4A3LG

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid and soaked with ampcpp
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 32
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3lG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3lG01
4LW1A 2QGQA 3PCOB 3GTOH 4KHZA 2MQHA 2N78A 4KLKA 3F2BA 1WOCA 2ZTEA 1X65A 3I4OA 5C3EG 3S16H 4LWCA 1HR0Q 4GOPA 4DV1L 3CD6A 2KENA 3I56A 2R93H 1SN8A 4A76A 3LGJA 4DR4L 2GN5A 3RLNA 2BA0A 1XPRA 4GKKQ 1N32Q 1NMGA 1X3EA 2VUMG 3KDFB 4R4QA 1V1QA 4O2DA 2CCZA 3PIOA 2LXJA 4EX5A 2NVYH 4JYAQ 3KLWA 2Z0SA 4JC0A 1M1KC 4R1JA 1WFQA 4JI6Q 2B29A 5C3EH 2N8NA 4OO1I 4NXML 4PG3A 4OXPA 4HJ9A 4C2MH 3KJOA 3U50C 2D0OA 3CCUA 1NMFA 3CC2A 4DK3C 1K73C 5C4XG 1U5KA 2ID0A 4J15A 3U58A 1PH7A 2VUMH 1RIPA 1T9HA 2PQAB 3HKSA 2PI2E 4IFDJ 4YY3L 4JI0L 1EWIA 5GAHC 1C0AA 4X62Q 4JOIC 2UXCQ 1X56A 1PYBA 1LYLA 2I5MX 5C0XI 2JQOA 4A3EG 2JA5H 1N33Q 3S2DH 4RMFA 4JI1Q 4JI2Q 2RHQB 4DV2Q 1Y1VH 4LNQA 3OTOL 3GTPH 5LMNW 1VQ4A 2QEXA 4IO9A 3HOXG 2VW9A 2CKZB 4BXXG 2E2HH 1HR0W 1NE3A 5C4XH 4UP7A 1TWGH 1VQDA 2VZAA 1IZ6A 2NVTH 2UUBQ 1J5EQ 4IJHA 4BBRG 1HH2P 5IYCG 2Q2HA 5AJ3Q 4DAMA 1G51A 4QL5A 3KF6B 1OTCA 2VNUD 1C9OA 4APVA 4HJ8A 2H5XA 5IYDG 4BBSG 3T1YQ 1EFWA 5BR8L 4DV4L 1PH4A 1UE1A 4GN5A 3EN2A 4R4CA 5M5XH 3RN5A 4X66Q 3I4MG 4O0AA 5JJLA 1VQNA 2YV5A 2YTXA 4DR5L 4DR7Q 4L5QA 3L7ZC 3S1RH 3CCMA 2AMCB 2WB1G 3J81c 5LMUL 4POFA 1EIFA 2JK8A 1OXUA 3J80c 2BH8A 3L2PA 4OX9L 1HJPA 4JI5L 2BA1A 4BXXH 3CCRA 3B6YA 1PV4A 4LF5Q 4JI4L 1L1OB 3KYHC 5IYCH 4GKKL 1VQLA 5IYDH 1PHJA 2HQLA 1FGUA 2A19A 1VQKA 3JC66 4YWMA 4JI7L 2JEAI 3HOVG 2WAQG 4B3RQ 1WI5A 4C3JH 1PH5A 1XNQQ 1NBWA 1HZAA 3UDXA 1CSPA 1EQQA 2A8VA 1Q1BA 2WB1E 3AYHB 2ZM6Q 3G6EA 2CFMA 3AFQA 3RNUA 4LFCQ 3STBD 4R4OA 3A5UA 2K5HA 2YTVA 2MNAA 3J81i 3K7UC 3E9HA 1RL2A 1K9MC 4IPHA 2ES2A 4YWKA 1LM0A 3CF5A 5IWAL 2R7DA 3ER0A 2UUCQ 2F4VQ 3TRZA 1VQJA 3CCJA 1LUZA 1JE5A 2IX1A 1HNXQ 4Y52H 5JJKA 2KBNA 1Y1WG 4A3MH 3CW2C 2WAQE 3U4VA 2JA9A 3W5OA 2NZOA 4UY8C 3CMEA 3CPWA 3CAMA 2UU9Q 2ZTDA 3M85A 1U0LA 2K50A 4NXNL 1OXSC 3D31A 4BA2I 5DLQE 3RLOA 3MEFA 3T1HL 4LF9Q 4A3JG 2K14A 3TREA 1IBML 1P8LA 3KOJA 2JA8H 2IX0A 3S2HH 4PMWA 1L1OC 3J7ZC 4POGA 2N49A 4DV7L 1Y1WH 2NZHA 3IRBA 1XMQQ 3PV0A 2AKWB 3GO5A 1YZ6A 1MKHA 1X3GA 4DV5L 2OTJA 2LSSA 1VQBA 3JAMc 3PO3H 4LF7L 4KHPL 4GLXA 1JJ2A 3S1NH 3CCEA 1VQEA 4DAYB 2K52A 1AE3A 1YEZA 3K0XA 3PF4A 3PO2H 4YHHL 2E5LQ 2N3SA 2VQFL 5C4JH 4LFAL 1CKMA 5J3BA 2E2JH 1YVCA 5IE8A 1PVOA 5GQOA 4B3TQ 2WP8J 4X65Q 5LMNL 3UE1A 4DR3Q 1S3OA 4DUYL 4ALPA 3OYYA 2KHJA 1HR0L 2BH2A 2K5VA 1X6OA 3GDEA 5C44H 5M3FG 4LF6Q 2FXQA 4GNXB 4GKJQ 4IJLA 1VQ8A 1XNRQ 1AE2A 1IXRA 2V1CC 3BZCA 4PZ7A 4H02A 5M3MG 3JAMi 1PH3A 4P73A 2KHIA 2E8GA 4LUVA 5ELOA 4JG2A 2AHOB 2JE6I 2XTIA 4OWTB 3CC4A 1IBLQ 4A3BG 4A3DG 1A63A 3G4SA 1KRSA 1VCIA 4JI8L 1PYSB 2C35B 4WJ3M 1I6HH 1M90C 1IL2A 2E2IH 4DV1Q 2I0QA 5JEAG 4EQ5A 4JI6L 2VQEL 2L15A 1YJ9A 4A3FG 3ULJA 1FL0A 3AQQA 1WYDA 2DUDA 4DR4Q 4QJFA 4JBMA 3F1ZA 1K3RA 4B3ML 2Y0SG 1Q81C 5M5WH 2MO1A 5HY6A 1KC8C 2ATWA 2ZJQA 4P74A 5M3MH 1TWFH 1VQMA 3A5ZB 2K75A 4DV6Q 4A3BH 2RHSB 3UDIA 4A3DH 3PUVA 1YITA 3PUWA 1HZCA 1Q8KA 1QUQB 4GN3B 1XMOQ 2R7ZG 4IOAA 4OWWB 2MFIA 2UUAQ 1Z47A 3ICEA 2KCMA 4A4IA 1E3PA 3FKIG 3M4QA 4JI1L 4AQYL 4A3FH 3PF5A 1YIJA 4JI2L 1SMXA 4BY1G 1HNZQ 3SGIA 2EIFA 2Y0SE 1TWCH 4GNXC 2CWAA 4A3KG 3S14H 3DLLA 3TS2A 2B3GA 3G71A 1KL9A 1N8RC 4A3LG 2IY5B 2OCEA 1K8AC 4DNIA 4JBKA 3PGZA 1E1OA 1CKNA 3K81C 4HIDA 1Q82C 3EBEA 3S24A 3WWVA 3T1YL 2R7ZH 4A3EH 4B3SL 2AWOA 4Y7NH 3NELA 3GTQH 3HOUG 1GVPA 4JOIA 1QVCA 4X66L 4LF4Q 2GVAA 5GAEC 1IBKQ 3I7FA 3HFZB 1QVGA 2K4KA 1Q12A 2PNHA 1VQIA 3UE0A 3HOXH 4HJ7A 1W2BA 4BY1H 4DR7L 4GLVB 1N34L 5C0XJ 1Q46A 4IPDA 4IPGA 4A75A 4A3KH 1QVFA 3J7A5 1EYGA 4DUZQ 1PFSA 4BBRH 1QZHA 1YHAA 1XPOA 4QY7A 4LFBL 2NVQH 4K0KQ 1YI2A 4JV5L 2OTLA 4DV3L 4DR2Q 3KDFA 4XIGS 2RCNA 4BBSH 3HKZG 1UWVA 3CCLA 3A0JA 3I4MH 1B70B 2HT1A 3HOUH 1PH1A 2NN6G 3F2CA 5GROA 1Q1EA 1N36L 1SROA 3CMAA 1VQ5A 1SFOH 1FJGQ 1P16A 4R4IA 3W1BA 1KQSA 4A3GH 4GOPB 3J80i 4DR6Q 4A3GG 2HHHQ 4X64Q 3S15H 2Q2TA 4UPAA 1JB7A 3I4NG 3S17H 1X9NA 4DR1L 3K80C 3GTMH 1VQOA 3HKZE 3VDYA 4DV0L 1G6PA 4LF8Q 3RN2A 4JI7Q 2PQAA 2Q2IA 1OXVA 3UDFA 1NY4A 3HOVH 1I5FA 3NENA 4TVAB 3L0OA 4A3CG 2XGTA 4LUZA 2R6GA 1QUQA 5HGQA 2ZJPA 2Z6KC 1YJWA 3W1GA 2NVXH 5FJ8G 3ULPA 4YCWA 4WJ4A 1I94L 5E7NA 4JI3Q 1E1TA 2OWOA 3I4NH 4LF9L 1VQAA 3CP0A 1D7QA 3M7NA 4AIMA 3NBHB 3PUXA 4LUOA 3RZOH 4QIWE 1XMQL 1EIYB 1BVSA 1MJCA 1A0IA 3CPFA 3KF6A 4DPGA 3GTJH 3HOZG 1NTGA 2HIVA 1GD7A 3HOYG 3KJPA 4A3IG 1JJGA 4L5RC 2ZJRA 1GM5A 2GVBA 2AWNA 3RZDH 3GTLH 2UXDL 1C7YA 3T1HQ 2JA6G 1TXYA 2IHFA 4GOPC 3H3VH 1NJIC 4A3JH 1UE6A 4B3TL 4FDBA 3H0GG 4X65L 4IOCA 4DV7Q 2YU9H 4MTNA 3ERSX 5IT9c 3RLFA 3PIPA 3CCSA 3J81j 1KIXA 1L1OA 3CQZH 4AH6A 1HZBA 1YHBA 2F3IA 1S72A 4LF7Q 3HOZH 4KHPQ 5IYBG 4C3IH 1HNWQ 2ASBA 4A3IH 3KFUA 3M3YH 3H15A 3M4OH 4LFAQ 2VQFQ 1IBLL 2JA6H 4JYAL 3DM3A 1VS0A 2OQKA 5LMNQ 1YHQA 1PH8A 4DUYQ 1YJNA 3PUYA 1VQCA 3H0GH 4P75A 1WCMG 2KCTA 1S40A 2ALYB 5GADC 1YBYA 4IFDI 2UXDQ 4NB3A 2LXKA 5M3FH 4IFDG 1L2FA 1OXXK 2R7FA 3E9IA 2JA7G 4AYBG 5IYBH 2QA4A 3F2DA 1PH6A 2OQ0A 4DV6L 4L5SA 3TQYA 3ZJYC 2VS1A 4JI8Q 1I3QH 1LTLA 4HIKA 5M5YH 4HJ5A 1VQGA 4X62L 4HIMA 2F52A 4NXMQ 2UXCL 3EIVA 2JA5G 1MIUA 2VQEQ 1V9PA 1HZ9A 1XMOL 1N33L 2DGYA 1Y1VG 3PSIA 3KF8B 1CUKA 2UUAL 4DV2L 1WCMH 4OO1G 4A93G 1V43A 2YYZA 1X3FA 1N9WA 4JBJA 4B3MQ 1HNZL 3I2ZA 4AYBE 4C3HH 1GO3E 5JEAJ 1G291 3D0FA 2JA7H 2PI2A 1D8LA 4MNOA 4KI0A 3CXCA 1Q86C 1A62A 2CQOA 1EQRA 2WFWA 1CKOA 1UE5A 3G48A 4YCVA 3NEMA 1KHIA 1J5EL 2UUBL 1BBUA 4YY3Q 4JI0Q 2CWPA 5AJ3L 5K36G 1Z9FA 1MJEA 4HJAA 4QQBX 4IPCA 1YNXA 3RR5A 1X55A 1PH9A 1EOVA 1FVIA 1VQ7A 4AQYQ 1N32L 3OTOQ 5C0XG 3FKIH 1PH2A 1WJJA 3BZKA 4X6AH 3K8AA 4A93H 4HIOA 4LF4L 3M9BA 1KXLA 1IBKL 3GD7A 1K0RA 3GTGH 4BA1I 1OXTA 3S1QH 1J6QA 3BU2A 4DK6C 1SR3A 1TWHH 5H1SE 4GN4B 4LF5L 3TEHB 3UDGA 4A3LH 4JBWA 