 3NENA 1VS0A 2R93H 1HJPA 4OWTB 2K75A 4GN4B 5ELNA 1QZHA 1PH7A 1T9HA 3J7ZC 1Y1WG 1J5EQ 2DGYA 3F2DA 4HJ5A 4GOPC 4JI2L 3U4ZA 1WI5A 1A63A 1IL2A 5H1SE 1YITA 1QZGA 4GKKQ 5FJ8G 4DUZQ 2N3SA 3UDXA 2YTVA 4A76A 4A93H 4JCVE 4GKKL 1YIJA 2CWAA 2JEBI 1PA6A 2UXBL 4JC0A 3HKZE 4B3ML 4DUYQ 4YWMA 2Q2HA 2VY3A 2UXBQ 4DUYL 3ZJYC 4JI0Q 4IPGA 2YV5A 1B7YB 3CAMA 4P75A 4BBSH 1A8VA 1E1TA 4A3BH 3GTPH 4IOAA 3CPFA 4UP9A 1NTGA 4A3DG 3IRBA 4DR2L 4GKJL 4B3TQ 3S1MH 3H3VH 1L1OC 4QL5A 4X6AH 4B3TL 2R7DA 3F2BA 1E22A 1NMFA 1PHJA 4IFDJ 4DV3Q 4AH6A 2ID0A 3CP0A 3M85A 1WFQA 3KJPA 3RZOH 2PNHA 4R4TA 4KI0A 2UUCL 2I5HA 4YCVA 3F2CA 1J5EL 4X64L 4JI6L 2ALYB 2HHHQ 2B3GA 4GLXA 4JI1L 4A3IG 4HIMA 5FLXc 2PI2E 5HY6A 3KOJA 4PMWA 3CCLA 3L0OA 3GTMH 4LF8Q 2WAQE 1XNRQ 3AFPA 4DPGA 5LMUL 4BA1I 4AYBG 4KLKA 3M7NA 1VQOA 3K0XA 3S1RH 3RLOA 1N9WA 1HNWL 5M3MH 2ZJQA 2E8GA 1YHBA 4LNQA 4DR1L 1XPUA 4L5QA 4BY1G 4B3RQ 1I94L 1JJCB 1EQQA 1E24A 4OO1G 1Y1VG 1N34L 2PQAB 4KHPQ 2ATWA 1L2FA 4OWXB 4HIKA 1HR0Q 4A3LG 3SGIA 3F8TA 5GAEC 2VQFQ 2JE6I 1V9PA 3A5ZB 3NELA 1Q12A 4HJ8A 4BBRH 4DR2Q 4GKJQ 3I2ZA 4X66Q 3CCUA 4GLVB 4DR5L 4AQYL 5J3BA 2UUAQ 2UUBL 4X66L 4AQYQ 1R9TH 3S14H 1KAWA 1GD7A 4UPAA 1KQSA 1FL0A 4BA2I 4JBJA 5M5WH 1EQRA 3UDFA 1VQGA 3GTJH 4APVA 3RNUA 4RG1A 4JI1Q 4LUZA 3OTOL 1JT8A 4ALPA 2ES2A 2AMCB 2LXKA 3HOVH 1U5KA 2JQOA 3ULLA 3TREA 5LMUQ 4A3FG 3PIPA 1AE3A 4PG3A 5IY0A 2JA5G 4JBKA 3EN2A 4R4IA 3AEVA 3FP9A 4IPHA 1N33L 4AIMA 4OWWB 1V1QA 2KCTA 1UE1A 4DR1Q 3F1ZA 4KHZA 1SE8A 1SN8A 5LMNQ 3H0GH 1XMQL 2UU9Q 1X56A 4DR6Q 4DV5L 5LMNL 1TWGH 4YWLA 1DGSA 1OXXK 2JA7G 4OONA 5M5YH 2C35B 1HNZL 1C0AA 4C3HH 3PUVA 4BXXH 5IYDH 3GO5A 4FDBA 3NBHB 1PH6A 1G6PA 3JC66 5C0XG 4LFBQ 1CKMA 1C7YA 2OTLA 1GKHA 1WYDA 1IZ6A 1QVGA 1OTCA 1HZBA 5GAGC 3E9HA 3KYHC 2VW9A 3CCSA 1XPOA 1MKHA 1EIYB 1PYBA 3PF4A 2D0PA 2E5LL 3HOVG 1H95A 4LW1A 1VCIA 1YZ6A 1IXRA 1E1OA 5IE8A 1PV4A 3ER0A 2JEAI 4GS3A 5DLQE 1X6OA 4YHHL 3UDIA 1VQNA 2B63H 1CKOA 3PGZA 2K52A 2VZAA 1EIFA 4YWKA 4LF4L 4LF7Q 1XMQQ 4QQBX 4LF4Q 3CMAA 4LF7L 4A3BG 2RCNA 4JV5L 2WP8J 3M4QA 3PO2G 5M3FG 2JA7H 2Z6KA 1HZCA 1Q82C 2JA8H 3M3YH 4WJ4A 4HIDA 3CF5A 3EIVA 4XIGS 5IYCG 3FHWA 1IYJB 1SR3A 3GDEA 1PH3A 2JK8A 4B3SQ 1VQMA 1Y1VH 3GTOH 2KBNA 2H5XA 4LFBL 3S17H 3D31A 2A8VA 3NEMA 5AJ3L 1L0WA 2UXCL 2Z6KC 5AJ3Q 1C9OA 1IBKL 4DV6L 2UXCQ 2ZM6L 2NVQH 3S2DH 1CKNA 4GOPB 4A3DH 1U0LA 4DK6C 3M4PA 2CCZA 4A4IA 1VQCA 2BH8A 1UWVA 2GVAA 3H0GG 3HKZG 4LF5L 4JYAQ 1S72A 1X3EA 2B63G 4DV4L 2HIXA 2LSSA 2R92H 4BY7G 2NZHA 4DV3L 2MO0A 1Q8KA 5BR8Q 4GNXA 1N8RC 4DV4Q 4JI5L 4YHHQ 5C44G 4RMFA 5BR8L 4IOCA 3CW2C 1B70B 1HNXQ 4JBMA 4DAYB 2LXJA 2UUCQ 3GTQH 5EAYA 1N32Q 4DV1L 3U50C 3T1YQ 3AYHB 1O7IA 4A3MH 1KIXA 3T1YL 3OYYA 1EOVA 4JI2Q 4JV5Q 1YHQA 3D0FA 3CXCA 4A3EG 5C0XI 5C0XJ 2FXQA 3TRZA 1Q1BA 3M4OH 2YTXA 2IHFA 2I5MX 4IO9A 1P16A 4NXNL 2OCEA 3RR5A 4DUZL 5IWAL 2K4KA 4B3SL 3CMEA 5GROA 5C44H 1JMCA 2ZJRA 5IWAQ 2QGQA 2XTIA 1OXVA 1NBWA 2N49A 4NB3A 1VQDA 1I94Q 1K73C 4JI0L 2RHQB 3E9IA 1BVSA 1OXUA 4MNOA 4KHPL 2YYZA 3ICEA 3S1NH 4A3LH 2VQFL 4DR3Q 1GO3E 1GVPA 3U4VA 2IX1A 1KRTA 4QGUA 4JYAL 4IFDG 4R1JA 4LF5Q 2UUBQ 1VQEA 1G291 1YI2A 2GN5A 3PSIA 1VQJA 3GD7A 2VQEQ 2JA5H 3M9BA 1EYGA 2K5NA 2OQ0A 1VQPA 1X65A 1XNQL 4DV1Q 2VQEL 1N32L 3TEHB 1RL2A 1E7ZA 3BU2A 4AYBE 1L1OB 4X64Q 2E2JH 4LFAQ 4TVAB 1FJGQ 3CQZH 2Z0SA 2HIVA 2R7FA 4A3JH 5JJKA 4LF8L 3A0JA 3A5UA 2OWOA 3AQQA 4JI4L 1Q86C 4DV0Q 3CPWA 4DKAC 4A3KG 5JJIA 2AWNA 3TS2A 1I5FA 1VQ4A 1HNWQ 3A74A 2R92G 2OTJA 4NXML 1HZAA 3J81j 1IBMQ 1FVIA 1MJCA 1Q1EA 1Q46A 1K0RA 1V43A 1X3FA 2DUDA 3W1BA 5IP7G 3I55A 1X54A 4X62L 4DV2Q 3WWVA 4MZ9A 1HR0L 1HNZQ 4X62Q 3UE1A 1L1OA 4LUVA 3RZDH 3PUZA 1XMOL 2E2IH 4A3CH 3I4NG 4GLAC 1XMOQ 1AE2A 1PYSB 4PZ7A 4YCUA 1CKNB 2IT1A 2R6GA 4YY3Q 4GOPA 1SFOH 5M3FH 1LTLA 4LF9L 1VQIA 5LMNW 1YJWA 1XNQQ 3HOUH 1AH9A 3HOYG 1A62A 2R93G 4HIOA 1KRSA 3E0EA 2IX0A 1N36L 3AFQA 1BKBA 1S40A 4H02A 1NMGA 2PMZE 1P8LA 4L5TA 1YJNA 3K81C 1VQ7A 3HKSA 2VNUD 4A3FH 2UXDQ 2QA4A 3B6YA 3KF8B 1X3GA 1FGUA 5C4JH 3CCJA 1ASYA 5IYBG 1HH2P 1UE6A 4P74A 4DV0L 2Q2TA 3I4MG 1WOCA 2BH2A 1IBLL 3PO3G 3BZCA 2JJQA 2MQHA 4OX9Q 2ASBA 3S1QH 3GTLH 4DR7Q 5C3EG 2BA1A 3PUYA 5JJLA 4EQ5A 4DAMA 4OX9L 2B29A 1KC8C 1JB7A 4NXMQ 1LUZA 3J81c 3JAMc 2I0QA 2Q2UA 1M90C 3I4OA 2UU9L 4JI7L 4DR6L 3STBC 2K5VA 1LYLA 4DV2L 4JI7Q 4BBSG 1W2BA 4GN5A 3T1HQ 1VQ5A 1PH2A 3U58A 5IYDG 2EXDA 2RHSB 3HOXH 2IY5B 4DNIA 1SMXA 4YY3L 1I6HH 1HZ9A 4WJ3M 2Y0SE 4IFDI 3RLFA 2R7ZG 4K0KQ 3KLWA 2CFMA 1VQ6A 1E3PA 4C3JH 4LWCA 4DV6Q 1TWAH 4K0KL 1XTDA 2AWOA 2IHEA 3PF5A 1QVFA 4QIWE 1B8AA 1SROA 4LFCQ 4HJ7A 1I50H 3BZKA 4LFCL 1KD1C 3TQYA 1VQBA 3PO3H 2E5LQ 3FKIG 5FLMH 3K8AA 5HGQA 4QY7A 3PIOA 4A3IH 1D7QA 3HOWG 2VUMG 5M5XH 3PUWA 3J7A5 2ZTEA 4JI8Q 2D0OA 1CUKA 1NJIC 3J81i 3HOZH 3JAMi 3TS0A 1YHAA 1WCMG 3CCMA 4JOIA 3PUXA 2KHIA 4A3GG 3K7AH 3HFZB 3J80i 1YNXA 4JG2A 1UE7A 3PO2H 5C4XG 2PQAA 2OQKA 1HR0W 2WB1G 2WFWA 1Z47A 2VS1A 4QJFA 1XPRA 3KF6B 1XNRL 2ZJPA 1W3SA 4P73A 2RF4A 5IYCH 2EIFA 3CCRA 4A75A 1VQ9A 3HOXG 1VQAA 2R7ZH 1UEBA 5C3EH 3CCVA 1VQFA 4JOIC 4ME3A 4BY7H 1EFWA 2AHOB 3GTGH 5K36G 1VQKA 3HOZG 3UDGA 1XJVA 4B3MQ 3VDYA 4IPCA 1PH8A 5IT9c 1TWCH 4GNXB 2NN6G 2NZOA 1IBKQ 5GQOA 3DM3A 3L7ZC 2ZM6Q 1GM5A 4DR4L 2BA0A 4IJHA 4P72A 4TQUS 3RN2A 2VUMH 2UUAL 4OO1I 3PV0A 4JBWA 2K14A 4DK3C 3OW2A 4A93G 2MO1A 1ASZA 3RLNA 3S16H 3H15A 2MNAA 5E7NA 3CC7A 1BBWA 5M3MG 4YCWA 4X65L 1SLJA 2YTYA 4POFA 1JJ2A 2NVXH 1TWHH 3RN5A 4X65Q 2KCMA 3G6EA 4XTCS 1K9MC 2MFIA 3CC2A 4OXPA 2JA8G 4L5RC 1SRUA 1TWFH 4POGA 1FJGL 2XGTA 4JI6Q 4JI3L 2HHHL 3HOYH 1OXSC 4PZ6A 3HOUG 1Y1WH 1D8LA 3KDFB 4HJ9A 1M1KC 3KFUA 4NXNQ 2D62A 4IJLA 4GNXC 1N33Q 2F4VL 1RIPA 3LGJA 1NY4A 2HT1A 2CQOA 1Q7YC 1A0IA 2WB1E 3MXNB 2F4VQ 2N8NA 4DV7Q 4A3CG 2KENA 2F52A 1BBUA 1JE5A 1IBML 1Y14B 3H3VI 1KHIA 3I4MH 4B3RL 2NN6I 1YEZA 1MJEA 1QUQB 4UP8A 3I56A 2QEXA 1NE3A 1PFSA 1N34Q 4DR4Q 4DR3L 1YBYA 1PH4A 5JEAG 3GTKH 4O0AA 4A3JG 1J6QA 2HQLA 1CSQA 1K8AC 1G51A 2JA9A 1TXYA 4O2DA 3STBD 4DR5Q 4A3KH 1VQHA 1X9NA 4BXXG 1JJGA 4P71A 3KDFA 3BJUA 4LF9Q 1WJJA 2N78A 4A3EH 1OXTA 3MEFA 3G71A 1EUJA 3W1GA 3J80c 3I7FA 2E2HH 1N36Q 2A1AA 5FJ8H 4BBRG 2EQSA 3K7UC 4JI3Q 2VL6A 4EX5A 4LFAL 2NVTH 3HOWH 2UXDL 2Y0SG 1QVCA 4J15A 4C2MH 3K80C 3OTOQ 1S3OA 3CD6A 1K3RA 5GADC 4JI4Q 1K83H 1WCMH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QUQ A;  1MIU A;  2CKZ B;  4LF6 Q;  4UP7 A;  3I4N H;  2JA6 G;  5GAH C;  3FKI H;  5FLM G;  4LF6 L;  4DR7 L;  1KXL A;  4NPS A;  2K5H A;  1EWI A;  4DV7 L;  1VQ8 A;  4HJA A;  1K8G A;  2CWP A;  5JEA J;  3G4S A;  2A19 A;  1PH5 A;  3CCE A;  4R4C A;  2V1C C;  4L5S A;  2WAQ G;  4Y52 H;  1YVC A;  5IP9 G;  1YJ9 A;  3T1H L;  4DV5 Q;  2GVB A;  4LUO A;  1LM0 A;  1X55 A;  2KHJ A;  1UE5 A;  2Q2I A;  5ELO A;  3S2H H;  4IPD A;  3CCQ A;  2K50 A;  4R4Q A;  1CSP A;  1PH1 A;  4PZ8 A;  2L15 A;  3S24 A;  5IP7 H;  2ZTC A;  2YU9 H;  3ERS X;  1KL9 A;  2PI2 A;  3L2P A;  3EBE A;  4UY8 C;  3UE0 A;  3Q8D A;  2I5L X;  3KJO A;  5IP9 H;  3PCO B;  4C3I H;  3ULP A;  3CC4 A;  5C4X H;  1Z9F A;  4GN3 B;  3S15 H;  4A3M G;  3DLL A;  2AKW B;  1PH9 A;  3KF6 A;  4R4O A;  4MTN A;  4A3G H;  2ZTD A;  5IYB H;  3G48 A;  4Y7N H;  1I3Q H;  3ULJ A;  1VQL A;  2F3I A;  4BY1 H;  1PVO A;  2JA6 H;  3W5O A;  4JI8 L;  4JI5 Q;  1Q81 C;  1IBL Q;  1HNX L;  2NVY H;  3NEN A;  1VS0 A;  2R93 H;  1HJP A;  4OWT B;  2K75 A;  4GN4 B;  5ELN A;  1QZH A;  1PH7 A;  1T9H A;  3J7Z C;  1Y1W G;  1J5E Q;  2DGY A;  3F2D A;  4HJ5 A;  4GOP C;  4JI2 L;  3U4Z A;  1WI5 