4A3LG

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid and soaked with ampcpp
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 32
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3lG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3lG01
3KF6B 1N33Q 3AEVA 1MJEA 3CCMA 4POFA 4L5TA 1G291 3CCJA 3D0FA 4X64Q 5GQOA 1UE1A 3NENA 3G71A 1XPRA 3GTOH 4LF6L 4LUOA 2UUBQ 3BU2A 2ZJQA 3HFZB 5FJ8H 5IYCG 1OXVA 4DR3Q 1QZHA 1SLJA 1PV4A 3Q8DA 4L5RC 2ZJRA 1PH2A 1C0AA 4GKKL 4JV5L 4DUYQ 1M1KC 3ER0A 1YHQA 1AE3A 4DR2L 1VQDA 2RHQB 4DR5L 1N32L 3GDEA 2I0QA 1U0LA 1XTDA 1KHIA 3A0JA 1IYJB 2OCEA 3I4NH 4BBRH 4IPCA 4LFAL 4P73A 3I56A 1XJVA 5IYDH 2XGTA 1GVPA 2UXCQ 2IHEA 1SN8A 3KFUA 5IP9H 5GAGC 4JI4Q 3A5ZB 5FJ8G 1J5EQ 5C4JH 1Q86C 4X6AH 1OXSC 1JJGA 4DV4Q 1Z9FA 4JI5Q 4LF8L 5M3FH 5IWAL 1TXYA 4AIMA 2ATWA 3G48A 3I7FA 3CD6A 3TRZA 4GLVB 2ALYB 4DKAC 1MJCA 4BBSH 4A3CH 3I4NG 4BBRG 2AHOB 1VQGA 3PGZA 1XMOL 2HHHQ 4LFBL 4GN3B 3FHWA 5IYDG 4ALPA 2BA0A 3J81j 1VQ6A 2VQFQ 5IP7H 4K0KL 1E24A 3E9HA 5GADC 1HZ9A 3OTOQ 5IP9G 4YY3L 4LFCL 1FVIA 1V1QA 2K5HA 4HJ7A 4NXNQ 2JA7H 1EWIA 2R92G 2GVBA 4DV6Q 1RIPA 5H1SE 2K14A 2UUCQ 1WFQA 3HKSA 1X6OA 4UP9A 4DR6L 2B3GA 1YZ6A 2DGYA 4YHHQ 4C3JH 1YHAA 5M3FG 4DNIA 4Y52H 4C2MH 4A3EH 1SRUA 4BBSG 3I55A 4IOCA 1JJ2A 4A3CG 4RMFA 1W3SA 4LF4L 2N8NA 5LMUQ 5IY0A 4GKJQ 2IHFA 5IP7G 4JI1Q 2WP8J 1YIJA 3K7AH 4X65Q 1MIUA 4QGUA 1X3FA 1L0WA 3G6EA 4DV5Q 5GROA 3UE0A 2JA7G 2ES2A 1BBWA 1CUKA 3JAMc 4LF9L 3MXNB 2K4KA 3STBC 2I5LX 2KHJA 4LUVA 2KCMA 4O2DA 2YYZA 4PZ6A 4OWXB 3U4VA 4DV2L 5IT9c 2VW9A 1X56A 1GM5A 2CKZB 1B7YB 1LUZA 2VZAA 4A3EG 3G4SA 5FLMH 4A3MH 1M90C 2I5MX 2RHSB 1N36Q 3WWVA 3S2HH 1S3OA 1EIFA 4R4QA 1UE6A 2E2JH 1A8VA 3I4OA 4R1JA 1S72A 4UPAA 2N78A 4B3SQ 1VQNA 3HOWH 5JEAG 3W5OA 1EYGA 1H95A 1UE5A 2JA5H 4GLAC 3J81c 3CCLA 2D0OA 1BKBA 1K0RA 1C7YA 4JBKA 5FLXc 4R4OA 4HIOA 2MFIA 4R4CA 3S1QH 4B3RL 1E1OA 5AJ3L 1VQCA 1HNZL 2JA8H 4DR4L 1XMQQ 4DPGA 5FLMG 4A3MG 4PMWA 3STBD 2IX1A 3L2PA 4IFDI 3ZJYC 1FGUA 2IT1A 1VQKA 3CMEA 4OO1I 4B3ML 2MNAA 2Z0SA 4R4TA 3GTJH 1W2BA 2EQSA 4LF6Q 4L5QA 1L2FA 3M9BA 2BH2A 3HOWG 3PF4A 2CFMA 1Q82C 2JA5G 1X65A 2OQ0A 2ZJPA 4HJ9A 1A62A 4BY7H 4NXML 2R6GA 4GKKQ 1NE3A 4R4IA 4JV5Q 1OTCA 4DR5Q 1OXTA 4DR2Q 1JB7A 2N49A 4LW1A 1EQQA 1VQ7A 3GTQH 4OX9L 3NBHB 4BY1H 2JA8G 1PH3A 1I50H 4UP7A 5ELNA 4JBWA 4LFAQ 4A76A 2OTJA 1YVCA 3RLNA 2F52A 1KXLA 3U4ZA 2NN6I 3GD7A 3BZKA 4DK3C 3UDIA 2C35B 1YJWA 4IFDJ 1HZCA 4BY7G 2OWOA 4JC0A 4JI7L 4GOPB 4LF8Q 3H3VI 4MNOA 2JA6H 5IWAQ 1TWFH 2B63H 3S16H 1TWHH 1PYSB 4JI2L 4BY1G 1TWAH 2NZOA 4IPHA 1WCMH 1XMOQ 5C0XI 3HOVH 4LFBQ 4GLXA 3H0GH 4YWKA 4JI3L 1ASZA 1FJGL 1IL2A 4A3LH 4K0KQ 3CAMA 4JBJA 3PV0A 4YY3Q 2AKWB 1YJNA 2UU9L 1CSPA 4NPSA 4DAYB 4L5SA 4LFCQ 4IOAA 3DLLA 2PI2E 2R7ZH 3FP9A 4JOIA 4DR6Q 3TS2A 4LF7L 3M4PA 1AH9A 4JG2A 2JA6G 4JI8L 2B63G 3TREA 1EUJA 3CXCA 4ME3A 1PFSA 3J80c 1QVGA 5M3MH 3UE1A 3CCEA 1IXRA 1WCMG 4OO1G 3HOVG 1VQMA 3I2ZA 3S24A 4LF4Q 3H0GG 1JJCB 4A3LG 2R92H 4GS3A 3PO2H 3CCUA 3T1HL 2DUDA 2MQHA 1Y1WH 3A5UA 4P74A 1G51A 4DK6C 5LMNW 3F8TA 5C0XJ 3T1YL 4LNQA 3H3VH 2R7ZG 2QA4A 3GTMH 4LF9Q 1VQAA 3PUXA 1GD7A 1VQJA 3A74A 4DV3L 4JI0Q 4J15A 3ULJA 2JEBI 4DV2Q 1YEZA 1AE2A 1N9WA 1KAWA 4A3IH 3KOJA 1NJIC 1EIYB 3J80i 1DGSA 5M3MG 3F1ZA 1IBML 4QY7A 2KBNA 3IRBA 1HNWL 4IPDA 4XIGS 3DM3A 3PO2G 1PH9A 3M4QA 4DR7L 1Y1WG 3HOXH 3J7A5 2WFWA 2ASBA 4GOPA 4A75A 4JOIC 1N34L 2UXDL 1XNQL 1C9OA 4NB3A 2F4VL 4QIWE 3W1BA 5C3EH 5GAEC 2JQOA 1L1OA 2WAQG 3TQYA 1VQOA 4B3RQ 4OWTB 3HOYH 3CPWA 5AJ3Q 4A3IG 1HNZQ 4DR4Q 4YWMA 1VQFA 2VQEL 2KENA 2D0PA 1PYBA 1N8RC 1YNXA 1CKNB 1CSQA 3D31A 2AWNA 3JC66 4KI0A 3CF5A 3RNUA 1X3EA 1PH8A 1QZGA 5ELOA 1CKOA 3TEHB 1YHBA 3HOXG 1PH6A 1Q1EA 1I94L 4NXMQ 4JI0L 1QVCA 4DV1L 2EIFA 1QUQB 3KJPA 2D62A 4DUZL 3HOZH 5C3EG 2PQAB 1NTGA 3AFPA 1WJJA 3CC7A 1YITA 2E8GA 3EIVA 1X3GA 3MEFA 4JCVE 5JEAJ 4OX9Q 3HOYG 1Q12A 1VQIA 2Q2UA 2KCTA 1Q7YC 1UWVA 1EOVA 2UUAL 1WOCA 4DR1L 1XNRL 3K80C 2K52A 3CCVA 1HZBA 3KF8B 3UDXA 1Q81C 4AH6A 1EFWA 4YCVA 1OXUA 4A3FH 3JAMi 4H02A 1V43A 2AMCB 4GOPC 3K81C 2PNHA 4GNXB 2XTIA 1TWCH 4LUZA 4X66L 4JI7Q 1VQ8A 3F2DA 3U58A 2L15A 3HOZG 4A4IA 3BZCA 2VY3A 2HIXA 2ZTDA 4AQYL 1VQ5A 4BA1I 2Q2HA 3KJOA 4A3BH 5JJKA 4QL5A 4JI2Q 3UDGA 2PMZE 2BH8A 4RG1A 4P71A 4JI3Q 1FJGQ 2A8VA 3RN5A 1IZ6A 3S1MH 1SROA 4QJFA 2CQOA 2YTVA 2JJQA 2UU9Q 3J81i 5JJIA 5BR8L 3HKZG 4LWCA 4YCUA 4A3FG 1KIXA 3S15H 2NZHA 4AYBG 1IBLL 2YTXA 2JE6I 4LF7Q 2K5NA 1NBWA 3PO3G 3OYYA 2Y0SG 4PZ7A 4JI8Q 4EX5A 4HIMA 2HIVA 3PUYA 2VNUD 2IX0A 3E9IA 1VQ4A 4A3BG 1VQLA 1VCIA 3RLOA 4DAMA 4LF5L 2VUMH 1CKNA 1OXXK 1KRTA 1NMGA 2UXBL 1J6QA 3S17H 3K8AA 3CC2A 1JMCA 3T1HQ 1BVSA 1HR0L 2N3SA 4B3TL 4YCWA 1Q46A 4APVA 3T1YQ 4X62L 2JK8A 3GTLH 3KLWA 4WJ4A 1QUQA 1QVFA 2HQLA 4OONA 2NVQH 1D8LA 2PQAA 2E5LL 1A0IA 4OWWB 1K73C 4A93H 4DV3Q 1I3QH 4GN4B 1L1OB 4PG3A 5C44H 4HIDA 1B8AA 1X9NA 3PUWA 1HNXL 3S2DH 4BXXH 2YV5A 2VUMG 1IBMQ 1LM0A 4BA2I 1HNWQ 1K8AC 4XTCS 3VDYA 2OTLA 2KHIA 1Y14B 3ULLA 1GKHA 4DR7Q 3GO5A 2FXQA 1IBKL 4GNXA 4IO9A 2NVXH 2JEAI 2UXDQ 1N34Q 1XNQQ 2GN5A 1HZAA 3KYHC 2F4VQ 1KQSA 3J7ZC 4A93G 1PH7A 2VS1A 4IFDG 4MTNA 3RZOH 1LTLA 4C3IH 5C44G 2QEXA 4O0AA 2VQEQ 4TQUS 4DV7L 4BXXG 3GTPH 3K7UC 5LMNL 5JJLA 1VQPA 3PUVA 5E7NA 1HH2P 1UEBA 2QGQA 5HY6A 2ZM6L 4DV0L 1PH4A 1V9PA 3ERSX 1VS0A 4A3DH 1E1TA 2Z6KA 1WI5A 3PUZA 3S1NH 1I94Q 2CWPA 3L7ZC 2IY5B 4DV1Q 1PVOA 3PIPA 4JI6L 1U5KA 3PCOB 3U50C 4DUZQ 1NMFA 1SR3A 3UDFA 1YJ9A 4JYAL 1R9TH 1BBUA 3M4OH 1JT8A 2NN6G 3CC4A 4TVAB 4KHPL 3PIOA 4IPGA 1XNRQ 2UUAQ 2YU9H 4KHZA 4DR1Q 2R93H 3RLFA 3TS0A 4GNXC 4A3DG 1SE8A 2LXKA 1FL0A 3AYHB 3CMAA 3F2CA 2JA9A 4X66Q 2R7DA 1N33L 5C0XG 2V1CC 3EBEA 3CCRA 4AQYQ 1GO3E 4X64L 2LSSA 2WB1G 4GN5A 2E2IH 3AFQA 1WYDA 3B6YA 3CP0A 3EN2A 4A3JH 2UUBL 3SGIA 1K3RA 5M5YH 4HJAA 4OXPA 3NELA 4DR3L 2R93G 1VQEA 3CQZH 1JE5A 4PZ8A 4IJLA 4UY8C 2ID0A 4DUYL 1E22A 1SMXA 2Z6KC 5BR8Q 3CCSA 2WAQE 3CPFA 3ULPA 1S40A 1XPUA 2GVAA 2ZTCA 3M85A 3H15A 1IBLQ 2ZTEA 3GTKH 4C3HH 1T9HA 2WB1E 3KF6A 1B70B 1KD1C 2EXDA 2RCNA 2UXCL 1D7QA 3W1GA 2K75A 4MZ9A 1VQHA 2VL6A 1SFOH 4JI4L 4LF5Q 3E0EA 4A3JG 1J5EL 3M7NA 1I6HH 3KDFB 2K5VA 2UXBQ 5IYBH 5GAHC 4HIKA 1HR0Q 1K83H 4HJ5A 4YWLA 4JI5L 1KRSA 4DV4L 4B3TQ 2HT1A 4X62Q 1Y1VH 2R7FA 3I4MH 2YTYA 1E7ZA 3RN2A 3RZDH 3PO3H 1L1OC 1K8GA 2E5LQ 1Q8KA 5J3BA 1P8LA 3F2BA 3M3YH 2HHHL 3HOUH 5C4XH 1UE7A 5DLQE 2VQFL 2B29A 3OTOL 1HNXQ 4NXNL 4DV6L 3S14H 1G6PA 3BJUA 3NEMA 5IYBG 2OQKA 3CCQA 2UUCL 2H5XA 4YHHL 1K9MC 1CKMA 2Q2IA 1IBKQ 3CW2C 1Y1VG 1TWGH 2K50A 3I4MG 1Z47A 2MO0A 5M5WH 4B3MQ 4UP8A 2Q2TA 4POGA 5HGQA 1RL2A 3HOUG 2I5HA 1HR0W 1X54A 5LMUL 1XPOA 2E2HH 4P75A 2NVTH 4GKJL 5C4XG 1MKHA 4JI1L 1A63A 2BA1A 3FKIH 1LYLA 4KLKA 3HKZE 4X65L 4DV7Q 4A3GH 4DV5L 5LMNQ 3AQQA 2RF4A 3GTGH 4AYBE 1X55A 2LXJA 2ZM6Q 4DV0Q 3OW2A 1ASYA 2A19A 2CCZA 1O7IA 2Y0SE 3K0XA 4A3KH 4EQ5A 1N32Q 3S1RH 4JBMA 1NY4A 1PHJA 3LGJA 4WJ3M 1P16A 4JI6Q 1YI2A 5K36G 4JYAQ 1N36L 2CWAA 1PA6A 4Y7NH 4KHPQ 3KDFA 1Q1BA 4B3SL 5EAYA 1KC8C 3FKIG 1HJPA 5IYCH 4A3GG 2MO1A 1VQBA 4IJHA 4HJ8A 1I5FA 3ICEA 4P72A 3RR5A 3PF5A 1EQRA 2A1AA 2F3IA 1PH1A 1KL9A 2AWOA 4FDBA 1VQ9A 4A3KG 2PI2A 1E3PA 4QQBX 5IE8A 2NVYH 5M5XH 1YBYA 1PH5A 3L0OA 1XMQL 3PSIA
chains in the Genus database with same CATH superfamily
1N33Q 1KLGD 4NMZA 3CCMA 3MWEA 4POFA 3CCJA 3DUZA 1UC9A 2EJGC 2I46A 2ZJQA 4ED7A 2JEJA 3NHHA 4ECSA 5TSSA 1BXTA 2VQFH 4DR3Q 1QZHA 5FLXE 2IW3A 3Q8DA 2XD4A 4ZKBB 1C0AA 1YHQA 1N32L 4DR2L 3KBXA 3JAMW 3GDEA 4O3QA 1BF4A 2F0TA 1RCVD 1XTDA 2XSCA 2I0QA 4YR0A 2NVYA 2ZXPA 5D14A 2L4NA 4A3EB 2J4XA 4DK1A 2WDTA 1PTOB 2R87A 3KFUA 5IP9H 3KUPA 4KKTA 5T1IA 3LP8A 3ITPA 5FJ8G 1I6HB 1WTVA 3M9MB 4H44C 1Q86C 3D6CA 1CS0A 1STAA 1VBGA 3UQ8A 3QR8A 3QZ7A 1OXSC 5IODA 1Z9FA 1MZBA 1G6ZA 2CVRA 5M3FH 4AIMA 3QO2A 1VF7A 4FM9A 5ELCA 5C5LA 4GN3B 1ZEQX 5IYDG 1DXMA 4EQOA 4K0KL 1E24A 3E9HA 1HZ9A 3FRPB 3S2HB 2MGSA 2NU8B 4LFCL 2ALZA 2F03A 2K5HA 2JA7H 2OLSA 1OWTA 1CE8A 3U9OA 5H1SE 2F0QA 2K14A 1KDAA 1FNUA 3HOWB 1X6OA 2LKVA 1YZ6A 1Z2OX 2C5CA 2OEOA 2HVQA 4O4LF 1LTGD 1C3OA 5KG2A 4DNIA 5EGTA 4ZK9B 3I12A 1SRUA 4ODGA 1SSOA 2ZXRA 4FXDA 1JDBB 2N8NA 1B50A 4GKJQ 1S5FD 2X69A 1E2VA 1KJ9A 1XMQH 1YIJA 5JJZA 5JEAH 2EY1A 2W57A 4IAJA 2NB0A 1MIUA 2QF7A 1L0WA 3G6EA 3N52A 4XYQA 4EG0A 5LYJF 1PMRA 2HD3A 4LF6H 2SCUB 3A8JE 3HGBA 3STBC 5DQGA 1JB3A 2F0HA 4O2DA 3U4VA 3V4SA 4K2KA 1LUZA 2K5DA 4J1MA 4A3EG 1IKMA 4DR5H 3R3OA 5F2DA 3Q23A 1EYZA 1RKNA 5C3WA 4R4QA 1SJED 1UE6A 2NYZD 3DEPA 1ENFA 1UAPA 2X6LA 1TS2A 4HCSA 1BQQT 1EY7A 4R1JA 5I6YA 3W5OA 4FYDA 2RBMA 3KLSA 4B9XA 4MTKA 3L9AX 5FLXc 4A2BA 4R4OA 4HIOA 2MFIA 3QJYA 3E6ZX 4UCVA 1E1OA 5KFJA 4O42A 3MHBA 1HNZL 5IWAH 4PMWA 3T13A 3S16B 1TWHB 3L2PA 4IFDI 3ZJYC 2RSOA 2W9BB 3BA8A 2FE3A 2ASJA 2HVRA 1S4ZA 3CMEA 1EY6A 4OO1I 1ENCA 2Z0SA 1IYVA 3P1HA 2PCFB 5EQ0A 3HOWG 3URYA 3KAJA 1Q82C 1X65A 4HJ9A 2W9AA 2JA5A 2QYZA 4DU9A 4DA2A 4JV5Q 3D4DA 4RAZA 1OTCA 1B6SA 5KFBA 4LW1A 1EQQA 1S0NA 5DQIA 3NBHB 2FPIB 1I50H 4LFAQ 5ELNA 4JBWA 3I4NB 4QIWB 3OSNA 1YVCA 2F52A 2EYOA 3BVMA 1KXLA 2NN6I 3LWUA 2W6ZA 3D3RA 2I8CA 3O13A 3MXNA 1S9FA 1EY8A 5IT9E 1FNWA 2OWOA 1A15A 3H3VI 4EFEA 2W7OA 2JA6H 2EYHA 1QNUA 1I94H 1EYAA 2F0MA 4BY1G 2C00A 4JI0H 4ECQA 3OSOA 4IPHA 4BBSB 4OO1H 1DONA 5D1PA 5BPFA 5C0XI 2XGQA 3GIIA 4DV2H 4GLXA 3H0GH 4YWKA 1IL2A 4WD3A 1WH2A 2JYOA 4JBJA 4YY3Q 5AFWA 1CSPA 4NPSA 4DAYB 3R2IA 3DLLA 3T5HA 3SK4A 4JOIA 4DR6Q 2Z4HA 3TN2A 5JVLA 1H9JA 4IURA 2FLPA 1VKZA 5CV9A 5C6AA 1LT3D 5EPLA 2Z4IA 5KFKA 5M3MH 1JORA 3CCEA 1TWAA 3Q22A 4B3RH 4LF4Q 4K8IA 1SE3A 1FGBD 1QB5D 4A3LG 3T51B 3GQBA 4GS3A 3PO2H 4HNTA 1Y1WH 2PMZB 4HMJA 1KJ8A 3NSWA 3H3VH 2R7ZG 2QA4A 3GTMH 4LF9Q 4YR2A 2SEBD 2V4DA 1GD7A 1VQJA 5L9XA 3EYYA 2GA4B 1N9WA 1KAWA 2F0SA 2ASLA 4IUNA 1TR5A 4ED6A 3F1ZA 4XYMB 5I9PA 2W71A 4F4ZA 3DM3A 2R92A 3M4QA 2PN1A 3RMHA 1E2WA 2DIKA 2WFWA 3K5MA 4B08A 4JOIC 1XNQL 3DXJC 5C3EH 3W1BA 2XGPA 5BN4A 1RJPA 1RJRA 4OWTB 5KT6A 5AJ3Q 4LK1C 4YWMA 4C5CA 1TA8A 3NTIA 1TIID 2W6QA 4XDXA 4QUFA 1AN7A 1I7LA 4QWCA 4JI2H 4I50F 1CKNB 3H40A 4KI0A 3CF5A 4JI3H 1PH6A 1BNCA 1WTXA 1I94L 1SMYD 4JI0L 4PDBA 3HOZH 1YNJC 1ZYRC 3AFPA 2F0WA 1YITA 3EIVA 3MEFA 2XNAC 3M4YA 5JOBA 3K58A 2FK3A 3RAQA 4LF7H 1Q12A 1VQIA 3N6RA 2Q2UA 2F0IA 2KCTA 4MV4A 2TMPA 2RGVA 1EOVA 2UUAL 1XNRL 4JI8H 3K80C 1AZPA 3D8GA 5LP6F 1HZBA 4G7ZC 4YCVA 1JDEA 1D5MC 4F50A 2YS7A 4L63B 5DM73 3BG5A 4AQYL 2IMWP 1H9SB 2Q2HA 5JJKA 4QL5A 3UDGA 1I4XA 2BH8A 1EY0A 5IGDA 1XYIA 5C44B 1H9KA 1WCMB 1KDBA 1FJGQ 4LH7A 3S1MH 3S2DB 1W6JA 3TQTA 4QJFA 5KKNB 2CQOA 1I4RA 1IBMH 5JJIA 2A6HD 3J81i 2KOLA 1VMPA 1SDFA 3R8BA 4J9MA 3PW7A 1KIXA 1HNWH 3S15H 4X3SA 1WR2A 3NK9A 5EDWA 4U6PA 2JE6I 4DR7H 3ERQA 2K5NA 3PO3G 2NVXB 1LT6D 2EYMA 1HCZA 2Y0SG 5EKKA 4PZ7A 4EX5A 2R8JA 2PBZA 5DQHA 2IX0A 3E9IA 4C1NI 4DNRB 4HTHA 2VUMH 3T53B 5DG9A 1PRTF 2K32A 1J6QA 4Q0FA 3K8AA 3CC2A 1NNXA 1BVSA 2TSSA 3NPPA 5J39A 3FVQA 3GTPB 3TIIA 3T1YQ 4X62L 2FHTA 1QUQA 1QVFA 5J1ZA 1ET6A 2E5LL 3MXPA 2BQ3A 3DMUA 4DK0A 2FJZA 5KFVA 4HIDA 2B2UC 4A3IB 1X9NA 4CJ1B 3OW7A 3M4OB 2IBKA 3KF8A 4UFZA 1J9OA 2PW5A 1ET9A 3K5OA 3TDQA 1HTLD 3ULLA 1GKHA 4WORA 2FXQA 4GNXA 3GTLA 2UXDQ 1N34Q 1HZAA 2IJ0A 4I55F 3GIDA 1GOZA 2VS1A 4C3IH 5C44G 4EEQA 1HA6A 1T5XD 2AQ1B 3OMCA 4IUVA 2QEXA 2O4XA 4O0AA 