4GNXA 4DUZL 4RG1A 3FHWA 1SLJA 2RF4A 5IY0A 3GTKH 5IP9G 4K0KL 5BR8Q 3CCQA 2JJQA 4DV4Q 5EAYA 2NN6I 4XTCS 4DR2L 4B3SQ 3U4ZA 4P72A 4B3RL 1XNQL 1JT8A 4DR5Q 2K5NA 5LMUQ 4NPSA 4OX9Q 2ZM6L 1PA6A 4LFCL 4JI5Q 1UE7A 1FJGL 3K7AH 1N34Q 2D62A 3AEVA 3HOWG 4OWXB 4DR6L 4JI4Q 2HHHL 4MZ9A 1L0WA 4X64L 1BKBA 2UUCL 1KD1C 2B63G 1E24A 4P71A 2F4VL 4UP9A 5IP7G 1A8VA 4JV5Q 4LFBQ 4GS3A 4DV3Q 5FLXc 1HNXL 1O7IA 3ULLA 2A1AA 5IP9H 4A3MG 3S1MH 2UXBQ 5GAGC 1UEBA 2IT1A 4LF8L 1XTDA 2D0PA 1Y14B 1I50H 5FLMG 4QGUA 1BBWA 3MXNB 4PZ6A 3A74A 1XPUA 1X54A 1JJCB 2VY3A 1N36Q 2UU9L 3CC7A 2UXBL 3H3VI 1GKHA 3STBC 5JJIA 4OONA 1E7ZA 3TS0A 1XJVA 1EUJA 2PMZE 2MO0A 5IWAQ 3OW2A 3HOWH 1DGSA 2EQSA 4DR1Q 2JA8G 1VQPA 3F8TA 2VL6A 4JI3L 1SRUA 4ME3A 3CCVA 2B63H 1W3SA 5IP7H 3I55A 4DV0Q 1JMCA 1QZGA 4PZ8A 3PUZA 3FP9A 4BY7G 2HIXA 2R92G 1H95A 1E22A 5ELNA 3PO3G 5FLMH 2YTYA 4YCUA 2Q2UA 4NXNQ 2I5HA 4A3CH 1VQ6A 1VQ9A 3PO2G 2JEBI 1B7YB 1CSQA 3AFPA 1VQHA 2E5LL 5FJ8H 4TQUS 1I94Q 1K8GA 1IBMQ 2Z6KA 4YWLA 4GLAC 1K83H 4JCVE 1KAWA 4DKAC 2I5LX 3Q8DA 2R93G 2EXDA 4DR3L 1SE8A 1VQFA 1B8AA 1IYJB 3E0EA 5C44G 1KRTA 4DV5Q 1ASZA 4LF6L 4R4TA 3BJUA 4BY7H 2IHEA 1ASYA 2R92H 4GKJL 1TWAH 2ZTCA 4UP8A 1XNRL 3HOYH 1CKNB 4YHHQ 1AH9A 1R9TH 3M4PA 4L5TA 1Q7YC 1HNWL
chains in the Genus database with same CATH superfamily
4LW1A 3U9SA 5EKIA 4I65A 3PCOB 4WFN3 3F8NA 2N78A 3BYTB 2ZTEA 3PZPA 3CQZA 1HR0Q 4EEYA 4PMCA 1BJTA 2L4NA 2R93H 1G6ZA 1SN8A 3DHQA 4A76A 4RUAA 5D65A 2BE5D 2NZ1D 1X3EA 2VUMG 5DQIA 2K03A 4R4QA 5KFMA 2YZNA 5KFXA 2NVYH 1EY0A 2KECA 3CRLC 4R1JA 3SHLA 1WFQA 4JI6Q 1Y8PB 3NTKA 3MXUA 1B6RA 1IL8A 1SMYD 3KJOA 3LWEA 4HJ9A 4B3TH 1CHPD 4DR3H 1DZ1A 1H9MA 3URYA 5KG4A 4GKJH 4J15A 1SEIA 2VUMH 1T9HA 3HKSA 2HJWA 1VKZA 4YP3A 4IFDJ 4G7OC 4MV8A 2Z1CA 4J9MA 4ECSA 1TIID 1LYLA 4EEQA 2JA5H 2Z4HA 3CHBD 4NLGA 1TWCA 2SOBA 3MEHA 4GC6A 2Y0SA 1Y1VH 3OMCA 2BOSA 4LNQA 3EPIA 4DV1H 1F2MA 1KNEA 1LLRD 4M7EA 5BN4A 4ZUIA 1HR0W 2EY1A 4FS2A 4KKTA 5K2MA 3SK6A 4MV7A 4QL5A 2ZDHA 1G91A 2F3VA 5IYDG 4ECXA 4DV6H 1PTOD 2JEIA 5KFNA 3TQTA 5BR8L 5E4XA 4DV4L 2X0SA 1UE1A 4GN5A 2NU8B 5M5XH 5C0XH 1XMOH 2UUAH 3CCMA 2AMCB 5LMUL 5LL6b 2NTSA 3L2PA 3J80c 2VQDA 2BH8A 2SEBD 4JI5L 4WD3A 1WTQA 3CCRA 4LF5Q 3V6HA 5JAVA 2W6QA 5FPRA 3V96A 3KYHC 2JEFA 2DLNA 4ZKBB 4DLKA 1G2TA 2GPWA 3Q8SB 4QWBA 5IYDH 1VDZA 1PHJA 1CQJB 1KBLA 1SFOA 4JI7L 2UXBL 2JEAI 3N42B 1A15A 4B3RQ 1S0NA 1EQQA 1CSPA 5KRUA 3KUPA 2A8VA 2R93B 1V51A 3AYHB 3RNUA 4TRDA 2AUJD 2XRSD 2IA6A 2YTVA 1F2LA 2MNAA 4LF4H 2KA7A 5DG7A 1K3BC 2R85A 3RAQA 4IRDA 4C56C 2R7DA 2QCPX 3TRZA 1UNSA 1LUZA 3VPDA 2XRQD 1HNXQ 2NVYB 4DNTB 4Y52H 5L1JA 4IURA 3OHBA 4A3MH 2IJ0A 1S5DD 4K0KH 1ENFA 3R3OA 2F0FA 3RGZA 3U4VA 2R6FA 1SYDA 4J9SA 3N52A 1SE4A 2NZOA 3L3OC 1GSOA 3CMEA 2NVXA 3CAMA 2Z6BA 1U0LA 1EQVA 1SE2A 4K2LA 1W96A 5DG9A 1CI3M 3I73A 3T1HL 4MV1A 4FF1A 1XTCD 1IKLA 2OF1A 2VUMB 5DGBA 2C2RA 4IRKA 2IX0A 4MV3A 5CR3A 4X64H 4RUCA 4QIWA 4EQNA 4OELB 2KJXA 3SEBA 3IRBA 3PV0A 2FPIB 1MSHA 2JA5B 3KHRA 3PO3H 2CW8A 2YRXA 1Y1VB 3S1NH 1VQEA 1ENCA 3PF4A 1AE3A 1V1OA 4TV9F 4YHHL 3E5NA 1PLFA 4LFAL 5C4JH 2E2JH 1YVCA 5IE8A 2B8GA 3SR1A 4U673 5GQOA 2WP8J 3CU7A 5LMNL 4QUCA 1H9KA 4DUYL 1IYVA 2KHJA 1BOSA 3IFTA 1QG7A 1X6OA 2K5VA 5M3FG 3G7LA 3LWUA 4ED3A 3A8IE 2FXQA 5FO8B 1DONA 1W93A 2ZXRA 1Q8IA 4Q5VA 5M5XB 1VBHA 1AE2A 1PH3A 2V1CC 4ZI7F 4PZ7A 1STGA 3VA7A 1N32L 2JA6A 2KHIA 2F0SA 3CC4A 3ICEA 2AHOB 4A3BG 1IBLQ 5EJWA 1L0XB 3VYSA 3GLKA 1Z7TA 2C35B 4ZKCB 4KV6A 1I6HH 3MFIA 2K33A 1IL2A 4J1MA 5JEAG 4RNOA 4YR2A 1YJ9A 3BG5A 3K5MA 3MVVA 3CKIB 1FL0A 2LFNA 3AQQA 5FLXL 4DV7H 1WYDA 2DUDA 4DR4Q 3F1ZA 1K3RA 4B3ML 1Q81C 1JIHA 5HY6A 4FP5D 1KC8C 3V4ZA 1HA5A 3KHHA 5DEHA 1FD7D 3NSWA 1VQMA 2F1MA 4A3BH 3D6WA 5KNDA 2VQFH 5KFQA 1YITA 3IG0A 4CJ1B 4G4KA 1Q8KA 2R7ZG 4GN3B 1WTOA 2MFIA 1D5XC 5AFWA 5JEAH 1TT2A 2K1BA 1RK5A 2JA7A 4JI1L 4A3MB 1EWHA 4BY1G 4U68A 3SGIA 1HNZQ 1S10A 1WTXA 1SNCA 2MPMA 1VMPA 2CWAA 2AQ2B 3DLLA 4LK1C 4A3LG 1X32A 2IY5B 4GC7A 2JA5A 2E2DC 1Y1VA 3BS1A 1EY4A 1GUSA 5FPOA 5L37A 2R7ZH 4A3EH 2AWOA 2TMPA 5CV7A 3TIIA 3GTGA 3K5IA 4QUFA 4KD4A 2ZT9C 1I7LA 2AGQA 5GAEC 1QVGA 4BY1H 3KLSX 1W2BA 3PO3B 4WBNF 3K5NA 1Q3LA 1E2ZA 4FF4A 4LMQD 3S1NB 4FBUA 1STAA 3OIQA 4DUZQ 2XCAA 1YHAA 3ZYYX 2PO4A 4QY7A 5C4JB 4KMUC 4LFBL 2E2JB 4DR2Q 4JW0A 4OEMB 2HCCA 2N55A 3I4MH 3KALA 3BZDB 1PH1A 2AGPA 1RCVD 3Q6SA 3P20A 1SROA 1N36L 1KQSA 4A3GH 3C1FA 4GOPB 3J80i 2FKLA 3LNNA 2HHHQ 3QFFA 4UPAA 4XZ3B 2MJ8A 1LTAD 1M0WA 1I4QA 3GP7A 2DJGC 3DUZA 3HKZE 3VDYA 2K05A 2PQAA 4XQQA 1I6HB 2Q2IA 5KFAA 2B39A 3NENA 4TVAB 1NCVA 3X3NA 5HBRB 3T5KA 2D2CC 2HVRA 2Z6KC 1EY8A 4GZYC 3W1GA 2EYLA 5FJ8G 2OXPA 4G7ZC 1H9SB 4WJ4A 1JCKB 5EKLA 2JEJA 2FMAA 3CP0A 4A3BB 1D7QA 1PDQA 3M7NA 1A3UA 4DGZA 2YW2A 4KHVA 2FLNA 3PUXA 4LUOA 5I6WA 4ED6A 5A35A 5IGEA 3TMEA 3RJ0A 2HGSA 3CPFA 4L6TB 3LMLA 1NTGA 1JDBB 3BQ0A 1H9RA 3HOYG 4A3IG 1TAEA 3EPGA 1GM5A 4TQRA 1FGBD 2GVBA 2HCIA 4DK1A 3RZDH 1C7YA 1OWTA 5JVDF 2FLPA 2IHFA 1SDFA 4A3JH 4CKEA 2UVUA 1Z2PX 3H0GG 4QW9A 2CH4W 4IOCA 4MTNA 4RB2C 2OT2A 5IT9c 4EVOA 3CCSA 2EOTA 4RAUC 5E3FA 2R7ZB 4A3EB 1HZBA 1YHBA 2VB2X 2FB9A 2RDGA 2R3ZA 4V0BA 4A3IH 3N40P 3TINA 3H15A 4BY1B 1U9RA 3M4OH 4NXNH 4P2CB 2NUAB 3I90A 1YHQA 2YRWA 1B53A 3IKJA 4KKSA 4K8IA 3HXLA 3H0GH 3QZ8A 4P75A 5CGKA 1WCMG 1YBYA 1E4GT 2X6GA 4NB3A 3OUZA 5KFVA 2MGSA 4IFDG 2R7FA 1OXXK 2RKSA 3E9IA 3I4MB 1B44D 4CKCA 1PYWD 1TKWB 3R93A 3WOEA 5K36H 2KEEA 1RTNA 1K0SA 2OQ0A 4A3GB 3MR3A 4JI8Q 1I3QH 3WO0A 2UXDH 4HIKA 1WTVA 3EIVA 1HZ9A 5T1GA 2XWJB 4CDFC 1I4RA 3KF8B 1CUKA 1GUGA 1WCMH 2QK4A 3BJYA 2IBKA 4JBJA 4K6LA 3I2ZA 4AYBE 3KBXA 4IFDH 4EBCA 3M4YA 3GV3A 1D8LA 4MNOA 5J39A 3CXCA 3S2DH 1PZID 2CQOA 1RK6A 1CKOA 3G48A 4YCVA 3NEMA 4KN7C 3N6XA 3PIP3 4DL5A 1IKMA 2JEGA 1G8ZD 3J80W 1CZGA 3TP6A 3FKIH 1ILQA 5EKKA 4XYMB 4HIOA 3M9BA 1KXLA 1IBKL 3Q1KA 1JOQA 3SE0A 1J6QA 3W3AA 3JAML 4LF5L 1HQRD 2QKIC 4F8MA 1GSHA 3RZDB 4YQWA 1ML0D 3H94A 5IP9G 5BR8Q 4DV4Q 