A;  1A63 A;  1IL2 A;  5H1S E;  1YIT A;  1QZG A;  4GKK Q;  5FJ8 G;  4DUZ Q;  2N3S A;  3UDX A;  2YTV A;  4A76 A;  4A93 H;  4JCV E;  4GKK L;  1YIJ A;  2CWA A;  2JEB I;  1PA6 A;  2UXB L;  4JC0 A;  3HKZ E;  4B3M L;  4DUY Q;  4YWM A;  2Q2H A;  2VY3 A;  2UXB Q;  4DUY L;  3ZJY C;  4JI0 Q;  4IPG A;  2YV5 A;  1B7Y B;  3CAM A;  4P75 A;  4BBS H;  1A8V A;  1E1T A;  4A3B H;  3GTP H;  4IOA A;  3CPF A;  4UP9 A;  1NTG A;  4A3D G;  3IRB A;  4DR2 L;  4GKJ L;  4B3T Q;  3S1M H;  3H3V H;  1L1O C;  4QL5 A;  4X6A H;  4B3T L;  2R7D A;  3F2B A;  1E22 A;  1NMF A;  1PHJ A;  4IFD J;  4DV3 Q;  4AH6 A;  2ID0 A;  3CP0 A;  3M85 A;  1WFQ A;  3KJP A;  3RZO H;  2PNH A;  4R4T A;  4KI0 A;  2UUC L;  2I5H A;  4YCV A;  3F2C A;  1J5E L;  4X64 L;  4JI6 L;  2ALY B;  2HHH Q;  2B3G A;  4GLX A;  4JI1 L;  4A3I G;  4HIM A;  5FLX c;  2PI2 E;  5HY6 A;  3KOJ A;  4PMW A;  3CCL A;  3L0O A;  3GTM H;  4LF8 Q;  2WAQ E;  1XNR Q;  3AFP A;  4DPG A;  5LMU L;  4BA1 I;  4AYB G;  4KLK A;  3M7N A;  1VQO A;  3K0X A;  3S1R H;  3RLO A;  1N9W A;  1HNW L;  5M3M H;  2ZJQ A;  2E8G A;  1YHB A;  4LNQ A;  4DR1 L;  1XPU A;  4L5Q A;  4BY1 G;  4B3R Q;  1I94 L;  1JJC B;  1EQQ A;  1E24 A;  4OO1 G;  1Y1V G;  1N34 L;  2PQA B;  4KHP Q;  2ATW A;  1L2F A;  4OWX B;  4HIK A;  1HR0 Q;  4A3L G;  3SGI A;  3F8T A;  5GAE C;  2VQF Q;  2JE6 I;  1V9P A;  3A5Z B;  3NEL A;  1Q12 A;  4HJ8 A;  4BBR H;  4DR2 Q;  4GKJ Q;  3I2Z A;  4X66 Q;  3CCU A;  4GLV B;  4DR5 L;  4AQY L;  5J3B A;  2UUA Q;  2UUB L;  4X66 L;  4AQY Q;  1R9T H;  3S14 H;  1KAW A;  1GD7 A;  4UPA A;  1KQS A;  1FL0 A;  4BA2 I;  4JBJ A;  5M5W H;  1EQR A;  3UDF A;  1VQG A;  3GTJ H;  4APV A;  3RNU A;  4RG1 A;  4JI1 Q;  4LUZ A;  3OTO L;  1JT8 A;  4ALP A;  2ES2 A;  2AMC B;  2LXK A;  3HOV H;  1U5K A;  2JQO A;  3ULL A;  3TRE A;  5LMU Q;  4A3F G;  3PIP A;  1AE3 A;  4PG3 A;  5IY0 A;  2JA5 G;  4JBK A;  3EN2 A;  4R4I A;  3AEV A;  3FP9 A;  4IPH A;  1N33 L;  4AIM A;  4OWW B;  1V1Q A;  2KCT A;  1UE1 A;  4DR1 Q;  3F1Z A;  4KHZ A;  1SE8 A;  1SN8 A;  5LMN Q;  3H0G H;  1XMQ L;  2UU9 Q;  1X56 A;  4DR6 Q;  4DV5 L;  5LMN L;  1TWG H;  4YWL A;  1DGS A;  1OXX K;  2JA7 G;  4OON A;  5M5Y H;  2C35 B;  1HNZ L;  1C0A A;  4C3H H;  3PUV A;  4BXX H;  5IYD H;  3GO5 A;  4FDB A;  3NBH B;  1PH6 A;  1G6P A;  3JC6 6;  5C0X G;  4LFB Q;  1CKM A;  1C7Y A;  2OTL A;  1GKH A;  1WYD A;  1IZ6 A;  1QVG A;  1OTC A;  1HZB A;  5GAG C;  3E9H A;  3KYH C;  2VW9 A;  3CCS A;  1XPO A;  1MKH A;  1EIY B;  1PYB A;  3PF4 A;  2D0P A;  2E5L L;  3HOV G;  1H95 A;  4LW1 A;  1VCI A;  1YZ6 A;  1IXR A;  1E1O A;  5IE8 A;  1PV4 A;  3ER0 A;  2JEA I;  4GS3 A;  5DLQ E;  1X6O A;  4YHH L;  3UDI A;  1VQN A;  2B63 H;  1CKO A;  3PGZ A;  2K52 A;  2VZA A;  1EIF A;  4YWK A;  4LF4 L;  4LF7 Q;  1XMQ Q;  4QQB X;  4LF4 Q;  3CMA A;  4LF7 L;  4A3B G;  2RCN A;  4JV5 L;  2WP8 J;  3M4Q A;  3PO2 G;  5M3F G;  2JA7 H;  2Z6K A;  1HZC A;  1Q82 C;  2JA8 H;  3M3Y H;  4WJ4 A;  4HID A;  3CF5 A;  3EIV A;  4XIG S;  5IYC G;  3FHW A;  1IYJ B;  1SR3 A;  3GDE A;  1PH3 A;  2JK8 A;  4B3S Q;  1VQM A;  1Y1V H;  3GTO H;  2KBN A;  2H5X A;  4LFB L;  3S17 H;  3D31 A;  2A8V A;  3NEM A;  5AJ3 L;  1L0W A;  2UXC L;  2Z6K C;  5AJ3 Q;  1C9O A;  1IBK L;  4DV6 L;  2UXC Q;  2ZM6 L;  2NVQ H;  3S2D H;  1CKN A;  4GOP B;  4A3D H;  1U0L A;  4DK6 C;  3M4P A;  2CCZ A;  4A4I A;  1VQC A;  2BH8 A;  1UWV A;  2GVA A;  3H0G G;  3HKZ G;  4LF5 L;  4JYA Q;  1S72 A;  1X3E A;  2B63 G;  4DV4 L;  2HIX A;  2LSS A;  2R92 H;  4BY7 G;  2NZH A;  4DV3 L;  2MO0 A;  1Q8K A;  5BR8 Q;  4GNX A;  1N8R C;  4DV4 Q;  4JI5 L;  4YHH Q;  5C44 G;  4RMF A;  5BR8 L;  4IOC A;  3CW2 C;  1B70 B;  1HNX Q;  4JBM A;  4DAY B;  2LXJ A;  2UUC Q;  3GTQ H;  5EAY A;  1N32 Q;  4DV1 L;  3U50 C;  3T1Y Q;  3AYH B;  1O7I A;  4A3M H;  1KIX A;  3T1Y L;  3OYY A;  1EOV A;  4JI2 Q;  4JV5 Q;  1YHQ A;  3D0F A;  3CXC A;  4A3E G;  5C0X I;  5C0X J;  2FXQ A;  3TRZ A;  1Q1B A;  3M4O H;  2YTX A;  2IHF A;  2I5M X;  4IO9 A;  1P16 A;  4NXN L;  2OCE A;  3RR5 A;  4DUZ L;  5IWA L;  2K4K A;  4B3S L;  3CME A;  5GRO A;  5C44 H;  1JMC A;  2ZJR A;  5IWA Q;  2QGQ A;  2XTI A;  1OXV A;  1NBW A;  2N49 A;  4NB3 A;  1VQD A;  1I94 Q;  1K73 C;  4JI0 L;  2RHQ B;  3E9I A;  1BVS A;  1OXU A;  4MNO A;  4KHP L;  2YYZ A;  3ICE A;  3S1N H;  4A3L H;  2VQF L;  4DR3 Q;  1GO3 E;  1GVP A;  3U4V A;  2IX1 A;  1KRT A;  4QGU A;  4JYA L;  4IFD G;  4R1J A;  4LF5 Q;  2UUB Q;  1VQE A;  1G29 1;  1YI2 A;  2GN5 A;  3PSI A;  1VQJ A;  3GD7 A;  2VQE Q;  2JA5 H;  3M9B A;  1EYG A;  2K5N A;  2OQ0 A;  1VQP A;  1X65 A;  1XNQ L;  4DV1 Q;  2VQE L;  1N32 L;  3TEH B;  1RL2 A;  1E7Z A;  3BU2 A;  4AYB E;  1L1O B;  4X64 Q;  2E2J H;  4LFA Q;  4TVA B;  1FJG Q;  3CQZ H;  2Z0S A;  2HIV A;  2R7F A;  4A3J H;  5JJK A;  4LF8 L;  3A0J A;  3A5U A;  2OWO A;  3AQQ A;  4JI4 L;  1Q86 C;  4DV0 Q;  3CPW A;  4DKA C;  4A3K G;  5JJI A;  2AWN A;  3TS2 A;  1I5F A;  1VQ4 A;  1HNW Q;  3A74 A;  2R92 G;  2OTJ A;  4NXM L;  1HZA A;  3J81 j;  1IBM Q;  1FVI A;  1MJC A;  1Q1E A;  1Q46 A;  1K0R A;  1V43 A;  1X3F A;  2DUD A;  3W1B A;  5IP7 G;  3I55 A;  1X54 A;  4X62 L;  4DV2 Q;  3WWV A;  4MZ9 A;  1HR0 L;  1HNZ Q;  4X62 Q;  3UE1 A;  1L1O A;  4LUV A;  3RZD H;  3PUZ A;  1XMO L;  2E2I H;  4A3C H;  3I4N G;  4GLA C;  1XMO Q;  1AE2 A;  1PYS B;  4PZ7 A;  4YCU A;  1CKN B;  2IT1 A;  2R6G A;  4YY3 Q;  4GOP A;  1SFO H;  5M3F H;  1LTL A;  4LF9 L;  1VQI A;  5LMN W;  1YJW A;  1XNQ Q;  3HOU H;  1AH9 A;  3HOY G;  1A62 A;  2R93 G;  4HIO A;  1KRS A;  3E0E A;  2IX0 A;  1N36 L;  3AFQ A;  1BKB A;  1S40 A;  4H02 A;  1NMG A;  2PMZ E;  1P8L A;  4L5T A;  1YJN A;  3K81 C;  1VQ7 A;  3HKS A;  2VNU D;  4A3F H;  2UXD Q;  2QA4 A;  3B6Y A;  3KF8 B;  1X3G A;  1FGU A;  5C4J H;  3CCJ A;  1ASY A;  5IYB G;  1HH2 P;  1UE6 A;  4P74 A;  4DV0 L;  2Q2T A;  3I4M G;  1WOC A;  2BH2 A;  1IBL L;  3PO3 G;  3BZC A;  2JJQ A;  2MQH A;  4OX9 Q;  2ASB A;  3S1Q H;  3GTL H;  4DR7 Q;  5C3E G;  2BA1 A;  3PUY A;  5JJL A;  4EQ5 A;  4DAM A;  4OX9 L;  2B29 A;  1KC8 C;  1JB7 A;  4NXM Q;  1LUZ A;  3J81 c;  3JAM c;  2I0Q A;  2Q2U A;  1M90 C;  3I4O A;  2UU9 L;  4JI7 L;  4DR6 L;  3STB C;  2K5V A;  1LYL A;  4DV2 L;  4JI7 Q;  4BBS G;  1W2B A;  4GN5 A;  3T1H Q;  1VQ5 A;  1PH2 A;  3U58 A;  5IYD G;  2EXD A;  2RHS B;  3HOX H;  2IY5 B;  4DNI A;  1SMX A;  4YY3 L;  1I6H H;  1HZ9 A;  4WJ3 M;  2Y0S E;  4IFD I;  3RLF A;  2R7Z G;  4K0K Q;  3KLW A;  2CFM A;  1VQ6 A;  1E3P A;  4C3J H;  4LWC A;  4DV6 Q;  1TWA H;  4K0K L;  1XTD A;  2AWO A;  2IHE A;  3PF5 A;  1QVF A;  4QIW E;  1B8A A;  1SRO A;  4LFC Q;  4HJ7 A;  1I50 H;  3BZK A;  4LFC L;  1KD1 C;  3TQY A;  1VQB A;  3PO3 H;  2E5L Q;  3FKI G;  5FLM H;  3K8A A;  5HGQ A;  4QY7 A;  3PIO A;  4A3I H;  1D7Q A;  3HOW G;  2VUM G;  5M5X H;  3PUW A;  3J7A 5;  2ZTE A;  4JI8 Q;  2D0O A;  1CUK A;  1NJI C;  3J81 i;  3HOZ H;  3JAM i;  3TS0 A;  1YHA A;  1WCM G;  3CCM A;  4JOI A;  3PUX A;  2KHI A;  4A3G G;  3K7A H;  3HFZ B;  3J80 i;  1YNX A;  4JG2 A;  1UE7 A;  3PO2 H;  5C4X G;  2PQA A;  2OQK A;  1HR0 W;  2WB1 G;  2WFW A;  1Z47 A;  2VS1 A;  4QJF A;  1XPR A;  3KF6 B;  1XNR L;  2ZJP A;  1W3S A;  4P73 A;  2RF4 A;  5IYC H;  2EIF A;  3CCR A;  4A75 A;  1VQ9 A;  3HOX G;  1VQA A;  2R7Z H;  1UEB A;  5C3E H;  3CCV A;  1VQF A;  4JOI C;  4ME3 A;  4BY7 H;  1EFW A;  2AHO B;  3GTG H;  5K36 G;  1VQK A;  3HOZ G;  3UDG A;  1XJV A;  4B3M Q;  3VDY A;  4IPC A;  1PH8 