4TQUS 2VQEQ 4DV7L 2E2IB 1VQPA 2V59A 1DOKA 4P2CB 4A3JB 2JEGA 4CDEC 2QGQA 1ENAA 1RJTA 2R7MA 1V9PA 5C1OA 3TQ1A 3RB3A 1CHQD 4IUTA 3RUZA 2DLNA 4FF1A 4PWQA 1PFNA 3BQ2A 3AMUA 4DV1Q 4Q0YA 1U5KA 3PCOB 4DUZQ 1SYBA 1YJ9A 3F2UA 3GTKB 4UCUA 5C5JA 4IN3A 5KRUA 4C5BA 2WIIB 4TVAB 1EY5A 1CT1D 3GQCA 3TINA 2F3VA 1DJRD 4KHZA 4DR1Q 2YU9H 1W93A 4ECYA 3CRKC 1WVLA 2R93H 1D2BA 4GKJH 2AUKA 3TS0A 3RTXA 3OIQA 1AUXA 3MR3A 2FP4B 3EROA 3QOJA 3QWNA 4GNXC 2KSWA 3HKZB 4A3FB 2UXBH 3OMGA 3AYHB 3MWMA 1Z7TA 1RYSA 1IOVA 4ULLA 1Y1VB 4X66Q 1TWCB 1EUDB 1N33L 1R9TA 2V9WA 3J81L 4FS2A 3AFQA 1LT4D 2E75C 5M5YH 4HJAA 4TV8F 1JX4A 4OXPA 3NELA 4DR3L 3K3VA 4X3TA 5LL6X 4IJLA 2ID0A 2QDBA 1STNA 2WAQE 1S5BD 1S40A 2AQ4A 1IBLQ 5KFPA 5KFTA 1ZHSA 2W9CB 2YRWA 1MBYA 1G8ZD 2A68D 3EJIA 3W1GA 1RHPA 2CW7A 4MZ9A 3BDOA 4A3JG 5LOVF 3PMFA 3KDFB 2CW0D 4DXFA 4G7OC 1HXYD 5IYBH 5ELEA 1PRTC 3S17B 1HR0Q 4HJ5A 2RDFA 4DL2A 3H3VC 3HBLA 2NWGA 4RZRA 2YTYA 3PO3H 4TKOB 1ZQ7A 2MCTA 4DV0H 1SYFA 2R7LA 5BPHA 2SNSA 4YAKB 4ECXA 3PN1A 3I8ZA 3M3YH 2ZDHA 4JV5H 3S1RB 4RH6A 3G6JB 2B29A 5C1PA 4JYAH 3E5SA 2MUYA 2UVUA 3LNNA 1SCUB 5DM63 1NR2A 3VR3A 4Y7NB 1PYWD 1GJXA 1EFID 1G6PA 4KHPH 2VB3X 1XWEA 1YNNC 3NP8A 2JEIA 4HEDA 1K9MC 1FYCA 4PQXA 1Y1VG 1TWGH 2K50A 2P5ZX 5M5WH 2LMCB 2E2DC 3GV3A 2R8KA 5HGQA 5KT7A 4RB3C 2I5HA 2NVTH 3RZOB 2E2HH 4GKJL 1DV2A 2FKLA 2CH4W 1A63A 3FKIH 1LYLA 5EBDA 4H7BA 4A3GH 4X64H 2DY7A 3AQQA 1SE2A 4AYBE 1I4HA 2LXJA 1ASYA 2CCZA 5CAEB 1O7IA 5K5PA 2G9DA 5EWGA 1OO9B 4JBMA 2K28A 1PHJA 3LGJA 2F0LA 1YI2A 3IAYA 4JI6Q 2V4RA 4RGOS 2J9GA 4IZOA 4ILWA 5L1KA 2VUMA 4RCOA 5EAYA 2PZTA 3J7AF 1HUNA 2J6TA 5IYCH 3K5IA 3A7AB 4MAMA 2B2YA 3A8KE 2X6GA 3GTGA 3NQIA 4IJHA 4JI4H 1I5FA 2Q8TA 3RJ0A 3PW4A 1PH1A 2A1AA 1KL9A 3H4BA 2K03A 1Z2PX 4QMGA 2PI2A 4ECUA 4JI5H 1K8MA 2NVYH 5LMNW 5CA0F 3L0OA 3PSIA 3KF6B 3V6KA 1L0XB 2IPKD 4L5TA 1G291 4DL4A 4BS9A 1WTWA 4XT3B 3BU2A 2HHHH 3HFZB 1TT2A 3VYUA 1PV4A 3OTOH 3SVMA 4KD4A 2JA7B 2EY6A 3CRLC 1ZHQA 3NE5B 1N56A 1SYDA 4DUYQ 1VF5C 1M1KC 3ER0A 4JV5L 4DV6H 1VQDA 2W8LA 2Q8IB 1U0LA 3TP5A 3A0JA 4IPCA 4LFAL 4P73A 4LSAA 2W9BA 1TY2A 3I56A 1XJVA 5IT9W 1HA5A 4ZUIA 2YRXA 1B4OA 2Z8LA 3IFDA 5GAGC 3QG1A 1J5EQ 2B2YC 3EA6A 4JI1H 1C8CA 1JJGA 2VA3A 1K83B 5KFIA 5FK9C 4HR7A 5DG8A 1TXYA 3I7FA 3I4MB 3TRZA 4DKAC 3VA7A 3RZDB 3DF7A 3R5XA 2FFKB 2VA2A 2RDHA 3HXLA 3HOUB 4MV1A 3J81j 1VQ6A 2AGOA 5IP7H 5IP9G 4YY3L 1N36H 3MFYA 5IOCA 4HJ7A 2R92G 2FMCA 2E2JB 4B3SH 1WFQA 4DR6L 4DAPA 2B3GA 4YHHQ 3BQ1A 4X3KA 2B39A 1KAAA 1XTCD 5M3FG 1LLRD 1STHA 1S5CD 3Q24A 1ILPA 3BQ0A 5HGTA 4IOCA 1JJ2A 4FU0A 2AQ3B 4MA5A 1LTSD 1TU2B 4LF4L 1W3SA 4ED2A 5LMUQ 3DHQA 1BJTA 4J9OA 1PZID 3K7AH 4X65Q 4CDFC 4DV5Q 2JA7G 3DEOA 1SE4A 2ES2A 1ZXTA 1CUKA 4LF9L 1FJGH 5HBRB 4I7AA 2KJXA 3G7LA 2I5LX 4F87A 4LUVA 2KCMA 4PZ6A 1A9XA 1GM5A 2FJ2A 1B7YB 4C2MA 5FLMH 4A3MH 4DR2H 2I5MX 2RHSB 3WWVA 1AZQA 1S3OA 3M7GA 2K5WA 2R3ZA 1BUVT 3I4OA 1S72A 1TS5A 1EZ6A 2PMZA 5CV4A 5JEAG 5KT4A 3PZPA 1UE5A 2JA5H 2N55A 4RHSA 3J81c 4KKSA 4UCRA 4IR1A 4O2BF 3M9OB 1ESRA 4JBKA 3W2DA 1I6VC 4R4CA 3S1QH 3HZXA 4ZRZA 5AJ3L 1VQCA 2JA8H 3ETHA 2JEFA 1HUMA 1GYFA 2IT1A 1VQKA 3J80W 2MNAA 3ONAB 1L2FA 3H0GB 1GUWA 3I3CA 2ZJPA 1N48A 4BY7H 2W70A 3TP8A 4LFCH 1OXTA 3KBGA 3TIGA 2DNEA 1YNND 3D4WA 4YBZB 4ETSA 3MR5A 1N34H 4UP7A 1AW7A 4A76A 3I72A 2E2HA 1RK6A 3VR2A 4QUCA 4PNYA 4L6TB 3EVQA 1S03G 3C46A 2Z1CA 2C35B 3GTJA 3D6WA 2VQEH 1NAPA 3PO2B 5C4JB 1B33N 1Y1WB 2C28A 1QWYA 2F0FA 3QFFA 4IRCA 3NQTA 4LF8Q 2NBFA 3H94A 3NUCA 2B63H 5I47A 1TWAH 5CB4F 2RCFA 3L4JA 3WNZA 4LFBQ 3GV7B 1FJGL 2WE6A 3U9TA 3L3OC 2VPQA 1YJNA 5EPJA 4L5SA 4IOAA 2EE1A 1PTOD 3C2PA 3KHGA 4EBEA 3SEBA 1D1KA 1FNVA 2JA6G 3V96A 2L12A 2LS01 1PFSA 2C2EA 4RKBA 2C2DA 4WFN3 4X66H 1IXRA 4XT1B 4OO1G 5T14A 3IL8A 3I2ZA 3S9WA 1CI3M 3H0GG 1JWSD 3NTKA 1IYUA 1HNZH 4J9RA 2R92H 4I7ZC 3CCUA 2OT2A 3A5UA 3T1YL 4LNQA 2HDMA 4C5AA 2EPBA 1VQAA 1CA5A 1B6RA 3A74A 1WTOA 3MFHA 4J15A 3HB9A 2JEBI 5C5MA 3QIAA 3FEWX 1NJIC 3HOZB 3DWQA 3J80i 5M3MG 1ICFB 3BA9A 3MWYW 4QY7A 1LABA 1SMYC 3PO2G 1PH9A 1Y1WG 2H1EA 3J7A5 4F88A 4GOPA 4A75A 4JVZA 2L9HA 1N34L 2UXDL 5KG0A 1C9OA 2L0CA 4TSSA 1PZKD 3KK7A 1O7YA 3KLRA 4AYBB 2JQOA 2WAQG 1BCPB 4NDXA 2O5IC 2W6MA 4DR4Q 1U9RA 1VQFA 1Q90A 4ZUJA 2VQEL 5L1IA 1E4EB 5DG7A 2D0PA 2XWBB 3ND8A 1EYDA 3M9NB 4N8X1 2AWNA 3JC66 5E4WC 3BYYB 4B3MQ 1X3EA 4APMA 1CKOA 1CK1A 3TEHB 1D6EC 3S1MB 2YL2A 1Q1EA 4NXMQ 1QVCA 4DV1L 1B9NA 3TZDA 1BOSA 3VR6A 2WKCA 4LH6A 4DUZL 2R6FA 5C3EG 1EYCA 4FF3A 4RB1A 1NTGA 2KUMA 1R4QB 4JCVE 2CH4A 4XYOA 3GTQB 2R8GA 1UEAB 2A6HC 4BY1B 2UVWA 1EIGA 5CA1F 1Q7YC 4DR1L 5I9OA 4MHEA 3KAKA 3V2TA 2R84A 4TUYF 4HYKA 2M2LA 4AH6A 3AU7A 1T3NA 4OGQC 3JAMi 4ZYSA 4EQPA 1SEIA 4GOPC 3GLKA 4X66L 4LUZA 4JK1C 4JI7Q 3F2DA 3U58A 2L15A 1RTOA 5J22A 4A4IA 3Q0AA 3HOZG 2W6NA 1F9RA 4J8QA 1TWFB 1CFMA 3KJOA 1ICWA 4RG1A 1PXUA 2FPGB 1EU3A 1EQVA 2KVMA 2JP1A 4XYLB 2VQDA 1DOLA 2YTVA 5F9LA 2JJQA 2UU9Q 4DGZA 4YCUA 4LWCA 2QCPX 2NZHA 1S68A 4AYBG 2R7ZB 1IBLL 2YTXA 3GV5B 1NBWA 1AEXA 3AB9A 4RNOA 1G2TA 1HFNA 1XNQH 5ISRA 3ETJA 1VQ4A 4IWYA 4JUZA 4ED8A 4DAMA 4C3IB 3RB4A 4IZ8A 4RAUC 1OXXK 3QZ8A 1NMGA 4BWGB 1JMCA 3T1HQ 1HR0L 4NLGA 2FLNA 4DL3A 4APVA 3WOFA 1SEBD 1KEEA 3GTLH 4WJ4A 2I87A 2NVQH 2Z9HA 2B8FA 4OONA 4UHVA 2XCPA 4ECTA 1D8LA 2PQAA 1A0IA 1F9QA 3C1EA 4A93H 1GHJA 2PO4A 4DV3Q 4JV1A 4IFDH 1L1OB 2C22A 4CKBA 4CC6A 5DAUA 3PUWA 1VAJA 4BXXH 1II3A 2VUMG 5I2YA 2JSOA 2SOBA 2CQAA 5I6WA 4BA2I 3RV4A 2V4QA 4XTCS 4R8UB 3OWEB 3VDYA 2YU9B 1XNRH 2UUAH 1EUCB 3GO5A 2R93B 4IO9A 2KECA 3MJFA 2YW2A 4WRDA 2GN5A 2F4VQ 4IALA 2B63A 4MTNA 1I3QA 1LTLA 2NN6H 5KYIA 2CHBD 2XRSD 5J2UF 5COYA 2XCAA 1LACA 4R8NA 4AQYH 1LTRD 4UDUC 3HP3A 1HH2P 2F0PA 1BDOA 1SNDA 1E1TA 4HSVA 1JE4A 3PIO3 2IY5B 3L7ZC 3GV6A 3PIPA 3Q8QB 4JI6L 5M9OA 3TBIB 1SR3A 5C0XH 1R9TH 3R5FA 3C0FB 5IGEA 1JT8A 4C3IG 3CC4A 1HQRD 1STBA 3JAML 1GLVA 2RDIA 3BVGA 2ICEC 5LMUH 5FD5A 1FL0A 4DV5H 2A68C 4ME5A 4Q45A 5EOYA 1SNOA 4KV6A 4X62H 3PO3B 2R7DA 4XQNA 2CW0C 1W6KA 4DF7A 2R85A 2Y0SB 1QG7A 1GO3E 2E5LH 3BVZA 4KN4C 2WB1A 1M8AA 3M3YB 1D1IA 3B6YA 2K05A 4IWXA 1JLLB 1K3RA 1Q3LA 4EGVA 2R93G 1VQEA 2RVLA 4PV1C 1JE5A 2CQYA 4DUYL 1E22A 5BR8Q 5CV6A 4J9LA 4LSXA 2QK4A 2ZTCA 1K28A 3M85A 5A2QW 2YS6A 2ZTEA 1CQVA 3VR5A 2B8GA 4ED1A 1TWGB 2WB1E 3VA5A 3KF6A 1B70B 2ATLA 1KD1C 3V4ZA 2XC9A 1CM9A 2DY8A 2RCNA 2PVPA 3BAAA 4CGYB 4MV3A 2VL6A 4WJ3M 4LF5Q 2NVTB 1J5EL 1I6HH 2K5VA 4E4TA 1NR4A 2ASDA 5GAHC 4DV7H 4YWLA 1KRSA 4WJWA 4B3TQ 3CKIB 2HGSA 4O3RA 3CU7A 1Q8KA 5J3BA 1P8LA 2L1BA 3FDTA 5C4XH 2EY5A 2AU0A 1UE7A 5DLQE 3NBIA 1QE6A 1EIHA 2K7VA 3X3MA 2VOBA 1HNXQ 1SFOA 1I4PA 2IL8A 2SDFA 4HAEA 1B3QA 1IOWA 3BJUA 5IYBG 2OQKA 1RD9D 4OHJA 4EGQA 1IW7D 2H5XA 4YHHL 1CKMA 2Q2IA 3NWSA 3CW2C 4JV2A 1G91A 2EJMA 5K36H 4POGA 4EEYA 4ZQ3A 1DV1A 2EOTA 5FOBB 5KFDA 2NVYB 5LMUL 2XIWA 1XPOA 1SAPA 1JWMD 2BE5C 3C1FA 1JCKB 3GP7A 3VPDA 2R7NA 1N33H 4PMCA 4X65L 5L1JA 3T5JA 4DV5L 5LMNQ 3A8IE 1RJQA 2RF4A 2QW7A 3GTGH 2ZM6Q 2A19A 2WV6D 4DR3H 1SBBB 3N44B 4A3KH 3S1NB 3WO0A 1WTPA 1N32Q 5KG3A 1P16A 2R61A 1AFPA 2CWAA 3OHBA 1PA6A 3MTSA 3GIPA 1KC8C 4M9UA 4GC7A 3FKIG 4A3GG 2RA4A 4G3IA 4MTDA 2F3WA 2FK2A 4P72A 4I7HA 2A69C 5DGBA 1C4QA 2F3IA 2GPWA 2AWOA 4RZQA 4FDBA 5IE8A 5M5XH 1BXRA 2K04A 2ASBA 1DD2A 1K0SA 1MJEA 3BDCA 4GC6A 3D0FA 5GQOA 1UE1A 3NENA 1XPRA 3T16A 2C2RA 4F7XA 4LUOA 2UUBQ 2FMAA 4K5WA 5IYCG 1Z2NX 1I4QA 5IIFA 1PH2A 3OHXC 3CQZB 4RB0A 1EOTA 3MA2B 2RHQB 1PX2A 3VYRA 4NKLA 1KHIA 1IYJB 1PTOF 2B2VA 4BBRH 1U4PA 2L11A 2PW7A 3DWPA 3I4NH 3ORQA 2XGTA 4JW0A 1GVPA 4U7CA 2UXCQ 1E0BA 2HQEA 2MJ8A 1CZGA 5CBAE 4O3PA 3GTOA 2ZJTA 2W6OA 4DR4H 3WO1A 3UFXB 3FPUB 4QB4A 2DPJA 5D65A 3WDNA 4X6AH 5EBCA 3K7AB 1PZJD 1H9RA 4LF8L 2ATWA 3Q8RB 3CD6A 3QOLA 4GLVB 2ALYB 5FLXW 4RGMA 4BBSH 4A3CH 1EY9A 3SHLA 2B2TA 4V0BA 4LFBL 1WTHA 3FHWA 2BA0A 2VQFQ 4A3MB 5GADC 4TQSA 2DJFC 1FVIA 1ZKOA 1V1QA 1EWIA 2EYFA 3K3PA 2YCHA 1JOKA 4UP9A 2DZDA 4N8FA 2DGYA 4BWSC 1BCPF 4C3JH 4EGJA 3VMMA 1TY0A 1YHAA 1MSHA 4CDDC 4Y52H 4C2MH 2B2VC 1PLFA 5L1LA 4JI7H 1WTQA 4ECRA 3C3LA 4OL7A 4RMFA 2JA8B 1PFBA 2NU9B 5KT5A 5IY0A 2IHFA 5IP7G 1E4FT 2XCLA 2FLLA 4QGUA 1FKAH 5GROA 3UE0A 1BBWA 3JAMc 1MGSA 1EWHA 3MXNB 4QWBA 5D1OB 4BY7B 2J6SA 2RQXA 4EYIB 2CKZB 2VZAA 1SNMA 3G4SA 3I91A 1M90C 3Q8SB 2B2TC 4HSPA 5GONF 5JQWA 5I4DA 4LFAH 4RA8A 4UPAA 1VQNA 3GILA 1EYGA 2KA7A 1LO5D 5KFOA 1X3QA 3CCLA 1I6UA 1BKBA 1JR0D 4UCSA 3J7AK 1C7YA 4CJ2C 3H4DA 5FO8B 3EFXD 1KLUD 1DZ1A 4DR4L 2QEJC 3P20A 2BCOA 5FLMG 4A3MG 1XMQQ 3VR4A 2IX1A 4DV3H 3N8DA 3BG3A 4B3ML 4RUAA 4LF6Q 3GTJH 4KJNA 1W2BA 3PF4A 4O4HF 2JA5G 2OQ0A 1GHKA 4NXML 4YY3H 5KFHA 4CHTB 4GKKQ 1NE3A 4R4IA 2AQ2B 1Z6HA 4DR5Q 1VQ7A 1JB7A 1LTBD 4QWAA 3K57A 4DR6H 1HFGA 3HG9A 2JA8G 2AGPA 4F4WA 1EL0A 1PTOC 2XN9C 2OTJA 3RLNA 4L8JA 4EBDA 3GD7A 2KQ3A 2F0VA 1GXDC 4JPBW 3OWFA 3UDIA 1YJWA 4LF4H 4IFDJ 4O3OA 2BE5D 2R92B 1HZCA 1O75A 4G57A 4BY7G 4DL7A 2UVVA 4JI7L 4RCNA 4J0MA 4MNOA 5IWAQ 4LF9H 5M3FB 2ZDGA 3GTQA 1PYSB 5EPKA 4DN4M 3TMEA 2IA6A 1KJJA 1WCMH 3RBEA 3MEHA 1XMOQ 3HOVH 3R23A 1UNSA 3J81E 4TV9F 2EYPA 3PV0A 1SNPA 2D5DA 4LAAA 2UU9L 3N43B 4ED0A 1V1PB 2I07B 2J0TD 2PI2E 3FP9A 2P0AA 2XRQD 3LMLA 3TS2A 3WOEA 2VB2X 1AH9A 4RUCA 4JG2A 3DM1A 2WKDA 2B63G 3TREA 1EUJA 3CXCA 3GIJA 3GV8B 2A69D 2I80A 4ME3A 3MZ5A 1TWHA 5KFXA 1QVGA 2WTFA 3UE1A 2MP1A 4M1UB 2QDLA 3OPOA 3S24A 1HRJA 1JJCB 2Z6BA 4HN7A 5D3IB 5CBEE 3T1HL 2DUDA 2MQHA 3PIP3 1F2LA 3OUUA 1Y8NB 5KGUA 4J9PA 3F8TA 5C0XJ 4EBCA 1X32A 1S10A 2R7ZA 3PUXA 5EKLA 1O78A 2HJWA 4DV3L 4JI0Q 3NBHA 3JZIA 4JV0A 1A2UA 5BR8H 2EY2A 4DV2Q 1YEZA 1BR9A 4A3IH 3KOJA 4QIWA 1EIYB 5L37A 2ENBA 3IRBA 4IPDA 2WINB 3HOXH 4LF5H 2PZUA 4XXEA 1JICA 4LJZC 1GGOA 1UC8A 4R9WA 1EQTA 2F4VL 4X3UA 4QIWE 5GAEC 1L1OA 3TQYA 1VQOA 3FMCA 4B3RQ 3QB3A 5KT3A 3HOYH 1D5XC 3CPWA 1GSOA 4F4XA 5KFZA 4O3SA 5C8YF 1I4GA 4DAVA 2FK1A 2M00A 1PYBA 1YNXA 2MHVA 3D31A 3MXGA 4N9TA 4DAYA 3RNUA 1PH8A 2YZGA 2ZT9C 4S3SA 2QILA 1YHBA 5DLFA 2W7PA 3RBDA 4I4TF 4FO2A 3K0YA 1F77A 2YZMA 1QUQB 1F2YA 2KHSA 4KHVA 2EDGA 3KJPA 1GUNA 3CC7A 4RGNA 2LY7A 4K2LA 4OX9Q 1ML0D 1KTKA 2YYAA 4IQZA 1UWVA 1I50B 1EWCA 2JN4A 2NZ1D 3KF8B 4QCLA 1EFWA 4A3FH 1BGWA 2F0DA 4H02A 4K8JA 3V6HA 4IRKA 1K1SA 4GNXB 1CTMA 3SK5A 1TWCH 2O5JC 5CMDA 5BN3A 3GTLB 3E0JA 1U4RA 5JPMC 2NVQB 4YP3A 3OHAA 3T1YH 3BZCA 2HIXA 2JA6B 4BA1I 4NXNH 4A3BH 3MVVA 4JI2Q 2PMZE 4KKUA 1IL8A 5KG1A 1D5ZC 4JI3Q 2A8VA 1IZ6A 2EYJA 1K1QA 4XZ3B 1STEA 3KLSX 4MV8A 5BR8L 1BBXC 3L4KA 4LF7Q 1B2TA 5NUCA 2FMMA 4JI8Q 4ZCKA 2UXDH 2HIVA 3PUYA 3N42B 1SYXB 1VQLA 1ULZA 5LL6S 3RLOA 3NXWA 4LF5L 1CKNA 5M3MB 5JH7F 1EZ8A 1KRTA 5KNBA 1SYGA 3S17H 1MHWC 2FB9A 3BYTB 2FINB 2N3SA 4B3TL 1Q46A 2XIGA 2UUBH 1I7NA 2JK8A 1PRTB 3KLWA 1BNZA 3GTMB 4OWWB 1K73C 5G3LD 5HV6A 1I3QH 4KD3A 4GN4B 1G2SA 4PG3A 2WAQB 4DV1H 1JWUD 4IUPA 5DLGA 4DUZH 5CC4A 1HPCA 1B04A 1HNXL 1R9TB 2OXPA 4YAJB 1IBMQ 1KDCA 4OIKA 1WSCA 2F0NA 1TS4A 1HNWQ 1KNEA 1K8AC 4Q8EA 3TP7A 2UXCH 2OTLA 2KHIA 4WBNF 4DR7Q 4DR1H 5KNCA 1RTNA 3G8CA 3G6VA 2E74C 3KYHC 1KQSA 1H9SA 3J7ZC 4A93G 1PH7A 5C3EB 4IFDG 3RIZA 1Q8IA 3RZOH 1AN8A 2F4IA 1WCMA 5EKIA 4BXXG 1JXLA 3K7UC 5LMNL 3PUVA 5E7NA 1UEBA 3DWAA 2RDJA 2WYOA 5HY6A 1BO0A 2ZM6L 1LTAD 1PH4A 3F8NA 3ERSX 4A3DH 1TVXA 4EYHB 2NVXA 2EXZA 2CWPA 4YIJA 5KFNA 1PVOA 4O3NA 3H6MA 3OUZA 