4A3JB 1DOLA 2F0HA 1EIGA 1JT8A 4B3RL 1ZXTA 1JC7A 5LMUQ 4JI2H 4AQYH 1TA8A 2RQXA 1J8IA 5EOYA 4JI5Q 1UE7A 3E0JA 2O5JC 3NQIA 3HOWG 4OWXB 5FO9B 4MZ9A 4A3IB 2C2DA 3KK7A 1L0WA 4B9WA 1BKBA 2F0UA 3M4OB 4M8AA 1E24A 4UP9A 4JV5Q 2UUBH 4I50F 1J5EH 4DV3Q 5KG5A 1HNXL 3R8BA 5IP9H 3T16A 3S1MH 2UXBQ 1HXYD 3RB4A 2F0GA 1XXGA 2CZGA 1MHWC 1XTDA 5CORA 4LF8L 1QB5D 3T51B 2XD4A 3MXNB 3A74A 3H0GB 4O3RA 4UAIA 1T36A 4X66H 1B4OA 4IWYA 3H3VI 1GKHA 4LSXA 3TBIB 3L9AX 3UI2A 1XJVA 1ICFB 3OW2A 5J1ZA 3HOWH 4EBDA 4DR1Q 2JA8G 3F8TA 3CCVA 4MA5A 1JDEA 1TS4A 4ZAIA 3K0YA 1JMCA 1I3QB 2W9CA 1CQFA 5KFKA 3KLSA 4BY7G 4X3KA 5ELFA 4O2AF 4RZQA 2V9WA 2I5HA 1RJQA 5D1OB 1WCMB 1XNQH 3D4RA 4YB8B 1VQ6A 3TP8A 1PRTF 4LJZC 1AN7A 1VQHA 4LFCH 3S2DB 4TQUS 1I94Q 3NE5B 2Z6KA 1JB3A 2EJGC 4GLAC 1K83H 1K8MA 2EYFA 3Q8DA 2F4VH 4CDDC 2K5QA 1PRTB 4B9XA 3S9WA 1B8AA 2SNMA 4ID6A 4NDXA 3E0EA 5JH7F 4DV0H 4BY7H 1ET9A 3SI8A 4OIKA 1DOKA 1TWAH 4O4LF 3FKIB 2ATLA 4YHHQ 3DXJC 3KLRA 3LP8A 2W7OA 4XIGS 2J6TA 1BXRA 4KY5A 3GTOH 3R5FA 2I80A 5LP6F 1WOCA 2EYHA 4LWCA 4LF9H 3CD6A 1B50A 5JQWA 3MJFA 3BQ1A 1C3OA 2NYZD 3MZ5A 1YNNC 3LGJA 4DR4L 2F0JA 3RLNA 1XPRA 1XMQH 1N32Q 2A69C 1LV9A 1T5XD 3H91A 2E75C 3DMUA 3KDFB 4X3UA 2WE6A 4O2DA 2L9HA 2FPPB 2E2IA 2LXJA 4HNVA 4JYAQ 3KXYT 4R8UA 3KLWA 2NWGA 1UEAB 2E5LH 3OMGA 2YS7A 3IL8A 4CJ0B 2N8NA 2IP4A 4NXML 5K5PA 5T1IA 4EFBA 5KFWA 4X65H 2LKVA 3CCUA 3S1MB 5LXTF 1TWFA 4DK3C 1K73C 5C4XG 1CA6A 4LF6H 1U5KA 3MFHA 4HCEA 3NBHA 3V05A 3KAKA 4YAKB 1I3QA 1PH7A 1U4LA 4Q0YA 2ZDQA 3O13A 4H0LC 2EYJA 4YY3L 2CW7A 5GAHC 1C0AA 4X62Q 1EUCB 1S4ZA 2YS6A 4J9RA 3HOWB 5EDWA 2FMMA 1X3PA 2DNCA 2HUGA 4RMFA 5CYUA 4JI1Q 4OGQC 4DV2Q 4OO1H 3GTPH 2W9BB 5LMNW 4EGJA 3BVGA 3TP7A 3HOXG 2CKZB 4BXXG 2E2HH 3GIKA 1B9MA 5C4XH 1TWGH 1T94A 3AB9A 2Q2HA 4CKBA 2VNUD 3KF6B 4S3SA 3WNZA 4FF3A 1A6XA 4F4ZA 2H5XA 2FE3A 3FKIA 5DQHA 5C5JA 2C28A 1EFWA 2AUKA 1AUXA 1K83B 4RU9A 1TY0A 4R4CA 3VR2A 4EG0A 1VQNA 5KFYA 4DR5L 4L5QA 1G2SA 3RV3A 2WB1G 3EFXD 4BY7B 4OX9L 5GONF 1OXUA 4BXXH 1TWAB 4DAPA 1TVXA 2A73B 1LT4D 5KFRA 2G9HD 3B6YA 5FLXW 4Q43A 3JRXA 5CA0F 1WD1A 1O7LA 2AQ1B 4J9QA 5LYJF 3GTOB 3FEWX 1EQTA 5CV5A 5I6YA 1DIKA 4YWMA 2XVSA 2WAQG 1F2YA 1B3QA 3W2DA 2V58A 3UDXA 5D3IB 4OL7A 2W7PA 1Q1BA 3G6EA 1J9OA 2PQEA 4R4OA 3A5UA 3J81i 4HEDA 2EE1A 3E9HA 1XYIA 1K9MC 2V5AA 5IWAL 2UUCQ 3ER0A 5HGTA 3HKZA 1VQJA 2MUYA 3CCJA 1JE5A 3MA2B 1Y1WG 3K5OA 5BPHA 3CW2C 2YL2A 1ESRA 2JA9A 3W5OA 2UU9Q 3M85A 4UCTA 1DV2A 2AQ3B 1AN8A 1GUNA 3K5LA 5DLQE 4BA2I 3RLOA 1FJGH 4IR9A 1F2ZA 3MEFA 3I91A 5IT9W 4AYBB 2R82A 4ABNA 4DR6H 2K14A 1IBML 3S2HH 2KSWA 1W6KA 1GLVA 1WTPA 3J7ZC 2N49A 1HHVA 3MWEA 1Y1WH 4EQPA 4RB3C 2B2TA 2AKWB 4RAZA 1MKHA 4DV5L 5EQ0A 2LSSA 4C3IG 3NQTA 3CCEA 4M1UB 4DAYB 4RWSC 4DK0A 4RGOS 3GTPB 1KJ9A 2F0OA 2E2HB 2N3SA 2YU9A 4CDEC 1CKMA 5C4XB 1TWGB 1U4RA 5J3BA 3L4JA 2FJ2A 4C1NI 1M4VA 4ETSA 3OSNA 2R84A 1PZKD 3UE1A 3I12A 3R2IA 4HCSA 2C22A 1RYRA 4JI3H 5KT4A 3RMHA 5I4DA 1YNND 2NU9B 1VF5C 5KFPA 3GTQB 4GNXB 1L2ZA 2A69D 4IJLA 5IOCA 1XNRQ 2EYOA 1IXRA 3JAMi 4GKKL 4H02A 4RCNA 5ELOA 4OWTB 2JE6I 1A63A 3T13A 1HA6A 4A3DG 5KFIA 4FXGC 3G4SA 4JI8L 4WJ3M 3LWBA 3T1HH 1QOHA 2L15A 4EYIB 3RAXA 5LHY1 5DNFA 1EY6A 4JBMA 5FO7B 2RGVA 2PNRC 2ATWA 5KFTA 4ZLTF 2WB1B 4A3DH 3R5HA 1GUOA 1S0MA 3VR3A 1HNWH 1B3AA 1S97A 4LFAH 4HSPA 4L1KA 1QUQB 2NTTA 5FD6A 4DL4A 1QNUA 2EZVA 4L8JA 1Z47A 2XCPA 1I6UA 2PVPA 3BDCA 4A4IA 4YR3A 3HB9A 5LMNH 4R9WA 3TQ1A 4AYBA 4DUYH 4YR0A 3HEJA 2WAQB 2O4XA 4A3KG 3S14H 2B3GA 1EYZA 5EPKA 4CDCC 1KL9A 3LX0A 3N44B 4JBKA 2RDJA 3PGZA 1AUVA 1E1OA 1Q82C 1YNJC 1TU2B 3EBEA 1CS0A 3S2HB 2WKDA 3T1YL 4FNFA 3HOUG 4Y7NH 2DWCA 3J81W 1S03G 3EJIA 1B6SA 5C1OA 1GVPA 5IIFA 1Y1WB 1IBKQ 2Z8LA 3I7FA 2VA3A 2K4KA 1Q12A 2JXMB 4DR7L 1Z2NX 1Q46A 1T3NA 4B3MH 4A3KH 4ZRZA 1QVFA 3J7A5 1EYGA 1PFSA 1N48A 5A2QL 1QZHA 1BGWA 3NUCA 2NVQH 4JV5L 1QNKA 2G9DA 1YI2A 4DV3L 5E1FA 4JI0H 1UNNC 1SNQA 1D2BA 1MD2D 3A0JA 4IUNA 1SYGA 3HOUH 2NU7B 2D9UA 3MR6A 3ONAB 3FDSA 1Q1EA 1IOVA 4KJOA 3OTOH 4QB4A 4R4IA 3PW5A 3J7AV 4RGNA 3T4AC 2RSOA 3S17H 2BQRA 4DR1L 3K80C 4LSAA 2K28A 3DWAA 1JICA 4IZ8A 5C3XA 4XYLB 2B2VC 4HYKA 2BR0A 1SYCA 3C46A 3E3XA 4LF8Q 3RIZA 4WJWA 1VF7A 3UDFA 2UVRA 1NY4A 2DY8A 1I5FA 4HAEA 3C3LA 1RJTA 4KY7A 2FK2A 4A3CG 4H44C 1QUQA 4CHTB 5EWGA 2ZJPA 2IW3A 3I72A 2EXZA 1D1IA 3L4KA 2J4XA 3ITPA 1O7ZA 2SDFA 1I94L 1E1TA 2IPKD 2OWOA 1BCPF 3WOFA 4F88A 1VQAA 3RGXA 2B2UC 4A3DB 3EYYA 4JI4H 5KT3A 1SYBA 3JAMW 3SE7A 4UHVA 4E4TA 4LFBH 3RZOH 1EIYB 1BVSA 1MJCA 1A0IA 2YYAA 3GTJH 5JUMA 1BCPB 2HIVA 1NR4A 1JJGA 3I3CA 3Q8RB 2W71A 1LT6D 1I4GA 2AWNA 1ULZA 3JSLA 1TXYA 1DOMA 4GOPC 3H3VH 3S14B 5EZYF 1HTLD 4U6PA 1CHQD 4RGMA 4B3TL 4FDBA 3HGBA 1R4PB 4ED2A 1B9NA 3RLFA 2OEOA 3OSOA 3GIDA 4MAMA 3RUZA 2PZTA 4AH6A 4Y7NB 2CHBD 1MSGA 4LF7Q 4KHPQ 5L1IA 5IYBG 3BA8A 3SDZA 1CT1D 2MP1A 2F0LA 3G6YA 5C8YF 2V4DA 3MFGA 3T5LA 4JYAL 2R93A 3Q2OA 4K2KA 3DM3A 4A3KB 3GQBA 5EPJA 2OQKA 3SK5A 3PUYA 1K1QA 2F0NA 2NVQB 4Q45A 4RNMA 4J9LA 3VR5A 2ALYB 3K5HA 2W6OA 1UUPA 2LXKA 5M3FH 1PZJD 4O1NA 3HOUB 2NVYA 5IYBH 2HDLA 1ET6A 1EEID 4MN3A 4DV6L 1IYUA 1IHZA 1RD9D 5I2XA 5IGCA 1VMCA 5CV4A 4X62L 3S17B 1M0TA 4NXMQ 4TV8F 1RDPD 2VQEQ 1V9PA 1XMOL 2DGYA 2UUAL 2W6ZA 3TIGA 2F0WA 4DV2L 1EZ6A 2JN4A 4A93G 2P0AA 1HR0H 5EBDA 2VUMA 4MTDA 3HZXA 2ALZA 1G291 1BXTA 1Q86C 2VXWA 1E0BA 5KT5A 4YY3Q 3RD4A 2CWPA 4KKUA 2WDTA 1YNJD 3ORRA 3D8GA 4HJAA 2QEJC 4IPCA 1YNXA 4ZHQF 1E4EB 3J7AK 3RR5A 1X55A 2LS01 1PH9A 4AQYQ 3SXHA 5C4HA 2PPBC 4JI6H 4X6AH 3RZOB 4A93H 3DF7A 4J8QA 4LF4L 2R61A 2NB0A 3GTJB 4PDBA 3QJYA 3BU2A 4DK6C 5KGUA 5KIXA 4EYHB 1SR3A 1EFID 4RGTA 4GN4B 5IODA 1KDBA 5C1PA 4A3LH 4RG1A 2CVRA 4RCOA 4K0KL 3CCQA 2JJQA 4B3SQ 4RFBA 1WTWA 1C30A 3U4ZA 4P72A 2IWHA 4QWDA 2PN1A 4DR5Q 2K5NA 4G57A 4UCRA 1LTBD 4OX9Q 3T53B 5KFUA 1EUDB 4O3OA 2F0EA 3K7AH 1N34Q 2D62A 5KFSA 2DIKA 4X64L 4DFAA 2UUCL 4XYQA 2B63G 2HQEA 1A8VA 1EY5A 5KYIA 5FLXc 2RDHA 2A1AA 1SJED 1UEBA 1I50H 