A;  5IT9 c;  1TWC H;  4GNX B;  2NN6 G;  2NZO A;  1IBK Q;  5GQO A;  3DM3 A;  3L7Z C;  2ZM6 Q;  1GM5 A;  4DR4 L;  2BA0 A;  4IJH A;  4P72 A;  4TQU S;  3RN2 A;  2VUM H;  2UUA L;  4OO1 I;  3PV0 A;  4JBW A;  2K14 A;  4DK3 C;  3OW2 A;  4A93 G;  2MO1 A;  1ASZ A;  3RLN A;  3S16 H;  3H15 A;  2MNA A;  5E7N A;  3CC7 A;  1BBW A;  5M3M G;  4YCW A;  4X65 L;  1SLJ A;  2YTY A;  4POF A;  1JJ2 A;  2NVX H;  1TWH H;  3RN5 A;  4X65 Q;  2KCM A;  3G6E A;  4XTC S;  1K9M C;  2MFI A;  3CC2 A;  4OXP A;  2JA8 G;  4L5R C;  1SRU A;  1TWF H;  4POG A;  1FJG L;  2XGT A;  4JI6 Q;  4JI3 L;  2HHH L;  3HOY H;  1OXS C;  4PZ6 A;  3HOU G;  1Y1W H;  1D8L A;  3KDF B;  4HJ9 A;  1M1K C;  3KFU A;  4NXN Q;  2D62 A;  4IJL A;  4GNX C;  1N33 Q;  2F4V L;  1RIP A;  3LGJ A;  1NY4 A;  2HT1 A;  2CQO A;  1Q7Y C;  1A0I A;  2WB1 E;  3MXN B;  2F4V Q;  2N8N A;  4DV7 Q;  4A3C G;  2KEN A;  2F52 A;  1BBU A;  1JE5 A;  1IBM L;  1Y14 B;  3H3V I;  1KHI A;  3I4M H;  4B3R L;  2NN6 I;  1YEZ A;  1MJE A;  1QUQ B;  4UP8 A;  3I56 A;  2QEX A;  1NE3 A;  1PFS A;  1N34 Q;  4DR4 Q;  4DR3 L;  1YBY A;  1PH4 A;  5JEA G;  3GTK H;  4O0A A;  4A3J G;  1J6Q A;  2HQL A;  1CSQ A;  1K8A C;  1G51 A;  2JA9 A;  1TXY A;  4O2D A;  3STB D;  4DR5 Q;  4A3K H;  1VQH A;  1X9N A;  4BXX G;  1JJG A;  4P71 A;  3KDF A;  3BJU A;  4LF9 Q;  1WJJ A;  2N78 A;  4A3E H;  1OXT A;  3MEF A;  3G71 A;  1EUJ A;  3W1G A;  3J80 c;  3I7F A;  2E2H H;  1N36 Q;  2A1A A;  5FJ8 H;  4BBR G;  2EQS A;  3K7U C;  4JI3 Q;  2VL6 A;  4EX5 A;  4LFA L;  2NVT H;  3HOW H;  2UXD L;  2Y0S G;  1QVC A;  4J15 A;  4C2M H;  3K80 C;  3OTO Q;  1S3O A;  3CD6 A;  1K3R A;  5GAD C;  4JI4 Q;  1K83 H;  1WCM H; 
#chains in the Genus database with same CATH topology
 2TSS A;  1IOV A;  4CHT B;  3ERQ A;  2G9D A;  2JA6 G;  3MTS A;  3VR3 A;  4RH6 A;  4NPS A;  4DV7 L;  3FEW X;  1VQ8 A;  1HUM A;  1ZET A;  2A19 A;  1ZXT A;  1PH5 A;  2V1C C;  1JXL A;  1HNX H;  4HSV A;  1YJ9 A;  1SYB A;  3P75 A;  1X55 A;  2KHS A;  3RTX A;  1UE5 A;  1D1I A;  2PN1 A;  2ASJ A;  1WTW A;  2F0F A;  1A3T A;  4IPD A;  2VPS A;  3NP8 A;  1PH1 A;  4XX0 B;  3GTO A;  2F0N A;  1E0B A;  4CKC A;  1Y8O B;  2F0U A;  2PI2 A;  5CMD A;  4PNY A;  3EBE A;  4KN7 C;  4UAI A;  3G8C A;  1SDF A;  2DWC A;  4QWB A;  4C5A A;  3ETJ A;  3Q8D A;  5LMU H;  2FP4 B;  3KJO A;  3S15 H;  2JYO A;  5A2Q L;  3F2U A;  1QNU A;  4JI1 H;  4A3G H;  3M4O B;  1F9R A;  1HPC A;  2ZTD A;  5IYB H;  2Q8R E;  5I2X A;  4PDB A;  1I3Q H;  2R92 A;  4BY1 H;  3URY A;  4EFE A;  3W5O A;  2E2J B;  1X32 A;  1Q81 C;  1LTI D;  1IBL Q;  4YB8 B;  5ELN A;  4GN4 B;  1LLR D;  2QKI C;  1T9H A;  2NVY A;  4A3G B;  4JI2 L;  5BN3 A;  4JUZ A;  3GIK A;  1EY8 A;  1B6S A;  1A63 A;  4J9M A;  2Q8I B;  4LFB H;  5J2T F;  2L11 A;  5H1S E;  1K1S A;  4IAL A;  2V58 A;  4DUZ Q;  1KJ9 A;  3TIN A;  5JUM A;  1CQV A;  1S5D D;  3UDX A;  4A76 A;  2PCF B;  2EYF A;  4GKK L;  5KT2 A;  2JEB I;  4HQ6 A;  3HKZ E;  5CV9 A;  3NXW A;  2VY3 A;  2EXZ A;  3G6X A;  2PYK A;  3DEO A;  4JI0 Q;  4YJ2 F;  1ZEQ X;  2YV5 A;  1E4E A;  1E1T A;  4FXD A;  4CGY B;  3VPB A;  2ICI A;  5BPH A;  4A3D G;  2Z4H A;  3KK7 A;  1ULZ A;  4DR2 L;  4FP5 D;  2R7Z B;  4M9U A;  5D8D A;  4DV2 H;  1NMF A;  3V2T A;  4IFD J;  4C5B A;  4DV3 Q;  4AH6 A;  2ID0 A;  1U9R A;  4R4T A;  2LKV A;  2I5H A;  3VYU A;  2A6E D;  1E2W A;  2W9A A;  4X64 L;  2ALY B;  2LY7 A;  4HIM A;  3OHX C;  2FMC A;  2PI2 E;  3KOJ A;  5FO9 B;  3CCL A;  3GTM H;  4DPG A;  2VXW A;  2E74 C;  4MTK A;  4NMZ A;  1RYR A;  2KEE A;  2K7V A;  4AYB G;  2C28 A;  1F9Q A;  2R7K A;  4KLK A;  5EPK A;  2FLL A;  4JI3 H;  5F9N A;  5M3M H;  4RB2 C;  4LNQ A;  1IKM A;  4A2B A;  3E6Z X;  4IUT A;  5IOC A;  4B3R Q;  2B2U C;  1E24 A;  5KFI A;  2ATW A;  2EJF C;  2VUG A;  5H80 A;  4ECS A;  5GAE C;  1V9P A;  2YS6 A;  1Q12 A;  5JPM C;  4DR2 Q;  1BDO A;  3I2Z A;  4AQY L;  3HOW B;  1PDQ A;  3FPU B;  2UUB L;  3GLK A;  2F3V A;  2JXM B;  1R9T H;  1PRT D;  3S14 H;  1TWF A;  3PQI A;  3R5X A;  1GUG A;  2DPJ A;  2PMZ B;  3N44 B;  2QW7 A;  4G3I A;  3GQB A;  1VQG A;  5I4D A;  3GIL A;  5DQI A;  5KFA A;  1SFO A;  4RG1 A;  1D5Z C;  3OTO L;  5KFD A;  4R8I A;  2D2C C;  3PIP 3;  1JT8 A;  4EYH B;  4PV1 C;  1AZP A;  3HOV H;  2JQO A;  5M5X B;  3K58 A;  1AE3 A;  1EQV A;  3MXP A;  1GUS A;  2RCF A;  5M5W B;  3J80 W;  5EPL A;  4AIM A;  4ZHQ F;  3QOL A;  5KFH A;  1L0Y B;  2W70 A;  5EQ0 A;  3M3Y B;  4KHZ A;  3NWT A;  2ZXR A;  1SE8 A;  1SN8 A;  3OUU A;  5KT5 A;  4DV5 L;  2AUJ D;  3MR2 A;  1DGS A;  4A3J B;  3NTH A;  4OON A;  2UU9 H;  3VR4 A;  2FLN A;  4C3H H;  3PUV A;  3GO5 A;  4FDB A;  1I4P A;  3NBH B;  4Q45 A;  3RUZ A;  2XGP A;  1BGW A;  2J6T A;  2ICE C;  2R7Z A;  1S5B D;  3OIP A;  2C9O A;  1J8I A;  5KIX A;  4JI6 H;  1GKH A;  4A3I B;  3WDN A;  5IOD A;  1QVG A;  4R8U B;  1S0N A;  1OTC A;  5GAG C;  1RF2 D;  1H9S A;  1RD9 D;  3CCS A;  5KKN B;  2K05 A;  5CV6 A;  1PYB A;  3SK6 A;  1EIY B;  4TQR A;  3IN5 A;  2W7O A;  1ESR A;  1H95 A;  2TMP A;  2F0W A;  4DV7 H;  1A9X A;  5IE8 A;  4DV0 H;  3K6O A;  2B63 A;  3ER0 A;  5CGK A;  1DXM A;  5ELD A;  4YHH L;  3LWU A;  2YRX A;  3T5H A;  1RCV D;  4YWK A;  1EIF A;  3QFF A;  4LF7 Q;  5KFG A;  1I50 B;  4LF4 Q;  3CMA A;  1XMO H;  1JWS D;  2MHV A;  2Z6K A;  1HZC A;  1EYZ A;  2ASL A;  4YAK B;  4Q0F A;  3CF5 A;  3MXG A;  4XIG S;  5HUR A;  4F87 A;  2FK3 A;  3EQL C;  3GTO H;  2KBN A;  1M6V A;  4RGT A;  4I65 A;  3D31 A;  3NEM A;  4G7Z C;  3LML A;  2UXD H;  5E4X A;  3VR6 A;  2HDL A;  3ORR A;  4WBN F;  2J0T D;  5KFT A;  2V59 A;  2UXC Q;  2NVQ H;  5DGA A;  4OIK A;  1LTS D;  3CRL C;  1E2V A;  1U0L A;  4CDC C;  5KFF A;  1G2S A;  3M4P A;  2CCZ A;  3LWE A;  2A6H C;  2RGR A;  4XYO A;  2WB1 B;  4LF5 L;  2HIX A;  5BR8 Q;  3ERO A;  4DV4 Q;  3X3N A;  4YHH Q;  4RMF A;  1LTG D;  1B70 B;  1HNX Q;  1IYU A;  2UUC Q;  3I4N B;  5FPO A;  5J22 A;  3AYH B;  1O7I A;  5EOY A;  3T1Y L;  3PZP A;  1EOV A;  2F0H A;  1YHQ A;  2EY6 A;  4A3E G;  5C0X I;  3KUP A;  2YTX A;  2IHF A;  2I5M X;  2OCE A;  2RSO A;  2EYM A;  4MV8 A;  5GRO A;  5C44 H;  3TME A;  3FPP A;  5IWA Q;  3TQ1 A;  4DK1 A;  2YRW A;  1OXV A;  2R7M A;  2R86 A;  3PR4 A;  4KJN A;  3BDL A;  1VQD A;  1K73 C;  1D2B A;  3PW0 A;  5I2Y A;  5J2U F;  3E9I A;  1BVS A;  2NTT A;  3NBH A;  4KHP L;  3TZU A;  5KFL A;  4MV4 A;  4APM A;  3S1N H;  3IFD A;  4A3L H;  1ICW A;  5KFV A;  3DMU A;  3KHL A;  2XWJ B;  4IFD G;  4LF5 Q;  5C44 B;  1BBX C;  1H9S B;  3H4D A;  1J9O A;  4ECU A;  3I70 A;  4OIJ A;  3PR5 B;  2ZDQ A;  2JA5 H;  4J0M A;  4X64 H;  1VQP A;  1DD2 A;  1D6E C;  3Q6S A;  1IW7 C;  4LFA Q;  1YNJ D;  2B2W A;  2PW7 A;  2Z0S A;  2WKC A;  4MAM A;  2HIV A;  4A3J H;  4LF8 L;  4LFA H;  1W93 A;  3AQQ A;  4ECQ A;  3V05 A;  2NVX B;  5JJI A;  5G3L D;  2KOL A;  5KG4 A;  3J7A F;  2C2D A;  4C2M A;  2BOS A;  3IFT A;  1HNW Q;  4WRD A;  2VUM A;  1LT5 D;  1CZG A;  1EU3 A;  2VR1 A;  2XC9 A;  1MJC A;  3I55 A;  1K0R A;  4Q0Y A;  3OSN A;  2FIN B;  1PZK D;  3WWV A;  2K5W A;  1HR0 L;  5NUC A;  1Q8I A;  4RCN A;  3RZD H;  1L1O A;  1XMO L;  2E2I H;  4O3Q A;  1N48 A;  1X3P A;  3TP8 A;  4DL3 A;  3TP5 A;  5ELE A;  5C0X H;  2R6G A;  3QO2 A;  3G6V A;  2QCP X;  5LXT F;  3CRK C;  4LF9 L;  1VQI A;  5LMN W;  1YJW A;  2FJZ A;  3H0G B;  1ONL A;  1EL0 A;  4RU9 A;  3HOY G;  1A62 A;  2M2L A;  4P2C B;  4ZUI A;  3N52 A;  1KRS A;  2QDB A;  4C56 C;  1N36 L;  3KBX A;  4X3U A;  1NMG A;  