1B9MA 2Q8RE 2N88A 3U50C 1NMFA 5KT2A 1ZETA 3GIQA 1IBLH 1BBUA 4DXGA 2NN6G 2L55A 1E4GT 5KFRA 1BCPD 1SJHD 3OIPA 3VPBA 4FNFA 3GTPA 2NTSA 3V6JA 3BZDB 3RLFA 5IT9L 5FD6A 1U4MA 2LXKA 3NWTA 3IG0A 2PQEA 4Q43A 1HR0H 1CA6A 2JA9A 5IGCA 4HQ6A 1QJOA 4XQJA 4J6HA 1WD1A 5C0XG 1QNKA 4Q8FA 2LSSA 2NUAB 1V8QA 1WYDA 3CP0A 3LWEA 2UUBL 5C4XB 5LL6b 2R8HA 2HCIA 4FF4A 4KY5A 4KMUC 4PZ8A 4UY8C 1ILQA 3PW2A 4YR3A 2J7ZA 3EPGA 2B2WA 5LA6F 3CCSA 3CPFA 1M4VA 3H15A 2F0UA 3S15B 4J9NA 2M9VA 2DPIA 4YQWA 4C3HH 3PQIA 1DM0B 1T9HA 1RF2D 5A35A 2EXDA 2UXCL 1FD7D 1IW7C 4U673 4OEMB 2GLTA 1SFOH 5KX5F 1VQHA 2E2IA 2R7KA 3E0EA 4MN3A 2V58A 2ZDQA 2VUMB 3JRXA 3RV3A 1S5ED 2UXBQ 3N40P 2QKIC 2HT1A 1K83H 3CQZA 1A3UA 3GTGB 3I4MH 1E7ZA 3D4RA 3RN2A 5ELFA 3RZDH 2BQRA 1MD2D 3RAXA 1A6XA 3TZUA 4FBUA 3GTKA 4KTAA 4A3KB 4GKKH 3HOUH 2R82A 2VQFL 4JI6H 1VDZA 4O4IF 3ZYYX 3S14H 4IR9A 4K14A 3CCQA 3MR6A 4N9PA 5KG6A 3HKZA 2F0GA 2A6ED 2B2WC 2ZXOA 4ECZA 1IBKQ 4FS1A 1Y1VA 4TRDA 2MO0A 1TWCA 2KCCA 3MAQA 1RYRA 4UP8A 2Q2TA 4HMIA 5JVG3 5CV5A 2F0EA 1O7ZA 3EPIA 4K6DA 5M5XB 5C4XG 1MKHA 1NSNS 2BA1A 1S5DD 5EJWA 3HKZE 1XMOH 1CQFA 2DN8A 2BDOA 3I70A 4B9WA 1NCVA 1X55A 4DV0Q 3N41B 1B3AA 1TKWB 3J80L 4ZAIA 2VPSA 3ORRA 5KG7A 3RB0A 2R86A 4EQ5A 2W9CA 2L5TA 4HR7B 3OSPA 4DUYH 5CV7A 5K36G 1KBLA 5KEEA 4JYAQ 5CGKA 2K5QA 5JAVA 5IYZF 5E3FA 3JSNA 4BBRB 3SXHA 4KHPQ 3KDFA 3J7YW 3PR4A 2K33A 1HJPA 3MWDA 4FVMA 1RK5A 2MO1A 1VQBA 4HJ8A 1QCBD 1J5EH 3H20A 1ESFA 3PF5A 1EQRA 5D1OA 4GZYC 1JIHA 4HCEA 2X0SA 4A3KG 1DCZA 3Q8PB 4QQBX 1YBYA 1X3PA 1VMCA 1KABA 4FP5D 3MC0B 5IGGA 1XMQL 1T36A 3AEVA 1GSAA 3SDZA 5LHY1 4X64Q 3G71A 3H91A 3GTOH 3OOCA 4LF6L 5FJ8H 1PK8A 1OXVA 5M5YB 1SLJA 3K5HA 4L5RC 1CQJB 1FR3A 2ZJRA 4GKKL 2EZVA 1KNAA 1IKLA 1AE3A 4RWSC 4DR5L 4XX0B 5KYLA 1V51A 2AGQA 4C3JB 3M4IA 2FPPB 3ND9A 2OCEA 4M7EA 4YHHH 4MV9A 5IYDH 4C2MB 4ECWA 1LV9A 1V4YA 2IHEA 1SN8A 4JI4Q 1STYA 3A5ZB 5KFCA 4H0LC 5C4JH 4A2AA 1XX8A 4X65H 4DV4Q 4JI5Q 2IX3A 3J81W 1MSGA 5IWAL 3FMAA 5KFLA 3G48A 4YB8B 5FPOA 2M05A 1MJCA 2OF1A 1NUCA 3I4NG 4BBRG 1T5EA 2AHOB 1VQGA 3PGZA 1XMOL 2HHHQ 2PPBC 1C30A 4ALPA 5KFEA 3R2TA 5DGAA 3OTOQ 4OX9H 1DYQA 4KK7A 4RB2C 4NXNQ 4MV7A 2GVBA 4DV6Q 1RIPA 2JXMB 2UUCQ 3HKSA 4IHJF 1CHPD 2PYKA 2PNRC 3LWBA 4K5VA 4Y8VB 5M5WB 4A3EH 3RGZA 4TQRA 4BBSG 3CHBD 3I55A 4A3CG 1HHVA 1PTOH 3FPPA 1T94A 4F4YA 5EZYF 2KEDA 2YZNA 3JRWA 2E2HB 1CQIB 4JI1Q 2WP8J 5JVH3 1K3BC 3FKIB 1X3FA 1F9PA 2JA7A 1V1PA 4A3GB 3GTJB 3SK8A 3G6XA 1Y8OB 3U9SA 2K4KA 5CORA 5JVDF 5EWFA 5CR3A 4C3JG 2KHJA 3J80E 2YYZA 4OWXB 4H13C 4DV2L 5IGBA 5IT9c 4O1NA 2VW9A 1X56A 1N36Q 3S2HH 1JC7A 1JQYD 2AUJD 1EIFA 3RB6A 4DL5A 1L2ZA 1KJQA 1A8VA 2K6AA 4OIJA 4B3SQ 1H95A 2N78A 3HOWH 5BMVF 4GLAC 2O2LD 2D0OA 1K83A 4Q44A 1K0RA 3P7JA 4M8AA 3RF2A 4B3RL 1M0TA 1LTID 4LF8H 1PDQA 1M6VA 4ID6A 4DPGA 3STBD 4ME6A 3JSLA 2B2UA 1FGUA 4KN7C 3K59A 2LFNA 2E76C 1GUTA 2MPMA 4R4TA 1WTRA 3HOVB 2EQSA 4L5QA 1HTPA 4LFBH 1Y8PB 3M9BA 2BH2A 2CFMA 2OH2A 1A62A 2R6GA 4NP5A 5JUMA 1KC7A 5D8DA 4ED3A 1SNCA 4DR2Q 1EZ1A 1GUSA 2G5DA 2N49A 3GTQH 4OX9L 3KALA 2VXWA 4BY1H 1SXTA 2WACA 1PH3A 3PW0A 1EEFD 3U4ZA 1KJIA 3JAME 3BZKA 4IUQA 4G7HC 4DK3C 1WD0A 2EVBA 2XVSA 2O03A 4OELB 1A3TA 1UNNC 3KXYT 3I4LA 4JC0A 4GOPB 5H80A 1EEID 3MFIA 1DIKA 1TWFH 2F0JA 3S16H 1TWHH 3SK6A 4JI2L 5C4ZA 4IRDA 3IFTA 4ECVA 2NZOA 1I50A 2V5AA 4JI3L 1ASZA 1B53A 5G3LF 4A3LH 3FDSA 4K0KQ 2DWCA 3CAMA 3TSSA 2AKWB 4CKCA 4LFCQ 5T1GA 4RGTA 2R7ZH 1S0OA 5KFUA 3HOXB 4LF7L 3M4PA 4J9SA 4ZLTF 5KIXA 4JI8L 1IHZA 2JA6A 1VBHA 5E4XA 3J80c 2A5HA 2HVSA 3X3NA 2F0KA 4J9KA 1WCMG 3HOYB 3HOVG 1VQMA 4YJ2F 1EY4A 3G6YA 3H0GA 4RAYA 4K6LA 5FO7B 5IGFA 4P74A 1G51A 4DK6C 4MV6A 5KFAA 4B3MH 3T5KA 1L0YB 1F2MA 4R8IA 3ULJA 4NXMH 3Q6SA 1AE2A 5CV8A 1K8OA 1DGSA 4ZHQF 1IBML 2KBNA 1RDPD 2KCNA 1HNWL 4MA0A 1SNQA 2R8IA 4XIGS 2D9UA 4ABNA 2GPSA 2IWHA 1JKJB 4DR7L 1Y1WA 2UVRA 1A2TA 3A7LA 4FF2A 2JA5B 2VR1A 1F9SA 2ICIA 3KTMA 3GTMA 4NB3A 3KHLA 4K5XA 2F1MA 3BJYA 1EU4A 1STGA 3A54A 2WAQA 3S1QB 4QWDA 4C1NK 4DNTB 4A3IG 1HNZQ 1W96A 2HDLA 1GSHA 4V190 1E2ZA 2KENA 4A3BB 1N8RC 1CSQA 5C4HA 2K1BA 1QZGA 5ELOA 4PMBA 5CYUA 3I73A 1B1ZA 3RD4A 3HOXG 3J7AV 2K01A 1O7LA 4Q5VA 2EJFC 4KY6A 2EIFA 4YJ3F 2UU9H 2BDNA 2D62A 5BN5A 3P75A 2NU6B 2PQAB 1QOHA 1WJJA 1IBKH 2BOSA 2E8GA 1X3GA 3MFGA 5JEAJ 1Y69U 3HOYG 5ELBA 5A2QL 1CZWA 2RKSA 1WOCA 3RGXA 5KG5A 2K52A 3CCVA 3SE7A 4HNUA 4O2AF 3R93A 3UDXA 4ZKCB 1Q81C 2HUGA 1OXUA 1TS3A 1V43A 2AMCB 3K81C 1RODA 2PNHA 4RKLA 3T1HH 2XTIA 1SYEA 5E1FA 1VQ8A 3KHRA 4I65A 2VY3A 2ZTDA 3A55A 1VQ5A 4R7RA 2B63B 1I3QB 4CBVA 4UCTA 4L1KA 4P71A 4DLKA 1TWAB 3GIKA 2VUGA 5FO9B 1JOQA 1YNJD 1ZYRD 3RN5A 5KFYA 4XQQA 1SROA 1HQMC 3HKZG 4A3FG 4MTEA 5EWEA 4NW2A 4AYBA 4ZI7F 1AUVA 3E3XA 1GUOA 3OYYA 3RFCA 4HIMA 5FPRA 4CC5A 1TQOA 2VNUD 2F4VH 3I90A 2XWJB 4A3BG 1E4EA 3NGDA 1VCIA 4F8MA 5KG4A 2RSNA 4QF4A 2UXBL 5DEHA 1M0WA 5KNDA 4YCWA 2G9HD 2A74C 5KFGA 2HQLA 4FXGC 1S97A 2W8KA 4A3DB 4RNNA 3T5LA 2CW8A 3A56A 3RUPA 4QWEA 5C44H 1B8AA 2SNMA 3S2DH 4QW8A 2YV5A 2IP4A 2WB1B 1LM0A 4RU9A 5F9NA 2C9OA 4KJOA 1Y14B 1LTTD 1QILA 3HRZC 3H09A 1IBKL 4UCOA 2NVXH 2JEAI 1XNQQ 2KEEA 5LXTF 1BCPC 1TWFA 4DV4H 2RGRA 3GTPH 1R4PB 3T56B 5JJLA 2D2CC 2BQUA 1J8IA 4DV0L 4U68A 1H9MA 1VS0A 3S1NH 2Z6KA 1WI5A 3PUZA 1I94Q 4DL6A 3GIMA 4LMQD 2H4OA 2UUCH 3E5NA 4JYAL 3UDFA 1S0MA 3HS0C 4C3HB 3M4OH 3MXUA 3Q1KA 4KHPL 3PIOA 4IPGA 1LT5D 1XNRQ 5A2QE 2UUAQ 4CJ0B 2RDGA 1SFOB 4LMYA 1B44D 3T4AC 5C3XA 2CZGA 4IUUA 4KY7A 4A3DG 1SE8A 2DNCA 5K2MA 3CMAA 3LX0A 3F2CA 4B3TH 3SI8A 1U4LA 3Q2OA 1XDNA 2V1CC 3EBEA 4CKEA 3CCRA 4AQYQ 4X64L 4ZOLF 1JOOA 2WB1G 4GN5A 4C56C 2E2IH 1M7JA 5JPNC 4ZQIA 3EN2A 4A3JH 5FKAC 3SGIA 2NU7B 4R8UA 5FLXL 2YU9A 4DFAA 4RHRA 1HNXH 2F0OA 3CQZH 5HURA 2R93A 4G4KA 3S14B 1SMXA 2Z6KC 2EYLA 3ULPA 3R5HA 1XPUA 2GVAA 2HCCA 1ONLA 3GTKH 3N6XA 4EQNA 3KHHA 4MIUA 3K5NA 1PFMA 5KFSA 1TAEA 4EVOA 1D7QA 2A6EC 2K75A 4JI4L 3M7NA 3MR2A 2DJGC 4HIKA 4JI5L 4DV4L 5LMNH 4E6IA 4X62Q 1Y1VH 2R7FA 3UI2A 2ZM6H 1L1OC 1O80A 1K8GA 2E5LQ 1EHIA 4QW9A 4C3HG 3NTHA 3F2BA 4A93B 2HHHL 5KFFA 1N32H 1UUPA 4CDCC 3OTOL 5KFMA 3W3AA 3VYTA 4NXNL 4DV6L 3K5LA 3BDLA 3NEMA 2UUCL 4UAIA 3EQLC 5I2XA 2J6UA 1SYCA 3HEJA 3I4MG 1Z47A 4RNMA 3IKJA 3PR5B 1PRTD 2Y0SA 1RL2A 3HOUG 1HR0W 1X54A 4P75A 1DOMA 4HNVA 3TP6A 4JI1L 3CVZA 4KLKA 4DV7Q 4EFBA 3GTOB 4FXKC 2NTTA 3VPCA 5ELDA 3BS1A 3OW2A 4K0KH 3VYSA 2Y0SE 3K0XA 1MI2A 1TWGA 1V1OA 3S1RH 5J2TF 1NY4A 4Z9CB 3BABA 1XXGA 3PVXA 4RFBA 1N36L 3IN5A 1C48A 4FBTA 2NUCA 1F2ZA 2A73B 3V05A 4Y7NH 1AP0A 1A3VA 1Q1BA 4B3SL 5D3DA 5KFWA 3SR1A 5DNFA 3SE0A 3FKIA 2W6PA 2BR0A 3ICEA 2E2JH 5KFQA 4J9QA 3RR5A 1GUGA 1VQ9A 3PW5A 1E3PA 2PZWA 1PH5A 3K6OA
chains in the Genus database with same CATH topology
3KF6B 1N33Q 3AEVA 1MJEA 3CCMA 4POFA 4L5TA 1G291 3CCJA 3D0FA 4X64Q 5GQOA 1UE1A 3NENA 3G71A 1XPRA 3GTOH 4LF6L 4LUOA 2UUBQ 3BU2A 2ZJQA 3HFZB 5FJ8H 5IYCG 1OXVA 4DR3Q 1QZHA 1SLJA 1PV4A 3Q8DA 4L5RC 2ZJRA 1PH2A 1C0AA 4GKKL 4JV5L 4DUYQ 1M1KC 3ER0A 1YHQA 1AE3A 4DR2L 1VQDA 2RHQB 4DR5L 1N32L 3GDEA 2I0QA 1U0LA 1XTDA 1KHIA 3A0JA 1IYJB 2OCEA 3I4NH 4BBRH 4IPCA 4LFAL 4P73A 3I56A 1XJVA 5IYDH 2XGTA 1GVPA 2UXCQ 2IHEA 1SN8A 3KFUA 5IP9H 5GAGC 4JI4Q 3A5ZB 5FJ8G 1J5EQ 5C4JH 1Q86C 4X6AH 1OXSC 1JJGA 4DV4Q 1Z9FA 4JI5Q 4LF8L 5M3FH 5IWAL 1TXYA 4AIMA 2ATWA 3G48A 3I7FA 3CD6A 3TRZA 4GLVB 2ALYB 4DKAC 1MJCA 4BBSH 4A3CH 3I4NG 4BBRG 2AHOB 1VQGA 3PGZA 1XMOL 2HHHQ 4LFBL 4GN3B 3FHWA 5IYDG 4ALPA 2BA0A 3J81j 1VQ6A 2VQFQ 5IP7H 4K0KL 1E24A 3E9HA 5GADC 1HZ9A 3OTOQ 5IP9G 4YY3L 4LFCL 1FVIA 1V1QA 2K5HA 4HJ7A 4NXNQ 2JA7H 1EWIA 2R92G 2GVBA 4DV6Q 1RIPA 5H1SE 2K14A 2UUCQ 1WFQA 3HKSA 1X6OA 4UP9A 4DR6L 2B3GA 1YZ6A 2DGYA 4YHHQ 4C3JH 1YHAA 5M3FG 4DNIA 4Y52H 4C2MH 4A3EH 1SRUA 4BBSG 3I55A 4IOCA 1JJ2A 4A3CG 4RMFA 1W3SA 4LF4L 2N8NA 5LMUQ 5IY0A 4GKJQ 2IHFA 5IP7G 4JI1Q 2WP8J 1YIJA 3K7AH 4X65Q 1MIUA 4QGUA 1X3FA 1L0WA 3G6EA 4DV5Q 5GROA 3UE0A 2JA7G 2ES2A 1BBWA 1CUKA 3JAMc 4LF9L 3MXNB 2K4KA 3STBC 2I5LX 2KHJA 4LUVA 2KCMA 4O2DA 2YYZA 4PZ6A 4OWXB 3U4VA 4DV2L 5IT9c 2VW9A 1X56A 1GM5A 2CKZB 1B7YB 1LUZA 2VZAA 4A3EG 3G4SA 5FLMH 4A3MH 1M90C 2I5MX 2RHSB 1N36Q 3WWVA 3S2HH 1S3OA 1EIFA 4R4QA 1UE6A 2E2JH 1A8VA 3I4OA 4R1JA 1S72A 4UPAA 2N78A 4B3SQ 1VQNA 3HOWH 5JEAG 3W5OA 1EYGA 1H95A 1UE5A 2JA5H 4GLAC 3J81c 3CCLA 2D0OA 1BKBA 1K0RA 1C7YA 4JBKA 5FLXc 4R4OA 4HIOA 2MFIA 4R4CA 3S1QH 4B3RL 1E1OA 5AJ3L 1VQCA 1HNZL 2JA8H 4DR4L 1XMQQ 4DPGA 5FLMG 4A3MG 4PMWA 3STBD 2IX1A 3L2PA 4IFDI 3ZJYC 1FGUA 2IT1A 1VQKA 3CMEA 4OO1I 4B3ML 2MNAA 2Z0SA 4R4TA 3GTJH 1W2BA 2EQSA 4LF6Q 4L5QA 1L2FA 3M9BA 2BH2A 3HOWG 3PF4A 2CFMA 1Q82C 2JA5G 1X65A 2OQ0A 2ZJPA 4HJ9A 1A62A 4BY7H 4NXML 2R6GA 4GKKQ 1NE3A 4R4IA 4JV5Q 1OTCA 4DR5Q 1OXTA 4DR2Q 1JB7A 2N49A 4LW1A 1EQQA 1VQ7A 3GTQH 4OX9L 3NBHB 4BY1H 2JA8G 1PH3A 1I50H 4UP7A 5ELNA 4JBWA 4LFAQ 4A76A 2OTJA 1YVCA 3RLNA 2F52A 1KXLA 3U4ZA 2NN6I 3GD7A 3BZKA 4DK3C 3UDIA 2C35B 1YJWA 4IFDJ 1HZCA 4BY7G 2OWOA 4JC0A 4JI7L 4GOPB 4LF8Q 3H3VI 4MNOA 2JA6H 5IWAQ 1TWFH 2B63H 3S16H 1TWHH 1PYSB 4JI2L 4BY1G 1TWAH 2NZOA 4IPHA 1WCMH 1XMOQ 5C0XI 3HOVH 4LFBQ 4GLXA 3H0GH 4YWKA 4JI3L 1ASZA 1FJGL 1IL2A 4A3LH 4K0KQ 3CAMA 4JBJA 3PV0A 4YY3Q 2AKWB 1YJNA 2UU9L 1CSPA 4NPSA 4DAYB 4L5SA 4LFCQ 4IOAA 3DLLA 2PI2E 2R7ZH 3FP9A 4JOIA 4DR6Q 3TS2A 4LF7L 3M4PA 1AH9A 4JG2A 2JA6G 4JI8L 2B63G 3TREA 1EUJA 3CXCA 4ME3A 1PFSA 3J80c 1QVGA 5M3MH 3UE1A 3CCEA 1IXRA 1WCMG 4OO1G 3HOVG 1VQMA 3I2ZA 3S24A 4LF4Q 3H0GG 1JJCB 4A3LG 2R92H 4GS3A 3PO2H 3CCUA 3T1HL 2DUDA 2MQHA 1Y1WH 3A5UA 4P74A 1G51A 4DK6C 5LMNW 3F8TA 5C0XJ 3T1YL 4LNQA 3H3VH 2R7ZG 2QA4A 3GTMH 4LF9Q 1VQAA 3PUXA 1GD7A 1VQJA 3A74A 4DV3L 4JI0Q 4J15A 3ULJA 2JEBI 4DV2Q 1YEZA 1AE2A 1N9WA 1KAWA 4A3IH 3KOJA 1NJIC 1EIYB 3J80i 1DGSA 5M3MG 3F1ZA 1IBML 4QY7A 2KBNA 3IRBA 1HNWL 4IPDA 4XIGS 3DM3A 3PO2G 1PH9A 3M4QA 4DR7L 1Y1WG 3HOXH 3J7A5 2WFWA 2ASBA 4GOPA 4A75A 4JOIC 1N34L 2UXDL 1XNQL 1C9OA 4NB3A 2F4VL 4QIWE 3W1BA 5C3EH 5GAEC 2JQOA 1L1OA 2WAQG 3TQYA 1VQOA 4B3RQ 4OWTB 3HOYH 3CPWA 5AJ3Q 4A3IG 1HNZQ 4DR4Q 4YWMA 1VQFA 2VQEL 2KENA 2D0PA 1PYBA 1N8RC 1YNXA 1CKNB 1CSQA 3D31A 2AWNA 3JC66 4KI0A 3CF5A 3RNUA 1X3EA 1PH8A 1QZGA 5ELOA 1CKOA 3TEHB 1YHBA 3HOXG 1PH6A 1Q1EA 1I94L 4NXMQ 4JI0L 1QVCA 4DV1L 2EIFA 1QUQB 3KJPA 2D62A 4DUZL 3HOZH 5C3EG 2PQAB 1NTGA 3AFPA 1WJJA 3CC7A 1YITA 2E8GA 3EIVA 1X3GA 3MEFA 4JCVE 5JEAJ 4OX9Q 3HOYG 1Q12A 1VQIA 2Q2UA 2KCTA 1Q7YC 1UWVA 1EOVA 2UUAL 1WOCA 4DR1L 1XNRL 3K80C 2K52A 3CCVA 1HZBA 3KF8B 3UDXA 1Q81C 4AH6A 1EFWA 4YCVA 1OXUA 4A3FH 3JAMi 4H02A 1V43A 2AMCB 4GOPC 3K81C 2PNHA 4GNXB 2XTIA 1TWCH 4LUZA 4X66L 4JI7Q 1VQ8A 3F2DA 3U58A 2L15A 3HOZG 4A4IA 3BZCA 2VY3A 2HIXA 2ZTDA 4AQYL 1VQ5A 4BA1I 2Q2HA 3KJOA 4A3BH 5JJKA 4QL5A 4JI2Q 3UDGA 2PMZE 2BH8A 4RG1A 4P71A 4JI3Q 1FJGQ 2A8VA 3RN5A 1IZ6A 3S1MH 1SROA 4QJFA 2CQOA 2YTVA 2JJQA 2UU9Q 3J81i 5JJIA 5BR8L 3HKZG 4LWCA 4YCUA 4A3FG 1KIXA 3S15H 2NZHA 4AYBG 1IBLL 2YTXA 2JE6I 4LF7Q 2K5NA 1NBWA 3PO3G 3OYYA 2Y0SG 4PZ7A 4JI8Q 4EX5A 4HIMA 2HIVA 3PUYA 2VNUD 2IX0A 3E9IA 1VQ4A 4A3BG 1VQLA 1VCIA 3RLOA 4DAMA 4LF5L 2VUMH 1CKNA 1OXXK 1KRTA 1NMGA 2UXBL 1J6QA 3S17H 3K8AA 3CC2A 1JMCA 3T1HQ 1BVSA 1HR0L 2N3SA 4B3TL 4YCWA 1Q46A 4APVA 3T1YQ 4X62L 2JK8A 3GTLH 3KLWA 4WJ4A 1QUQA 1QVFA 2HQLA 4OONA 2NVQH 1D8LA 2PQAA 2E5LL 1A0IA 4OWWB 