1LTSD 1BBWA 4DXGA 2R7KA 2VY3A 4YJ2F 2UU9L 3RTXA 5M3FB 1GOZA 3D4DA 3STBC 2AGOA 5JPMC 3T5JA 2QDLA 4HR7B 5IWAQ 4F50A 1E2VA 2LMCB 3NWSA 1BNZA 5CAEB 3C0FB 1IOWA 1KJJA 4I7HA 2FHTA 2B63H 1W3SA 4DV0Q 3A54A 3FP9A 3IAYA 2B2VA 2R92G 1E22A 2AQ4A 5IGBA 1C48A 1BQQT 2OLSA 4YJ3F 4B3RH 5F2DA 4ECZA 5LOVF 1Q90A 1E4EA 3PO2G 4TUYF 2F4IA 5FJ8H 4F7XA 1RYSA 3EVQA 1IBMQ 1Y8OB 1F9SA 2DNEA 1JKJB 3E6ZX 4JCVE 1WH2A 4DKAC 2I5LX 2F0TA 4N9TA 1EY7A 1SE8A 2X6LA 1IYJB 5C44G 4DV5Q 2B2UA 1AZQA 1HNXH 4R4TA 2IHEA 2R92H 3ERQA 1XNRL 2EY5A 3HOYH 1CKNB 1NR2A 1AH9A 1R9TH 4A93B 3QZ7A 3R5XA 2YCHA 2PZWA 3SK4A 5KFEA 3ETHA 4X3TA 2MQHA 2PYKA 2F0IA 1X65A 3I4OA 1C8CA 2I8CA 4IUTA 4GOPA 3GIIA 4N8FA 1EWCA 2KENA 1TS3A 2F0KA 3I56A 2FJZA 1KC7A 2K7VA 4ED7A 5ISRA 2GN5A 2BA0A 4GKKQ 1GSAA 1WD0A 1J5EQ 1NMGA 4XX0B 1V1QA 2NUCA 3PIOA 2XWBB 3K7AB 3TN2A 3VYUA 4PV1C 4KK7A 3PQIA 4JC0A 1M1KC 5KX5F 1TY2A 2B2YC 4ZUJA 2K01A 2WYOA 3PW0A 4FU0A 4PG3A 1JXLA 4OXPA 4C2MH 1H9SA 5JVG3 3JSNA 2VB3X 3U50C 2A5HA 1NMFA 1PRTC 5G3LF 2R87A 2J6UA 5BN3A 1I50B 3TZDA 2OH2A 4YIJA 2XIGA 3U58A 4ILWA 2R8GA 3HS0C 3A8JE 3DWPA 4K6DA 3J80E 1IBLH 1AW7A 2UXCQ 3MXGA 1PYBA 5ELDA 5KFCA 5C0XI 2JQOA 3OW7A 1N33Q 1EYCA 3M7GA 2B63B 2RHQB 4Q0FA 1JWMD 4FYDA 2VW9A 1ZKOA 4UP7A 1VQDA 4DR4H 5ELCA 2VZAA 2M2LA 2NVTH 1BDOA 4BBRG 1HH2P 5IYCG 2R7ZA 4DAMA 1OTCA 3OHXC 1SEBD 4APVA 1HTPA 5KNBA 2KHSA 4HJ8A 1STEA 4BBSG 5COYA 3T1YQ 5J2UF 5FKAC 2DPJA 2DN8A 4C3JG 2CQYA 3EN2A 5JJLA 4O0AA 2W57A 2YV5A 2YTXA 4DR7Q 3V2TA 3S1RH 2XNAC 1C4QA 3J81c 1JX4A 3QOLA 4POFA 1EIFA 3MWYW 2JK8A 4DXFA 2R92B 1HNZH 1HJPA 2BA1A 1IW7C 3HOYB 2SCUB 4RZRA 1R9TB 5M9OA 1L1OB 1N56A 5IYCH 3M9OB 4DAVA 2PCFB 4V190 3T5HA 1FGUA 2DZDA 3JC66 3HOVG 3A55A 4XXEA 1WI5A 4C3JH 5KNCA 3TDQA 1NBWA 1HZAA 4BWGB 3BQ2A 5D8DA 1JLLB 4UCOA 2WB1E 2HVSA 1F9QA 2ZM6Q 2CFMA 3AFQA 3RB0A 4H13C 4JVZA 3STBD 2VPQA 2FFKB 1EU3A 3SVMA 1EHIA 3H4DA 3K7UC 4IUUA 2PZUA 5C6AA 2J6SA 3KF8A 1RL2A 4MV4A 1LM0A 4HNUA 1ZHQA 2K5DA 2B2TC 2IX1A 5I47A 4DUZH 2KBNA 1STBA 4E6IA 2MCTA 5KEEA 2WAQE 2AU0A 5KFBA 4CJ2C 4DR2H 3NPPA 4UDUC 4J0MA 3CPWA 4C2MB 1II3A 1CZWA 2ZTDA 4WORA 2K50A 4NXNL 1OXSC 1PK8A 1EEFD 1RTOA 2NBFA 3TREA 1GYFA 2JA8H 4APMA 3KOJA 2HHHH 1JWSD 2GPSA 3M9NB 3OIPA 1OO9B 4POGA 2NZHA 4R7RA 5A2QW 5KFFA 5E4WC 1VQBA 3JAMc 1EL0A 1FR3A 4LF7L 4KHPL 3H4BA 4GLXA 1JJ2A 3RB3A 2UVVA 2K52A 3R2TA 3D4WA 5CV6A 2Z9HA 2NVTB 4JUZA 4B3TQ 1ZHSA 5DLGA 1SNMA 1EU4A 3F2UA 4DR3Q 3U9TA 1HFNA 4ALPA 3OYYA 3VR4A 4O3PA 4KJNA 1PFNA 4GKJQ 3PR5B 2WV6D 4MIUA 4P73A 4LUVA 2WKCA 5EBCA 2F03A 3S1RB 4ECTA 4KN4C 3MXNA 3H0GA 3FMCA 1O78A 1PYSB 3Q0AA 3Q22A 1M90C 4IR1A 4BBRB 4DV1Q 4LH6A 4O42A 2VQEL 5LA6F 3I8ZA 1PRTD 3ULJA 4HNTA 3VPBA 4TQSA 3EA6A 4DF7A 4C3JB 2C00A 4XT1B 4C3HG 2Y0SG 2Q8RE 5M5WH 2MO1A 2ZJQA 5ELBA 2K75A 4DV6Q 2M9VA 4PQXA 2ICIA 2RHSB 3MAQA 2FK1A 3PW4A 3A56A 3PUVA 5D1OA 1WCMA 1SAPA 1LT5D 1HZCA 2KVMA 1XMOQ 2UUAQ 4FVMA 1LTRD 2KCMA 3K59A 1XDNA 4AQYL 4JI2L 2B2YA 1SMXA 2BQUA 4A2AA 1Y8NB 4PWQA 2RA4A 1TWCH 4BWSC 4GNXC 1TS2A 5TSSA 3KBGA 4C5AA 3BYYB 3G71A 4IUVA 5T14A 3WO1A 2L12A 1N8RC 5H80A 2W70A 1FNUA 1K8AC 4DNIA 2RDIA 3RBDA 1LO5D 3KHLA 3K81C 1JORA 4KY6A 3S24A 3WWVA 3GTQH 2JA8B 2EJMA 4B3SL 4ECYA 4JI8H 3NELA 5ELEA 3PW2A 5HURA 1DXMA 1LT3D 4X66L 4O4HF 4LF4Q 2GVAA 3OPOA 5FLXE 4ECRA 4UFZA 3PVXA 1NJIC 2RBMA 3UE0A 3HOXH 4HJ7A 4GLVB 1IW7D 1BUVT 1N34L 2IX3A 4IPDA 4IPGA 2JSOA 5JPNC 1K28A 5CBAE 2GLTA 2EY2A 1WR2A 1AZPA 3MFYA 4K0KQ 2OTLA 3KDFA 4RH6A 1UWVA 3CCLA 1LABA 3QO2A 2HT1A 3GIMA 3F2CA 3FMAA 5GROA 1VQ5A 1MGSA 1RODA 1SFOH 1P16A 4HSVA 3W1BA 4EGVA 5BN5A 2RCFA 1PTOH 4IN3A 2D5DA 3PN1A 1BR9A 4X64Q 2RDFA 3I4NG 1X9NA 5KFGA 5D14A 4K8JA 1QILA 3GTMH 3VMMA 4ECQA 3H20A 4XYOA 4DV0L 1G6PA 3MXPA 3IFDA 1OXVA 1E4FT 5BR8H 2VPSA 3DEOA 4DV4H 3L0OA 1AEXA 2XGTA 4LUZA 5IT9E 1U4PA 2FPGB 4J9KA 4RB0A 5LMUH 2NVXH 3ULPA 5M5WB 1SNDA 3KHGA 4ME6A 3RUPA 4YCWA 4JI5H 2W9BA 1MI2A 3I4NH 4LF9L 4K14A 5F9LA 3AMUA 4AIMA 2XIWA 4LH7A 1SJHD 2EVBA 4JV5H 1RKNA 1M6VA 4ECWA 4DV3H 1XMQL 3KF6A 2BQ3A 2UVWA 3HOZG 4JI7H 2UXBH 4R8IA 1TR5A 3KJPA 4L5RC 4FF2A 2CH4A 2ASLA 3OWFA 4KD3A 1K83A 3HBLA 1TWCB 4Z9CB 2JA6G 2Y0SB 1GUWA 4IUQA 1EYDA 3DEPA 2V4QA 3PW7A 1Y69U 4X65L 1TWAA 4DV7Q 1KDAA 3NGDA 4L63B 1JR0D 5KG7A 1KABA 1ENAA 2F3IA 1S72A 3HOZH 3GTOA 4DL6A 4C3IH 2ASBA 3M3YH 1B33N 1GGOA 2K04A 2VQFQ 3HOXB 3RB6A 2JA6H 3J80L 3OHAA 2H4OA 2P5ZX 1PH8A 1I94H 1SSOA 1S40A 1V4YA 4IFDI 3M4IA 3RF2A 1PTOF 1LACA 3GQCA 2JA7G 3AU7A 2I07B 1BCPC 2QA4A 1SFOB 3HP3A 3F2DA 1PH6A 4YHHH 1KJIA 5JVLA 3TQYA 1PTOB 4HJ5A 5M5YH 1ILPA 5C3WA 5KFOA 4HIMA 2F52A 1XX8A 2UXCL 3D6CA 3UFXB 2JA5G 3GTMB 1N33L 1Y1VG 2LY7A 3QIAA 2DY7A 1EY9A 2JP1A 1PFMA 2YYZA 2L5TA 1GO3E 2JA7H 1HCZA 2WFWA 4QW8A 1UE5A 1AFPA 1N32H 1KHIA 5C5LA 4YAJB 1JOOA 3J81E 2NVXB 1Z9FA 3VA5A 1MJEA 4DAYA 3GTPA 2ZXOA 2J9GA 3Q8QB 3HRZC 4JYAH 3FPUB 3I4NB 1CA5A 4HMJA 2C2EA 2E2HA 1EOVA 1FVIA 4ZK9B 1VQ7A 3G6JB 1TWGA 5C0XG 2K6AA 1WJJA 3K8AA 1A3TA 3MWMA 4I55F 2I46A 1KLUD 2ZDGA 3GTGH 2K5WA 2QW7A 4QIWB 5JVH3 3S1QH 3A7LA 1TWHH 4U7CA 3TEHB 4JBWA 4GNXA 2L55A 3GTQA 1R4QB 3CVZA 2RF4A 5IY0A 3H09A 3GTKH 4DL2A 3P7JA 4J9NA 2NN6I 4XTCS 4IWXA 5KYLA 4X62H 1Z2OX 3VYRA 3GIPA 4C5BA 2XGPA 4N8X1 4JI1H 4NPSA 3TP5A 2J0TD 2ZM6L 4DV2H 2HVQA 1FJGL 4JPBW 3HOZB 2RVLA 4DR6L 4C3IB 4I4TF 3M3YB 4Q44A 1NAPA 1STNA 2DJFC 3MC0B 1EZ1A 4GS3A 5EGTA 3ULLA 2JA6B 4A3MG 4Q8FA 4UCSA 4Y8VB 2WB1A 4QGUA 1XPUA 4PZ6A 3U9OA 1JJCB 4RB1A 1Z6HA 5JJIA 3GV6A 3GTMA 4OONA 1E7ZA 4ZQ3A 1EUJA 2PMZE 4ECVA 2MO0A 3JAME 1DGSA 2EDGA 5CV9A 2VL6A 3BDLA 4JI3L 4ME3A 2WAQA 1D5ZC 3HG9A 4RHRA 4JV2A 2O5IC 5M5YB 4PZ8A 3PUZA 3H3VC 1H95A 1HUNA 3PO3G 5J2TF 2R7NA 4YCUA 4NXNQ 3BVZA 4A3CH 3NBIA 4PMBA 1F9PA 1N36H 1HRJA 2KUMA 2JA7B 4WRDA 3BAAA 1Y1WA 1KTKA 2QILA 2FK3A 3FRPB 2XSCA 4QWEA 2GA4B 4F4YA 2UUCH 1D6EC 4DR3L 2R7MA 1VQFA 3Q23A 1KRTA 3OOCA 3BJUA 1ASYA 2ASJA 2R8HA 2L1BA 4GKJL 4ZQIA 4UP8A 4C1NK 1VQKA 1PVOA 1NNXA 1Q7YC 1HNWL 