3HKS A;  1FGU A;  4E4T A;  1ASY A;  2XGQ A;  1PLF A;  3I4M G;  4P74 A;  4DL7 A;  1AZQ A;  1WOC A;  1VBG A;  2F0M A;  1QIL A;  4KV6 A;  2BH2 A;  1TWG A;  2L5T A;  2IL8 A;  1S9F A;  2F4V H;  4A93 B;  3S1Q H;  4FF1 A;  2JA6 A;  1M7J A;  4XYM B;  2W9B A;  1LUZ A;  3T1H H;  3KLR A;  1M90 C;  3I4O A;  2UU9 L;  4OX9 H;  4GZY C;  4BBS G;  1U4L A;  1W2B A;  3D8G A;  2WAC A;  4UCU A;  3UI2 A;  3DM1 A;  1U4P A;  2EXD A;  2SDF A;  4I7Z C;  4KD3 A;  1VAJ A;  2RDF A;  2Z8L A;  4RAY A;  1B9N A;  4XQQ A;  3LNN A;  3RLF A;  3F8N A;  1E3P A;  4J8Q A;  3NK9 A;  5KFK A;  1WCM A;  5K5P A;  4OGQ C;  2IHE A;  3PF5 A;  1HCZ A;  2A69 D;  1QVF A;  2H1E A;  5CV4 A;  4LFC Q;  3BDC A;  5D65 A;  4RNN A;  3BZK A;  1KD1 C;  3A7L A;  4IUV A;  3PO3 H;  4HAE A;  5IGF A;  3K8A A;  1GLV A;  1B4O A;  2Y0S A;  3W2D A;  3QWN A;  4A3I H;  1D7Q A;  3HOW G;  5M5X H;  5JH7 F;  3J7A 5;  5L1J A;  4IRK A;  1DCZ A;  2HCC A;  1CUK A;  2EYL A;  3TS0 A;  4AQY H;  3CCM A;  4IQZ A;  4JOI A;  5DGB A;  1NCV A;  4K2K A;  4A3G G;  4IAJ A;  4JG2 A;  3PO2 H;  3GTM A;  2OQK A;  2YS7 A;  4ZKB B;  2MP1 A;  2XCL A;  1XPR A;  1XNR L;  3KF6 B;  2RF4 A;  5IYC H;  1VQ9 A;  4RB3 C;  4FU0 A;  3J80 L;  3HOX G;  1IL8 A;  2HD3 A;  3Q22 A;  5DNF A;  4MTD A;  4KJO A;  2C2R A;  5K36 G;  1KLU D;  1XJV A;  3AU7 A;  4CKE A;  4X3T A;  2PPB C;  3VDY A;  4K6L A;  2PMZ A;  1IBM H;  2NN6 G;  2NZO A;  1IBK Q;  3NPP A;  3T13 A;  1PMR A;  4IUU A;  2F0O A;  2ZM6 Q;  1B44 D;  1GM5 A;  1S4Z A;  4IJH A;  2R8H A;  3G6J B;  4JBW A;  4DK3 C;  5K2M A;  4A93 G;  3MC0 B;  1BBW A;  5DM6 3;  2A68 D;  2YTY A;  4ZOL F;  1UNS A;  1TWH H;  2JA8 G;  4X65 Q;  3G6E A;  3CC2 A;  4L5R C;  1SRU A;  1TWF H;  1FJG L;  1EYD A;  2CZG A;  1AW7 A;  1V1P B;  1MHW C;  4PZ6 A;  3HOU G;  1A15 A;  1D8L A;  1O80 A;  3J7A V;  1X3Q A;  2W9B B;  3KFU A;  4NXN Q;  2D62 A;  4FF4 A;  3C1F A;  1N33 Q;  4I55 F;  1RIP A;  3LGJ A;  2HT1 A;  4RFB A;  4JK1 C;  4C3I G;  2N8N A;  5DG7 A;  4TRD A;  5EWF A;  1IBM L;  1SNQ A;  2K04 A;  1Y14 B;  4A3E B;  4JV1 A;  2AQ3 B;  3OHA A;  4B3R L;  1A6X A;  4GC7 A;  4UP8 A;  3I56 A;  1PFS A;  3EPG A;  1PH4 A;  4MV7 A;  4O0A A;  4A3J G;  1J6Q A;  1B6R A;  1CSQ A;  2C00 A;  4BXX G;  2R84 A;  1NSN S;  1JJG A;  1WJJ A;  1DZ1 A;  3MWY W;  1OXT A;  1RHP A;  3J80 c;  2WII B;  2PZW A;  5FJ8 H;  1EQT A;  3K7U C;  4JI4 H;  2VL6 A;  3DHQ A;  2UXD L;  4IFD H;  2Y0S G;  3CQZ A;  4IWY A;  4C2M H;  3OTO Q;  4IWX A;  3K80 C;  4CDE C;  3Q8Q B;  3V4Z A;  4JI4 Q;  1K83 H;  2RGV A;  4EFB A;  2ZXP A;  1WCM H;  4UP7 A;  2QDL A;  4ED6 A;  4LF6 L;  2FFK B;  3RGZ A;  4EVO A;  4DR7 L;  1KXL A;  2K5H A;  1EWI A;  5IYZ F;  3HG9 A;  2E5L H;  1V8Q A;  2CWP A;  3G4S A;  1BNZ A;  4R4C A;  1S03 G;  2C2E A;  1ZHQ A;  4LMQ D;  5IP9 G;  1H9R A;  1LTT D;  1HA5 A;  4DV5 Q;  4JI8 H;  2GVB A;  4LUO A;  1EWH A;  2IJ0 A;  2VQF H;  2C5C A;  3S2H H;  3CCQ A;  4IN3 A;  2JA7 A;  3MFG A;  2XSC A;  2J4X A;  2L15 A;  5IP7 H;  3KXY T;  5BN5 A;  1I4G A;  5CAE B;  3ERS X;  3L2P A;  2MUY A;  5CA1 F;  4UY8 C;  5CBA E;  3HRZ C;  5DQH A;  2W71 A;  2A73 B;  1UNN C;  4GN3 B;  2ZDH A;  5KFX A;  4EBD A;  4A3M G;  5JAV A;  4R4O A;  4YIJ A;  1JOK A;  1T5E A;  2DNE A;  2QF7 A;  2Z9H A;  3G48 A;  3MZ5 A;  5I6W A;  3R23 A;  2PZT A;  1PVO A;  2JA6 H;  4JI5 Q;  4JI8 L;  4O3R A;  2F4I A;  3WO1 A;  4Q5V A;  3NEN A;  1I7N A;  3OMG A;  3GTG B;  1NJI C;  2K75 A;  3J7Z C;  2OH2 A;  2AQ2 B;  2OLS A;  1WD1 A;  5C4X B;  2OEO A;  3U4Z A;  1HFN A;  4GKK Q;  1OO9 B;  4A93 H;  4JCV E;  3S1N B;  1JKJ B;  1PTO D;  4JC0 A;  5ELF A;  2Q2H A;  5IGD A;  2AUK A;  4H44 C;  3ZJY C;  1L2Z A;  1B7Y B;  3RZO B;  2B2U A;  4BBS H;  1A8V A;  4EEY A;  2K6A A;  5M5Y B;  1R4Q B;  3GTP H;  4IOA A;  3RAQ A;  4J9K A;  4GKJ L;  5KYL A;  3HBL A;  5KFW A;  3FVQ A;  4ED0 A;  4QCL A;  4DR5 H;  1JLL B;  2A6H D;  3T51 B;  1KJ8 A;  1ZYR D;  3M85 A;  3KJP A;  1B50 A;  1KEE A;  4KI0 A;  2K1B A;  2UUC L;  5J1Z A;  4YCV A;  2I8C A;  4EGJ A;  2IA6 A;  4GLX A;  4MIU A;  5HY6 A;  4PMW A;  2KA7 A;  5C4H A;  4CJ0 B;  3MXU A;  5FD5 A;  2JEF A;  5EWG A;  1TT2 A;  4K2L A;  4UFZ A;  1Y1V A;  4IR9 A;  1T3N A;  1DM0 B;  3U9S A;  4DXF A;  1VQO A;  1BCP C;  3RLO A;  2JA7 B;  1EIH A;  2RBM A;  3Q8S B;  1BNC A;  1YHB A;  4KHP H;  3K5H A;  2NU7 B;  2H4O A;  4UDU C;  4BY1 G;  1JJC B;  4J9R A;  4IUR A;  3ND8 A;  4OO1 G;  4KHP Q;  5DM7 3;  1L2F A;  2NB0 A;  1IW7 D;  2KED A;  4CC6 A;  3NEL A;  4GKJ Q;  5F2D A;  4BBR H;  2UUA Q;  2UVR A;  4DR5 L;  5J3B A;  2R6F A;  4RHS A;  5T1I A;  4GKJ H;  3S1R B;  4DV4 H;  1KAW A;  4QIW A;  4C3I B;  5LA6 F;  4UPA A;  4BA2 I;  2F0S A;  2DNC A;  1PK8 A;  5D14 A;  4K6D A;  3RNU A;  5KFE A;  3S1Q B;  4DFA A;  4JI2 H;  1TU2 B;  3K5O A;  1KBL A;  2ES2 A;  2O03 A;  1EYC A;  3RB3 A;  5FLX E;  2EE1 A;  1C30 A;  3ULL A;  1GOZ A;  4J9O A;  3PIP A;  2JA5 G;  4GC6 A;  5IY0 A;  2BE5 D;  3FP9 A;  4R8U A;  1KLG D;  1V1Q A;  4OWW B;  5I9P A;  1GHK A;  4BY7 B;  2VOB A;  1I94 H;  1XMQ L;  3R93 A;  3H0G H;  1LTR D;  5E1F A;  5C3E B;  4DR6 Q;  4DLK A;  4YWL A;  1OXX K;  3BJY A;  3U9T A;  2JA7 G;  4DR6 H;  3K0Y A;  4A3B B;  1LAB A;  3HP3 A;  1SE3 A;  4BWG B;  3Q2O A;  1G6P A;  3JC6 6;  4ZCK A;  1PFB A;  2YCH A;  4JI0 H;  1C7Y A;  2OTL A;  2EY5 A;  3M4I A;  2W8L A;  1R4P B;  2VW9 A;  4R8N A;  2HJW A;  4HNU A;  1MKH A;  4ZAI A;  5KFO A;  2F0J A;  1TY0 A;  1STH A;  5CBE E;  2D0P A;  3HOV G;  3BAB A;  4RZR A;  1KTK A;  4LW1 A;  1SMY C;  2GLT A;  4UCT A;  1PV4 A;  4GS3 A;  1IKL A;  1ESF A;  5DLQ E;  3UDI A;  1VQN A;  1YNN D;  5LHY 1;  5A2Q W;  2WV6 D;  4LF4 L;  1FGB D;  1MZB A;  1XMQ Q;  2WKD A;  2CW7 A;  3R3O A;  2UVW A;  2VQD A;  2RCN A;  3SHL A;  2WB1 A;  4F8M A;  5M3F G;  4M7E A;  1XMQ H;  4O42 A;  4IUP A;  3QG1 A;  4HID A;  4ED7 A;  1C4Q A;  3GTP B;  1Z2P X;  1K8O A;  3FHW A;  4H0L C;  1SR3 A;  3GDE A;  1EZ1 A;  1PH3 A;  1Y1V H;  4MHE A;  2PW5 A;  2A8V A;  2FJ2 A;  1L0W A;  3HOZ B;  2Z6K C;  2UXC L;  3MR5 A;  1H9M A;  1C9O A;  5AJ3 Q;  1M0T A;  3OTO H;  1B53 A;  1BCP D;  2B2Y A;  3WOE A;  4ZKC B;  5KG3 A;  5C5L A;  2V5A A;  1CKN A;  4CKB A;  3I3C A;  3BZD B;  1F9S A;  3DXJ C;  1U4M A;  4U68 A;  2YYA A;  2BH8 A;  3HKZ G;  5EBD A;  1QWY A;  2B63 G;  3OSP A;  4DV4 L;  2L1B A;  5DAU A;  2NZH A;  1UC9 A;  1N32 H;  1Q8K A;  2EPB A;  1Z2O X;  5C4J B;  1KDB A;  1HRJ A;  4DAY B;  2LXJ A;  4WD3 A;  5LP6 F;  3T1Y Q;  4A3M H;  3GTQ A;  2B8G A;  1ICF B;  1Q1B A;  1TWH A;  4FVM A;  2BQ3 A;  1JB3 A;  1RDP D;  1W6K A;  2GPS A;  3D6C A;  3MJF A;  5IWA L;  3CME A;  2ZXO A;  2EYJ A;  4O4L F;  2ZJR A;  3G6Y A;  2QGQ A;  4J9Q A;  1NBW A;  2BR0 A;  4M8A A;  3TP6 A;  3K3P A;  4DL6 A;  3R5F A;  3N40 P;  2VQF L;  1L0X B;  2D5D A;  2NUA B;  3K5N A;  1I4H A;  3GTO B;  3CQZ B;  1KRT A;  4J9S A;  2PVP A;  1HTL D;  1DV1 A;  1G29 1;  1YI2 A;  1DV2 A;  3PSI A;  1VQJ A;  4WJW A;  1XDN A;  3VPD A;  1SNM A;  4EGQ A;  1EYG A;  1PRT F;  2XCP A;  2W9C A;  2K5N A;  2OQ0 A;  3VYR A;  2NUC A;  4IUN A;  4ZYS A;  2VQE L;  2IBK A;  4O2B F;  5KT3 A;  2OF1 A;  1L1O B;  2N88 A;  2E2J H;  2I46 A;  1FJG Q;  4DV1 H;  4ED2 A;  2B8F A;  4JV2 A;  4AYB B;  5JJK A;  2EDG A;  2HDM A;  1CI3 M;  4DV0 Q;  1Q86 C;  4DGZ A;  3BQ1 A;  5C5M A;  3WOF A;  2R61 A;  3K3V A;  4XT3 B;  1VQ4 A;  5COY A;  5FK9 C;  2OTJ A;  1HZA A;  1IBM Q;  1FVI A;  1Q46 A;  