1K73C 4A93H 4DV3Q 1I3QH 4GN4B 1L1OB 4PG3A 5C44H 4HIDA 1B8AA 1X9NA 3PUWA 1HNXL 3S2DH 4BXXH 2YV5A 2VUMG 1IBMQ 1LM0A 4BA2I 1HNWQ 1K8AC 4XTCS 3VDYA 2OTLA 2KHIA 1Y14B 3ULLA 1GKHA 4DR7Q 3GO5A 2FXQA 1IBKL 4GNXA 4IO9A 2NVXH 2JEAI 2UXDQ 1N34Q 1XNQQ 2GN5A 1HZAA 3KYHC 2F4VQ 1KQSA 3J7ZC 4A93G 1PH7A 2VS1A 4IFDG 4MTNA 3RZOH 1LTLA 4C3IH 5C44G 2QEXA 4O0AA 2VQEQ 4TQUS 4DV7L 4BXXG 3GTPH 3K7UC 5LMNL 5JJLA 1VQPA 3PUVA 5E7NA 1HH2P 1UEBA 2QGQA 5HY6A 2ZM6L 4DV0L 1PH4A 1V9PA 3ERSX 1VS0A 4A3DH 1E1TA 2Z6KA 1WI5A 3PUZA 3S1NH 1I94Q 2CWPA 3L7ZC 2IY5B 4DV1Q 1PVOA 3PIPA 4JI6L 1U5KA 3PCOB 3U50C 4DUZQ 1NMFA 1SR3A 3UDFA 1YJ9A 4JYAL 1R9TH 1BBUA 3M4OH 1JT8A 2NN6G 3CC4A 4TVAB 4KHPL 3PIOA 4IPGA 1XNRQ 2UUAQ 2YU9H 4KHZA 4DR1Q 2R93H 3RLFA 3TS0A 4GNXC 4A3DG 1SE8A 2LXKA 1FL0A 3AYHB 3CMAA 3F2CA 2JA9A 4X66Q 2R7DA 1N33L 5C0XG 2V1CC 3EBEA 3CCRA 4AQYQ 1GO3E 4X64L 2LSSA 2WB1G 4GN5A 2E2IH 3AFQA 1WYDA 3B6YA 3CP0A 3EN2A 4A3JH 2UUBL 3SGIA 1K3RA 5M5YH 4HJAA 4OXPA 3NELA 4DR3L 2R93G 1VQEA 3CQZH 1JE5A 4PZ8A 4IJLA 4UY8C 2ID0A 4DUYL 1E22A 1SMXA 2Z6KC 5BR8Q 3CCSA 2WAQE 3CPFA 3ULPA 1S40A 1XPUA 2GVAA 2ZTCA 3M85A 3H15A 1IBLQ 2ZTEA 3GTKH 4C3HH 1T9HA 2WB1E 3KF6A 1B70B 1KD1C 2EXDA 2RCNA 2UXCL 1D7QA 3W1GA 2K75A 4MZ9A 1VQHA 2VL6A 1SFOH 4JI4L 4LF5Q 3E0EA 4A3JG 1J5EL 3M7NA 1I6HH 3KDFB 2K5VA 2UXBQ 5IYBH 5GAHC 4HIKA 1HR0Q 1K83H 4HJ5A 4YWLA 4JI5L 1KRSA 4DV4L 4B3TQ 2HT1A 4X62Q 1Y1VH 2R7FA 3I4MH 2YTYA 1E7ZA 3RN2A 3RZDH 3PO3H 1L1OC 1K8GA 2E5LQ 1Q8KA 5J3BA 1P8LA 3F2BA 3M3YH 2HHHL 3HOUH 5C4XH 1UE7A 5DLQE 2VQFL 2B29A 3OTOL 1HNXQ 4NXNL 4DV6L 3S14H 1G6PA 3BJUA 3NEMA 5IYBG 2OQKA 3CCQA 2UUCL 2H5XA 4YHHL 1K9MC 1CKMA 2Q2IA 1IBKQ 3CW2C 1Y1VG 1TWGH 2K50A 3I4MG 1Z47A 2MO0A 5M5WH 4B3MQ 4UP8A 2Q2TA 4POGA 5HGQA 1RL2A 3HOUG 2I5HA 1HR0W 1X54A 5LMUL 1XPOA 2E2HH 4P75A 2NVTH 4GKJL 5C4XG 1MKHA 4JI1L 1A63A 2BA1A 3FKIH 1LYLA 4KLKA 3HKZE 4X65L 4DV7Q 4A3GH 4DV5L 5LMNQ 3AQQA 2RF4A 3GTGH 4AYBE 1X55A 2LXJA 2ZM6Q 4DV0Q 3OW2A 1ASYA 2A19A 2CCZA 1O7IA 2Y0SE 3K0XA 4A3KH 4EQ5A 1N32Q 3S1RH 4JBMA 1NY4A 1PHJA 3LGJA 4WJ3M 1P16A 4JI6Q 1YI2A 5K36G 4JYAQ 1N36L 2CWAA 1PA6A 4Y7NH 4KHPQ 3KDFA 1Q1BA 4B3SL 5EAYA 1KC8C 3FKIG 1HJPA 5IYCH 4A3GG 2MO1A 1VQBA 4IJHA 4HJ8A 1I5FA 3ICEA 4P72A 3RR5A 3PF5A 1EQRA 2A1AA 2F3IA 1PH1A 1KL9A 2AWOA 4FDBA 1VQ9A 4A3KG 2PI2A 1E3PA 4QQBX 5IE8A 2NVYH 5M5XH 1YBYA 1PH5A 3L0OA 1XMQL 3PSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KF6 B;  1N33 Q;  3AEV A;  1MJE A;  3CCM A;  4POF A;  4L5T A;  1G29 1;  3CCJ A;  3D0F A;  4X64 Q;  5GQO A;  1UE1 A;  3NEN A;  3G71 A;  1XPR A;  3GTO H;  4LF6 L;  4LUO A;  2UUB Q;  3BU2 A;  2ZJQ A;  3HFZ B;  5FJ8 H;  5IYC G;  1OXV A;  4DR3 Q;  1QZH A;  1SLJ A;  1PV4 A;  3Q8D A;  4L5R C;  2ZJR A;  1PH2 A;  1C0A A;  4GKK L;  4JV5 L;  4DUY Q;  1M1K C;  3ER0 A;  1YHQ A;  1AE3 A;  4DR2 L;  1VQD A;  2RHQ B;  4DR5 L;  1N32 L;  3GDE A;  2I0Q A;  1U0L A;  1XTD A;  1KHI A;  3A0J A;  1IYJ B;  2OCE A;  3I4N H;  4BBR H;  4IPC A;  4LFA L;  4P73 A;  3I56 A;  1XJV A;  5IYD H;  2XGT A;  1GVP A;  2UXC Q;  2IHE A;  1SN8 A;  3KFU A;  5IP9 H;  5GAG C;  4JI4 Q;  3A5Z B;  5FJ8 G;  1J5E Q;  5C4J H;  1Q86 C;  4X6A H;  1OXS C;  1JJG A;  4DV4 Q;  1Z9F A;  4JI5 Q;  4LF8 L;  5M3F H;  5IWA L;  1TXY A;  4AIM A;  2ATW A;  3G48 A;  3I7F A;  3CD6 A;  3TRZ A;  4GLV B;  2ALY B;  4DKA C;  1MJC A;  4BBS H;  4A3C H;  3I4N G;  4BBR G;  2AHO B;  1VQG A;  3PGZ A;  1XMO L;  2HHH Q;  4LFB L;  4GN3 B;  3FHW A;  5IYD G;  4ALP A;  2BA0 A;  3J81 j;  1VQ6 A;  2VQF Q;  5IP7 H;  4K0K L;  1E24 A;  3E9H A;  5GAD C;  1HZ9 A;  3OTO Q;  5IP9 G;  4YY3 L;  4LFC L;  1FVI A;  1V1Q A;  2K5H A;  4HJ7 A;  4NXN Q;  2JA7 H;  1EWI A;  2R92 G;  2GVB A;  4DV6 Q;  1RIP A;  5H1S E;  2K14 A;  2UUC Q;  1WFQ A;  3HKS A;  1X6O A;  4UP9 A;  4DR6 L;  2B3G A;  1YZ6 A;  2DGY A;  4YHH Q;  4C3J H;  1YHA A;  5M3F G;  4DNI A;  4Y52 H;  4C2M H;  4A3E H;  1SRU A;  4BBS G;  3I55 A;  4IOC A;  1JJ2 A;  4A3C G;  4RMF A;  1W3S A;  4LF4 L;  2N8N A;  5LMU Q;  5IY0 A;  4GKJ Q;  2IHF A;  5IP7 G;  4JI1 Q;  2WP8 J;  1YIJ A;  3K7A H;  4X65 Q;  1MIU A;  4QGU A;  1X3F A;  1L0W A;  3G6E A;  4DV5 Q;  5GRO A;  3UE0 A;  2JA7 G;  2ES2 A;  1BBW A;  1CUK A;  3JAM c;  4LF9 L;  3MXN B;  2K4K A;  3STB C;  2I5L X;  2KHJ A;  4LUV A;  2KCM A;  4O2D A;  2YYZ A;  4PZ6 A;  4OWX B;  3U4V A;  4DV2 L;  5IT9 c;  2VW9 A;  1X56 A;  1GM5 A;  2CKZ B;  1B7Y B;  1LUZ A;  2VZA A;  4A3E G;  3G4S A;  5FLM H;  4A3M H;  1M90 C;  2I5M X;  2RHS B;  1N36 Q;  3WWV A;  3S2H H;  1S3O A;  1EIF A;  4R4Q A;  1UE6 A;  2E2J H;  1A8V A;  3I4O A;  4R1J A;  1S72 A;  4UPA A;  2N78 A;  4B3S Q;  1VQN A;  3HOW H;  5JEA G;  3W5O A;  1EYG A;  1H95 A;  1UE5 A;  2JA5 H;  4GLA C;  3J81 c;  3CCL A;  2D0O A;  1BKB A;  1K0R A;  1C7Y A;  4JBK A;  5FLX c;  4R4O A;  4HIO A;  2MFI A;  4R4C A;  3S1Q H;  4B3R L;  1E1O A;  5AJ3 L;  1VQC A;  1HNZ L;  2JA8 H;  4DR4 L;  1XMQ Q;  4DPG A;  5FLM G;  4A3M G;  4PMW A;  3STB D;  2IX1 A;  3L2P A;  4IFD I;  3ZJY C;  1FGU A;  2IT1 A;  1VQK A;  3CME A;  4OO1 I;  4B3M L;  2MNA A;  2Z0S A;  4R4T A;  3GTJ H;  1W2B A;  2EQS A;  4LF6 Q;  4L5Q A;  1L2F A;  3M9B A;  2BH2 A;  3HOW G;  3PF4 A;  2CFM A;  1Q82 C;  2JA5 G;  1X65 A;  2OQ0 A;  2ZJP A;  4HJ9 A;  1A62 A;  4BY7 H;  4NXM L;  2R6G A;  4GKK Q;  1NE3 A;  4R4I A;  4JV5 Q;  1OTC A;  4DR5 Q;  1OXT A;  4DR2 Q;  1JB7 A;  2N49 A;  4LW1 A;  1EQQ A;  1VQ7 A;  3GTQ H;  4OX9 L;  3NBH B;  4BY1 H;  2JA8 G;  1PH3 A;  1I50 H;  4UP7 A;  5ELN A;  4JBW A;  4LFA Q;  4A76 A;  2OTJ A;  1YVC A;  3RLN A;  2F52 A;  1KXL A;  3U4Z A;  2NN6 I;  3GD7 A;  3BZK A;  4DK3 C;  3UDI A;  2C35 B;  1YJW A;  4IFD J;  1HZC A;  4BY7 G;  2OWO A;  4JC0 A;  4JI7 L;  4GOP B;  4LF8 Q;  3H3V I;  4MNO A;  2JA6 H;  5IWA Q;  1TWF H;  2B63 H;  3S16 H;  1TWH H;  1PYS B;  4JI2 L;  4BY1 G;  1TWA H;  2NZO A;  4IPH A;  1WCM H;  1XMO Q;  5C0X I;  3HOV H;  4LFB Q;  4GLX A;  3H0G H;  4YWK A;  4JI3 L;  1ASZ A;  1FJG L;  1IL2 A;  4A3L H;  4K0K Q;  3CAM A;  4JBJ A;  3PV0 A;  4YY3 Q;  2AKW B;  1YJN A;  2UU9 L;  1CSP A;  4NPS A;  4DAY B;  4L5S A;  4LFC Q;  4IOA A;  3DLL A;  2PI2 E;  2R7Z H;  3FP9 A;  4JOI A;  4DR6 Q;  3TS2 A;  4LF7 L;  3M4P A;  1AH9 A;  4JG2 A;  2JA6 G;  4JI8 L;  2B63 G;  3TRE A;  1EUJ A;  3CXC A;  4ME3 A;  1PFS A;  3J80 c;  1QVG A;  5M3M H;  3UE1 A;  3CCE A;  1IXR A;  1WCM G;  4OO1 G;  3HOV G;  1VQM A;  3I2Z A;  3S24 A;  4LF4 Q;  3H0G G;  1JJC B;  4A3L G;  2R92 H;  4GS3 A;  3PO2 H;  3CCU A;  3T1H L;  2DUD A;  2MQH A;  1Y1W H;  3A5U A;  4P74 A;  1G51 A;  4DK6 C;  5LMN W;  3F8T A;  5C0X J;  3T1Y L;  4LNQ A;  3H3V H;  2R7Z G;  2QA4 A;  3GTM H;  4LF9 Q;  1VQA A;  3PUX A;  1GD7 A;  1VQJ A;  3A74 A;  4DV3 L;  4JI0 Q;  4J15 A;  3ULJ A;  2JEB I;  4DV2 Q;  1YEZ A;  1AE2 A;  1N9W A;  1KAW A;  4A3I H;  3KOJ A;  1NJI C;  1EIY B;  3J80 i;  1DGS A;  5M3M G;  3F1Z A;  1IBM L;  4QY7 A;  2KBN A;  3IRB A;  1HNW L;  4IPD A;  4XIG S;  3DM3 A;  3PO2 G;  1PH9 A;  3M4Q A;  4DR7 L;  1Y1W G;  3HOX H;  3J7A 5;  2WFW A;  2ASB A;  4GOP A;  4A75 A;  4JOI C;  1N34 L;  2UXD L;  1XNQ L;  1C9O A;  4NB3 A;  2F4V L;  4QIW E;  3W1B A;  5C3E H;  5GAE C;  2JQO A;  1L1O A;  2WAQ G;  3TQY A;  1VQO A;  4B3R Q;  4OWT B;  3HOY H;  3CPW A;  5AJ3 Q;  4A3I G;  1HNZ Q;  4DR4 Q;  4YWM A;  1VQF A;  2VQE L;  2KEN A;  2D0P A;  1PYB A;  1N8R C;  1YNX A;  1CKN B;  1CSQ A;  3D31 A;  2AWN A;  3JC6 6;  4KI0 A;  3CF5 A;  3RNU A;  1X3E A;  1PH8 A;  1QZG A;  5ELO A;  1CKO A;  3TEH B;  1YHB A;  3HOX G;  1PH6 A;  1Q1E A;  1I94 L;  4NXM Q;  4JI0 L;  1QVC A;  4DV1 L;  2EIF A;  1QUQ B;  3KJP A;  2D62 A;  4DUZ L;  3HOZ H;  5C3E G;  2PQA B;  1NTG A;  3AFP A;  1WJJ A;  3CC7 A;  1YIT A;  2E8G A;  3EIV A;  1X3G A;  3MEF A;  4JCV E;  5JEA J;  4OX9 Q;  3HOY G;  1Q12 A;  1VQI A;  2Q2U A;  2KCT A;  1Q7Y C;  1UWV A;  1EOV A;  2UUA L;  1WOC A;  4DR1 L;  1XNR L;  3K80 C;  2K52 A;  3CCV A;  1HZB A;  3KF8 B;  3UDX A;  1Q81 C;  4AH6 A;  1EFW A;  4YCV A;  1OXU A;  4A3F H;  3JAM i;  4H02 A;  1V43 A;  2AMC B;  4GOP C;  3K81 C;  2PNH A;  4GNX B;  2XTI A;  1TWC H;  4LUZ A;  4X66 L;  4JI7 Q;  1VQ8 A;  3F2D A;  3U58 A;  2L15 A;  3HOZ G;  4A4I A;  3BZC A;  2VY3 A;  2HIX A;  2ZTD A;  4AQY L;  1VQ5 A;  4BA1 I;  2Q2H A;  3KJO A;  4A3B H;  5JJK A;  4QL5 A;  4JI2 Q;  3UDG A;  2PMZ E;  2BH8 A;  4RG1 A;  4P71 A;  4JI3 Q;  1FJG Q;  2A8V A;  3RN5 A;  1IZ6 A;  3S1M H;  1SRO A;  4QJF A;  2CQO A;  2YTV A;  2JJQ A;  2UU9 Q;  3J81 i;  5JJI A;  5BR8 L;  3HKZ G;  4LWC A;  4YCU A;  4A3F G;  1KIX A;  3S15 H;  2NZH A;  4AYB G;  1IBL L;  2YTX A;  2JE6 I;  4LF7 Q;  2K5N A;  1NBW A;  3PO3 G;  3OYY A;  2Y0S G;  4PZ7 A;  4JI8 Q;  4EX5 A;  4HIM A;  2HIV A;  3PUY A;  2VNU D;  2IX0 A;  3E9I A;  1VQ4 A;  4A3B G;  1VQL A;  1VCI A;  3RLO A;  4DAM A;  4LF5 L;  2VUM H;  1CKN A;  1OXX K;  1KRT A;  1NMG A;  2UXB L;  1J6Q A;  3S17 H;  3K8A A;  3CC2 A;  1JMC A;  3T1H Q;  1BVS A;  1HR0 L;  2N3S A;  4B3T L;  4YCW A;  1Q46 A;  4APV A;  3T1Y Q;  4X62 L;  2JK8 A;  3GTL H;  3KLW A;  4WJ4 A;  1QUQ A;  1QVF A;  2HQL A;  4OON A;  2NVQ H;  1D8L A;  2PQA A;  2E5L L;  1A0I A;  4OWW B;  1K73 C;  4A93 H;  4DV3 Q;  1I3Q H;  4GN4 B;  1L1O B;  4PG3 A;  5C44 H;  4HID A;  1B8A A;  1X9N A;  3PUW A;  1HNX L;  3S2D H;  4BXX H;  2YV5 A;  2VUM G;  1IBM Q;  1LM0 A;  4BA2 I;  1HNW Q;  1K8A C;  4XTC S;  3VDY A;  2OTL A;  2KHI A;  1Y14 B;  3ULL A;  1GKH A;  4DR7 Q;  3GO5 A;  2FXQ A;  1IBK L;  4GNX A;  4IO9 A;  2NVX H;  2JEA I;  2UXD Q;  1N34 Q;  1XNQ Q;  2GN5 A;  1HZA A;  3KYH C;  2F4V Q;  1KQS A;  3J7Z C;  4A93 G;  1PH7 A;  2VS1 A;  4IFD G;  4MTN A;  3RZO H;  1LTL A;  4C3I H;  5C44 G;  2QEX A;  4O0A A;  2VQE Q;  4TQU S;  4DV7 L;  4BXX G;  3GTP H;  3K7U C;  5LMN L;  5JJL A;  1VQP A;  3PUV A;  5E7N A;  1HH2 P;  1UEB A;  2QGQ A;  5HY6 A;  2ZM6 L;  4DV0 L;  1PH4 A;  1V9P A;  3ERS X;  1VS0 A;  4A3D H;  1E1T A;  2Z6K A;  1WI5 A;  3PUZ A;  3S1N H;  1I94 Q;  2CWP A;  3L7Z C;  2IY5 B;  4DV1 Q;  1PVO A;  3PIP A;  4JI6 L;  1U5K A;  3PCO B;  3U50 C;  4DUZ Q;  1NMF A;  1SR3 A;  3UDF A;  1YJ9 A;  4JYA L;  1R9T H;  1BBU A;  3M4O H;  1JT8 A;  2NN6 G;  3CC4 A;  4TVA B;  4KHP L;  3PIO A;  4IPG A;  1XNR Q;  2UUA Q;  2YU9 H;  4KHZ A;  4DR1 Q;  2R93 H;  3RLF A;  3TS0 A;  4GNX C;  4A3D G;  1SE8 A;  2LXK A;  1FL0 A;  3AYH B;  3CMA A;  3F2C A;  2JA9 A;  4X66 Q;  2R7D A;  1N33 L;  5C0X G;  2V1C C;  3EBE A;  3CCR A;  4AQY Q;  1GO3 E;  4X64 L;  2LSS A;  2WB1 G;  4GN5 A;  2E2I H;  3AFQ A;  1WYD A;  3B6Y A;  3CP0 A;  3EN2 A;  4A3J H;  2UUB L;  3SGI A;  1K3R A;  5M5Y H;  4HJA A;  4OXP A;  3NEL A;  4DR3 L;  2R93 G;  1VQE A;  3CQZ H;  1JE5 A;  4PZ8 A;  4IJL A;  4UY8 C;  2ID0 A;  4DUY L;  1E22 A;  1SMX A;  2Z6K C;  5BR8 Q;  3CCS A;  2WAQ E;  3CPF A;  3ULP A;  1S40 A;  1XPU A;  2GVA A;  2ZTC A;  3M85 A;  3H15 A;  1IBL Q;  2ZTE A;  3GTK H;  4C3H H;  1T9H A;  2WB1 E;  3KF6 A;  1B70 B;  1KD1 C;  2EXD A;  2RCN A;  2UXC L;  1D7Q A;  3W1G A;  2K75 A;  4MZ9 A;  1VQH A;  2VL6 A;  1SFO H;  4JI4 L;  4LF5 Q;  3E0E A;  4A3J G;  1J5E L;  3M7N A;  1I6H H;  3KDF B;  2K5V A;  2UXB Q;  5IYB H;  5GAH C;  4HIK A;  1HR0 Q;  1K83 H;  4HJ5 A;  4YWL A;  4JI5 L;  1KRS A;  4DV4 L;  4B3T Q;  2HT1 A;  4X62 Q;  1Y1V H;  2R7F A;  3I4M H;  2YTY A;  1E7Z A;  3RN2 A;  3RZD H;  3PO3 H;  1L1O C;  1K8G A;  2E5L Q;  1Q8K A;  5J3B A;  1P8L A;  3F2B A;  3M3Y H;  2HHH L;  3HOU H;  5C4X H;  1UE7 A;  5DLQ E;  2VQF L;  2B29 A;  3OTO L;  1HNX Q;  4NXN L;  4DV6 L;  3S14 H;  1G6P A;  3BJU A;  3NEM A;  5IYB G;  2OQK A;  3CCQ A;  2UUC L;  2H5X A;  4YHH L;  1K9M C;  1CKM A;  2Q2I A;  1IBK Q;  3CW2 C;  1Y1V G;  1TWG H;  2K50 A;  3I4M G;  1Z47 A;  2MO0 A;  5M5W H;  4B3M Q;  4UP8 A;  2Q2T A;  4POG A;  5HGQ A;  1RL2 A;  3HOU G;  2I5H A;  1HR0 W;  1X54 A;  5LMU L;  1XPO A;  2E2H H;  4P75 A;  2NVT H;  4GKJ L;  5C4X G;  1MKH A;  4JI1 L;  1A63 A;  2BA1 A;  3FKI H;  1LYL A;  4KLK A;  3HKZ E;  4X65 L;  4DV7 Q;  4A3G H;  4DV5 L;  5LMN Q;  3AQQ A;  2RF4 A;  3GTG H;  4AYB E;  1X55 A;  2LXJ A;  2ZM6 Q;  4DV0 Q;  3OW2 A;  1ASY A;  2A19 A;  2CCZ A;  1O7I A;  2Y0S E;  3K0X A;  4A3K H;  4EQ5 A;  1N32 Q;  3S1R H;  4JBM A;  1NY4 A;  1PHJ A;  3LGJ A;  4WJ3 M;  1P16 A;  4JI6 Q;  1YI2 A;  5K36 G;  4JYA Q;  1N36 L;  2CWA A;  1PA6 A;  4Y7N H;  4KHP Q;  3KDF A;  1Q1B A;  4B3S L;  5EAY A;  1KC8 C;  3FKI G;  1HJP A;  5IYC H;  4A3G G;  2MO1 A;  1VQB A;  4IJH A;  4HJ8 A;  1I5F A;  3ICE A;  4P72 A;  3RR5 A;  3PF5 A;  1EQR A;  2A1A A;  2F3I A;  1PH1 A;  1KL9 A;  2AWO A;  4FDB A;  1VQ9 A;  4A3K G;  2PI2 A;  1E3P A;  4QQB X;  5IE8 A;  2NVY H;  5M5X H;  1YBY A;  1PH5 A;  3L0O A;  1XMQ L;  3PSI A; 