2UXDQ 2UU9H 3GTGB 2QGQA 3S1QB 4KHZA 1TWHB 2EPBA 4KLKA 3F2BA 5C3EG 4RKLA 3S16H 4DV1L 3GTKB 1JOKA 1V8QA 4HTHA 4XT3B 5DAUA 1QE6A 2PW5A 5DQGA 2QDBA 1BCPD 3E5SA 4DN4M 5EWFA 2CCZA 1GXDC 1X3QA 2BDNA 3DWQA 4EX5A 2Z0SA 2W6PA 2C9OA 2WTFA 1UC8A 4IALA 3NHHA 2B29A 5C3EH 4OO1I 1BBXC 1BNCA 3OUUA 1SNOA 2D0OA 4LMYA 5KKNB 3CC2A 4QCLA 3NK9A 1STHA 2A68C 5DM73 2ID0A 1XNRH 1RIPA 1S5BD 2PQAB 2PI2E 1FKAH 2KOLA 4JI0L 1EWIA 3FVQA 3N41B 1JWUD 4JOIC 1X56A 2I5MX 3DM1A 4NP5A 3ETJA 4A3EG 4JI2Q 5CBEE 1ZYRC 3M9MB 4EBEA 2VA2A 3OTOL 2M00A 4ODGA 1VQ4A 2QEXA 3VR6A 1ESFA 4IO9A 1S5FD 1BO0A 1NE3A 2VR1A 3H40A 4IUPA 1IZ6A 2UUBQ 1GJXA 4XQJA 2B2WC 3NWTA 4IJHA 3MHBA 1MBYA 4OHJA 1T5EA 3T56B 5AJ3Q 1G51A 1SXTA 2R8IA 1C9OA 1NSNS 3NP8A 4J9PA 1CTMA 3G8CA 3BVMA 3V6JA 2CW0C 3GILA 1PH4A 3I4MG 3RN5A 2SNSA 4X66Q 5J22A 2ZJTA 4MHEA 1EYAA 1TWHA 1CQIB 3L7ZC 3UQ8A 5IT9L 3PIO3 4A3GG 3V4SA 2TSSA 4CC5A 3K3VA 2HDMA 3GTKA 2QYZA 2F0VA 4XDXA 1PV4A 5KT2A 3PR4A 1JE4A 4IRCA 4JI4L 2F0DA 5D1PA 5C5MA 5KT6A 5L9XA 4ED8A 1M8AA 1VQLA 2HQLA 4MTKA 2A19A 2W6NA 4N9PA 3K58A 3S16B 1XNQQ 1CQVA 1PH5A 5IYZF 1KLGD 5FD5A 1O7YA 2VUGA 4LFCQ 4DU9A 2K5HA 5I9OA 4QWAA 5KFDA 1IBKH 1PFBA 4EQOA 2RSNA 4IPHA 1CK1A 4YWKA 3PMFA 2ES2A 1RJRA 1RJPA 2FP4B 3CF5A 2F4VQ 1S5ED 4LF5H 1UAPA 1RHPA 3FPPA 1F77A 5JJKA 3MTSA 2CQAA 3JZIA 4LAAA 4Q8EA 5IGGA 3QOJA 1WTRA 4KTAA 5C3EB 4TSSA 4UY8C 4UCVA 4FBTA 2X69A 3D31A 1ICWA 4J6HA 3RV4A 4LF9Q 4A3JG 3GV7B 1P8LA 1CM9A 1SYEA 4PMWA 3MR5A 1K1SA 4ED1A 3GTJA 5CA1F 1L1OC 5CB4F 4DV7L 3RFCA 1XMQQ 3GO5A 1YZ6A 2E76C 5LL6S 1X3GA 3WDNA 4DA2A 2OTJA 4LF8H 4QF4A 1YEZA 3K0XA 3PO2H 5L1KA 2E5LQ 2VQFL 3TSSA 2A74C 1H9JA 4X65Q 1S3OA 1HR0L 2BH2A 4MV9A 4RHSA 1SNPA 3GDEA 4LF6Q 2WINB 5C44H 1VBGA 1M7JA 1W6JA 1VQ8A 2ASDA 1I6VC 3BZCA 5M3MG 4R8NA 1QWYA 4I7ZC 4O3SA 2E8GA 5K36G 4JG2A 2XTIA 5KG6A 2F0MA 3ORQA 1KEEA 1JQYD 1KRSA 3J81L 4EGQA 2WACA 1SBBB 1VCIA 4CBVA 3Q24A 2Q8IB 3J7YW 1RF2D 2E2IH 1B1ZA 2I0QA 2V4RA 4EQ5A 4JI6L 4RKBA 4A3FG 4HR7A 5CMDA 4HQ6A 4RAYA 4QJFA 1D5MC 2A68D 3QB3A 1AP0A 2J7ZA 5IGDA 4P74A 5M3MH 4LF7H 4KHPH 1TWFH 3A5ZB 3BDOA 5I9PA 5JJZA 2L11A 3UDIA 3RBEA 1PXUA 2PMZB 3PUWA 5FOBB 2F0QA 1VAJA 5LL6X 4IOAA 1ZYRD 4OWWB 3PF5A 1E3PA 3FKIG 3M4QA 1YIJA 4A3FH 1S68A 3G6VA 2R7LA 4ZOLF 2EIFA 2Y0SE 2A6EC 2A6HC 1HQMC 3TS2A 4JK1C 2W9CB 4NMZA 2KEDA 2H1EA 2OCEA 1U4MA 5CC4A 4FXDA 4QWCA 1O75A 1CKNA 2L0CA 4HIDA 4ZCKA 4IAJA 2CW0D 2XCLA 5I2YA 4JOIA 4NXMH 4G7HC 1QVCA 2VQEH 4BS9A 3HFZB 4O4IF 2PNHA 1VQIA 3N8DA 2Q8TA 3K57A 5C0XJ 2O2LD 4A75A 1WVLA 2ENBA 3K3PA 2MHVA 4BBRH 3PO2B 2B8FA 3I4LA 1DYQA 3G6XA 1XPOA 5G3LD 2R86A 2B2WA 3TZUA 4BBSH 4ME5A 2RCNA 4YY3H 3HKZG 1ZETA 1B70B 1LTGD 2NN6G 1B04A 5KG3A 1D1KA 3MR2A 3GV8B 4FO2A 4XQNA 1KDCA 1I4HA 3A7AB 3CMAA 1FJGQ 4EFEA 5C44B 1A3VA 4CGYB 4DR6Q 3S15H 2Q2TA 1JB7A 1KJ8A 3ND9A 1VQOA 1I50A 1A2UA 3K6OA 4IHJF 5CV8A 2EJFC 1PX2A 3RN2A 4JI7Q 3MWDA 3HOVH 2E2IB 1QCBD 3QG1A 1DM0B 4OIJA 4ZYSA 1EIHA 4B3SH 3BA9A 3BABA 4R8UB 2NN6H 1LTID 4UCUA 4TKOB 2R6GA 3OWEB 4QMGA 2PMZA 1K8OA 4DR5H 5HGQA 1YJWA 2EY6A 2B63A 3GIQA 1STYA 4IQZA 4OX9H 2N88A 4DNRB 1KNAA 3GIJA 5M3MB 4PNYA 5E7NA 4JI3Q 1N34H 1TWFB 3QWNA 3A8KE 5A2QE 4K5XA 1I7NA 4X3SA 3C2PA 3NBHB 2M05A 4DL7A 1DCZA 4HMIA 4QIWE 5KFLA 4M9UA 4DPGA 2O03A 3P75A 3GV5B 1GD7A 4A3FB 1L0YB 1S5CD 2ZJRA 2FMCA 3GTLH 2UXDL 2PW7A 3T1HQ 4NW2A 4JV1A 1CFMA 1F9RA 1UE6A 2BDOA 3NXWA 1KJQA 5IWAH 2IL8A 1EZ8A 2R92A 2YU9H 4MV6A 3ERSX 3PIPA 3QR8A 1R9TA 3J81j 1KIXA 5EWEA 2V59A 1L1OA 3J7AF 3CQZH 1GHKA 1MZBA 5HV6A 3JRWA 5KFHA 1HNWQ 3KFUA 4MTEA 1ONLA 4F4XA 4LFAQ 1IBLL 2ICEC 5KT7A 2R8KA 1VS0A 2W9AA 5LMNQ 1IBMH 4DUYQ 1YJNA 4JV0A 1QJOA 1VQCA 2KCTA 5GADC 2KCNA 2XGQA 4BBSB 5L1LA 3VPCA 3V6KA 1KAAA 4FS1A 1V1PB 3EROA 3NTIA 1L2FA 3KAJA 1A2TA 1SE3A 2BE5C 2W6MA 4DV5H 4FXKC 4AYBG 5KG1A 4IZOA 4YBZB 1O80A 2DPIA 1TQOA 1SCUB 4L5SA 3ZJYC 2VS1A 4C2MA 2FLLA 1LTLA 3S15B 1VQGA 1FNWA 3KTMA 4RNNA 1MIUA 4ECUA 3PSIA 2K32A 4HN7A 1SMYC 4OO1G 3I70A 4FM9A 1ZEQX 2A6ED 1V43A 2KCCA 1WTHA 1X3FA 1N9WA 2A6HD 3HKZB 1BF4A 1HNZL 4B3MQ 3HOVB 4O3QA 4C3HH 5JEAJ 3D0FA 4G3IA 3SK8A 1S9FA 2PI2A 5JOBA 4KI0A 1A62A 2RGRA 1EQRA 4GKKH 2UUBL 1J5EL 1BBUA 5KFZA 5F9NA 4JI0Q 5AJ3L 4J9OA 4QQBX 5DGAA 3H6MA 5KG2A 3OTOQ 1PH2A 3X3MA 5D3DA 2E74C 3BZKA 3N43B 1HUMA 5DM63 1DD2A 3EQLC 1XWEA 3CRKC 3GD7A 1K0RA 4BA1I 1OXTA 1HPCA 4O3NA 5DG8A 2FINB 5BPFA 5H1SE 1HFGA 1ZQ7A 3UDGA 3GTLB 4DUZL 3FHWA 1SLJA 4DL3A 2VOBA 1PTOC 1SYXB 5EAYA 4DR2L 5BMVF 4B08A 3Q8PB 2UXCH 1XNQL 2YU9B 4MA0A 2NU6B 2W8LA 2KQ3A 2BCOA 2XN9C 2QF7A 1N33H 5FK9C 4CC6A 4NKLA 2XC9A 1PA6A 4LFCL 3CQZB 4O2BF 2EYPA 3D3RA 2Z4IA 3VYTA 3AEVA 4I7AA 4JI4Q 4F4WA 1GHJA 2HHHL 2JYOA 2F4VL 3R23A 1KD1C 2YZMA 2G5DA 1V1PA 4P71A 5IP7G 4LFBQ 4K5WA 1I4PA 3C1EA 1PMRA 1E2WA 1O7IA 5GAGC 1B2TA 1TS5A 3OSPA 1LTTD 2IT1A 4K5VA 2D0PA 5EPLA 1Y14B 5FLMG 5IGFA 3T1YH 5KFJA 1X54A 1N36Q 5DLFA 1NUCA 1GUTA 3CC7A 2PBZA 1DJRD 4DR7H 3TS0A 2EQSA 1VQPA 1FYCA 4H7BA 1SRUA 4ED0A 2F3WA 4F87A 5IP7H 2F0PA 3I55A 1QZGA 5NUCA 2HIXA 2YZGA 1A9XA 3IN5A 3N6RA 4RA8A 5ELNA 5FLMH 2EYMA 2YTYA 2Q2UA 1UC9A 1DV1A 4C5CA 1VQ9A 1WSCA 2JEBI 1B7YB 1CSQA 2ZM6H 3AFPA 4C3HB 2E5LL 1K8GA 2I87A 4YWLA 5C4ZA 2WIIB 1KAWA 3FDTA 4DR1H 2R93G 3P1HA 2EXDA 5KG0A 1EOTA 2C5CA 3ND8A 1ASZA 3BG3A 4LF6L 1S0OA 1FNVA 1I4XA 3NTHA 1CE8A 2IMWP 3GTLA 2W8KA 1SYFA 2ZTCA 2HD3A 2ZXPA 4A2BA 4ULLA 2R8JA 3M4PA 4L5TA
chains in the Genus database with same CATH topology