3W1B A;  4FS2 A;  3W3A A;  1W96 A;  2DUD A;  3A8J E;  1CM9 A;  2NU9 B;  2O5J C;  5EKI A;  4XQJ A;  2FK1 A;  2I87 A;  3T56 B;  1TQO A;  4KY5 A;  4ZRZ A;  1AN7 A;  3GV6 A;  2O4X A;  3PUZ A;  1TWC B;  4HCS A;  3T5K A;  2F0D A;  2JA6 B;  4YCU A;  1CKN B;  2IT1 A;  4YY3 Q;  2AGQ A;  1HTP A;  4EQP A;  3TDQ A;  4K8J A;  2CW0 C;  1AH9 A;  1S5E D;  3MFY A;  2WTF A;  1JWM D;  2UXC H;  1QOH A;  2DZD A;  3BVG A;  3E0E A;  3RUP A;  1BKB A;  2LMC B;  4H02 A;  4OHJ A;  4L5T A;  1EY4 A;  4B9X A;  1YJN A;  2VNU D;  1T36 A;  2UXD Q;  1VBH A;  2W6M A;  4JYA H;  3B6Y A;  3KF8 B;  1X3G A;  2XD4 A;  4ODG A;  3PN1 A;  4X3K A;  4DV0 L;  1WSC A;  3SI8 A;  2Q2T A;  4RNM A;  3Q1K A;  3PIO 3;  1IBL L;  3BZC A;  4DR4 H;  2MQH A;  1BOS A;  3NTI A;  2ASB A;  3S17 B;  1KJJ A;  4DR7 Q;  2UUC H;  1EWC A;  3PUY A;  3A56 A;  4I50 F;  4OX9 L;  3HZX A;  1KC8 C;  1JB7 A;  2Q2U A;  1BR9 A;  2JA5 A;  3PW5 A;  4YHH H;  1FD7 D;  4JI7 Q;  1B1Z A;  3DF7 A;  1VQ5 A;  3I91 A;  4IZ8 A;  1PH2 A;  3U58 A;  2CQY A;  2RHS B;  4O3O A;  5BMV F;  4EYI B;  2EVB A;  4YY3 L;  3PW7 A;  4IFD I;  2JEJ A;  1I4Q A;  3H3V C;  1VQ6 A;  2CFM A;  4IZO A;  4LWC A;  4DV6 Q;  1C48 A;  1TWA H;  4K0K L;  4ED8 A;  5JJZ A;  3BVZ A;  4X3S A;  4QIW E;  1BF4 A;  2M05 A;  1CHP D;  1A3V A;  5A2Q E;  2RDI A;  2HVS A;  2E5L Q;  2J6U A;  2L4N A;  5DG8 A;  2VUM G;  3EFX D;  3PUW A;  5F9L A;  2ZTE A;  4JI8 Q;  3J7Y W;  3MFH A;  3C2P A;  4DV5 H;  1HXY D;  2V4D A;  1YHA A;  4Y8V B;  1WCM G;  2XIG A;  4RGN A;  3J80 i;  3HFZ B;  4EGV A;  4O3N A;  2KCN A;  3GIM A;  2J6S A;  4I7H A;  2WFW A;  1KDA A;  1STN A;  2VS1 A;  2ZJP A;  3CCR A;  2R7Z H;  3CCV A;  4EQN A;  3KAJ A;  4ME3 A;  2R93 B;  4F4X A;  1EFI D;  4E6I A;  1RJQ A;  4DL2 A;  1DOK A;  2XIW A;  1TWC H;  3FRP B;  1LV9 A;  5GQO A;  5A35 A;  3BAA A;  5KG6 A;  4G7O C;  4XYL B;  4RAU C;  4L8J A;  4OO1 I;  3PV0 A;  4KMU C;  5I47 A;  1TS4 A;  4RA8 A;  1ASZ A;  3RLN A;  5K36 H;  2MNA A;  3CC7 A;  5KFJ A;  1LT4 D;  1ET6 A;  4HMI A;  4X65 L;  1EUD B;  1PYW D;  1S68 A;  4TUY F;  5KT6 A;  3L3O C;  2XRQ D;  2MFI A;  2A69 C;  3GTJ A;  1J5E H;  2XGT A;  1KJI A;  2XWB B;  5ISR A;  3I4L A;  4UCV A;  1S0M A;  3JAM W;  1EZ6 A;  1VMC A;  2GA4 B;  1WTR A;  1NY4 A;  3J7A K;  2F4V Q;  3GV7 B;  2KEN A;  2F52 A;  4I4T F;  4NXM H;  5T1G A;  3VMM A;  2N55 A;  1NAP A;  2QEJ C;  1PTO H;  3D3R A;  2EYO A;  3TP7 A;  4DR3 L;  5IGG A;  4RB0 A;  4C3J G;  1LTB D;  2VA3 A;  1S5F D;  1I4X A;  2F0E A;  1G51 A;  4DR5 Q;  1TXY A;  1K8A C;  4J1M A;  3STB D;  3H4B A;  1VQH A;  3KDF A;  2N78 A;  3OPO A;  4A3E H;  2A5H A;  1ENC A;  3MEF A;  1EUJ A;  1SNO A;  3GQC A;  3I7F A;  2E2H H;  3MXN A;  5IGE A;  4BBR G;  2EQS A;  1JDE A;  4EX5 A;  4PMC A;  1M8A A;  1EY9 A;  2RDH A;  4DF7 A;  2NVT H;  1QVC A;  4J15 A;  3NUC A;  1KJQ A;  4QB4 A;  3UQ8 A;  1QUQ A;  1MIU A;  4LF6 Q;  5D1O B;  2AQ4 A;  4LFC H;  5FLM G;  1TWF B;  5KGU A;  2JEI A;  4FS1 A;  4OO1 H;  1PZI D;  3BYT B;  4CJ1 B;  4FF2 A;  2W6Z A;  3NQT A;  5JEA J;  2AQ1 B;  3LP8 A;  2G9H D;  4L5S A;  3QB3 A;  1YVC A;  3I90 A;  5CYU A;  3T1H L;  2CHB D;  4EQO A;  4DU9 A;  1DIK A;  5ELO A;  2NU6 B;  3Q23 A;  2HQE A;  2J7Z A;  2D9U A;  2EZV A;  3PW4 A;  2K50 A;  1ET9 A;  3K57 A;  1JOO A;  2ZTC A;  1SE4 A;  1CZW A;  1KL9 A;  3KAL A;  1YNJ C;  4LH6 A;  1TVX A;  3UE0 A;  4ZLT F;  3S16 B;  2I5L X;  4ETS A;  3RB0 A;  5IWA H;  5IP9 H;  4C3I H;  1TWG B;  3CC4 A;  1V51 A;  1CTM A;  4KKU A;  1SJE D;  2RQX A;  1IHZ A;  2AKW B;  2EYH A;  1SYF A;  1PZJ D;  3E0J A;  3J80 E;  1MSG A;  3ULJ A;  3N43 B;  2F3I A;  4XXE A;  3TN2 A;  4TV9 F;  4QWA A;  3BYY B;  3HOY B;  1HNX L;  4DN4 M;  1QNK A;  1VS0 A;  2B2T A;  4OWT B;  3VYT A;  2KUM A;  3N6X A;  3DWQ A;  1BO0 A;  1Y1W G;  4JV0 A;  4GOP C;  5C8Y F;  5DQG A;  1B3Q A;  1WI5 A;  3H09 A;  1DOL A;  1ILQ A;  1EYA A;  1TWA A;  1VDZ A;  1YIT A;  3MAQ A;  3R5H A;  2E76 C;  4FXG C;  3PO3 B;  5KFS A;  5FJ8 G;  1TAE A;  3OUZ A;  1A2T A;  2N3S A;  3DEP A;  2YTV A;  2VUM B;  1XNQ H;  2YZN A;  1YIJ A;  4YWM A;  1ENA A;  3GTK B;  2UXB Q;  1XX8 A;  1JX4 A;  4RWS C;  4DUY L;  2F0K A;  1PXU A;  4IPG A;  1WR2 A;  1QB5 D;  4P75 A;  4WOR A;  1Y69 U;  4A3B H;  5D1P A;  4RUA A;  3PVX A;  1N34 H;  5CB4 F;  4UP9 A;  1VMP A;  3IRB A;  4YP3 A;  2NWG A;  2K01 A;  3S1M H;  3KHG A;  1RTN A;  3H3V H;  1L1O C;  4HED A;  4X6A H;  3WNZ A;  4B3T L;  2K28 A;  3F2B A;  1E22 A;  4DAP A;  1NNX A;  1Y1W B;  1CT1 D;  4ED3 A;  3RZO H;  2HHH H;  4U7C A;  2BE5 C;  1LAC A;  5KG1 A;  4R7R A;  4KY7 A;  2HHH Q;  4HN7 A;  5KND A;  4A3I G;  5FLX c;  5JQW A;  3EYY A;  3AB9 A;  4LF8 Q;  3RV4 A;  2NTS A;  4RGO S;  1KAA A;  4BA1 I;  3RJ0 A;  2F1M A;  1TWC A;  4O3P A;  4I7A A;  1V1O A;  3KLS X;  5KG2 A;  4B3S H;  1H9K A;  3S1R H;  1N9W A;  3NHH A;  5EPJ A;  1HNW L;  2HGS A;  4DR1 L;  1JE4 A;  4HR7 B;  1XPU A;  2IW3 A;  3KAK A;  4DNR B;  2W6Q A;  1Y1V G;  1N34 L;  2PQA B;  3BA8 A;  2ZT9 C;  4HIK A;  1HR0 Q;  4A3L G;  2VQF Q;  5JOB A;  4HYK A;  4HJ8 A;  3A5Z B;  1S0O A;  2NVT B;  3CCU A;  1HR0 H;  1CK1 A;  2K32 A;  3MWM A;  4X66 L;  4DR2 H;  3M7G A;  3X3M A;  1FL0 A;  5M5W H;  1EQR A;  2B63 B;  3JRX A;  3GTJ H;  4APV A;  4J6H A;  4LUZ A;  2V4Q A;  1RJT A;  4RHR A;  1MD2 D;  2OXP A;  3BQ2 A;  1SMY D;  2AMC B;  2G5D A;  2LXK A;  4U6P A;  3TRE A;  4A3F G;  2IPK D;  3A54 A;  4PG3 A;  3BS1 A;  4YR0 A;  3EN2 A;  1RJP A;  4IPH A;  2SCU B;  1FNV A;  2KCT A;  3NQI A;  1MSH A;  4DR1 Q;  4MV1 A;  3TQT A;  3MHB A;  2UUB H;  3DUZ A;  2UU9 Q;  3FDS A;  5LMN L;  4UCR A;  1TWG H;  5L37 A;  5JVH 3;  1CE8 A;  4UHV A;  4C3J B;  1SE2 A;  4RB1 A;  5M5Y H;  2C35 B;  1XTC D;  1SSO A;  3P20 A;  1C0A A;  3OHB A;  4BXX H;  5IYD H;  1PH6 A;  1RK5 A;  1FJG H;  5C0X G;  2KVM A;  5FO7 B;  1PTO C;  1WYD A;  1B9M A;  1GGO A;  3SEB A;  1IZ6 A;  3SE0 A;  3MA2 B;  2YW2 A;  3KYH C;  1UAP A;  5E4W C;  4JPB W;  1XYI A;  1PRT C;  1B04 A;  3CVZ A;  4B3T H;  3FKI A;  1HHV A;  3V6J A;  3ZYY X;  1VCI A;  1YZ6 A;  1EY5 A;  5JVD F;  2FLP A;  4MV6 A;  1GSH A;  5FD6 A;  3H40 A;  4CC5 A;  3EA6 A;  5KFU A;  3O13 A;  1CKO A;  3PGZ A;  2VZA A;  4H13 C;  3ETH A;  2X69 A;  1CA6 A;  2XRS D;  4LMY A;  2R7L A;  3RFC A;  4ILW A;  4ED1 A;  2WAQ B;  3NBI A;  4A3B G;  4C3H G;  4JV5 L;  3M4Q A;  1DON A;  4MV3 A;  5CA0 F;  5JVL A;  2Z4I A;  2PBZ A;  2JA7 H;  4WJ4 A;  3SDZ A;  3M3Y H;  4HR7 A;  2O5I C;  2QK4 A;  3TSS A;  1WTO A;  2FPI B;  4KKT A;  1IYJ B;  3OIQ A;  1FNU A;  4C5C A;  5DEH A;  1VQM A;  3GTQ B;  1N36 H;  1PFN A;  5L1L A;  5AJ3 L;  1JDB B;  1IBK L;  1TWH B;  2A6E C;  4DV6 L;  2DLN A;  2ZM6 L;  4A3D H;  4DK6 C;  4A4I A;  2GVA A;  4JYA Q;  1UWV A;  3H0G G;  3BA9 A;  5KFQ A;  2RDG A;  1X3E A;  1S72 A;  2LSS A;  1SYD A;  2R92 H;  1I3Q A;  5CC4 A;  2MO0 A;  1XWE A;  4GNX A;  3DWA A;  1EY0 A;  1C8C A;  3BG5 A;  5L1K A;  2MPM A;  1TWA B;  4JBM A;  4RKL A;  3GTQ H;  3K5I A;  4LH7 A;  5EAY A;  1WCM B;  2R7N A;  4CDD C;  4G4K A;  1ZYR C;  4JI2 Q;  4JV5 Q;  3EVQ A;  4MTE A;  2W6P A;  3ONA B;  3L4J A;  5IT9 W;  1TR5 A;  2L55 A;  3T53 B;  5IGC A;  3M4O H;  2PZU A;  1KDC A;  4IO9 A;  4NXN L;  4JV5 H;  4ME5 A;  4DUZ L;  5KYI A;  5C6A A;  3RV3 A;  2K4K A;  1Q90 A;  4XDX A;  1JMC A;  5LYJ F;  1I50 A;  2MCT A;  1SND A;  2XTI A;  3PO2 B;  4MA5 A;  4EBE A;  1BCP B;  1CQF A;  2N49 A;  2FPP B;  1I94 Q;  