#chains in the Genus database with same CATH topology
 1N33 Q;  1KLG D;  4NMZ A;  3CCM A;  3MWE A;  4POF A;  3CCJ A;  3DUZ A;  1UC9 A;  2EJG C;  2I46 A;  2ZJQ A;  4ED7 A;  2JEJ A;  3NHH A;  4ECS A;  5TSS A;  1BXT A;  2VQF H;  4DR3 Q;  1QZH A;  5FLX E;  2IW3 A;  3Q8D A;  2XD4 A;  4ZKB B;  1C0A A;  1YHQ A;  1N32 L;  4DR2 L;  3KBX A;  3JAM W;  3GDE A;  4O3Q A;  1BF4 A;  2F0T A;  1RCV D;  1XTD A;  2XSC A;  2I0Q A;  4YR0 A;  2NVY A;  2ZXP A;  5D14 A;  2L4N A;  4A3E B;  2J4X A;  4DK1 A;  2WDT A;  1PTO B;  2R87 A;  3KFU A;  5IP9 H;  3KUP A;  4KKT A;  5T1I A;  3LP8 A;  3ITP A;  5FJ8 G;  1I6H B;  1WTV A;  3M9M B;  4H44 C;  1Q86 C;  3D6C A;  1CS0 A;  1STA A;  1VBG A;  3UQ8 A;  3QR8 A;  3QZ7 A;  1OXS C;  5IOD A;  1Z9F A;  1MZB A;  1G6Z A;  2CVR A;  5M3F H;  4AIM A;  3QO2 A;  1VF7 A;  4FM9 A;  5ELC A;  5C5L A;  4GN3 B;  1ZEQ X;  5IYD G;  1DXM A;  4EQO A;  4K0K L;  1E24 A;  3E9H A;  1HZ9 A;  3FRP B;  3S2H B;  2MGS A;  2NU8 B;  4LFC L;  2ALZ A;  2F03 A;  2K5H A;  2JA7 H;  2OLS A;  1OWT A;  1CE8 A;  3U9O A;  5H1S E;  2F0Q A;  2K14 A;  1KDA A;  1FNU A;  3HOW B;  1X6O A;  2LKV A;  1YZ6 A;  1Z2O X;  2C5C A;  2OEO A;  2HVQ A;  4O4L F;  1LTG D;  1C3O A;  5KG2 A;  4DNI A;  5EGT A;  4ZK9 B;  3I12 A;  1SRU A;  4ODG A;  1SSO A;  2ZXR A;  4FXD A;  1JDB B;  2N8N A;  1B50 A;  4GKJ Q;  1S5F D;  2X69 A;  1E2V A;  1KJ9 A;  1XMQ H;  1YIJ A;  5JJZ A;  5JEA H;  2EY1 A;  2W57 A;  4IAJ A;  2NB0 A;  1MIU A;  2QF7 A;  1L0W A;  3G6E A;  3N52 A;  4XYQ A;  4EG0 A;  5LYJ F;  1PMR A;  2HD3 A;  4LF6 H;  2SCU B;  3A8J E;  3HGB A;  3STB C;  5DQG A;  1JB3 A;  2F0H A;  4O2D A;  3U4V A;  3V4S A;  4K2K A;  1LUZ A;  2K5D A;  4J1M A;  4A3E G;  1IKM A;  4DR5 H;  3R3O A;  5F2D A;  3Q23 A;  1EYZ A;  1RKN A;  5C3W A;  4R4Q A;  1SJE D;  1UE6 A;  2NYZ D;  3DEP A;  1ENF A;  1UAP A;  2X6L A;  1TS2 A;  4HCS A;  1BQQ T;  1EY7 A;  4R1J A;  5I6Y A;  3W5O A;  4FYD A;  2RBM A;  3KLS A;  4B9X A;  4MTK A;  3L9A X;  5FLX c;  4A2B A;  4R4O A;  4HIO A;  2MFI A;  3QJY A;  3E6Z X;  4UCV A;  1E1O A;  5KFJ A;  4O42 A;  3MHB A;  1HNZ L;  5IWA H;  4PMW A;  3T13 A;  3S16 B;  1TWH B;  3L2P A;  4IFD I;  3ZJY C;  2RSO A;  2W9B B;  3BA8 A;  2FE3 A;  2ASJ A;  2HVR A;  1S4Z A;  3CME A;  1EY6 A;  4OO1 I;  1ENC A;  2Z0S A;  1IYV A;  3P1H A;  2PCF B;  5EQ0 A;  3HOW G;  3URY A;  3KAJ A;  1Q82 C;  1X65 A;  4HJ9 A;  2W9A A;  2JA5 A;  2QYZ A;  4DU9 A;  4DA2 A;  4JV5 Q;  3D4D A;  4RAZ A;  1OTC A;  1B6S A;  5KFB A;  4LW1 A;  1EQQ A;  1S0N A;  5DQI A;  3NBH B;  2FPI B;  1I50 H;  4LFA Q;  5ELN A;  4JBW A;  3I4N B;  4QIW B;  3OSN A;  1YVC A;  2F52 A;  2EYO A;  3BVM A;  1KXL A;  2NN6 I;  3LWU A;  2W6Z A;  3D3R A;  2I8C A;  3O13 A;  3MXN A;  1S9F A;  1EY8 A;  5IT9 E;  1FNW A;  2OWO A;  1A15 A;  3H3V I;  4EFE A;  2W7O A;  2JA6 H;  2EYH A;  1QNU A;  1I94 H;  1EYA A;  2F0M A;  4BY1 G;  2C00 A;  4JI0 H;  4ECQ A;  3OSO A;  4IPH A;  4BBS B;  4OO1 H;  1DON A;  5D1P A;  5BPF A;  5C0X I;  2XGQ A;  3GII A;  4DV2 H;  4GLX A;  3H0G H;  4YWK A;  1IL2 A;  4WD3 A;  1WH2 A;  2JYO A;  4JBJ A;  4YY3 Q;  5AFW A;  1CSP A;  4NPS A;  4DAY B;  3R2I A;  3DLL A;  3T5H A;  3SK4 A;  4JOI A;  4DR6 Q;  2Z4H A;  3TN2 A;  5JVL A;  1H9J A;  4IUR A;  2FLP A;  1VKZ A;  5CV9 A;  5C6A A;  1LT3 D;  5EPL A;  2Z4I A;  5KFK A;  5M3M H;  1JOR A;  3CCE A;  1TWA A;  3Q22 A;  4B3R H;  4LF4 Q;  4K8I A;  1SE3 A;  1FGB D;  1QB5 D;  4A3L G;  3T51 B;  3GQB A;  4GS3 A;  3PO2 H;  4HNT A;  1Y1W H;  2PMZ B;  4HMJ A;  1KJ8 A;  3NSW A;  3H3V H;  2R7Z G;  2QA4 A;  3GTM H;  4LF9 Q;  4YR2 A;  2SEB D;  2V4D A;  1GD7 A;  1VQJ A;  5L9X A;  3EYY A;  2GA4 B;  1N9W A;  1KAW A;  2F0S A;  2ASL A;  4IUN A;  1TR5 A;  4ED6 A;  3F1Z A;  4XYM B;  5I9P A;  2W71 A;  4F4Z A;  3DM3 A;  2R92 A;  3M4Q A;  2PN1 A;  3RMH A;  1E2W A;  2DIK A;  2WFW A;  3K5M A;  4B08 A;  4JOI C;  1XNQ L;  3DXJ C;  5C3E H;  3W1B A;  2XGP A;  5BN4 A;  1RJP A;  1RJR A;  4OWT B;  5KT6 A;  5AJ3 Q;  4LK1 C;  4YWM A;  4C5C A;  1TA8 A;  3NTI A;  1TII D;  2W6Q A;  4XDX A;  4QUF A;  1AN7 A;  1I7L A;  4QWC A;  4JI2 H;  4I50 F;  1CKN B;  3H40 A;  4KI0 A;  3CF5 A;  4JI3 H;  1PH6 A;  1BNC A;  1WTX A;  1I94 L;  1SMY D;  4JI0 L;  4PDB A;  3HOZ H;  1YNJ C;  1ZYR C;  3AFP A;  2F0W A;  1YIT A;  3EIV A;  3MEF A;  2XNA C;  3M4Y A;  5JOB A;  3K58 A;  2FK3 A;  3RAQ A;  4LF7 H;  1Q12 A;  1VQI A;  3N6R A;  2Q2U A;  2F0I A;  2KCT A;  4MV4 A;  2TMP A;  2RGV A;  1EOV A;  2UUA L;  1XNR L;  4JI8 H;  3K80 C;  1AZP A;  3D8G A;  5LP6 F;  1HZB A;  4G7Z C;  4YCV A;  1JDE A;  1D5M C;  4F50 A;  2YS7 A;  4L63 B;  5DM7 3;  3BG5 A;  4AQY L;  2IMW P;  1H9S B;  2Q2H A;  5JJK A;  4QL5 A;  3UDG A;  1I4X A;  2BH8 A;  1EY0 A;  5IGD A;  1XYI A;  5C44 B;  1H9K A;  1WCM B;  1KDB A;  1FJG Q;  4LH7 A;  3S1M H;  3S2D B;  1W6J A;  3TQT A;  4QJF A;  5KKN B;  2CQO A;  1I4R A;  1IBM H;  5JJI A;  2A6H D;  3J81 i;  2KOL A;  1VMP A;  1SDF A;  3R8B A;  4J9M A;  3PW7 A;  1KIX A;  1HNW H;  3S15 H;  4X3S A;  1WR2 A;  3NK9 A;  5EDW A;  4U6P A;  2JE6 I;  4DR7 H;  3ERQ A;  2K5N A;  3PO3 G;  2NVX B;  1LT6 D;  2EYM A;  1HCZ A;  2Y0S G;  5EKK A;  4PZ7 A;  4EX5 A;  2R8J A;  2PBZ A;  5DQH A;  2IX0 A;  3E9I A;  4C1N I;  4DNR B;  4HTH A;  2VUM H;  3T53 B;  5DG9 A;  1PRT F;  2K32 A;  1J6Q A;  4Q0F A;  3K8A A;  3CC2 A;  1NNX A;  1BVS A;  2TSS A;  3NPP A;  5J39 A;  3FVQ A;  3GTP B;  3TII A;  3T1Y Q;  4X62 L;  2FHT A;  1QUQ A;  1QVF A;  5J1Z A;  1ET6 A;  2E5L L;  3MXP A;  2BQ3 A;  3DMU A;  4DK0 A;  2FJZ A;  5KFV A;  4HID A;  2B2U C;  4A3I B;  1X9N A;  4CJ1 B;  3OW7 A;  3M4O B;  2IBK A;  3KF8 A;  4UFZ A;  1J9O A;  2PW5 A;  1ET9 A;  3K5O A;  3TDQ A;  1HTL D;  3ULL A;  1GKH A;  4WOR A;  2FXQ A;  4GNX A;  3GTL A;  2UXD Q;  1N34 Q;  1HZA A;  2IJ0 A;  4I55 F;  3GID A;  1GOZ A;  2VS1 A;  4C3I H;  5C44 G;  4EEQ A;  1HA6 A;  1T5X D;  2AQ1 B;  3OMC A;  4IUV A;  2QEX A;  2O4X A;  4O0A A;  4TQU S;  2VQE Q;  4DV7 L;  2E2I B;  1VQP A;  2V59 A;  1DOK A;  4P2C B;  4A3J B;  2JEG A;  4CDE C;  2QGQ A;  1ENA A;  1RJT A;  2R7M A;  1V9P A;  5C1O A;  3TQ1 A;  3RB3 A;  1CHQ D;  4IUT A;  3RUZ A;  2DLN A;  4FF1 A;  4PWQ A;  1PFN A;  3BQ2 A;  3AMU A;  4DV1 Q;  4Q0Y A;  1U5K A;  3PCO B;  4DUZ Q;  1SYB A;  1YJ9 A;  3F2U A;  3GTK B;  4UCU A;  5C5J A;  4IN3 A;  5KRU A;  4C5B A;  2WII B;  4TVA B;  1EY5 A;  1CT1 D;  3GQC A;  3TIN A;  2F3V A;  1DJR D;  4KHZ A;  4DR1 Q;  2YU9 H;  1W93 A;  4ECY A;  3CRK C;  1WVL A;  2R93 H;  1D2B A;  4GKJ H;  2AUK A;  3TS0 A;  3RTX A;  3OIQ A;  1AUX A;  3MR3 A;  2FP4 B;  3ERO A;  3QOJ A;  3QWN A;  4GNX C;  2KSW A;  3HKZ B;  4A3F B;  2UXB H;  3OMG A;  3AYH B;  3MWM A;  1Z7T A;  1RYS A;  1IOV A;  4ULL A;  1Y1V B;  4X66 Q;  1TWC B;  1EUD B;  1N33 L;  1R9T A;  2V9W A;  3J81 L;  4FS2 A;  3AFQ A;  1LT4 D;  2E75 C;  5M5Y H;  4HJA A;  4TV8 F;  1JX4 A;  4OXP A;  3NEL A;  4DR3 L;  3K3V A;  4X3T A;  5LL6 X;  4IJL A;  2ID0 A;  2QDB A;  1STN A;  2WAQ E;  1S5B D;  1S40 A;  2AQ4 A;  1IBL Q;  5KFP A;  5KFT A;  1ZHS A;  2W9C B;  2YRW A;  1MBY A;  1G8Z D;  2A68 D;  3EJI A;  3W1G A;  1RHP A;  2CW7 A;  4MZ9 A;  3BDO A;  4A3J G;  5LOV F;  3PMF A;  3KDF B;  2CW0 D;  4DXF A;  4G7O C;  1HXY D;  5IYB H;  5ELE A;  1PRT C;  3S17 B;  1HR0 Q;  4HJ5 A;  2RDF A;  4DL2 A;  3H3V C;  3HBL A;  2NWG A;  4RZR A;  2YTY A;  3PO3 H;  4TKO B;  1ZQ7 A;  2MCT A;  4DV0 H;  1SYF A;  2R7L A;  5BPH A;  2SNS A;  4YAK B;  4ECX A;  3PN1 A;  3I8Z A;  3M3Y H;  2ZDH A;  4JV5 H;  3S1R B;  4RH6 A;  3G6J B;  2B29 A;  5C1P A;  4JYA H;  3E5S A;  2MUY A;  2UVU A;  3LNN A;  1SCU B;  5DM6 3;  1NR2 A;  3VR3 A;  4Y7N B;  1PYW D;  1GJX A;  1EFI D;  1G6P A;  4KHP H;  2VB3 X;  1XWE A;  1YNN C;  3NP8 A;  2JEI A;  4HED A;  1K9M C;  1FYC A;  4PQX A;  1Y1V G;  1TWG H;  2K50 A;  2P5Z X;  5M5W H;  2LMC B;  2E2D C;  3GV3 A;  2R8K A;  5HGQ A;  5KT7 A;  4RB3 C;  2I5H A;  2NVT H;  3RZO B;  2E2H H;  4GKJ L;  1DV2 A;  2FKL A;  2CH4 W;  1A63 A;  3FKI H;  1LYL A;  5EBD A;  4H7B A;  4A3G H;  4X64 H;  2DY7 A;  3AQQ A;  1SE2 A;  4AYB E;  1I4H A;  2LXJ A;  1ASY A;  2CCZ A;  5CAE B;  1O7I A;  5K5P A;  2G9D A;  5EWG A;  1OO9 B;  4JBM A;  2K28 A;  1PHJ A;  3LGJ A;  2F0L A;  1YI2 A;  3IAY A;  4JI6 Q;  2V4R A;  4RGO S;  2J9G A;  4IZO A;  4ILW A;  5L1K A;  2VUM A;  4RCO A;  5EAY A;  2PZT A;  3J7A F;  1HUN A;  2J6T A;  5IYC H;  3K5I A;  3A7A B;  4MAM A;  2B2Y A;  3A8K E;  2X6G A;  3GTG A;  3NQI A;  4IJH A;  4JI4 H;  1I5F A;  2Q8T A;  3RJ0 A;  3PW4 A;  1PH1 A;  2A1A A;  1KL9 A;  3H4B A;  2K03 A;  1Z2P X;  4QMG A;  2PI2 A;  4ECU A;  4JI5 H;  1K8M A;  2NVY H;  5LMN W;  5CA0 F;  3L0O A;  3PSI A;  3KF6 B;  3V6K A;  1L0X B;  2IPK D;  4L5T A;  1G29 1;  4DL4 A;  4BS9 A;  1WTW A;  4XT3 B;  3BU2 A;  2HHH H;  3HFZ B;  1TT2 A;  3VYU A;  1PV4 A;  3OTO H;  3SVM A;  4KD4 A;  2JA7 B;  2EY6 A;  3CRL C;  1ZHQ A;  3NE5 B;  1N56 A;  1SYD A;  4DUY Q;  1VF5 C;  1M1K C;  3ER0 A;  4JV5 L;  4DV6 H;  1VQD A;  2W8L A;  2Q8I B;  1U0L A;  3TP5 A;  3A0J A;  4IPC A;  4LFA L;  4P73 A;  4LSA A;  2W9B A;  1TY2 A;  3I56 A;  1XJV A;  5IT9 W;  1HA5 A;  4ZUI A;  2YRX A;  1B4O A;  2Z8L A;  3IFD A;  5GAG C;  3QG1 A;  1J5E Q;  2B2Y C;  3EA6 A;  4JI1 H;  1C8C A;  1JJG A;  2VA3 A;  1K83 B;  5KFI A;  5FK9 C;  4HR7 A;  5DG8 A;  1TXY A;  3I7F A;  3I4M B;  3TRZ A;  4DKA C;  3VA7 A;  3RZD B;  3DF7 A;  3R5X A;  2FFK B;  2VA2 A;  2RDH A;  3HXL A;  3HOU B;  4MV1 A;  3J81 j;  1VQ6 A;  2AGO A;  5IP7 H;  5IP9 G;  4YY3 L;  1N36 H;  3MFY