4LW1A 2QGQA 3PCOB 3GTOH 4KHZA 2MQHA 2N78A 4KLKA 3F2BA 1WOCA 2ZTEA 1X65A 3I4OA 5C3EG 3S16H 4LWCA 1HR0Q 4GOPA 4DV1L 3CD6A 2KENA 3I56A 2R93H 1SN8A 4A76A 3LGJA 4DR4L 2GN5A 3RLNA 2BA0A 1XPRA 4GKKQ 1N32Q 1NMGA 1X3EA 2VUMG 3KDFB 4R4QA 1V1QA 4O2DA 2CCZA 3PIOA 2LXJA 4EX5A 2NVYH 4JYAQ 3KLWA 2Z0SA 4JC0A 1M1KC 4R1JA 1WFQA 4JI6Q 2B29A 5C3EH 2N8NA 4OO1I 4NXML 4PG3A 4OXPA 4HJ9A 4C2MH 3KJOA 3U50C 2D0OA 3CCUA 1NMFA 3CC2A 4DK3C 1K73C 5C4XG 1U5KA 2ID0A 4J15A 3U58A 1PH7A 2VUMH 1RIPA 1T9HA 2PQAB 3HKSA 2PI2E 4IFDJ 4YY3L 4JI0L 1EWIA 5GAHC 1C0AA 4X62Q 4JOIC 2UXCQ 1X56A 1PYBA 1LYLA 2I5MX 5C0XI 2JQOA 4A3EG 2JA5H 1N33Q 3S2DH 4RMFA 4JI1Q 4JI2Q 2RHQB 4DV2Q 1Y1VH 4LNQA 3OTOL 3GTPH 5LMNW 1VQ4A 2QEXA 4IO9A 3HOXG 2VW9A 2CKZB 4BXXG 2E2HH 1HR0W 1NE3A 5C4XH 4UP7A 1TWGH 1VQDA 2VZAA 1IZ6A 2NVTH 2UUBQ 1J5EQ 4IJHA 4BBRG 1HH2P 5IYCG 2Q2HA 5AJ3Q 4DAMA 1G51A 4QL5A 3KF6B 1OTCA 2VNUD 1C9OA 4APVA 4HJ8A 2H5XA 5IYDG 4BBSG 3T1YQ 1EFWA 5BR8L 4DV4L 1PH4A 1UE1A 4GN5A 3EN2A 4R4CA 5M5XH 3RN5A 4X66Q 3I4MG 4O0AA 5JJLA 1VQNA 2YV5A 2YTXA 4DR5L 4DR7Q 4L5QA 3L7ZC 3S1RH 3CCMA 2AMCB 2WB1G 3J81c 5LMUL 4POFA 1EIFA 2JK8A 1OXUA 3J80c 2BH8A 3L2PA 4OX9L 1HJPA 4JI5L 2BA1A 4BXXH 3CCRA 3B6YA 1PV4A 4LF5Q 4JI4L 1L1OB 3KYHC 5IYCH 4GKKL 1VQLA 5IYDH 1PHJA 2HQLA 1FGUA 2A19A 1VQKA 3JC66 4YWMA 4JI7L 2JEAI 3HOVG 2WAQG 4B3RQ 1WI5A 4C3JH 1PH5A 1XNQQ 1NBWA 1HZAA 3UDXA 1CSPA 1EQQA 2A8VA 1Q1BA 2WB1E 3AYHB 2ZM6Q 3G6EA 2CFMA 3AFQA 3RNUA 4LFCQ 3STBD 4R4OA 3A5UA 2K5HA 2YTVA 2MNAA 3J81i 3K7UC 3E9HA 1RL2A 1K9MC 4IPHA 2ES2A 4YWKA 1LM0A 3CF5A 5IWAL 2R7DA 3ER0A 2UUCQ 2F4VQ 3TRZA 1VQJA 3CCJA 1LUZA 1JE5A 2IX1A 1HNXQ 4Y52H 5JJKA 2KBNA 1Y1WG 4A3MH 3CW2C 2WAQE 3U4VA 2JA9A 3W5OA 2NZOA 4UY8C 3CMEA 3CPWA 3CAMA 2UU9Q 2ZTDA 3M85A 1U0LA 2K50A 4NXNL 1OXSC 3D31A 4BA2I 5DLQE 3RLOA 3MEFA 3T1HL 4LF9Q 4A3JG 2K14A 3TREA 1IBML 1P8LA 3KOJA 2JA8H 2IX0A 3S2HH 4PMWA 1L1OC 3J7ZC 4POGA 2N49A 4DV7L 1Y1WH 2NZHA 3IRBA 1XMQQ 3PV0A 2AKWB 3GO5A 1YZ6A 1MKHA 1X3GA 4DV5L 2OTJA 2LSSA 1VQBA 3JAMc 3PO3H 4LF7L 4KHPL 4GLXA 1JJ2A 3S1NH 3CCEA 1VQEA 4DAYB 2K52A 1AE3A 1YEZA 3K0XA 3PF4A 3PO2H 4YHHL 2E5LQ 2N3SA 2VQFL 5C4JH 4LFAL 1CKMA 5J3BA 2E2JH 1YVCA 5IE8A 1PVOA 5GQOA 4B3TQ 2WP8J 4X65Q 5LMNL 3UE1A 4DR3Q 1S3OA 4DUYL 4ALPA 3OYYA 2KHJA 1HR0L 2BH2A 2K5VA 1X6OA 3GDEA 5C44H 5M3FG 4LF6Q 2FXQA 4GNXB 4GKJQ 4IJLA 1VQ8A 1XNRQ 1AE2A 1IXRA 2V1CC 3BZCA 4PZ7A 4H02A 5M3MG 3JAMi 1PH3A 4P73A 2KHIA 2E8GA 4LUVA 5ELOA 4JG2A 2AHOB 2JE6I 2XTIA 4OWTB 3CC4A 1IBLQ 4A3BG 4A3DG 1A63A 3G4SA 1KRSA 1VCIA 4JI8L 1PYSB 2C35B 4WJ3M 1I6HH 1M90C 1IL2A 2E2IH 4DV1Q 2I0QA 5JEAG 4EQ5A 4JI6L 2VQEL 2L15A 1YJ9A 4A3FG 3ULJA 1FL0A 3AQQA 1WYDA 2DUDA 4DR4Q 4QJFA 4JBMA 3F1ZA 1K3RA 4B3ML 2Y0SG 1Q81C 5M5WH 2MO1A 5HY6A 1KC8C 2ATWA 2ZJQA 4P74A 5M3MH 1TWFH 1VQMA 3A5ZB 2K75A 4DV6Q 4A3BH 2RHSB 3UDIA 4A3DH 3PUVA 1YITA 3PUWA 1HZCA 1Q8KA 1QUQB 4GN3B 1XMOQ 2R7ZG 4IOAA 4OWWB 2MFIA 2UUAQ 1Z47A 3ICEA 2KCMA 4A4IA 1E3PA 3FKIG 3M4QA 4JI1L 4AQYL 4A3FH 3PF5A 1YIJA 4JI2L 1SMXA 4BY1G 1HNZQ 3SGIA 2EIFA 2Y0SE 1TWCH 4GNXC 2CWAA 4A3KG 3S14H 3DLLA 3TS2A 2B3GA 3G71A 1KL9A 1N8RC 4A3LG 2IY5B 2OCEA 1K8AC 4DNIA 4JBKA 3PGZA 1E1OA 1CKNA 3K81C 4HIDA 1Q82C 3EBEA 3S24A 3WWVA 3T1YL 2R7ZH 4A3EH 4B3SL 2AWOA 4Y7NH 3NELA 3GTQH 3HOUG 1GVPA 4JOIA 1QVCA 4X66L 4LF4Q 2GVAA 5GAEC 1IBKQ 3I7FA 3HFZB 1QVGA 2K4KA 1Q12A 2PNHA 1VQIA 3UE0A 3HOXH 4HJ7A 1W2BA 4BY1H 4DR7L 4GLVB 1N34L 5C0XJ 1Q46A 4IPDA 4IPGA 4A75A 4A3KH 1QVFA 3J7A5 1EYGA 4DUZQ 1PFSA 4BBRH 1QZHA 1YHAA 1XPOA 4QY7A 4LFBL 2NVQH 4K0KQ 1YI2A 4JV5L 2OTLA 4DV3L 4DR2Q 3KDFA 4XIGS 2RCNA 4BBSH 3HKZG 1UWVA 3CCLA 3A0JA 3I4MH 1B70B 2HT1A 3HOUH 1PH1A 2NN6G 3F2CA 5GROA 1Q1EA 1N36L 1SROA 3CMAA 1VQ5A 1SFOH 1FJGQ 1P16A 4R4IA 3W1BA 1KQSA 4A3GH 4GOPB 3J80i 4DR6Q 4A3GG 2HHHQ 4X64Q 3S15H 2Q2TA 4UPAA 1JB7A 3I4NG 3S17H 1X9NA 4DR1L 3K80C 3GTMH 1VQOA 3HKZE 3VDYA 4DV0L 1G6PA 4LF8Q 3RN2A 4JI7Q 2PQAA 2Q2IA 1OXVA 3UDFA 1NY4A 3HOVH 1I5FA 3NENA 4TVAB 3L0OA 4A3CG 2XGTA 4LUZA 2R6GA 1QUQA 5HGQA 2ZJPA 2Z6KC 1YJWA 3W1GA 2NVXH 5FJ8G 3ULPA 4YCWA 4WJ4A 1I94L 5E7NA 4JI3Q 1E1TA 2OWOA 3I4NH 4LF9L 1VQAA 3CP0A 1D7QA 3M7NA 4AIMA 3NBHB 3PUXA 4LUOA 3RZOH 4QIWE 1XMQL 1EIYB 1BVSA 1MJCA 1A0IA 3CPFA 3KF6A 4DPGA 3GTJH 3HOZG 1NTGA 2HIVA 1GD7A 3HOYG 3KJPA 4A3IG 1JJGA 4L5RC 2ZJRA 1GM5A 2GVBA 2AWNA 3RZDH 3GTLH 2UXDL 1C7YA 3T1HQ 2JA6G 1TXYA 2IHFA 4GOPC 3H3VH 1NJIC 4A3JH 1UE6A 4B3TL 4FDBA 3H0GG 4X65L 4IOCA 4DV7Q 2YU9H 4MTNA 3ERSX 5IT9c 3RLFA 3PIPA 3CCSA 3J81j 1KIXA 1L1OA 3CQZH 4AH6A 1HZBA 1YHBA 2F3IA 1S72A 4LF7Q 3HOZH 4KHPQ 5IYBG 4C3IH 1HNWQ 2ASBA 4A3IH 3KFUA 3M3YH 3H15A 3M4OH 4LFAQ 2VQFQ 1IBLL 2JA6H 4JYAL 3DM3A 1VS0A 2OQKA 5LMNQ 1YHQA 1PH8A 4DUYQ 1YJNA 3PUYA 1VQCA 3H0GH 4P75A 1WCMG 2KCTA 1S40A 2ALYB 5GADC 1YBYA 4IFDI 2UXDQ 4NB3A 2LXKA 5M3FH 4IFDG 1L2FA 1OXXK 2R7FA 3E9IA 2JA7G 4AYBG 5IYBH 2QA4A 3F2DA 1PH6A 2OQ0A 4DV6L 4L5SA 3TQYA 3ZJYC 2VS1A 4JI8Q 1I3QH 1LTLA 4HIKA 5M5YH 4HJ5A 1VQGA 4X62L 4HIMA 2F52A 4NXMQ 2UXCL 3EIVA 2JA5G 1MIUA 2VQEQ 1V9PA 1HZ9A 1XMOL 1N33L 2DGYA 1Y1VG 3PSIA 3KF8B 1CUKA 2UUAL 4DV2L 1WCMH 4OO1G 4A93G 1V43A 2YYZA 1X3FA 1N9WA 4JBJA 4B3MQ 1HNZL 3I2ZA 4AYBE 4C3HH 1GO3E 5JEAJ 1G291 3D0FA 2JA7H 2PI2A 1D8LA 4MNOA 4KI0A 3CXCA 1Q86C 1A62A 2CQOA 1EQRA 2WFWA 1CKOA 1UE5A 3G48A 4YCVA 3NEMA 1KHIA 1J5EL 2UUBL 1BBUA 4YY3Q 4JI0Q 2CWPA 5AJ3L 5K36G 1Z9FA 1MJEA 4HJAA 4QQBX 4IPCA 1YNXA 3RR5A 1X55A 1PH9A 1EOVA 1FVIA 1VQ7A 4AQYQ 1N32L 3OTOQ 5C0XG 3FKIH 1PH2A 1WJJA 3BZKA 4X6AH 3K8AA 4A93H 4HIOA 4LF4L 3M9BA 1KXLA 1IBKL 3GD7A 1K0RA 3GTGH 4BA1I 1OXTA 3S1QH 1J6QA 3BU2A 4DK6C 1SR3A 1TWHH 5H1SE 4GN4B 4LF5L 3TEHB 3UDGA 4A3LH 4JBWA 4GNXA 4DUZL 4RG1A 3FHWA 1SLJA 2RF4A 5IY0A 3GTKH 5IP9G 4K0KL 5BR8Q 3CCQA 2JJQA 4DV4Q 5EAYA 2NN6I 4XTCS 4DR2L 4B3SQ 3U4ZA 4P72A 4B3RL 1XNQL 1JT8A 4DR5Q 2K5NA 5LMUQ 4NPSA 4OX9Q 2ZM6L 1PA6A 4LFCL 4JI5Q 1UE7A 1FJGL 3K7AH 1N34Q 2D62A 3AEVA 3HOWG 4OWXB 4DR6L 4JI4Q 2HHHL 4MZ9A 1L0WA 4X64L 1BKBA 2UUCL 1KD1C 2B63G 1E24A 4P71A 2F4VL 4UP9A 5IP7G 1A8VA 4JV5Q 4LFBQ 4GS3A 4DV3Q 5FLXc 1HNXL 1O7IA 3ULLA 2A1AA 5IP9H 4A3MG 3S1MH 2UXBQ 5GAGC 1UEBA 2IT1A 4LF8L 1XTDA 2D0PA 1Y14B 1I50H 5FLMG 4QGUA 1BBWA 3MXNB 4PZ6A 3A74A 1XPUA 1X54A 1JJCB 2VY3A 1N36Q 2UU9L 3CC7A 2UXBL 3H3VI 1GKHA 3STBC 5JJIA 4OONA 1E7ZA 3TS0A 1XJVA 1EUJA 2PMZE 2MO0A 5IWAQ 3OW2A 3HOWH 1DGSA 2EQSA 4DR1Q 2JA8G 1VQPA 3F8TA 2VL6A 4JI3L 1SRUA 4ME3A 3CCVA 2B63H 1W3SA 5IP7H 3I55A 4DV0Q 