4YAJ B;  2ALZ A;  4JI0 L;  1STE A;  4MNO A;  2YYZ A;  1SNC A;  1CQI B;  1FNW A;  2DJF C;  1GO3 E;  4N8X 1;  2IX1 A;  4JYA L;  3KBG A;  4KK7 A;  1VQE A;  2BQR A;  2GN5 A;  3N6R A;  3GD7 A;  1G8Z D;  1A2U A;  1JIH A;  2VQE Q;  4DL5 A;  3M9B A;  3C3L A;  1X65 A;  3TEH B;  1E7Z A;  4NP5 A;  4AYB E;  4RGM A;  4X64 Q;  3QZ8 A;  4TVA B;  4RUC A;  2FMM A;  1SYE A;  1I4R A;  3N42 B;  2R7F A;  5EGT A;  2F0Q A;  2BDO A;  3A0J A;  4JI4 L;  2OWO A;  5FLX L;  2E2H A;  4DKA C;  4HCE A;  4CDF C;  3TS2 A;  2A68 C;  3SXH A;  3RF2 A;  2CH4 A;  2ATL A;  4JVZ A;  1EOT A;  4NXM L;  3J81 j;  2YU9 B;  5BN4 A;  1X3F A;  4EEQ A;  2FMA A;  1EEI D;  2HCI A;  3A8K E;  2K5Q A;  4DV2 Q;  4CBV A;  1HNZ Q;  4X62 Q;  5KFY A;  1B3A A;  3T16 A;  1HA6 A;  3I4N G;  4GLA C;  1K8M A;  1ML0 D;  4PZ7 A;  4KY6 A;  4BY1 B;  4YJ3 F;  2EY1 A;  3J81 L;  1AFP A;  1I3Q B;  2RVL A;  1MBY A;  2IP4 A;  1GHJ A;  4OL7 A;  3HOU H;  4DXG A;  4PQX A;  2J9G A;  4LF8 H;  2R93 G;  2IX0 A;  1IYV A;  3AFQ A;  2EJM A;  2PMZ E;  4A3M B;  4ULL A;  2QA4 A;  5C4J H;  3CCJ A;  5IYB G;  1Y8P B;  3GTM B;  5TSS A;  3L9A X;  4ECZ A;  1G6Z A;  4TKO B;  2SNM A;  3PO3 G;  1B33 N;  2PO4 A;  3S9W A;  2JJQ A;  5M9O A;  4ECW A;  4OX9 Q;  3GTK A;  3GTL H;  3T1Y H;  5JJL A;  2BA1 A;  3A8I E;  4NXM Q;  1GJX A;  3J81 c;  3JAM c;  2I0Q A;  4JI7 L;  2KEC A;  3STB C;  4HNV A;  1LYL A;  4DV2 L;  4EBC A;  3T1H Q;  3VR2 A;  1GYF A;  3C1E A;  3Q8R B;  5IT9 E;  4DNT B;  2F03 A;  2IY5 B;  1DOM A;  2NVY B;  1I6H H;  2ZJT A;  2IWH A;  1XNR H;  4WJ3 M;  2Y0S E;  2UVU A;  3CKI B;  4O4I F;  4K0K Q;  3KLW A;  4K8I A;  4C3J H;  1BXR A;  2ZDG A;  2AWO A;  2RSN A;  2W57 A;  4NLG A;  1EEF D;  1SRO A;  4ECT A;  4V0B A;  4HJ7 A;  1RJR A;  4DR3 H;  5ELC A;  5FKA C;  1SFO B;  2R8K A;  3GIP A;  5FLM H;  3JAM E;  3K59 A;  5FO8 B;  2B2V A;  1Z7T A;  1CQJ B;  1RK6 A;  3E3X A;  3HOZ H;  3J81 i;  1ZQ7 A;  3JAM i;  4X66 H;  4HMJ A;  1KC7 A;  1Z2N X;  1EUC B;  3PUX A;  2VA2 A;  1HFG A;  1WVL A;  4HNT A;  3GID A;  4DL4 A;  1UE7 A;  4G57 A;  5C4X G;  5GON F;  2PQA A;  1HR0 W;  4IR1 A;  1M0W A;  1U4R A;  4ZQI A;  1I6U A;  2EIF A;  1HUN A;  1VQA A;  3HKZ B;  1UEB A;  2CH4 W;  2F0L A;  2EY2 A;  3HXL A;  1VQF A;  1E4G T;  1EFW A;  2AHO B;  4LJZ C;  4ECX A;  1F2L A;  4UCO A;  2LS0 1;  2AU0 A;  2SNS A;  3NTK A;  4XQN A;  3GTG A;  4IPC A;  1PH8 A;  4UCS A;  1F9P A;  5HGT A;  2X6G A;  2E2I B;  2KJX A;  4DAV A;  3L7Z C;  3HOX B;  2X0S A;  1S97 A;  4DR4 L;  4DAY A;  1ENF A;  3D6W A;  4O4H F;  3TII A;  1KNE A;  3RAX A;  1IBL H;  4P72 A;  3RN2 A;  1Z6H A;  2UUA L;  1VKZ A;  4ZK9 B;  4ECR A;  2B2Y C;  3S16 H;  3CU7 A;  5E7N A;  2F0T A;  4YCW A;  1SLJ A;  4POF A;  3RGX A;  2NVX H;  2KCM A;  2Z1C A;  1K9M C;  1R9T A;  3Q0A A;  4V19 0;  4FM9 A;  3GV3 A;  3M9N B;  4X65 H;  4JI3 L;  1GSO A;  3KHR A;  2HHH L;  3RB6 A;  1N33 H;  5FPR A;  1Y1W H;  3KDF B;  1M1K C;  2K33 A;  3HEJ A;  4DUZ H;  4KTA A;  2F4V L;  3E5S A;  1AUV A;  4ECV A;  3NGD A;  3MXN B;  4F88 A;  4A3C G;  5LL6 b;  4DR7 H;  2UXB H;  2OT2 A;  1FKA H;  3H20 A;  5LOV F;  1BBU A;  3H0G A;  3I8Z A;  3OOC A;  1O78 A;  3H3V I;  1KHI A;  3I4M H;  4H7B A;  4O2A F;  3TIG A;  2NN6 I;  1DJR D;  1QUQ B;  5LL6 X;  2QEX A;  1N34 Q;  1MJE A;  4DR4 Q;  3Q8P B;  4FBT A;  1YBY A;  5BR8 H;  5KT7 A;  3GTK H;  4TV8 F;  3IL8 A;  2HQL A;  5BPF A;  2JN4 A;  5KG0 A;  2JA9 A;  2WYO A;  4P71 A;  3BJU A;  4FXK C;  5C4Z A;  4TSS A;  2ENB A;  2I07 B;  2R8I A;  3W1G A;  2M00 A;  3I73 A;  1STA A;  2L12 A;  1N56 A;  1SNP A;  5CV5 A;  2AGO A;  3S1M B;  4LFA L;  4JI3 Q;  3CD6 A;  4XYQ A;  1S3O A;  3BQ0 A;  1K3R A;  4C3H B;  3E5N A;  4ZQ3 A;  5EDW A;  3K5L A;  4B3R H;  1JR0 D;  2CKZ B;  3I4N H;  5KFR A;  5GAH C;  3FKI H;  4QIW B;  5KFN A;  1AEX A;  1SAP A;  4KN4 C;  4ZUJ A;  4EG0 A;  1V4Y A;  1MGS A;  1STB A;  4HJA A;  1QE6 A;  3BDO A;  3HOU B;  1K8G A;  2F0P A;  4QWC A;  3CCE A;  4Y52 H;  2WAQ G;  3NWS A;  3QIA A;  4BBS B;  4Z9C B;  1LM0 A;  2KHJ A;  2Q2I A;  2NVQ B;  1EY7 A;  4PMB A;  3TBI B;  2VQE H;  3HOV B;  4QF4 A;  4KD4 A;  5T14 A;  4R4Q A;  1CSP A;  4PZ8 A;  4Q44 A;  3S24 A;  3JSN A;  2DIK A;  4DA2 A;  2YU9 H;  1OWT A;  2XNA C;  3P7J A;  4C1N I;  5JVG 3;  4S3S A;  2Z6B A;  3PCO B;  3ULP A;  5C4X H;  1Z9F A;  2R8G A;  1R9T B;  3S14 B;  4ABN A;  3DLL A;  1GUW A;  2DJG C;  4B3M H;  1PH9 A;  3KF6 A;  4MTN A;  3GV5 B;  1F2Z A;  3VYS A;  4Y7N H;  4XZ3 B;  2B2V C;  5M3F B;  2NN6 H;  1VQL A;  2XCA A;  2W9C B;  1SXT A;  3J81 E;  2NBF A;  3IKJ A;  1YNN C;  2NVY H;  2R93 H;  1HJP A;  1PH7 A;  2NVX A;  1QZH A;  4JI5 H;  3L4K A;  1J5E Q;  2DGY A;  3F2D A;  4HJ5 A;  4X62 H;  2KQ3 A;  2MGS A;  5KFP A;  4GKK H;  3LX0 A;  4QWE A;  2NU8 B;  3V6H A;  2W7P A;  3OSO A;  3SK4 A;  4U67 3;  5COR A;  4F7X A;  1IL2 A;  1VF7 A;  4CJ2 C;  1QZG A;  4YQW A;  1Y1W A;  4KKS A;  3S2D B;  1LT3 D;  2FHT A;  1SYG A;  3EJI A;  5L9X A;  2UXB L;  2CWA A;  1PA6 A;  1F77 A;  1JWU D;  4B3M L;  1STY A;  4DUY Q;  1SCU B;  1K0S A;  3R8B A;  3S2H B;  5JEA H;  4FF3 A;  3CAM A;  3LWB A;  4MA0 A;  1JOQ A;  1WTP A;  1O7L A;  1IOW A;  1E4F T;  1PFM A;  5L1I A;  3CPF A;  4IHJ F;  1NTG A;  4NDX A;  4RKB A;  1UUP A;  3MR3 A;  4J9L A;  3RMH A;  4B3T Q;  4LF7 H;  3OMC A;  1JCK B;  4QL5 A;  2E2H B;  2R7D A;  4HSP A;  4IRC A;  3K5M A;  1PHJ A;  3CP0 A;  1K83 B;  1WFQ A;  4J9N A;  5I6Y A;  2PNH A;  5IIF A;  1PRT B;  4YY3 H;  3MEH A;  3F2C A;  1J5E L;  2SEB D;  4JI6 L;  2CVR A;  2YU9 A;  2B3G A;  1WTQ A;  4JI1 L;  2F0I A;  2DY7 A;  1CFM A;  3L0O A;  2WAQ E;  1XNR Q;  2WE6 A;  3AFP A;  1LO5 D;  1PTO B;  4DK0 A;  4QUF A;  3R2T A;  5LMU L;  3WO0 A;  2RA4 A;  1NUC A;  3M7N A;  5DLF A;  1SBB B;  2PQE A;  1F2M A;  3K0X A;  1D5X C;  5C1O A;  3JSL A;  2ZJQ A;  2E8G A;  4KHV A;  1O7Z A;  1CA5 A;  5EKK A;  4L5Q A;  1I94 L;  1EY6 A;  1EQQ A;  3OWE B;  4LF6 H;  4LSX A;  4FYD A;  5EZY F;  4OWX B;  3SGI A;  3F8T A;  2FK2 A;  2JE6 I;  4B9W A;  4C2M B;  4QUC A;  4X66 Q;  4GLV B;  1FYC A;  3FMC A;  2HVQ A;  4AQY Q;  2QIL A;  5M3M B;  3EPI A;  2LFN A;  1GD7 A;  3S15 B;  1HQR D;  1UEA B;  1KQS A;  1ROD A;  4JBJ A;  4K5W A;  4OEM B;  3UDF A;  5C1P A;  2R82 A;  2V4R A;  3GTL B;  4XT1 B;  4ID6 A;  4JI1 Q;  4DV6 H;  3TZD A;  2E75 C;  4ALP A;  3RBE A;  1U5K A;  1RKN A;  5LMU Q;  4MV9 A;  4JBK A;  1S10 A;  4R4I A;  3M4Y A;  3AEV A;  1N33 L;  3VR5 A;  5ELB A;  2CQA A;  2V9W A;  1K3B C;  1UE1 A;  2ZM6 H;  1AP0 A;  2RKS A;  3F1Z A;  3G7L A;  5LMN Q;  1X56 A;  3IAY A;  3D4R A;  2EJG C;  4NW2 A;  4IRD A;  1HNZ L;  3M9O B;  2R93 A;  2R87 A;  4Q8F A;  5DG9 A;  4LFB Q;  2WAQ A;  1CKM A;  4Q43 A;  1M4V A;  2YZM A;  1G2T A;  5D1O A;  1K83 A;  3BVM A;  3T5J A;  1HZB A;  3E9H A;  2FPG B;  1XPO A;  3PF4 A;  3V6K A;  2DPI A;  3C0F B;  1H9J A;  2E5L L;  3NE5 B;  4N9P A;  2X6L A;  1IXR A;  1E1O A;  1D1K A;  1UC8 A;  3UFX B;  1G91 A;  3HKZ A;  1SEB D;  3H94 A;  4F4W A;  3A7A B;  2JEA I;  3SR1 A;  1X6O A;  3GTJ B;  2B2T C;  1WTH A;  1II3 A;  1O7Y A;  2B63 H;  1S5C D;  2K52 A;  3VA5 A;  1HNZ H;  5D3I B;  4QQB X;  4LF7 L;  2O2L D;  1B2T A;  2WP8 J;  3P1H A;  4DV3 H;  3PO2 G;  1TII D;  2JA8 H;  5CV8 A;  5KEE A;  1Q82 C;  1TA8 A;  3GV8 B;  1RYS A;  1GUN A;  3KF8 A;  1CS0 A;  3EIV A;  5IYC G;  3Q24 A;  1ZKO A;  5DLG A;  4B3S Q;  2JK8 A;  2XN9 C;  4PWQ A;  1BXT A;  2H5X A;  4LFB L;  