A;  5IOC A;  4HJ7 A;  2R92 G;  2FMC A;  2E2J B;  4B3S H;  1WFQ A;  4DR6 L;  4DAP A;  2B3G A;  4YHH Q;  3BQ1 A;  4X3K A;  2B39 A;  1KAA A;  1XTC D;  5M3F G;  1LLR D;  1STH A;  1S5C D;  3Q24 A;  1ILP A;  3BQ0 A;  5HGT A;  4IOC A;  1JJ2 A;  4FU0 A;  2AQ3 B;  4MA5 A;  1LTS D;  1TU2 B;  4LF4 L;  1W3S A;  4ED2 A;  5LMU Q;  3DHQ A;  1BJT A;  4J9O A;  1PZI D;  3K7A H;  4X65 Q;  4CDF C;  4DV5 Q;  2JA7 G;  3DEO A;  1SE4 A;  2ES2 A;  1ZXT A;  1CUK A;  4LF9 L;  1FJG H;  5HBR B;  4I7A A;  2KJX A;  3G7L A;  2I5L X;  4F87 A;  4LUV A;  2KCM A;  4PZ6 A;  1A9X A;  1GM5 A;  2FJ2 A;  1B7Y B;  4C2M A;  5FLM H;  4A3M H;  4DR2 H;  2I5M X;  2RHS B;  3WWV A;  1AZQ A;  1S3O A;  3M7G A;  2K5W A;  2R3Z A;  1BUV T;  3I4O A;  1S72 A;  1TS5 A;  1EZ6 A;  2PMZ A;  5CV4 A;  5JEA G;  5KT4 A;  3PZP A;  1UE5 A;  2JA5 H;  2N55 A;  4RHS A;  3J81 c;  4KKS A;  4UCR A;  4IR1 A;  4O2B F;  3M9O B;  1ESR A;  4JBK A;  3W2D A;  1I6V C;  4R4C A;  3S1Q H;  3HZX A;  4ZRZ A;  5AJ3 L;  1VQC A;  2JA8 H;  3ETH A;  2JEF A;  1HUM A;  1GYF A;  2IT1 A;  1VQK A;  3J80 W;  2MNA A;  3ONA B;  1L2F A;  3H0G B;  1GUW A;  3I3C A;  2ZJP A;  1N48 A;  4BY7 H;  2W70 A;  3TP8 A;  4LFC H;  1OXT A;  3KBG A;  3TIG A;  2DNE A;  1YNN D;  3D4W A;  4YBZ B;  4ETS A;  3MR5 A;  1N34 H;  4UP7 A;  1AW7 A;  4A76 A;  3I72 A;  2E2H A;  1RK6 A;  3VR2 A;  4QUC A;  4PNY A;  4L6T B;  3EVQ A;  1S03 G;  3C46 A;  2Z1C A;  2C35 B;  3GTJ A;  3D6W A;  2VQE H;  1NAP A;  3PO2 B;  5C4J B;  1B33 N;  1Y1W B;  2C28 A;  1QWY A;  2F0F A;  3QFF A;  4IRC A;  3NQT A;  4LF8 Q;  2NBF A;  3H94 A;  3NUC A;  2B63 H;  5I47 A;  1TWA H;  5CB4 F;  2RCF A;  3L4J A;  3WNZ A;  4LFB Q;  3GV7 B;  1FJG L;  2WE6 A;  3U9T A;  3L3O C;  2VPQ A;  1YJN A;  5EPJ A;  4L5S A;  4IOA A;  2EE1 A;  1PTO D;  3C2P A;  3KHG A;  4EBE A;  3SEB A;  1D1K A;  1FNV A;  2JA6 G;  3V96 A;  2L12 A;  2LS0 1;  1PFS A;  2C2E A;  4RKB A;  2C2D A;  4WFN 3;  4X66 H;  1IXR A;  4XT1 B;  4OO1 G;  5T14 A;  3IL8 A;  3I2Z A;  3S9W A;  1CI3 M;  3H0G G;  1JWS D;  3NTK A;  1IYU A;  1HNZ H;  4J9R A;  2R92 H;  4I7Z C;  3CCU A;  2OT2 A;  3A5U A;  3T1Y L;  4LNQ A;  2HDM A;  4C5A A;  2EPB A;  1VQA A;  1CA5 A;  1B6R A;  3A74 A;  1WTO A;  3MFH A;  4J15 A;  3HB9 A;  2JEB I;  5C5M A;  3QIA A;  3FEW X;  1NJI C;  3HOZ B;  3DWQ A;  3J80 i;  5M3M G;  1ICF B;  3BA9 A;  3MWY W;  4QY7 A;  1LAB A;  1SMY C;  3PO2 G;  1PH9 A;  1Y1W G;  2H1E A;  3J7A 5;  4F88 A;  4GOP A;  4A75 A;  4JVZ A;  2L9H A;  1N34 L;  2UXD L;  5KG0 A;  1C9O A;  2L0C A;  4TSS A;  1PZK D;  3KK7 A;  1O7Y A;  3KLR A;  4AYB B;  2JQO A;  2WAQ G;  1BCP B;  4NDX A;  2O5I C;  2W6M A;  4DR4 Q;  1U9R A;  1VQF A;  1Q90 A;  4ZUJ A;  2VQE L;  5L1I A;  1E4E B;  5DG7 A;  2D0P A;  2XWB B;  3ND8 A;  1EYD A;  3M9N B;  4N8X 1;  2AWN A;  3JC6 6;  5E4W C;  3BYY B;  4B3M Q;  1X3E A;  4APM A;  1CKO A;  1CK1 A;  3TEH B;  1D6E C;  3S1M B;  2YL2 A;  1Q1E A;  4NXM Q;  1QVC A;  4DV1 L;  1B9N A;  3TZD A;  1BOS A;  3VR6 A;  2WKC A;  4LH6 A;  4DUZ L;  2R6F A;  5C3E G;  1EYC A;  4FF3 A;  4RB1 A;  1NTG A;  2KUM A;  1R4Q B;  4JCV E;  2CH4 A;  4XYO A;  3GTQ B;  2R8G A;  1UEA B;  2A6H C;  4BY1 B;  2UVW A;  1EIG A;  5CA1 F;  1Q7Y C;  4DR1 L;  5I9O A;  4MHE A;  3KAK A;  3V2T A;  2R84 A;  4TUY F;  4HYK A;  2M2L A;  4AH6 A;  3AU7 A;  1T3N A;  4OGQ C;  3JAM i;  4ZYS A;  4EQP A;  1SEI A;  4GOP C;  3GLK A;  4X66 L;  4LUZ A;  4JK1 C;  4JI7 Q;  3F2D A;  3U58 A;  2L15 A;  1RTO A;  5J22 A;  4A4I A;  3Q0A A;  3HOZ G;  2W6N A;  1F9R A;  4J8Q A;  1TWF B;  1CFM A;  3KJO A;  1ICW A;  4RG1 A;  1PXU A;  2FPG B;  1EU3 A;  1EQV A;  2KVM A;  2JP1 A;  4XYL B;  2VQD A;  1DOL A;  2YTV A;  5F9L A;  2JJQ A;  2UU9 Q;  4DGZ A;  4YCU A;  4LWC A;  2QCP X;  2NZH A;  1S68 A;  4AYB G;  2R7Z B;  1IBL L;  2YTX A;  3GV5 B;  1NBW A;  1AEX A;  3AB9 A;  4RNO A;  1G2T A;  1HFN A;  1XNQ H;  5ISR A;  3ETJ A;  1VQ4 A;  4IWY A;  4JUZ A;  4ED8 A;  4DAM A;  4C3I B;  3RB4 A;  4IZ8 A;  4RAU C;  1OXX K;  3QZ8 A;  1NMG A;  4BWG B;  1JMC A;  3T1H Q;  1HR0 L;  4NLG A;  2FLN A;  4DL3 A;  4APV A;  3WOF A;  1SEB D;  1KEE A;  3GTL H;  4WJ4 A;  2I87 A;  2NVQ H;  2Z9H A;  2B8F A;  4OON A;  4UHV A;  2XCP A;  4ECT A;  1D8L A;  2PQA A;  1A0I A;  1F9Q A;  3C1E A;  4A93 H;  1GHJ A;  2PO4 A;  4DV3 Q;  4JV1 A;  4IFD H;  1L1O B;  2C22 A;  4CKB A;  4CC6 A;  5DAU A;  3PUW A;  1VAJ A;  4BXX H;  1II3 A;  2VUM G;  5I2Y A;  2JSO A;  2SOB A;  2CQA A;  5I6W A;  4BA2 I;  3RV4 A;  2V4Q A;  4XTC S;  4R8U B;  3OWE B;  3VDY A;  2YU9 B;  1XNR H;  2UUA H;  1EUC B;  3GO5 A;  2R93 B;  4IO9 A;  2KEC A;  3MJF A;  2YW2 A;  4WRD A;  2GN5 A;  2F4V Q;  4IAL A;  2B63 A;  4MTN A;  1I3Q A;  1LTL A;  2NN6 H;  5KYI A;  2CHB D;  2XRS D;  5J2U F;  5COY A;  2XCA A;  1LAC A;  4R8N A;  4AQY H;  1LTR D;  4UDU C;  3HP3 A;  1HH2 P;  2F0P A;  1BDO A;  1SND A;  1E1T A;  4HSV A;  1JE4 A;  3PIO 3;  2IY5 B;  3L7Z C;  3GV6 A;  3PIP A;  3Q8Q B;  4JI6 L;  5M9O A;  3TBI B;  1SR3 A;  5C0X H;  1R9T H;  3R5F A;  3C0F B;  5IGE A;  1JT8 A;  4C3I G;  3CC4 A;  1HQR D;  1STB A;  3JAM L;  1GLV A;  2RDI A;  3BVG A;  2ICE C;  5LMU H;  5FD5 A;  1FL0 A;  4DV5 H;  2A68 C;  4ME5 A;  4Q45 A;  5EOY A;  1SNO A;  4KV6 A;  4X62 H;  3PO3 B;  2R7D A;  4XQN A;  2CW0 C;  1W6K A;  4DF7 A;  2R85 A;  2Y0S B;  1QG7 A;  1GO3 E;  2E5L H;  3BVZ A;  4KN4 C;  2WB1 A;  1M8A A;  3M3Y B;  1D1I A;  3B6Y A;  2K05 A;  4IWX A;  1JLL B;  1K3R A;  1Q3L A;  4EGV A;  2R93 G;  1VQE A;  2RVL A;  4PV1 C;  1JE5 A;  2CQY A;  4DUY L;  1E22 A;  5BR8 Q;  5CV6 A;  4J9L A;  4LSX A;  2QK4 A;  2ZTC A;  1K28 A;  3M85 A;  5A2Q W;  2YS6 A;  2ZTE A;  1CQV A;  3VR5 A;  2B8G A;  4ED1 A;  1TWG B;  2WB1 E;  3VA5 A;  3KF6 A;  1B70 B;  2ATL A;  1KD1 C;  3V4Z A;  2XC9 A;  1CM9 A;  2DY8 A;  2RCN A;  2PVP A;  3BAA A;  4CGY B;  4MV3 A;  2VL6 A;  4WJ3 M;  4LF5 Q;  2NVT B;  1J5E L;  1I6H H;  2K5V A;  4E4T A;  1NR4 A;  2ASD A;  5GAH C;  4DV7 H;  4YWL A;  1KRS A;  4WJW A;  4B3T Q;  3CKI B;  2HGS A;  4O3R A;  3CU7 A;  1Q8K A;  5J3B A;  1P8L A;  2L1B A;  3FDT A;  5C4X H;  2EY5 A;  2AU0 A;  1UE7 A;  5DLQ E;  3NBI A;  1QE6 A;  1EIH A;  2K7V A;  3X3M A;  2VOB A;  1HNX Q;  1SFO A;  1I4P A;  2IL8 A;  2SDF A;  4HAE A;  1B3Q A;  1IOW A;  3BJU A;  5IYB G;  2OQK A;  1RD9 D;  4OHJ A;  4EGQ A;  1IW7 D;  2H5X A;  4YHH L;  1CKM A;  2Q2I A;  3NWS A;  3CW2 C;  4JV2 A;  1G91 A;  2EJM A;  5K36 H;  4POG A;  4EEY A;  4ZQ3 A;  1DV1 A;  2EOT A;  5FOB B;  5KFD A;  2NVY B;  5LMU L;  2XIW A;  1XPO A;  1SAP A;  1JWM D;  2BE5 C;  3C1F A;  1JCK B;  3GP7 A;  3VPD A;  2R7N A;  1N33 H;  4PMC A;  4X65 L;  5L1J A;  3T5J A;  4DV5 L;  5LMN Q;  3A8I E;  1RJQ A;  2RF4 A;  2QW7 A;  3GTG H;  2ZM6 Q;  2A19 A;  2WV6 D;  4DR3 H;  1SBB B;  3N44 B;  4A3K H;  3S1N B;  3WO0 A;  1WTP A;  1N32 Q;  5KG3 A;  1P16 A;  2R61 A;  1AFP A;  2CWA A;  3OHB A;  1PA6 A;  3MTS A;  3GIP A;  1KC8 C;  4M9U A;  4GC7 A;  3FKI G;  4A3G G;  2RA4 A;  4G3I A;  4MTD A;  2F3W A;  2FK2 A;  4P72 A;  4I7H A;  2A69 C;  5DGB A;  1C4Q A;  2F3I A;  2GPW A;  2AWO A;  4RZQ A;  4FDB A;  5IE8 A;  5M5X H;  1BXR A;  2K04 A;  2ASB A;  1DD2 A;  1K0S A;  1MJE A;  3BDC A;  4GC6 A;  3D0F A;  5GQO A;  1UE1 A;  3NEN A;  1XPR A;  3T16 A;  2C2R A;  4F7X A;  4LUO A;  2UUB Q;  2FMA A;  4K5W A;  5IYC G;  1Z2N X;  1I4Q A;  5IIF A;  1PH2 A;  3OHX C;  3CQZ B;  4RB0 A;  1EOT A;  3MA2 B;  2RHQ B;  1PX2 A;  3VYR A;  4NKL A;  1KHI A;  1IYJ B;  1PTO F;  2B2V A;  4BBR H;  1U4P A;  2L11 A;  2PW7 A;  3DWP A;  3I4N H;  3ORQ A;  2XGT A;  4JW0 A;  1GVP A;  4U7C A;  2UXC Q;  1E0B A;  2HQE A;  2MJ8 A;  1CZG A;  5CBA E;  4O3P A;  3GTO A;  2ZJT A;  2W6O A;  4DR4 H;  3WO1 A;  3UFX B;  3FPU B;  4QB4 A;  2DPJ A;  5D65 A;  3WDN A;  4X6A H;  5EBC A;  3K7A B;  1PZJ D;  1H9R A;  4LF8 L;  2ATW A;  3Q8R B;  3CD6 A;  3QOL A;  4GLV B;  2ALY B;  5FLX W;  4RGM A;  4BBS H;  4A3C H;  1EY9 A;  3SHL A;  2B2T A;  4V0B A;  4LFB L;  1WTH A;  3FHW A;  2BA0 A;  2VQF Q;  4A3M B;  5GAD C;  4TQS A;  2DJF C;  1FVI A;  1ZKO A;  1V1Q A;  1EWI A;  2EYF A;  3K3P A;  2YCH A;  1JOK A;  4UP9 A;  2DZD A;  4N8F A;  2DGY A;  4BWS C;  1BCP F;  4C3J H;  4EGJ A;  3VMM A;  1TY0 A;  1YHA A;  1MSH A;  4CDD C;  4Y52 H;  4C2M H;  2B2V C;  1PLF A;  5L1L A;  4JI7 H;  1WTQ A;  4ECR A;  3C3L A;  4OL7 A;  4RMF A;  2JA8 B;  1PFB A;  2NU9 B;  5KT5 A;  5IY0 A;  2IHF A;  5IP7 G;  1E4F T;  2XCL A;  2FLL A;  4QGU A;  1FKA H;  5GRO A;  3UE0 A;  1BBW A;  3JAM c;  1MGS A;  1EWH A;  3MXN B;  4QWB A;  5D1O B;  4BY7 B;  2J6S A;  2RQX A;  4EYI B;  2CKZ B;  2VZA A;  1SNM A;  3G4S A;  3I91 A;  1M90 C;  3Q8S B;  2B2T C;  4HSP A;  5GON F;  5JQW A;  5I4D A;  4LFA H;  4RA8 A;  4UPA A;  1VQN A;  3GIL A;  1EYG A;  2KA7 A;  1LO5 D;  5KFO A;  1X3Q A;  3CCL A;  1I6U A;  1BKB A;  1JR0 D;  4UCS A;  3J7A K;  1C7Y A;  4CJ2 C;  3H4D A;  5FO8 B;  3EFX D;  1KLU D;  1DZ1 A;  4DR4 L;  2QEJ C;  3P20 A;  2BCO A;  5FLM G;  4A3M G;  1XMQ Q;  3VR4 A;  2IX1 A;  4DV3 H;  3N8D A;  3BG3 A;  4B3M L;  4RUA A;  4LF6 Q;  3GTJ H;  4KJN A;  1W2B A;  3PF4 A;  4O4H F;  2JA5 G;  2OQ0 A;  1GHK A;  4NXM L;  4YY3 H;  5KFH A;  4CHT B;  4GKK Q;  1NE3 A;  4R4I A;  2AQ2 B;  1Z6H A;  4DR5 Q;  1VQ7 A;  1JB7 A;  1LTB D;  4QWA A;  3K57 A;  4DR6 H;  1HFG A;  3HG9 A;  2JA8 G;  2AGP A;  4F4W A;  1EL0 A;  1PTO C;  2XN9 C;  2OTJ A;  3RLN A;  4L8J A;  4EBD A;  3GD7 A;  2KQ3 A;  2F0V A;  1GXD C;  4JPB W;  3OWF A;  3UDI A;  1YJW A;  4LF4 H;  4IFD J;  4O3O A;  2BE5 D;  2R92 B;  1HZC A;  1O75 A;  4G57 A;  4BY7 G;  4DL7 A;  2UVV A;  4JI7 L;  4RCN A;  4J0M A;  4MNO A;  5IWA Q;  4LF9 H;  5M3F B;  2ZDG A;  3GTQ A;  1PYS B;  5EPK A;  4DN4 M;  3TME A;  2IA6 A;  1KJJ A;  1WCM H;  3RBE A;  3MEH A;  1XMO Q;  3HOV H;  3R23 A;  1UNS A;  3J81 E;  4TV9 F;  2EYP A;  3PV0 A;  1SNP A;  2D5D A;  4LAA A;  2UU9 L;  3N43 B;  4ED0 A;  1V1P B;  2I07 B;  2J0T D;  2PI2 E;  3FP9 A;  2P0A A;  2XRQ D;  3LML A;  3TS2 A;  3WOE A;  2VB2 X;  1AH9 A;  4RUC A;  4JG2 A;  3DM1 A;  2WKD A;  2B63 G;  3TRE A;  1EUJ A;  3CXC A;  3GIJ A;  3GV8 B;  2A69 D;  2I80 A;  4ME3 A;  3MZ5 A;  1TWH A;  5KFX A;  1QVG A;  2WTF A;  3UE1 A;  2MP1 A;  4M1U B;  2QDL A;  3OPO A;  3S24 A;  1HRJ A;  1JJC B;  2Z6B A;  4HN7 A;  5D3I B;  5CBE E;  3T1H L;  2DUD A;  2MQH A;  3PIP 3;  1F2L A;  3OUU A;  1Y8N B;  5KGU A;  4J9P A;  3F8T A;  5C0X J;  4EBC A;  1X32 A;  1S10 A;  2R7Z A;  3PUX A;  5EKL A;  1O78 A;  2HJW A;  4DV3 L;  4JI0 Q;  3NBH A;  3JZI A;  4JV0 A;  1A2U A;  5BR8 H;  2EY2 A;  4DV2 Q;  1YEZ A;  1BR9 A;  4A3I H;  3KOJ A;  4QIW A;  1EIY B;  5L37 A;  2ENB A;  3IRB A;  4IPD A;  2WIN B;  3HOX H;  4LF5 H;  2PZU A;  4XXE A;  1JIC A;  4LJZ C;  1GGO A;  1UC8 A;  4R9W A;  1EQT A;  2F4V L;  4X3U A;  4QIW E;  5GAE C;  1L1O A;  3TQY A;  1VQO A;  3FMC A;  4B3R Q;  3QB3 A;  5KT3 A;  3HOY H;  1D5X C;  3CPW A;  1GSO A;  4F4X A;  5KFZ A;  4O3S A;  5C8Y F;  1I4G A;  4DAV A;  2FK1 A;  2M00 A;  1PYB A;  1YNX A;  2MHV A;  3D31 A;  3MXG A;  4N9T A;  4DAY A;  3RNU A;  1PH8 A;  2YZG A;  2ZT9 C;  4S3S A;  2QIL A;  1YHB A;  