1JMCA 1QZGA 4PZ8A 3PUZA 3FP9A 4BY7G 2HIXA 2R92G 1H95A 1E22A 5ELNA 3PO3G 5FLMH 2YTYA 4YCUA 2Q2UA 4NXNQ 2I5HA 4A3CH 1VQ6A 1VQ9A 3PO2G 2JEBI 1B7YB 1CSQA 3AFPA 1VQHA 2E5LL 5FJ8H 4TQUS 1I94Q 1K8GA 1IBMQ 2Z6KA 4YWLA 4GLAC 1K83H 4JCVE 1KAWA 4DKAC 2I5LX 3Q8DA 2R93G 2EXDA 4DR3L 1SE8A 1VQFA 1B8AA 1IYJB 3E0EA 5C44G 1KRTA 4DV5Q 1ASZA 4LF6L 4R4TA 3BJUA 4BY7H 2IHEA 1ASYA 2R92H 4GKJL 1TWAH 2ZTCA 4UP8A 1XNRL 3HOYH 1CKNB 4YHHQ 1AH9A 1R9TH 3M4PA 4L5TA 1Q7YC 1HNWL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LW1 A;  2QGQ A;  3PCO B;  3GTO H;  4KHZ A;  2MQH A;  2N78 A;  4KLK A;  3F2B A;  1WOC A;  2ZTE A;  1X65 A;  3I4O A;  5C3E G;  3S16 H;  4LWC A;  1HR0 Q;  4GOP A;  4DV1 L;  3CD6 A;  2KEN A;  3I56 A;  2R93 H;  1SN8 A;  4A76 A;  3LGJ A;  4DR4 L;  2GN5 A;  3RLN A;  2BA0 A;  1XPR A;  4GKK Q;  1N32 Q;  1NMG A;  1X3E A;  2VUM G;  3KDF B;  4R4Q A;  1V1Q A;  4O2D A;  2CCZ A;  3PIO A;  2LXJ A;  4EX5 A;  2NVY H;  4JYA Q;  3KLW A;  2Z0S A;  4JC0 A;  1M1K C;  4R1J A;  1WFQ A;  4JI6 Q;  2B29 A;  5C3E H;  2N8N A;  4OO1 I;  4NXM L;  4PG3 A;  4OXP A;  4HJ9 A;  4C2M H;  3KJO A;  3U50 C;  2D0O A;  3CCU A;  1NMF A;  3CC2 A;  4DK3 C;  1K73 C;  5C4X G;  1U5K A;  2ID0 A;  4J15 A;  3U58 A;  1PH7 A;  2VUM H;  1RIP A;  1T9H A;  2PQA B;  3HKS A;  2PI2 E;  4IFD J;  4YY3 L;  4JI0 L;  1EWI A;  5GAH C;  1C0A A;  4X62 Q;  4JOI C;  2UXC Q;  1X56 A;  1PYB A;  1LYL A;  2I5M X;  5C0X I;  2JQO A;  4A3E G;  2JA5 H;  1N33 Q;  3S2D H;  4RMF A;  4JI1 Q;  4JI2 Q;  2RHQ B;  4DV2 Q;  1Y1V H;  4LNQ A;  3OTO L;  3GTP H;  5LMN W;  1VQ4 A;  2QEX A;  4IO9 A;  3HOX G;  2VW9 A;  2CKZ B;  4BXX G;  2E2H H;  1HR0 W;  1NE3 A;  5C4X H;  4UP7 A;  1TWG H;  1VQD A;  2VZA A;  1IZ6 A;  2NVT H;  2UUB Q;  1J5E Q;  4IJH A;  4BBR G;  1HH2 P;  5IYC G;  2Q2H A;  5AJ3 Q;  4DAM A;  1G51 A;  4QL5 A;  3KF6 B;  1OTC A;  2VNU D;  1C9O A;  4APV A;  4HJ8 A;  2H5X A;  5IYD G;  4BBS G;  3T1Y Q;  1EFW A;  5BR8 L;  4DV4 L;  1PH4 A;  1UE1 A;  4GN5 A;  3EN2 A;  4R4C A;  5M5X H;  3RN5 A;  4X66 Q;  3I4M G;  4O0A A;  5JJL A;  1VQN A;  2YV5 A;  2YTX A;  4DR5 L;  4DR7 Q;  4L5Q A;  3L7Z C;  3S1R H;  3CCM A;  2AMC B;  2WB1 G;  3J81 c;  5LMU L;  4POF A;  1EIF A;  2JK8 A;  1OXU A;  3J80 c;  2BH8 A;  3L2P A;  4OX9 L;  1HJP A;  4JI5 L;  2BA1 A;  4BXX H;  3CCR A;  3B6Y A;  1PV4 A;  4LF5 Q;  4JI4 L;  1L1O B;  3KYH C;  5IYC H;  4GKK L;  1VQL A;  5IYD H;  1PHJ A;  2HQL A;  1FGU A;  2A19 A;  1VQK A;  3JC6 6;  4YWM A;  4JI7 L;  2JEA I;  3HOV G;  2WAQ G;  4B3R Q;  1WI5 A;  4C3J H;  1PH5 A;  1XNQ Q;  1NBW A;  1HZA A;  3UDX A;  1CSP A;  1EQQ A;  2A8V A;  1Q1B A;  2WB1 E;  3AYH B;  2ZM6 Q;  3G6E A;  2CFM A;  3AFQ A;  3RNU A;  4LFC Q;  3STB D;  4R4O A;  3A5U A;  2K5H A;  2YTV A;  2MNA A;  3J81 i;  3K7U C;  3E9H A;  1RL2 A;  1K9M C;  4IPH A;  2ES2 A;  4YWK A;  1LM0 A;  3CF5 A;  5IWA L;  2R7D A;  3ER0 A;  2UUC Q;  2F4V Q;  3TRZ A;  1VQJ A;  3CCJ A;  1LUZ A;  1JE5 A;  2IX1 A;  1HNX Q;  4Y52 H;  5JJK A;  2KBN A;  1Y1W G;  4A3M H;  3CW2 C;  2WAQ E;  3U4V A;  2JA9 A;  3W5O A;  2NZO A;  4UY8 C;  3CME A;  3CPW A;  3CAM A;  2UU9 Q;  2ZTD A;  3M85 A;  1U0L A;  2K50 A;  4NXN L;  1OXS C;  3D31 A;  4BA2 I;  5DLQ E;  3RLO A;  3MEF A;  3T1H L;  4LF9 Q;  4A3J G;  2K14 A;  3TRE A;  1IBM L;  1P8L A;  3KOJ A;  2JA8 H;  2IX0 A;  3S2H H;  4PMW A;  1L1O C;  3J7Z C;  4POG A;  2N49 A;  4DV7 L;  1Y1W H;  2NZH A;  3IRB A;  1XMQ Q;  3PV0 A;  2AKW B;  3GO5 A;  1YZ6 A;  1MKH A;  1X3G A;  4DV5 L;  2OTJ A;  2LSS A;  1VQB A;  3JAM c;  3PO3 H;  4LF7 L;  4KHP L;  4GLX A;  1JJ2 A;  3S1N H;  3CCE A;  1VQE A;  4DAY B;  2K52 A;  1AE3 A;  1YEZ A;  3K0X A;  3PF4 A;  3PO2 H;  4YHH L;  2E5L Q;  2N3S A;  2VQF L;  5C4J H;  4LFA L;  1CKM A;  5J3B A;  2E2J H;  1YVC A;  5IE8 A;  1PVO A;  5GQO A;  4B3T Q;  2WP8 J;  4X65 Q;  5LMN L;  3UE1 A;  4DR3 Q;  1S3O A;  4DUY L;  4ALP A;  3OYY A;  2KHJ A;  1HR0 L;  2BH2 A;  2K5V A;  1X6O A;  3GDE A;  5C44 H;  5M3F G;  4LF6 Q;  2FXQ A;  4GNX B;  4GKJ Q;  4IJL A;  1VQ8 A;  1XNR Q;  1AE2 A;  1IXR A;  2V1C C;  3BZC A;  4PZ7 A;  4H02 A;  5M3M G;  3JAM i;  1PH3 A;  4P73 A;  2KHI A;  2E8G A;  4LUV A;  5ELO A;  4JG2 A;  2AHO B;  2JE6 I;  2XTI A;  4OWT B;  3CC4 A;  1IBL Q;  4A3B G;  4A3D G;  1A63 A;  3G4S A;  1KRS A;  1VCI A;  4JI8 L;  1PYS B;  2C35 B;  4WJ3 M;  1I6H H;  1M90 C;  1IL2 A;  2E2I H;  4DV1 Q;  2I0Q A;  5JEA G;  4EQ5 A;  4JI6 L;  2VQE L;  2L15 A;  1YJ9 A;  4A3F G;  3ULJ A;  1FL0 A;  3AQQ A;  1WYD A;  2DUD A;  4DR4 Q;  4QJF A;  4JBM A;  3F1Z A;  1K3R A;  4B3M L;  2Y0S G;  1Q81 C;  5M5W H;  2MO1 A;  5HY6 A;  1KC8 C;  2ATW A;  2ZJQ A;  4P74 A;  5M3M H;  1TWF H;  1VQM A;  3A5Z B;  2K75 A;  4DV6 Q;  4A3B H;  2RHS B;  3UDI A;  4A3D H;  3PUV A;  1YIT A;  3PUW A;  1HZC A;  1Q8K A;  1QUQ B;  4GN3 B;  1XMO Q;  2R7Z G;  4IOA A;  4OWW B;  2MFI A;  2UUA Q;  1Z47 A;  3ICE A;  2KCM A;  4A4I A;  1E3P A;  3FKI G;  3M4Q A;  4JI1 L;  4AQY L;  4A3F H;  3PF5 A;  1YIJ A;  4JI2 L;  1SMX A;  4BY1 G;  1HNZ Q;  3SGI A;  2EIF A;  2Y0S E;  1TWC H;  4GNX C;  2CWA A;  4A3K G;  3S14 H;  3DLL A;  3TS2 A;  2B3G A;  3G71 A;  1KL9 A;  1N8R C;  4A3L G;  2IY5 B;  2OCE A;  1K8A C;  4DNI A;  4JBK A;  3PGZ A;  1E1O A;  1CKN A;  3K81 C;  4HID A;  1Q82 C;  3EBE A;  3S24 A;  3WWV A;  3T1Y L;  2R7Z H;  4A3E H;  4B3S L;  2AWO A;  4Y7N H;  3NEL A;  3GTQ H;  3HOU G;  1GVP A;  4JOI A;  1QVC A;  4X66 L;  4LF4 Q;  2GVA A;  5GAE C;  1IBK Q;  3I7F A;  3HFZ B;  1QVG A;  2K4K A;  1Q12 A;  2PNH A;  1VQI A;  3UE0 A;  3HOX H;  4HJ7 A;  1W2B A;  4BY1 H;  4DR7 L;  4GLV B;  1N34 L;  5C0X J;  1Q46 A;  4IPD A;  4IPG A;  4A75 A;  4A3K H;  1QVF A;  3J7A 5;  1EYG A;  4DUZ Q;  1PFS A;  4BBR H;  1QZH A;  1YHA A;  1XPO A;  4QY7 A;  4LFB L;  2NVQ H;  4K0K Q;  1YI2 A;  4JV5 L;  2OTL A;  4DV3 L;  4DR2 Q;  3KDF A;  4XIG S;  2RCN