3S17 H;  4K5V A;  2BDN A;  3IG0 A;  1F2Y A;  3BG3 A;  4QW8 A;  3SK5 A;  5HV6 A;  1T94 A;  5KFZ A;  3S2D H;  4GOP B;  5KG7 A;  3C46 A;  1EU4 A;  2HUG A;  3GTL A;  5C3W A;  2K03 A;  1QCB D;  4HTH A;  1WD0 A;  1VQC A;  4QWD A;  4FBU A;  4BY7 G;  5KT4 A;  4DV3 L;  1N8R C;  3KTM A;  5C5J A;  1W6J A;  4JI5 L;  2NYZ D;  1Q3L A;  5C44 G;  5BR8 L;  5EBC A;  4IOC A;  3CW2 C;  1N32 Q;  4DV1 L;  3U50 C;  1WH2 A;  3MR6 A;  4C1N K;  2IX3 A;  3M9M B;  3QR8 A;  4OEL B;  1KIX A;  2UVV A;  3OYY A;  3GIJ A;  2F0G A;  4FO2 A;  3D0F A;  3CXC A;  5C0X J;  2FXQ A;  3TRZ A;  1CHQ D;  2R92 B;  1P16 A;  3RR5 A;  3SE7 A;  2F0V A;  4B3S L;  1SJH D;  1A3U A;  4A3K B;  1K1Q A;  3N41 B;  3H91 A;  4NB3 A;  5LL6 S;  1KAB A;  1NR4 A;  1V1P A;  1FR3 A;  3MFI A;  2RHQ B;  1OXU A;  1GXD C;  2VB3 X;  3ICE A;  5KG5 A;  4DR3 Q;  3FMA A;  3U4V A;  1GVP A;  2DY8 A;  3GII A;  1GUT A;  4QGU A;  4IUQ A;  2KSW A;  1I6V C;  4R1J A;  2UUB Q;  4BWS C;  1SYX B;  1AN8 A;  2EYP A;  3MWD A;  2PNR C;  1PX2 A;  2WDT A;  3PMF A;  1STG A;  1N32 L;  1XNQ L;  4DV1 Q;  4A2A A;  5CR3 A;  2WIN B;  1RL2 A;  3FDT A;  3NSW A;  3BU2 A;  2JEG A;  5CV7 A;  1SYC A;  1WTX A;  1Y8N B;  4FNF A;  3CQZ H;  2M9V A;  1PTO F;  4YR2 A;  2A74 C;  4JW0 A;  3HB9 A;  5KFB A;  3A5U A;  4DUY H;  2DN8 A;  2JA5 B;  3CPW A;  2JSO A;  4A3K G;  1QJO A;  4N9T A;  2YL2 A;  1BUV T;  2AWN A;  1I5F A;  2I80 A;  5J39 A;  2FKL A;  3A74 A;  5KFM A;  1HQM C;  1TS3 A;  2R92 G;  3V96 A;  5EJW A;  3QJY A;  1Q1E A;  3PW2 A;  4MN3 A;  1V43 A;  5IP7 G;  4YR3 A;  1IBK H;  1X54 A;  3ND9 A;  4X62 L;  1XXG A;  2RDJ A;  4MZ9 A;  2Q8T A;  2GPW A;  2L9H A;  3UE1 A;  4LUV A;  2P0A A;  4RNO A;  2VB2 X;  4A3C H;  4A3F B;  1XMO Q;  1AE2 A;  4LF4 H;  1PYS B;  4GOP A;  1SFO H;  2XVS A;  3KLS A;  2BCO A;  3D4D A;  5M3F H;  1LTL A;  1KNA A;  2SOB A;  4M1U B;  3U9O A;  1XNQ Q;  5KX5 F;  2ASD A;  2CW8 A;  2JP1 A;  3HGB A;  4L63 B;  4HIO A;  3J81 W;  1DYQ A;  1JQY D;  1S40 A;  1VQ7 A;  3I72 A;  1P8L A;  3K81 C;  4RCO A;  4A3F H;  5C3X A;  3GTP A;  5IT9 L;  1GSA A;  1HH2 P;  1UE6 A;  1BJT A;  4F4Z A;  4NXN H;  1EIG A;  5KFC A;  1TS2 A;  5C3E G;  1Y1V B;  3A55 A;  3OW7 A;  2FB9 A;  4EQ5 A;  4DAM A;  5EWE A;  2B29 A;  4JI7 H;  1E2Z A;  4DR6 L;  2K5V A;  5IGB A;  2C22 A;  2UUA H;  2YZG A;  4GN5 A;  2P5Z X;  5KNC A;  4N8F A;  1TKW B;  2B2W C;  5IYD G;  2W6N A;  3ORQ A;  3HOX H;  1BQQ T;  2EOT A;  1LT6 D;  4DNI A;  4LSA A;  1SMX A;  3CHB D;  3GP7 A;  1HZ9 A;  3T4A C;  3RIZ A;  1TY2 A;  2R7Z G;  2FE3 A;  4L1K A;  3QOJ A;  5EKL A;  3RZD B;  1EHI A;  1XTD A;  1B8A A;  2QYZ A;  2AGP A;  3H6M A;  3ITP A;  3RD4 A;  1I50 H;  4LFC L;  1JIC A;  1VQB A;  3TQY A;  1MI2 A;  3I12 A;  5FLX W;  4J9P A;  3FKI G;  4F4Y A;  5HGQ A;  4B08 A;  4O1N A;  4QY7 A;  3PIO A;  1D5M C;  5LMN H;  2E2I A;  2E2D C;  2D0O A;  2L0C A;  1ZHS A;  4QMG A;  4QW9 A;  3HS0 C;  2K5D A;  2F3W A;  4LF5 H;  2KHI A;  2IMW P;  3K7A H;  4G7H C;  3N8D A;  1YNX A;  3MWE A;  4BS9 A;  3I4M B;  4R9W A;  2WB1 G;  1Z47 A;  1WTV A;  4QJF A;  3JZI A;  3VPC A;  1W3S A;  4P73 A;  4Y7N B;  3AMU A;  1RTO A;  4A75 A;  4F50 A;  5C3E H;  3MVV A;  1SEI A;  5AFW A;  2CW0 D;  4JOI C;  5KNB A;  4BY7 H;  1JOR A;  4Q8E A;  3GTG H;  4BBR B;  1VQK A;  3HOZ G;  3UDG A;  1T5X D;  4B3M Q;  4LAA A;  1C3O A;  2Y0S B;  5E3F A;  5IT9 c;  5G3L F;  4GNX B;  3SVM A;  3K7A B;  1I6H B;  1O75 A;  1K28 A;  2R3Z A;  3DM3 A;  4YBZ B;  4K5X A;  4DR1 H;  1QG7 A;  2W8K A;  2BQU A;  1LTA D;  2BA0 A;  4AYB A;  4TQS A;  4TQU S;  1HNW H;  1AUX A;  2VUM H;  2K14 A;  3OW2 A;  1JC7 A;  2MO1 A;  3H15 A;  3VA7 A;  5M3M G;  3JRW A;  1JJ2 A;  4O3S A;  3RN5 A;  4XTC S;  4OXP A;  3T5L A;  4POG A;  2HVR A;  3FKI B;  4JI6 Q;  1ILP A;  3HOY H;  1OXS C;  4HJ9 A;  4NKL A;  3DWP A;  4IJL A;  4GNX C;  4LK1 C;  2JA8 B;  5JPN C;  1BCP F;  2CQO A;  1Q7Y C;  1A0I A;  2WB1 E;  5D3D A;  3GIQ A;  4ECY A;  4DV7 Q;  2NZ1 D;  5I9O A;  2R85 A;  1JE5 A;  2W6O A;  1YEZ A;  1NE3 A;  1I7L A;  1VF5 C;  2B39 A;  5JEA G;  3OWF A;  4WFN 3;  4LF9 H;  2MJ8 A;  1GUO A;  4O2D A;  3SK8 A;  4A3K H;  1X9N A;  4ZI7 F;  3JAM L;  4LF9 Q;  4A3D B;  1E4E B;  5HBR B;  4K14 A;  4ME6 A;  4RAZ A;  2KCC A;  3G71 A;  3V4S A;  4L6T B;  1NR2 A;  3QZ7 A;  1N36 Q;  2A1A A;  4RZQ A;  3KHH A;  3RBD A;  5FOB B;  1EZ8 A;  3R2I A;  5KRU A;  3HOW H;  3RB4 A;  4K0K H;  3D4W A;  2VPQ A;  2R8J A;  5GAD C;  1TS5 A; 
#chains in the Genus database with same CATH homology
 1QUQ A;  1MIU A;  2CKZ B;  4LF6 Q;  4UP7 A;  3I4N H;  2JA6 G;  5GAH C;  3FKI H;  5FLM G;  4LF6 L;  4DR7 L;  1KXL A;  4NPS A;  2K5H A;  1EWI A;  4DV7 L;  1VQ8 A;  4HJA A;  1K8G A;  2CWP A;  5JEA J;  3G4S A;  2A19 A;  1PH5 A;  3CCE A;  4R4C A;  2V1C C;  4L5S A;  2WAQ G;  4Y52 H;  1YVC A;  5IP9 G;  1YJ9 A;  3T1H L;  4DV5 Q;  2GVB A;  4LUO A;  1LM0 A;  1X55 A;  2KHJ A;  1UE5 A;  2Q2I A;  5ELO A;  3S2H H;  4IPD A;  3CCQ A;  2K50 A;  4R4Q A;  1CSP A;  1PH1 A;  4PZ8 A;  2L15 A;  3S24 A;  5IP7 H;  2ZTC A;  2YU9 H;  3ERS X;  1KL9 A;  2PI2 A;  3L2P A;  3EBE A;  4UY8 C;  3UE0 A;  3Q8D A;  2I5L X;  3KJO A;  5IP9 H;  3PCO B;  4C3I H;  3ULP A;  3CC4 A;  5C4X H;  1Z9F A;  4GN3 B;  3S15 H;  4A3M G;  3DLL A;  2AKW B;  1PH9 A;  3KF6 A;  4R4O A;  4MTN A;  4A3G H;  2ZTD A;  5IYB H;  3G48 A;  4Y7N H;  1I3Q H;  3ULJ A;  1VQL A;  2F3I A;  4BY1 H;  1PVO A;  2JA6 H;  3W5O A;  4JI8 L;  4JI5 Q;  1Q81 C;  1IBL Q;  1HNX L;  2NVY H;  3NEN A;  1VS0 A;  2R93 H;  1HJP A;  4OWT B;  2K75 A;  4GN4 B;  5ELN A;  1QZH A;  1PH7 A;  1T9H A;  3J7Z C;  1Y1W G;  1J5E Q;  2DGY A;  3F2D A;  4HJ5 A;  4GOP C;  4JI2 L;  3U4Z A;  1WI5 A;  1A63 A;  1IL2 A;  5H1S E;  1YIT A;  1QZG A;  4GKK Q;  5FJ8 G;  4DUZ Q;  2N3S A;  3UDX A;  2YTV A;  4A76 A;  4A93 H;  4JCV E;  4GKK L;  1YIJ A;  2CWA A;  2JEB I;  1PA6 A;  2UXB L;  4JC0 A;  3HKZ E;  4B3M L;  4DUY Q;  4YWM A;  2Q2H A;  2VY3 A;  2UXB Q;  4DUY L;  3ZJY C;  4JI0 Q;  4IPG A;  2YV5 A;  1B7Y B;  3CAM A;  4P75 A;  4BBS H;  1A8V A;  1E1T A;  4A3B H;  3GTP H;  4IOA A;  3CPF A;  4UP9 A;  1NTG A;  4A3D G;  3IRB A;  4DR2 L;  4GKJ L;  4B3T Q;  3S1M H;  3H3V H;  1L1O C;  4QL5 A;  4X6A H;  4B3T L;  2R7D A;  3F2B A;  1E22 A;  1NMF A;  1PHJ A;  4IFD J;  4DV3 Q;  4AH6 A;  2ID0 A;  3CP0 A;  3M85 A;  1WFQ A;  3KJP A;  3RZO H;  2PNH A;  4R4T A;  4KI0 A;  2UUC L;  2I5H A;  4YCV A;  3F2C A;  1J5E L;  4X64 L;  4JI6 L;  2ALY B;  2HHH Q;  2B3G A;  4GLX A;  4JI1 L;  4A3I G;  4HIM A;  5FLX c;  2PI2 E;  5HY6 A;  3KOJ A;  4PMW A;  3CCL A;  3L0O A;  3GTM H;  4LF8 Q;  2WAQ E;  1XNR Q;  3AFP A;  4DPG A;  5LMU L;  4BA1 I;  4AYB G;  4KLK A;  3M7N A;  1VQO A;  3K0X A;  3S1R H;  3RLO A;  1N9W A;  1HNW L;  5M3M H;  2ZJQ A;  2E8G A;  1YHB A;  4LNQ A;  4DR1 L;  1XPU A;  4L5Q A;  4BY1 G;  4B3R Q;  1I94 L;  1JJC B;  1EQQ A;  1E24 A;  4OO1 G;  1Y1V G;  1N34 L;  2PQA B;  4KHP Q;  2ATW A;  1L2F A;  4OWX B;  4HIK A;  1HR0 Q;  4A3L G;  3SGI A;  3F8T A;  5GAE C;  2VQF Q;  2JE6 I;  1V9P A;  3A5Z B;  3NEL A;  1Q12 A;  4HJ8 A;  4BBR H;  4DR2 Q;  4GKJ Q;  3I2Z A;  4X66 Q;  3CCU A;  4GLV B;  4DR5 L;  4AQY L;  5J3B A;  2UUA Q;  2UUB L;  4X66 L;  4AQY Q;  1R9T H;  3S14 H;  1KAW A;  1GD7 A;  4UPA A;  1KQS A;  1FL0 A;  4BA2 I;  4JBJ A;  5M5W H;  1EQR A;  3UDF A;  1VQG A;  3GTJ H;  4APV A;  3RNU A;  4RG1 A;  4JI1 Q;  4LUZ A;  3OTO L;  1JT8 A;  4ALP A;  