5DLF A;  2W7P A;  3RBD A;  4I4T F;  4FO2 A;  3K0Y A;  1F77 A;  2YZM A;  1QUQ B;  1F2Y A;  2KHS A;  4KHV A;  2EDG A;  3KJP A;  1GUN A;  3CC7 A;  4RGN A;  2LY7 A;  4K2L A;  4OX9 Q;  1ML0 D;  1KTK A;  2YYA A;  4IQZ A;  1UWV A;  1I50 B;  1EWC A;  2JN4 A;  2NZ1 D;  3KF8 B;  4QCL A;  1EFW A;  4A3F H;  1BGW A;  2F0D A;  4H02 A;  4K8J A;  3V6H A;  4IRK A;  1K1S A;  4GNX B;  1CTM A;  3SK5 A;  1TWC H;  2O5J C;  5CMD A;  5BN3 A;  3GTL B;  3E0J A;  1U4R A;  5JPM C;  2NVQ B;  4YP3 A;  3OHA A;  3T1Y H;  3BZC A;  2HIX A;  2JA6 B;  4BA1 I;  4NXN H;  4A3B H;  3MVV A;  4JI2 Q;  2PMZ E;  4KKU A;  1IL8 A;  5KG1 A;  1D5Z C;  4JI3 Q;  2A8V A;  1IZ6 A;  2EYJ A;  1K1Q A;  4XZ3 B;  1STE A;  3KLS X;  4MV8 A;  5BR8 L;  1BBX C;  3L4K A;  4LF7 Q;  1B2T A;  5NUC A;  2FMM A;  4JI8 Q;  4ZCK A;  2UXD H;  2HIV A;  3PUY A;  3N42 B;  1SYX B;  1VQL A;  1ULZ A;  5LL6 S;  3RLO A;  3NXW A;  4LF5 L;  1CKN A;  5M3M B;  5JH7 F;  1EZ8 A;  1KRT A;  5KNB A;  1SYG A;  3S17 H;  1MHW C;  2FB9 A;  3BYT B;  2FIN B;  2N3S A;  4B3T L;  1Q46 A;  2XIG A;  2UUB H;  1I7N A;  2JK8 A;  1PRT B;  3KLW A;  1BNZ A;  3GTM B;  4OWW B;  1K73 C;  5G3L D;  5HV6 A;  1I3Q H;  4KD3 A;  4GN4 B;  1G2S A;  4PG3 A;  2WAQ B;  4DV1 H;  1JWU D;  4IUP A;  5DLG A;  4DUZ H;  5CC4 A;  1HPC A;  1B04 A;  1HNX L;  1R9T B;  2OXP A;  4YAJ B;  1IBM Q;  1KDC A;  4OIK A;  1WSC A;  2F0N A;  1TS4 A;  1HNW Q;  1KNE A;  1K8A C;  4Q8E A;  3TP7 A;  2UXC H;  2OTL A;  2KHI A;  4WBN F;  4DR7 Q;  4DR1 H;  5KNC A;  1RTN A;  3G8C A;  3G6V A;  2E74 C;  3KYH C;  1KQS A;  1H9S A;  3J7Z C;  4A93 G;  1PH7 A;  5C3E B;  4IFD G;  3RIZ A;  1Q8I A;  3RZO H;  1AN8 A;  2F4I A;  1WCM A;  5EKI A;  4BXX G;  1JXL A;  3K7U C;  5LMN L;  3PUV A;  5E7N A;  1UEB A;  3DWA A;  2RDJ A;  2WYO A;  5HY6 A;  1BO0 A;  2ZM6 L;  1LTA D;  1PH4 A;  3F8N A;  3ERS X;  4A3D H;  1TVX A;  4EYH B;  2NVX A;  2EXZ A;  2CWP A;  4YIJ A;  5KFN A;  1PVO A;  4O3N A;  3H6M A;  3OUZ A;  1B9M A;  2Q8R E;  2N88 A;  3U50 C;  1NMF A;  5KT2 A;  1ZET A;  3GIQ A;  1IBL H;  1BBU A;  4DXG A;  2NN6 G;  2L55 A;  1E4G T;  5KFR A;  1BCP D;  1SJH D;  3OIP A;  3VPB A;  4FNF A;  3GTP A;  2NTS A;  3V6J A;  3BZD B;  3RLF A;  5IT9 L;  5FD6 A;  1U4M A;  2LXK A;  3NWT A;  3IG0 A;  2PQE A;  4Q43 A;  1HR0 H;  1CA6 A;  2JA9 A;  5IGC A;  4HQ6 A;  1QJO A;  4XQJ A;  4J6H A;  1WD1 A;  5C0X G;  1QNK A;  4Q8F A;  2LSS A;  2NUA B;  1V8Q A;  1WYD A;  3CP0 A;  3LWE A;  2UUB L;  5C4X B;  5LL6 b;  2R8H A;  2HCI A;  4FF4 A;  4KY5 A;  4KMU C;  4PZ8 A;  4UY8 C;  1ILQ A;  3PW2 A;  4YR3 A;  2J7Z A;  3EPG A;  2B2W A;  5LA6 F;  3CCS A;  3CPF A;  1M4V A;  3H15 A;  2F0U A;  3S15 B;  4J9N A;  2M9V A;  2DPI A;  4YQW A;  4C3H H;  3PQI A;  1DM0 B;  1T9H A;  1RF2 D;  5A35 A;  2EXD A;  2UXC L;  1FD7 D;  1IW7 C;  4U67 3;  4OEM B;  2GLT A;  1SFO H;  5KX5 F;  1VQH A;  2E2I A;  2R7K A;  3E0E A;  4MN3 A;  2V58 A;  2ZDQ A;  2VUM B;  3JRX A;  3RV3 A;  1S5E D;  2UXB Q;  3N40 P;  2QKI C;  2HT1 A;  1K83 H;  3CQZ A;  1A3U A;  3GTG B;  3I4M H;  1E7Z A;  3D4R A;  3RN2 A;  5ELF A;  3RZD H;  2BQR A;  1MD2 D;  3RAX A;  1A6X A;  3TZU A;  4FBU A;  3GTK A;  4KTA A;  4A3K B;  4GKK H;  3HOU H;  2R82 A;  2VQF L;  4JI6 H;  1VDZ A;  4O4I F;  3ZYY X;  3S14 H;  4IR9 A;  4K14 A;  3CCQ A;  3MR6 A;  4N9P A;  5KG6 A;  3HKZ A;  2F0G A;  2A6E D;  2B2W C;  2ZXO A;  4ECZ A;  1IBK Q;  4FS1 A;  1Y1V A;  4TRD A;  2MO0 A;  1TWC A;  2KCC A;  3MAQ A;  1RYR A;  4UP8 A;  2Q2T A;  4HMI A;  5JVG 3;  5CV5 A;  2F0E A;  1O7Z A;  3EPI A;  4K6D A;  5M5X B;  5C4X G;  1MKH A;  1NSN S;  2BA1 A;  1S5D D;  5EJW A;  3HKZ E;  1XMO H;  1CQF A;  2DN8 A;  2BDO A;  3I70 A;  4B9W A;  1NCV A;  1X55 A;  4DV0 Q;  3N41 B;  1B3A A;  1TKW B;  3J80 L;  4ZAI A;  2VPS A;  3ORR A;  5KG7 A;  3RB0 A;  2R86 A;  4EQ5 A;  2W9C A;  2L5T A;  4HR7 B;  3OSP A;  4DUY H;  5CV7 A;  5K36 G;  1KBL A;  5KEE A;  4JYA Q;  5CGK A;  2K5Q A;  5JAV A;  5IYZ F;  5E3F A;  3JSN A;  4BBR B;  3SXH A;  4KHP Q;  3KDF A;  3J7Y W;  3PR4 A;  2K33 A;  1HJP A;  3MWD A;  4FVM A;  1RK5 A;  2MO1 A;  1VQB A;  4HJ8 A;  1QCB D;  1J5E H;  3H20 A;  1ESF A;  3PF5 A;  1EQR A;  5D1O A;  4GZY C;  1JIH A;  4HCE A;  2X0S A;  4A3K G;  1DCZ A;  3Q8P B;  4QQB X;  1YBY A;  1X3P A;  1VMC A;  1KAB A;  4FP5 D;  3MC0 B;  5IGG A;  1XMQ L;  1T36 A;  3AEV A;  1GSA A;  3SDZ A;  5LHY 1;  4X64 Q;  3G71 A;  3H91 A;  3GTO H;  3OOC A;  4LF6 L;  5FJ8 H;  1PK8 A;  1OXV A;  5M5Y B;  1SLJ A;  3K5H A;  4L5R C;  1CQJ B;  1FR3 A;  2ZJR A;  4GKK L;  2EZV A;  1KNA A;  1IKL A;  1AE3 A;  4RWS C;  4DR5 L;  4XX0 B;  5KYL A;  1V51 A;  2AGQ A;  4C3J B;  3M4I A;  2FPP B;  3ND9 A;  2OCE A;  4M7E A;  4YHH H;  4MV9 A;  5IYD H;  4C2M B;  4ECW A;  1LV9 A;  1V4Y A;  2IHE A;  1SN8 A;  4JI4 Q;  1STY A;  3A5Z B;  5KFC A;  4H0L C;  5C4J H;  4A2A A;  1XX8 A;  4X65 H;  4DV4 Q;  4JI5 Q;  2IX3 A;  3J81 W;  1MSG A;  5IWA L;  3FMA A;  5KFL A;  3G48 A;  4YB8 B;  5FPO A;  2M05 A;  1MJC A;  2OF1 A;  1NUC A;  3I4N G;  4BBR G;  1T5E A;  2AHO B;  1VQG A;  3PGZ A;  1XMO L;  2HHH Q;  2PPB C;  1C30 A;  4ALP A;  5KFE A;  3R2T A;  5DGA A;  3OTO Q;  4OX9 H;  1DYQ A;  4KK7 A;  4RB2 C;  4NXN Q;  4MV7 A;  2GVB A;  4DV6 Q;  1RIP A;  2JXM B;  2UUC Q;  3HKS A;  4IHJ F;  1CHP D;  2PYK A;  2PNR C;  3LWB A;  4K5V A;  4Y8V B;  5M5W B;  4A3E H;  3RGZ A;  4TQR A;  4BBS G;  3CHB D;  3I55 A;  4A3C G;  1HHV A;  1PTO H;  3FPP A;  1T94 A;  4F4Y A;  5EZY F;  2KED A;  2YZN A;  3JRW A;  2E2H B;  1CQI B;  4JI1 Q;  2WP8 J;  5JVH 3;  1K3B C;  3FKI B;  1X3F A;  1F9P A;  2JA7 A;  1V1P A;  4A3G B;  3GTJ B;  3SK8 A;  3G6X A;  1Y8O B;  3U9S A;  2K4K A;  5COR A;  5JVD F;  5EWF A;  5CR3 A;  4C3J G;  2KHJ A;  3J80 E;  2YYZ A;  4OWX B;  4H13 C;  4DV2 L;  5IGB A;  5IT9 c;  4O1N A;  2VW9 A;  1X56 A;  1N36 Q;  3S2H H;  1JC7 A;  1JQY D;  2AUJ D;  1EIF A;  3RB6 A;  4DL5 A;  1L2Z A;  1KJQ A;  1A8V A;  2K6A A;  4OIJ A;  4B3S Q;  1H95 A;  2N78 A;  3HOW H;  5BMV F;  4GLA C;  2O2L D;  2D0O A;  1K83 A;  4Q44 A;  1K0R A;  3P7J A;  4M8A A;  3RF2 A;  4B3R L;  1M0T A;  1LTI D;  4LF8 H;  1PDQ A;  1M6V A;  4ID6 A;  4DPG A;  3STB D;  4ME6 A;  3JSL A;  2B2U A;  1FGU A;  4KN7 C;  3K59 A;  2LFN A;  2E76 C;  1GUT A;  2MPM A;  4R4T A;  1WTR A;  3HOV B;  2EQS A;  4L5Q A;  1HTP A;  4LFB H;  1Y8P B;  3M9B A;  2BH2 A;  2CFM A;  2OH2 A;  1A62 A;  2R6G A;  4NP5 A;  5JUM A;  1KC7 A;  5D8D A;  4ED3 A;  1SNC A;  4DR2 Q;  1EZ1 A;  1GUS A;  2G5D A;  2N49 A;  3GTQ H;  4OX9 L;  3KAL A;  2VXW A;  4BY1 H;  1SXT A;  2WAC A;  1PH3 A;  3PW0 A;  1EEF D;  3U4Z A;  1KJI A;  3JAM E;  3BZK A;  4IUQ A;  4G7H C;  4DK3 C;  1WD0 A;  2EVB A;  2XVS A;  2O03 A;  4OEL B;  1A3T A;  1UNN C;  3KXY T;  3I4L A;  4JC0 A;  4GOP B;  5H80 A;  1EEI D;  3MFI A;  1DIK A;  1TWF H;  2F0J A;  3S16 H;  1TWH H;  3SK6 A;  4JI2 L;  5C4Z A;  4IRD A;  3IFT A;  4ECV A;  2NZO A;  1I50 A;  2V5A A;  4JI3 L;  1ASZ A;  1B53 A;  5G3L F;  4A3L H;  3FDS A;  4K0K Q;  2DWC A;  3CAM A;  3TSS A;  2AKW B;  4CKC A;  4LFC Q;  5T1G A;  4RGT A;  2R7Z H;  1S0O A;  5KFU A;  3HOX B;  4LF7 L;  3M4P A;  4J9S A;  4ZLT F;  5KIX A;  4JI8 L;  1IHZ A;  2JA6 A;  1VBH A;  5E4X A;  3J80 c;  2A5H A;  2HVS A;  3X3N A;  2F0K A;  4J9K A;  1WCM G;  3HOY B;  3HOV G;  1VQM A;  4YJ2 F;  1EY4 A;  3G6Y A;  3H0G A;  4RAY A;  4K6L A;  5FO7 B;  5IGF A;  4P74 A;  1G51 A;  4DK6 C;  4MV6 A;  5KFA A;  4B3M H;  3T5K A;  1L0Y B;  1F2M A;  4R8I A;  3ULJ A;  4NXM H;  3Q6S A;  1AE2 A;  5CV8 A;  1K8O A;  1DGS A;  4ZHQ F;  1IBM L;  2KBN A;  1RDP D;  2KCN A;  1HNW L;  4MA0 A;  1SNQ A;  2R8I A;  4XIG S;  2D9U A;  4ABN A;  2GPS A;  2IWH A;  1JKJ B;  4DR7 L;  1Y1W A;  2UVR A;  1A2T A;  3A7L A;  4FF2 A;  2JA5 B;  2VR1 A;  1F9S A;  2ICI A;  3KTM A;  3GTM A;  4NB3 A;  3KHL A;  4K5X A;  2F1M A;  3BJY A;  1EU4 A;  1STG A;  3A54 A;  2WAQ A;  3S1Q B;  4QWD A;  4C1N K;  4DNT B;  4A3I G;  1HNZ Q;  1W96 A;  2HDL A;  1GSH A;  4V19 0;  1E2Z A;  2KEN A;  4A3B B;  1N8R C;  1CSQ A;  5C4H A;  2K1B A;  1QZG A;  5ELO A;  4PMB A;  5CYU A;  3I73 A;  1B1Z A;  3RD4 A;  3HOX G;  3J7A V;  2K01 A;  1O7L A;  4Q5V A;  2EJF C;  4KY6 A;  2EIF A;  4YJ3 F;  2UU9 H;  2BDN A;  2D62 A;  5BN5 A;  3P75 A;  2NU6 B;  2PQA B;  1QOH A;  1WJJ A;  1IBK H;  2BOS A;  2E8G A;  1X3G A;  3MFG A;  5JEA J;  1Y69 U;  3HOY G;  5ELB A;  5A2Q L;  1CZW A;  2RKS A;  1WOC A;  3RGX A;  5KG5 A;  2K52 A;  3CCV A;  3SE7 A;  4HNU A;  4O2A F;  3R93 A;  3UDX A;  4ZKC B;  1Q81 C;  2HUG A;  1OXU A;  1TS3 A;  1V43 A;  2AMC B;  3K81 C;  1ROD A;  2PNH A;  4RKL A;  3T1H H;  2XTI A;  1SYE A;  5E1F A;  1VQ8 A;  3KHR A;  4I65 A;  2VY3 A;  2ZTD A;  3A55 A;  1VQ5 A;  4R7R A;  2B63 B;  1I3Q B;  4CBV A;  4UCT A;  4L1K A;  4P71 A;  4DLK A;  1TWA B;  3GIK A;  2VUG A;  5FO9 B;  1JOQ A;  1YNJ D;  1ZYR D;  3RN5 A;  5KFY A;  4XQQ A;  1SRO A;  1HQM C;  3HKZ G;  4A3F G;  4MTE A;  5EWE A;  4NW2 A;  4AYB A;  4ZI7 F;  1AUV A;  3E3X A;  1GUO A;  3OYY A;  3RFC A;  4HIM A;  5FPR A;  4CC5 A;  1TQO A;  2VNU D;  2F4V H;  3I90 A;  2XWJ B;  4A3B G;  1E4E A;  3NGD A;  1VCI A;  4F8M A;  5KG4 A;  2RSN A;  4QF4 A;  2UXB L;  5DEH A;  1M0W A;  5KND A;  4YCW A;  2G9H D;  2A74 C;  5KFG A;  2HQL A;  4FXG C;  1S97 A;  2W8K A;  4A3D B;  4RNN A;  3T5L A;  2CW8 A;  3A56 A;  3RUP A;  4QWE A;  5C44 H;  1B8A A;  2SNM A;  3S2D H;  4QW8 A;  2YV5 A;  2IP4 A;  2WB1 B;  1LM0 A;  4RU9 A;  5F9N A;  2C9O A;  4KJO A;  1Y14 B;  1LTT D;  1QIL A;  3HRZ C;  3H09 A;  1IBK L;  4UCO A;  2NVX H;  2JEA I;  1XNQ Q;  2KEE A;  5LXT F;  1BCP C;  1TWF A;  4DV4 H;  2RGR A;  3GTP H;  1R4P B;  3T56 B;  5JJL A;  2D2C C;  2BQU A;  1J8I A;  4DV0 L;  4U68 A;  1H9M A;  1VS0 A;  3S1N H;  2Z6K A;  1WI5 A;  3PUZ A;  1I94 Q;  4DL6 A;  3GIM A;  4LMQ D;  2H4O A;  2UUC H;  3E5N A;  4JYA L;  3UDF A;  1S0M A;  3HS0 C;  4C3H B;  3M4O H;  3MXU A;  3Q1K A;  4KHP L;  3PIO A;  4IPG A;  1LT5 D;  1XNR Q;  5A2Q E;  2UUA Q;  4CJ0 B;  2RDG A;  1SFO B;  4LMY A;  1B44 D;  3T4A C;  5C3X A;  2CZG A;  4IUU A;  4KY7 A;  4A3D G;  1SE8 A;  2DNC A;  5K2M A;  3CMA A;  3LX0 A;  3F2C A;  4B3T H;  3SI8 A;  1U4L A;  3Q2O A;  1XDN A;  2V1C C;  3EBE A;  4CKE A;  3CCR A;  4AQY Q;  4X64 L;  4ZOL F;  1JOO A;  2WB1 G;  4GN5 A;  4C56 C;  2E2I H;  1M7J A;  5JPN C;  4ZQI A;  3EN2 A;  4A3J H;  5FKA C;  3SGI A;  2NU7 B;  4R8U A;  5FLX L;  2YU9 A;  4DFA A;  4RHR A;  1HNX H;  2F0O A;  3CQZ H;  5HUR A;  2R93 A;  4G4K A;  3S14 B;  1SMX A;  2Z6K C;  2EYL A;  3ULP A;  3R5H A;  1XPU A;  2GVA A;  2HCC A;  1ONL A;  3GTK H;  3N6X A;  4EQN A;  3KHH A;  4MIU A;  3K5N A;  1PFM A;  5KFS A;  1TAE A;  4EVO A;  1D7Q A;  2A6E C;  2K75 A;  4JI4 L;  3M7N A;  3MR2 A;  2DJG C;  4HIK A;  4JI5 L;  4DV4 L;  5LMN H;  4E6I A;  4X62 Q;  1Y1V H;  2R7F A;  3UI2 A;  2ZM6 H;  1L1O C;  1O80 A;  1K8G A;  2E5L Q;  1EHI A;  4QW9 A;  4C3H G;  3NTH A;  3F2B A;  4A93 B;  2HHH L;  5KFF A;  1N32 H;  1UUP A;  4CDC C;  3OTO L;  5KFM A;  3W3A A;  3VYT A;  4NXN L;  4DV6 L;  3K5L A;  3BDL A;  3NEM A;  2UUC L;  4UAI A;  3EQL C;  5I2X A;  2J6U A;  1SYC A;  3HEJ A;  3I4M G;  1Z47 A;  4RNM A;  3IKJ A;  3PR5 B;  1PRT D;  2Y0S A;  1RL2 A;  3HOU G;  1HR0 W;  1X54 A;  4P75 A;  1DOM A;  4HNV A;  3TP6 A;  4JI1 L;  3CVZ A;  4KLK A;  4DV7 Q;  4EFB A;  3GTO B;  4FXK C;  2NTT A;  3VPC A;  5ELD A;  3BS1 A;  3OW2 A;  4K0K H;  3VYS A;  2Y0S E;  3K0X A;  1MI2 A;  1TWG A;  1V1O A;  3S1R H;  5J2T F;  1NY4 A;  4Z9C B;  3BAB A;  1XXG A;  3PVX A;  4RFB A;  1N36 L;  3IN5 A;  1C48 A;  4FBT A;  2NUC A;  1F2Z A;  2A73 B;  3V05 A;  4Y7N H;  1AP0 A;  1A3V A;  1Q1B A;  4B3S L;  5D3D A;  5KFW A;  3SR1 A;  5DNF A;  3SE0 A;  3FKI A;  2W6P A;  2BR0 A;  3ICE A;  2E2J H;  5KFQ A;  4J9Q A;  3RR5 A;  1GUG A;  1VQ9 A;  3PW5 A;  1E3P A;  2PZW A;  1PH5 A;  3K6O A; 
#chains in the Genus database with same CATH homology
 3KF6 B;  1N33 Q;  3AEV A;  1MJE A;  3CCM A;  4POF A;  4L5T A;  1G29 1;  3CCJ A;  3D0F A;  4X64 Q;  5GQO A;  1UE1 A;  3NEN A;  3G71 A;  1XPR A;  3GTO H;  4LF6 L;  4LUO A;  2UUB Q;  3BU2 A;  2ZJQ A;  3HFZ B;  5FJ8 H;  5IYC G;  1OXV A;  4DR3 Q;  1QZH A;  1SLJ A;  1PV4 A;  3Q8D A;  4L5R C;  2ZJR A;  1PH2 A;  1C0A A;  4GKK L;  4JV5 L;  4DUY Q;  1M1K C;  3ER0 A;  1YHQ A;  1AE3 A;  4DR2 L;  1VQD A;  2RHQ B;  4DR5 L;  1N32 L;  3GDE A;  2I0Q A;  1U0L A;  1XTD A;  1KHI A;  3A0J A;  1IYJ B;  2OCE A;  3I4N H;  4BBR H;  4IPC A;  4LFA L;  4P73 A;  3I56 A;  1XJV A;  5IYD H;  2XGT A;  1GVP A;  2UXC Q;  2IHE A;  1SN8 A;  3KFU A;  5IP9 H;  5GAG C;  4JI4 Q;  3A5Z B;  5FJ8 G;  1J5E Q;  5C4J H;  1Q86 C;  4X6A H;  1OXS C;  1JJG A;  4DV4 Q;  1Z9F A;  4JI5 Q;  4LF8 L;  5M3F H;  5IWA L;  1TXY A;  4AIM A;  2ATW A;  3G48 A;  3I7F A;  3CD6 A;  3TRZ A;  4GLV B;  2ALY B;  4DKA C;  1MJC A;  4BBS H;  4A3C H;  3I4N G;  4BBR G;  2AHO B;  1VQG A;  3PGZ A;  1XMO L;  2HHH Q;  4LFB L;  4GN3 B;  3FHW A;  5IYD G;  4ALP A;  2BA0 A;  3J81 j;  1VQ6 A;  2VQF Q;  5IP7 H;  4K0K L;  1E24 A;  3E9H A;  5GAD C;  1HZ9 A;  3OTO Q;  5IP9 G;  4YY3 L;  4LFC L;  1FVI A;  1V1Q A;  2K5H A;  4HJ7 A;  4NXN Q;  2JA7 H;  1EWI A;  2R92 G;  2GVB A;  4DV6 Q;  1RIP A;  5H1S E;  2K14 A;  2UUC Q;  1WFQ A;  3HKS A;  1X6O A;  4UP9 A;  4DR6 L;  2B3G A;  1YZ6 A;  2DGY A;  4YHH Q;  4C3J H;  1YHA A;  5M3F G;  4DNI A;  4Y52 H;  4C2M H;  4A3E H;  1SRU A;  4BBS G;  3I55 A;  4IOC A;  1JJ2 A;  4A3C G;  4RMF A;  1W3S A;  4LF4 L;  2N8N A;  5LMU Q;  5IY0 A;  4GKJ Q;  2IHF A;  5IP7 G;  4JI1 Q;  2WP8 J;  1YIJ A;  3K7A H;  4X65 Q;  1MIU A;  4QGU A;  1X3F A;  1L0W A;  3G6E A;  4DV5 Q;  5GRO A;  3UE0 A;  2JA7 G;  2ES2 A;  1BBW A;  1CUK A;  3JAM c;  4LF9 L;  3MXN B;  2K4K A;  3STB C;  2I5L X;  2KHJ A;  4LUV A;  2KCM A;  4O2D A;  2YYZ A;  4PZ6 A;  4OWX B;  3U4V A;  4DV2 L;  5IT9 c;  2VW9 A;  1X56 A;  1GM5 A;  2CKZ B;  1B7Y B;  1LUZ A;  2VZA A;  4A3E G;  3G4S A;  5FLM H;  4A3M H;  1M90 C;  2I5M X;  2RHS B;  1N36 Q;  3WWV A;  3S2H H;  1S3O A;  1EIF A;  4R4Q A;  1UE6 A;  2E2J H;  1A8V A;  3I4O A;  4R1J A;  1S72 A;  4UPA A;  2N78 A;  4B3S Q;  1VQN A;  3HOW H;  5JEA G;  3W5O A;  1EYG A;  1H95 A;  1UE5 A;  2JA5 H;  4GLA C;  3J81 c;  3CCL A;  2D0O A;  1BKB A;  1K0R A;  1C7Y A;  4JBK A;  5FLX c;  4R4O A;  4HIO A;  2MFI A;  4R4C A;  3S1Q H;  4B3R L;  1E1O A;  5AJ3 L;  1VQC A;  1HNZ L;  2JA8 H;  4DR4 L;  1XMQ Q;  4DPG A;  5FLM G;  4A3M G;  4PMW A;  3STB D;  2IX1 A;  3L2P A;  4IFD I;  3ZJY C;  1FGU A;  2IT1 A;  1VQK A;  3CME A;  4OO1 I;  4B3M L;  2MNA A;  2Z0S A;  4R4T A;  3GTJ H;  1W2B A;  2EQS A;  4LF6 Q;  4L5Q A;  1L2F A;  3M9B A;  2BH2 A;  3HOW G;  3PF4 A;  2CFM A;  1Q82 C;  2JA5 G;  1X65 A;  2OQ0 A;  2ZJP A;  4HJ9 A;  1A62 A;  4BY7 H;  4NXM L;  2R6G A;  4GKK Q;  1NE3 A;  4R4I A;  4JV5 Q;  1OTC A;  4DR5 Q;  1OXT A;  4DR2 Q;  1JB7 A;  2N49 A;  4LW1 A;  1EQQ A;  1VQ7 A;  3GTQ H;  4OX9 L;  3NBH B;  4BY1 H;  2JA8 G;  1PH3 A;  1I50 H;  4UP7 A;  5ELN A;  4JBW A;  4LFA Q;  4A76 A;  2OTJ A;  1YVC A;  3RLN A;  2F52 A;  1KXL A;  3U4Z A;  2NN6 I;  3GD7 A;  3BZK A;  4DK3 C;  3UDI A;  2C35 B;  1YJW A;  4IFD J;  1HZC A;  4BY7 G;  2OWO A;  4JC0 A;  4JI7 L;  4GOP B;  4LF8 Q;  3H3V I;  4MNO A;  2JA6 H;  5IWA Q;  1TWF H;  2B63 H;  3S16 H;  1TWH H;  1PYS B;  4JI2 L;  4BY1 G;  1TWA H;  2NZO A;  4IPH A;  1WCM H;  1XMO Q;  5C0X I;  3HOV H;  4LFB Q;  4GLX A;  3H0G H;  4YWK A;  4JI3 L;  1ASZ A;  1FJG L;  1IL2 A;  4A3L H;  4K0K Q;  3CAM A;  4JBJ A;  3PV0 A;  4YY3 Q;  2AKW B;  1YJN A;  2UU9 L;  1CSP A;  4NPS A;  4DAY B;  4L5S A;  4LFC Q;  4IOA A;  3DLL A;  2PI2 E;  2R7Z H;  3FP9 A;  4JOI A;  4DR6 Q;  3TS2 A;  4LF7 L;  3M4P A;  1AH9 A;  4JG2 A;  2JA6 G;  4JI8 L;  2B63 G;  3TRE A;  1EUJ A;  3CXC A;  4ME3 A;  1PFS A;  3J80 c;  1QVG A;  5M3M H;  3UE1 A;  3CCE A;  1IXR A;  1WCM G;  4OO1 G;  3HOV G;  1VQM A;  3I2Z A;  3S24 A;  4LF4 Q;  3H0G G;  1JJC B;  4A3L G;  2R92 H;  4GS3 A;  3PO2 H;  3CCU A;  3T1H L;  2DUD A;  2MQH A;  1Y1W H;  3A5U A;  4P74 A;  1G51 A;  4DK6 C;  5LMN W;  3F8T A;  5C0X J;  3T1Y L;  4LNQ A;  3H3V H;  2R7Z G;  2QA4 A;  3GTM H;  4LF9 Q;  1VQA A;  3PUX A;  1GD7 A;  1VQJ A;  3A74 A;  4DV3 L;  4JI0 Q;  4J15 A;  3ULJ A;  2JEB I;  4DV2 Q;  1YEZ A;  1AE2 A;  1N9W A;  1KAW A;  4A3I H;  3KOJ A;  1NJI C;  1EIY B;  3J80 i;  1DGS A;  5M3M G;  3F1Z A;  1IBM L;  4QY7 A;  2KBN A;  3IRB A;  1HNW L;  4IPD A;  4XIG S;  3DM3 A;  3PO2 G;  1PH9 A;  3M4Q A;  4DR7 L;  1Y1W G;  3HOX H;  3J7A 5;  2WFW A;  2ASB A;  4GOP A;  4A75 A;  4JOI C;  1N34 L;  2UXD L;  1XNQ L;  1C9O A;  4NB3 A;  2F4V L;  4QIW E;  3W1B A;  5C3E H;  5GAE C;  2JQO A;  1L1O A;  2WAQ G;  3TQY A;  1VQO A;  4B3R Q;  4OWT B;  3HOY H;  3CPW A;  5AJ3 Q;  4A3I G;  1HNZ Q;  4DR4 Q;  4YWM A;  1VQF A;  2VQE L;  2KEN A;  2D0P A;  1PYB A;  1N8R C;  1YNX A;  1CKN B;  1CSQ A;  3D31 A;  2AWN A;  3JC6 6;  4KI0 A;  3CF5 A;  3RNU A;  1X3E A;  1PH8 A;  1QZG A;  5ELO A;  1CKO A;  3TEH B;  1YHB A;  3HOX G;  1PH6 A;  1Q1E A;  1I94 L;  4NXM Q;  4JI0 L;  1QVC A;  4DV1 L;  2EIF A;  1QUQ B;  3KJP A;  2D62 A;  4DUZ L;  3HOZ H;  5C3E G;  2PQA B;  1NTG A;  3AFP A;  1WJJ A;  3CC7 A;  1YIT A;  2E8G A;  3EIV A;  1X3G A;  3MEF A;  4JCV E;  5JEA J;  4OX9 Q;  3HOY G;  1Q12 A;  1VQI A;  2Q2U A;  2KCT A;  1Q7Y C;  1UWV A;  1EOV A;  2UUA L;  1WOC A;  4DR1 L;  1XNR L;  3K80 C;  2K52 A;  3CCV A;  1HZB A;  3KF8 B;  3UDX A;  1Q81 C;  4AH6 A;  1EFW A;  4YCV A;  1OXU A;  4A3F H;  3JAM i;  4H02 A;  1V43 A;  2AMC B;  4GOP C;  3K81 C;  2PNH A;  4GNX B;  2XTI A;  1TWC H;  4LUZ A;  4X66 L;  4JI7 Q;  1VQ8 A;  3F2D A;  3U58 A;  2L15 A;  3HOZ G;  4A4I A;  3BZC A;  2VY3 A;  2HIX A;  2ZTD A;  4AQY L;  1VQ5 A;  4BA1 I;  2Q2H A;  3KJO A;  4A3B H;  5JJK A;  4QL5 A;  4JI2 Q;  3UDG A;  2PMZ E;  2BH8 A;  4RG1 A;  4P71 A;  4JI3 Q;  1FJG Q;  2A8V A;  3RN5 A;  1IZ6 A;  3S1M H;  1SRO A;  4QJF A;  2CQO A;  2YTV A;  2JJQ A;  2UU9 Q;  3J81 i;  5JJI A;  5BR8 L;  3HKZ G;  4LWC A;  4YCU A;  4A3F G;  1KIX A;  3S15 H;  2NZH A;  4AYB G;  1IBL L;  2YTX A;  2JE6 I;  4LF7 Q;  2K5N A;  1NBW A;  3PO3 G;  3OYY A;  2Y0S G;  4PZ7 A;  4JI8 Q;  4EX5 A;  4HIM A;  2HIV A;  3PUY A;  2VNU D;  2IX0 A;  3E9I A;  1VQ4 A;  4A3B G;  1VQL A;  1VCI A;  3RLO A;  4DAM A;  4LF5 L;  2VUM H;  1CKN A;  1OXX K;  1KRT A;  1NMG A;  2UXB L;  1J6Q A;  3S17 H;  3K8A A;  3CC2 A;  1JMC A;  3T1H Q;  1BVS A;  1HR0 L;  2N3S A;  4B3T L;  4YCW A;  1Q46 A;  4APV A;  3T1Y Q;  4X62 L;  2JK8 A;  3GTL H;  3KLW A;  4WJ4 A;  1QUQ A;  1QVF A;  2HQL A;  4OON A;  2NVQ H;  1D8L A;  2PQA A;  2E5L L;  1A0I A;  4OWW B;  1K73 C;  4A93 H;  4DV3 Q;  1I3Q H;  4GN4 B;  1L1O B;  4PG3 A;  5C44 H;  4HID A;  1B8A A;  1X9N A;  3PUW A;  1HNX L;  3S2D H;  4BXX H;  2YV5 A;  2VUM G;  1IBM Q;  1LM0 A;  4BA2 I;  1HNW Q;  1K8A C;  4XTC S;  3VDY A;  2OTL A;  2KHI A;  1Y14 B;  3ULL A;  1GKH A;  4DR7 Q;  3GO5 A;  2FXQ A;  1IBK L;  4GNX A;  4IO9 A;  2NVX H;  2JEA I;  2UXD Q;  1N34 Q;  1XNQ Q;  2GN5 A;  1HZA A;  3KYH C;  2F4V Q;  1KQS A;  3J7Z C;  4A93 G;  1PH7 A;  2VS1 A;  4IFD G;  4MTN A;  3RZO H;  1LTL A;  4C3I H;  5C44 G;  2QEX A;  4O0A A;  2VQE Q;  4TQU S;  4DV7 L;  4BXX G;  3GTP H;  3K7U C;  5LMN L;  5JJL A;  1VQP A;  3PUV A;  5E7N A;  1HH2 P;  1UEB A;  2QGQ A;  5HY6 A;  2ZM6 L;  4DV0 L;  1PH4 A;  1V9P A;  3ERS X;  1VS0 A;  4A3D H;  1E1T A;  2Z6K A;  1WI5 A;  3PUZ A;  3S1N H;  1I94 Q;  2CWP A;  3L7Z C;  2IY5 B;  4DV1 Q;  1PVO A;  3PIP A;  4JI6 L;  1U5K A;  3PCO B;  3U50 C;  4DUZ Q;  1NMF A;  1SR3 A;  3UDF A;  1YJ9 A;  4JYA L;  1R9T H;  1BBU A;  3M4O H;  1JT8 A;  2NN6 G;  3CC4 A;  4TVA B;  4KHP L;  3PIO A;  4IPG A;  1XNR Q;  2UUA Q;  2YU9 H;  4KHZ A;  4DR1 Q;  2R93 H;  3RLF A;  3TS0 A;  4GNX C;  4A3D G;  1SE8 A;  2LXK A;  1FL0 A;  3AYH B;  3CMA A;  3F2C A;  2JA9 A;  4X66 Q;  2R7D A;  1N33 L;  5C0X G;  2V1C C;  3EBE A;  3CCR A;  4AQY Q;  1GO3 E;  4X64 L;  2LSS A;  2WB1 G;  4GN5 A;  2E2I H;  3AFQ A;  1WYD A;  3B6Y A;  3CP0 A;  3EN2 A;  4A3J H;  2UUB L;  3SGI A;  1K3R A;  5M5Y H;  4HJA A;  4OXP A;  3NEL A;  4DR3 L;  2R93 G;  1VQE A;  3CQZ H;  1JE5 A;  4PZ8 A;  4IJL A;  4UY8 C;  2ID0 A;  4DUY L;  1E22 A;  1SMX A;  2Z6K C;  5BR8 Q;  3CCS A;  2WAQ E;  3CPF A;  3ULP A;  1S40 A;  1XPU A;  2GVA A;  2ZTC A;  3M85 A;  3H15 A;  1IBL Q;  2ZTE A;  3GTK H;  4C3H H;  1T9H A;  2WB1 E;  3KF6 A;  1B70 B;  1KD1 C;  2EXD A;  2RCN A;  2UXC L;  1D7Q A;  3W1G A;  2K75 A;  4MZ9 A;  1VQH A;  2VL6 A;  1SFO H;  4JI4 L;  4LF5 Q;  3E0E A;  4A3J G;  1J5E L;  3M7N A;  1I6H H;  3KDF B;  2K5V A;  2UXB Q;  5IYB H;  5GAH C;  4HIK A;  1HR0 Q;  1K83 H;  4HJ5 A;  4YWL A;  4JI5 L;  1KRS A;  4DV4 L;  4B3T Q;  2HT1 A;  4X62 Q;  1Y1V H;  2R7F A;  3I4M H;  2YTY A;  1E7Z A;  3RN2 A;  3RZD H;  3PO3 H;  1L1O C;  1K8G A;  2E5L Q;  1Q8K A;  5J3B A;  1P8L A;  3F2B A;  3M3Y H;  2HHH L;  3HOU H;  5C4X H;  1UE7 A;  5DLQ E;  2VQF L;  2B29 A;  3OTO L;  1HNX Q;  4NXN L;  4DV6 L;  3S14 H;  1G6P A;  3BJU A;  3NEM A;  5IYB G;  2OQK A;  3CCQ A;  2UUC L;  2H5X A;  4YHH L;  1K9M C;  1CKM A;  2Q2I A;  1IBK Q;  3CW2 C;  1Y1V G;  1TWG H;  2K50 A;  3I4M G;  1Z47 A;  2MO0 A;  5M5W H;  4B3M Q;  4UP8 A;  2Q2T A;  4POG A;  5HGQ A;  1RL2 A;  3HOU G;  2I5H A;  1HR0 W;  1X54 A;  5LMU L;  1XPO A;  2E2H H;  4P75 A;  2NVT H;  4GKJ L;  5C4X G;  1MKH A;  4JI1 L;  1A63 A;  2BA1 A;  3FKI H;  1LYL A;  4KLK A;  3HKZ E;  4X65 L;  4DV7 Q;  4A3G H;  4DV5 L;  5LMN Q;  3AQQ A;  2RF4 A;  3GTG H;  4AYB E;  1X55 A;  2LXJ A;  2ZM6 Q;  4DV0 Q;  3OW2 A;  1ASY A;  2A19 A;  2CCZ A;  1O7I A;  2Y0S E;  3K0X A;  4A3K H;  4EQ5 A;  1N32 Q;  3S1R H;  4JBM A;  1NY4 A;  1PHJ A;  3LGJ A;  4WJ3 M;  1P16 A;  4JI6 Q;  1YI2 A;  5K36 G;  4JYA Q;  1N36 L;  2CWA A;  1PA6 A;  4Y7N H;  4KHP Q;  3KDF A;  1Q1B A;  4B3S L;  5EAY A;  1KC8 C;  3FKI G;  1HJP A;  5IYC H;  4A3G G;  2MO1 A;  1VQB A;  4IJH A;  4HJ8 A;  1I5F A;  3ICE A;  4P72 A;  3RR5 A;  3PF5 A;  1EQR A;  2A1A A;  2F3I A;  1PH1 A;  1KL9 A;  2AWO A;  4FDB A;  1VQ9 A;  4A3K G;  2PI2 A;  1E3P A;  4QQB X;  5IE8 A;  2NVY H;  5M5X H;  1YBY A;  1PH5 A;  3L0O A;  1XMQ L;  3PSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...