2ES2 A;  2AMC B;  2LXK A;  3HOV H;  1U5K A;  2JQO A;  3ULL A;  3TRE A;  5LMU Q;  4A3F G;  3PIP A;  1AE3 A;  4PG3 A;  5IY0 A;  2JA5 G;  4JBK A;  3EN2 A;  4R4I A;  3AEV A;  3FP9 A;  4IPH A;  1N33 L;  4AIM A;  4OWW B;  1V1Q A;  2KCT A;  1UE1 A;  4DR1 Q;  3F1Z A;  4KHZ A;  1SE8 A;  1SN8 A;  5LMN Q;  3H0G H;  1XMQ L;  2UU9 Q;  1X56 A;  4DR6 Q;  4DV5 L;  5LMN L;  1TWG H;  4YWL A;  1DGS A;  1OXX K;  2JA7 G;  4OON A;  5M5Y H;  2C35 B;  1HNZ L;  1C0A A;  4C3H H;  3PUV A;  4BXX H;  5IYD H;  3GO5 A;  4FDB A;  3NBH B;  1PH6 A;  1G6P A;  3JC6 6;  5C0X G;  4LFB Q;  1CKM A;  1C7Y A;  2OTL A;  1GKH A;  1WYD A;  1IZ6 A;  1QVG A;  1OTC A;  1HZB A;  5GAG C;  3E9H A;  3KYH C;  2VW9 A;  3CCS A;  1XPO A;  1MKH A;  1EIY B;  1PYB A;  3PF4 A;  2D0P A;  2E5L L;  3HOV G;  1H95 A;  4LW1 A;  1VCI A;  1YZ6 A;  1IXR A;  1E1O A;  5IE8 A;  1PV4 A;  3ER0 A;  2JEA I;  4GS3 A;  5DLQ E;  1X6O A;  4YHH L;  3UDI A;  1VQN A;  2B63 H;  1CKO A;  3PGZ A;  2K52 A;  2VZA A;  1EIF A;  4YWK A;  4LF4 L;  4LF7 Q;  1XMQ Q;  4QQB X;  4LF4 Q;  3CMA A;  4LF7 L;  4A3B G;  2RCN A;  4JV5 L;  2WP8 J;  3M4Q A;  3PO2 G;  5M3F G;  2JA7 H;  2Z6K A;  1HZC A;  1Q82 C;  2JA8 H;  3M3Y H;  4WJ4 A;  4HID A;  3CF5 A;  3EIV A;  4XIG S;  5IYC G;  3FHW A;  1IYJ B;  1SR3 A;  3GDE A;  1PH3 A;  2JK8 A;  4B3S Q;  1VQM A;  1Y1V H;  3GTO H;  2KBN A;  2H5X A;  4LFB L;  3S17 H;  3D31 A;  2A8V A;  3NEM A;  5AJ3 L;  1L0W A;  2UXC L;  2Z6K C;  5AJ3 Q;  1C9O A;  1IBK L;  4DV6 L;  2UXC Q;  2ZM6 L;  2NVQ H;  3S2D H;  1CKN A;  4GOP B;  4A3D H;  1U0L A;  4DK6 C;  3M4P A;  2CCZ A;  4A4I A;  1VQC A;  2BH8 A;  1UWV A;  2GVA A;  3H0G G;  3HKZ G;  4LF5 L;  4JYA Q;  1S72 A;  1X3E A;  2B63 G;  4DV4 L;  2HIX A;  2LSS A;  2R92 H;  4BY7 G;  2NZH A;  4DV3 L;  2MO0 A;  1Q8K A;  5BR8 Q;  4GNX A;  1N8R C;  4DV4 Q;  4JI5 L;  4YHH Q;  5C44 G;  4RMF A;  5BR8 L;  4IOC A;  3CW2 C;  1B70 B;  1HNX Q;  4JBM A;  4DAY B;  2LXJ A;  2UUC Q;  3GTQ H;  5EAY A;  1N32 Q;  4DV1 L;  3U50 C;  3T1Y Q;  3AYH B;  1O7I A;  4A3M H;  1KIX A;  3T1Y L;  3OYY A;  1EOV A;  4JI2 Q;  4JV5 Q;  1YHQ A;  3D0F A;  3CXC A;  4A3E G;  5C0X I;  5C0X J;  2FXQ A;  3TRZ A;  1Q1B A;  3M4O H;  2YTX A;  2IHF A;  2I5M X;  4IO9 A;  1P16 A;  4NXN L;  2OCE A;  3RR5 A;  4DUZ L;  5IWA L;  2K4K A;  4B3S L;  3CME A;  5GRO A;  5C44 H;  1JMC A;  2ZJR A;  5IWA Q;  2QGQ A;  2XTI A;  1OXV A;  1NBW A;  2N49 A;  4NB3 A;  1VQD A;  1I94 Q;  1K73 C;  4JI0 L;  2RHQ B;  3E9I A;  1BVS A;  1OXU A;  4MNO A;  4KHP L;  2YYZ A;  3ICE A;  3S1N H;  4A3L H;  2VQF L;  4DR3 Q;  1GO3 E;  1GVP A;  3U4V A;  2IX1 A;  1KRT A;  4QGU A;  4JYA L;  4IFD G;  4R1J A;  4LF5 Q;  2UUB Q;  1VQE A;  1G29 1;  1YI2 A;  2GN5 A;  3PSI A;  1VQJ A;  3GD7 A;  2VQE Q;  2JA5 H;  3M9B A;  1EYG A;  2K5N A;  2OQ0 A;  1VQP A;  1X65 A;  1XNQ L;  4DV1 Q;  2VQE L;  1N32 L;  3TEH B;  1RL2 A;  1E7Z A;  3BU2 A;  4AYB E;  1L1O B;  4X64 Q;  2E2J H;  4LFA Q;  4TVA B;  1FJG Q;  3CQZ H;  2Z0S A;  2HIV A;  2R7F A;  4A3J H;  5JJK A;  4LF8 L;  3A0J A;  3A5U A;  2OWO A;  3AQQ A;  4JI4 L;  1Q86 C;  4DV0 Q;  3CPW A;  4DKA C;  4A3K G;  5JJI A;  2AWN A;  3TS2 A;  1I5F A;  1VQ4 A;  1HNW Q;  3A74 A;  2R92 G;  2OTJ A;  4NXM L;  1HZA A;  3J81 j;  1IBM Q;  1FVI A;  1MJC A;  1Q1E A;  1Q46 A;  1K0R A;  1V43 A;  1X3F A;  2DUD A;  3W1B A;  5IP7 G;  3I55 A;  1X54 A;  4X62 L;  4DV2 Q;  3WWV A;  4MZ9 A;  1HR0 L;  1HNZ Q;  4X62 Q;  3UE1 A;  1L1O A;  4LUV A;  3RZD H;  3PUZ A;  1XMO L;  2E2I H;  4A3C H;  3I4N G;  4GLA C;  1XMO Q;  1AE2 A;  1PYS B;  4PZ7 A;  4YCU A;  1CKN B;  2IT1 A;  2R6G A;  4YY3 Q;  4GOP A;  1SFO H;  5M3F H;  1LTL A;  4LF9 L;  1VQI A;  5LMN W;  1YJW A;  1XNQ Q;  3HOU H;  1AH9 A;  3HOY G;  1A62 A;  2R93 G;  4HIO A;  1KRS A;  3E0E A;  2IX0 A;  1N36 L;  3AFQ A;  1BKB A;  1S40 A;  4H02 A;  1NMG A;  2PMZ E;  1P8L A;  4L5T A;  1YJN A;  3K81 C;  1VQ7 A;  3HKS A;  2VNU D;  4A3F H;  2UXD Q;  2QA4 A;  3B6Y A;  3KF8 B;  1X3G A;  1FGU A;  5C4J H;  3CCJ A;  1ASY A;  5IYB G;  1HH2 P;  1UE6 A;  4P74 A;  4DV0 L;  2Q2T A;  3I4M G;  1WOC A;  2BH2 A;  1IBL L;  3PO3 G;  3BZC A;  2JJQ A;  2MQH A;  4OX9 Q;  2ASB A;  3S1Q H;  3GTL H;  4DR7 Q;  5C3E G;  2BA1 A;  3PUY A;  5JJL A;  4EQ5 A;  4DAM A;  4OX9 L;  2B29 A;  1KC8 C;  1JB7 A;  4NXM Q;  1LUZ A;  3J81 c;  3JAM c;  2I0Q A;  2Q2U A;  1M90 C;  3I4O A;  2UU9 L;  4JI7 L;  4DR6 L;  3STB C;  2K5V A;  1LYL A;  4DV2 L;  4JI7 Q;  4BBS G;  1W2B A;  4GN5 A;  3T1H Q;  1VQ5 A;  1PH2 A;  3U58 A;  5IYD G;  2EXD A;  2RHS B;  3HOX H;  2IY5 B;  4DNI A;  1SMX A;  4YY3 L;  1I6H H;  1HZ9 A;  4WJ3 M;  2Y0S E;  4IFD I;  3RLF A;  2R7Z G;  4K0K Q;  3KLW A;  2CFM A;  1VQ6 A;  1E3P A;  4C3J H;  4LWC A;  4DV6 Q;  1TWA H;  4K0K L;  1XTD A;  2AWO A;  2IHE A;  3PF5 A;  1QVF A;  4QIW E;  1B8A A;  1SRO A;  4LFC Q;  4HJ7 A;  1I50 H;  3BZK A;  4LFC L;  1KD1 C;  3TQY A;  1VQB A;  3PO3 H;  2E5L Q;  3FKI G;  5FLM H;  3K8A A;  5HGQ A;  4QY7 A;  3PIO A;  4A3I H;  1D7Q A;  3HOW G;  2VUM G;  5M5X H;  3PUW A;  3J7A 5;  2ZTE A;  4JI8 Q;  2D0O A;  1CUK A;  1NJI C;  3J81 i;  3HOZ H;  3JAM i;  3TS0 A;  1YHA A;  1WCM G;  3CCM A;  4JOI A;  3PUX A;  2KHI A;  4A3G G;  3K7A H;  3HFZ B;  3J80 i;  1YNX A;  4JG2 A;  1UE7 A;  3PO2 H;  5C4X G;  2PQA A;  2OQK A;  1HR0 W;  2WB1 G;  2WFW A;  1Z47 A;  2VS1 A;  4QJF A;  1XPR A;  3KF6 B;  1XNR L;  2ZJP A;  1W3S A;  4P73 A;  2RF4 A;  5IYC H;  2EIF A;  3CCR A;  4A75 A;  1VQ9 A;  3HOX G;  1VQA A;  2R7Z H;  1UEB A;  5C3E H;  3CCV A;  1VQF A;  4JOI C;  4ME3 A;  4BY7 H;  1EFW A;  2AHO B;  3GTG H;  5K36 G;  1VQK A;  3HOZ G;  3UDG A;  1XJV A;  4B3M Q;  3VDY A;  4IPC A;  1PH8 A;  5IT9 c;  1TWC H;  4GNX B;  2NN6 G;  2NZO A;  1IBK Q;  5GQO A;  3DM3 A;  3L7Z C;  2ZM6 Q;  1GM5 A;  4DR4 L;  2BA0 A;  4IJH A;  4P72 A;  4TQU S;  3RN2 A;  2VUM H;  2UUA L;  4OO1 I;  3PV0 A;  4JBW A;  2K14 A;  4DK3 C;  3OW2 A;  4A93 G;  2MO1 A;  1ASZ A;  3RLN A;  3S16 H;  3H15 A;  2MNA A;  5E7N A;  3CC7 A;  1BBW A;  5M3M G;  4YCW A;  4X65 L;  1SLJ A;  2YTY A;  4POF A;  1JJ2 A;  2NVX H;  1TWH H;  3RN5 A;  4X65 Q;  2KCM A;  3G6E A;  4XTC S;  1K9M C;  2MFI A;  3CC2 A;  4OXP A;  2JA8 G;  4L5R C;  1SRU A;  1TWF H;  4POG A;  1FJG L;  2XGT A;  4JI6 Q;  4JI3 L;  2HHH L;  3HOY H;  1OXS C;  4PZ6 A;  3HOU G;  1Y1W H;  1D8L A;  3KDF B;  4HJ9 A;  1M1K C;  3KFU A;  4NXN Q;  2D62 A;  4IJL A;  4GNX C;  1N33 Q;  2F4V L;  1RIP A;  3LGJ A;  1NY4 A;  2HT1 A;  2CQO A;  1Q7Y C;  1A0I A;  2WB1 E;  3MXN B;  2F4V Q;  2N8N A;  4DV7 Q;  4A3C G;  2KEN A;  2F52 A;  1BBU A;  1JE5 A;  1IBM L;  1Y14 B;  3H3V I;  1KHI A;  3I4M H;  4B3R L;  2NN6 I;  1YEZ A;  1MJE A;  1QUQ B;  4UP8 A;  3I56 A;  2QEX A;  1NE3 A;  1PFS A;  1N34 Q;  4DR4 Q;  4DR3 L;  1YBY A;  1PH4 A;  5JEA G;  3GTK H;  4O0A A;  4A3J G;  1J6Q A;  2HQL A;  1CSQ A;  1K8A C;  1G51 A;  2JA9 A;  1TXY A;  4O2D A;  3STB D;  4DR5 Q;  4A3K H;  1VQH A;  1X9N A;  4BXX G;  1JJG A;  4P71 A;  3KDF A;  3BJU A;  4LF9 Q;  1WJJ A;  2N78 A;  4A3E H;  1OXT A;  3MEF A;  3G71 A;  1EUJ A;  3W1G A;  3J80 c;  3I7F A;  2E2H H;  1N36 Q;  2A1A A;  5FJ8 H;  4BBR G;  2EQS A;  3K7U C;  4JI3 Q;  2VL6 A;  4EX5 A;  4LFA L;  2NVT H;  3HOW H;  2UXD L;  2Y0S G;  1QVC A;  4J15 A;  4C2M H;  3K80 C;  3OTO Q;  1S3O A;  3CD6 A;  1K3R A;  5GAD C;  4JI4 Q;  1K83 H;  1WCM H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...