A;  4BBS H;  3HKZ G;  1UWV A;  3CCL A;  3A0J A;  3I4M H;  1B70 B;  2HT1 A;  3HOU H;  1PH1 A;  2NN6 G;  3F2C A;  5GRO A;  1Q1E A;  1N36 L;  1SRO A;  3CMA A;  1VQ5 A;  1SFO H;  1FJG Q;  1P16 A;  4R4I A;  3W1B A;  1KQS A;  4A3G H;  4GOP B;  3J80 i;  4DR6 Q;  4A3G G;  2HHH Q;  4X64 Q;  3S15 H;  2Q2T A;  4UPA A;  1JB7 A;  3I4N G;  3S17 H;  1X9N A;  4DR1 L;  3K80 C;  3GTM H;  1VQO A;  3HKZ E;  3VDY A;  4DV0 L;  1G6P A;  4LF8 Q;  3RN2 A;  4JI7 Q;  2PQA A;  2Q2I A;  1OXV A;  3UDF A;  1NY4 A;  3HOV H;  1I5F A;  3NEN A;  4TVA B;  3L0O A;  4A3C G;  2XGT A;  4LUZ A;  2R6G A;  1QUQ A;  5HGQ A;  2ZJP A;  2Z6K C;  1YJW A;  3W1G A;  2NVX H;  5FJ8 G;  3ULP A;  4YCW A;  4WJ4 A;  1I94 L;  5E7N A;  4JI3 Q;  1E1T A;  2OWO A;  3I4N H;  4LF9 L;  1VQA A;  3CP0 A;  1D7Q A;  3M7N A;  4AIM A;  3NBH B;  3PUX A;  4LUO A;  3RZO H;  4QIW E;  1XMQ L;  1EIY B;  1BVS A;  1MJC A;  1A0I A;  3CPF A;  3KF6 A;  4DPG A;  3GTJ H;  3HOZ G;  1NTG A;  2HIV A;  1GD7 A;  3HOY G;  3KJP A;  4A3I G;  1JJG A;  4L5R C;  2ZJR A;  1GM5 A;  2GVB A;  2AWN A;  3RZD H;  3GTL H;  2UXD L;  1C7Y A;  3T1H Q;  2JA6 G;  1TXY A;  2IHF A;  4GOP C;  3H3V H;  1NJI C;  4A3J H;  1UE6 A;  4B3T L;  4FDB A;  3H0G G;  4X65 L;  4IOC A;  4DV7 Q;  2YU9 H;  4MTN A;  3ERS X;  5IT9 c;  3RLF A;  3PIP A;  3CCS A;  3J81 j;  1KIX A;  1L1O A;  3CQZ H;  4AH6 A;  1HZB A;  1YHB A;  2F3I A;  1S72 A;  4LF7 Q;  3HOZ H;  4KHP Q;  5IYB G;  4C3I H;  1HNW Q;  2ASB A;  4A3I H;  3KFU A;  3M3Y H;  3H15 A;  3M4O H;  4LFA Q;  2VQF Q;  1IBL L;  2JA6 H;  4JYA L;  3DM3 A;  1VS0 A;  2OQK A;  5LMN Q;  1YHQ A;  1PH8 A;  4DUY Q;  1YJN A;  3PUY A;  1VQC A;  3H0G H;  4P75 A;  1WCM G;  2KCT A;  1S40 A;  2ALY B;  5GAD C;  1YBY A;  4IFD I;  2UXD Q;  4NB3 A;  2LXK A;  5M3F H;  4IFD G;  1L2F A;  1OXX K;  2R7F A;  3E9I A;  2JA7 G;  4AYB G;  5IYB H;  2QA4 A;  3F2D A;  1PH6 A;  2OQ0 A;  4DV6 L;  4L5S A;  3TQY A;  3ZJY C;  2VS1 A;  4JI8 Q;  1I3Q H;  1LTL A;  4HIK A;  5M5Y H;  4HJ5 A;  1VQG A;  4X62 L;  4HIM A;  2F52 A;  4NXM Q;  2UXC L;  3EIV A;  2JA5 G;  1MIU A;  2VQE Q;  1V9P A;  1HZ9 A;  1XMO L;  1N33 L;  2DGY A;  1Y1V G;  3PSI A;  3KF8 B;  1CUK A;  2UUA L;  4DV2 L;  1WCM H;  4OO1 G;  4A93 G;  1V43 A;  2YYZ A;  1X3F A;  1N9W A;  4JBJ A;  4B3M Q;  1HNZ L;  3I2Z A;  4AYB E;  4C3H H;  1GO3 E;  5JEA J;  1G29 1;  3D0F A;  2JA7 H;  2PI2 A;  1D8L A;  4MNO A;  4KI0 A;  3CXC A;  1Q86 C;  1A62 A;  2CQO A;  1EQR A;  2WFW A;  1CKO A;  1UE5 A;  3G48 A;  4YCV A;  3NEM A;  1KHI A;  1J5E L;  2UUB L;  1BBU A;  4YY3 Q;  4JI0 Q;  2CWP A;  5AJ3 L;  5K36 G;  1Z9F A;  1MJE A;  4HJA A;  4QQB X;  4IPC A;  1YNX A;  3RR5 A;  1X55 A;  1PH9 A;  1EOV A;  1FVI A;  1VQ7 A;  4AQY Q;  1N32 L;  3OTO Q;  5C0X G;  3FKI H;  1PH2 A;  1WJJ A;  3BZK A;  4X6A H;  3K8A A;  4A93 H;  4HIO A;  4LF4 L;  3M9B A;  1KXL A;  1IBK L;  3GD7 A;  1K0R A;  3GTG H;  4BA1 I;  1OXT A;  3S1Q H;  1J6Q A;  3BU2 A;  4DK6 C;  1SR3 A;  1TWH H;  5H1S E;  4GN4 B;  4LF5 L;  3TEH B;  3UDG A;  4A3L H;  4JBW A;  4GNX A;  4DUZ L;  4RG1 A;  3FHW A;  1SLJ A;  2RF4 A;  5IY0 A;  3GTK H;  5IP9 G;  4K0K L;  5BR8 Q;  3CCQ A;  2JJQ A;  4DV4 Q;  5EAY A;  2NN6 I;  4XTC S;  4DR2 L;  4B3S Q;  3U4Z A;  4P72 A;  4B3R L;  1XNQ L;  1JT8 A;  4DR5 Q;  2K5N A;  5LMU Q;  4NPS A;  4OX9 Q;  2ZM6 L;  1PA6 A;  4LFC L;  4JI5 Q;  1UE7 A;  1FJG L;  3K7A H;  1N34 Q;  2D62 A;  3AEV A;  3HOW G;  4OWX B;  4DR6 L;  4JI4 Q;  2HHH L;  4MZ9 A;  1L0W A;  4X64 L;  1BKB A;  2UUC L;  1KD1 C;  2B63 G;  1E24 A;  4P71 A;  2F4V L;  4UP9 A;  5IP7 G;  1A8V A;  4JV5 Q;  4LFB Q;  4GS3 A;  4DV3 Q;  5FLX c;  1HNX L;  1O7I A;  3ULL A;  2A1A A;  5IP9 H;  4A3M G;  3S1M H;  2UXB Q;  5GAG C;  1UEB A;  2IT1 A;  4LF8 L;  1XTD A;  2D0P A;  1Y14 B;  1I50 H;  5FLM G;  4QGU A;  1BBW A;  3MXN B;  4PZ6 A;  3A74 A;  1XPU A;  1X54 A;  1JJC B;  2VY3 A;  1N36 Q;  2UU9 L;  3CC7 A;  2UXB L;  3H3V I;  1GKH A;  3STB C;  5JJI A;  4OON A;  1E7Z A;  3TS0 A;  1XJV A;  1EUJ A;  2PMZ E;  2MO0 A;  5IWA Q;  3OW2 A;  3HOW H;  1DGS A;  2EQS A;  4DR1 Q;  2JA8 G;  1VQP A;  3F8T A;  2VL6 A;  4JI3 L;  1SRU A;  4ME3 A;  3CCV A;  2B63 H;  1W3S A;  5IP7 H;  3I55 A;  4DV0 Q;  1JMC A;  1QZG A;  4PZ8 A;  3PUZ A;  3FP9 A;  4BY7 G;  2HIX A;  2R92 G;  1H95 A;  1E22 A;  5ELN A;  3PO3 G;  5FLM H;  2YTY A;  4YCU A;  2Q2U A;  4NXN Q;  2I5H A;  4A3C H;  1VQ6 A;  1VQ9 A;  3PO2 G;  2JEB I;  1B7Y B;  1CSQ A;  3AFP A;  1VQH A;  2E5L L;  5FJ8 H;  4TQU S;  1I94 Q;  1K8G A;  1IBM Q;  2Z6K A;  4YWL A;  4GLA C;  1K83 H;  4JCV E;  1KAW A;  4DKA C;  2I5L X;  3Q8D A;  2R93 G;  2EXD A;  4DR3 L;  1SE8 A;  1VQF A;  1B8A A;  1IYJ B;  3E0E A;  5C44 G;  1KRT A;  4DV5 Q;  1ASZ A;  4LF6 L;  4R4T A;  3BJU A;  4BY7 H;  2IHE A;  1ASY A;  2R92 H;  4GKJ L;  1TWA H;  2ZTC A;  4UP8 A;  1XNR L;  3HOY H;  1CKN B;  4YHH Q;  1AH9 A;  1R9T H;  3M4P A;  4L5T A;  1Q7Y C;  1HNW L; 
#chains in the Genus database with same CATH topology
 4LW1 A;  3U9S A;  5EKI A;  4I65 A;  3PCO B;  4WFN 3;  3F8N A;  2N78 A;  3BYT B;  2ZTE A;  3PZP A;  3CQZ A;  1HR0 Q;  4EEY A;  4PMC A;  1BJT A;  2L4N A;  2R93 H;  1G6Z A;  1SN8 A;  3DHQ A;  4A76 A;  4RUA A;  5D65 A;  2BE5 D;  2NZ1 D;  1X3E A;  2VUM G;  5DQI A;  2K03 A;  4R4Q A;  5KFM A;  2YZN A;  5KFX A;  2NVY H;  1EY0 A;  2KEC A;  3CRL C;  4R1J A;  3SHL A;  1WFQ A;  4JI6 Q;  1Y8P B;  3NTK A;  3MXU A;  1B6R A;  1IL8 A;  1SMY D;  3KJO A;  3LWE A;  4HJ9 A;  4B3T H;  1CHP D;  4DR3 H;  1DZ1 A;  1H9M A;  3URY A;  5KG4 A;  4GKJ H;  4J15 A;  1SEI A;  2VUM H;  1T9H A;  3HKS A;  2HJW A;  1VKZ A;  4YP3 A;  4IFD J;  4G7O C;  4MV8 A;  2Z1C A;  4J9M A;  4ECS A;  1TII D;  1LYL A;  4EEQ A;  2JA5 H;  2Z4H A;  3CHB D;  4NLG A;  1TWC A;  2SOB A;  3MEH A;  4GC6 A;  2Y0S A;  1Y1V H;  3OMC A;  2BOS A;  4LNQ A;  3EPI A;  4DV1 H;  1F2M A;  1KNE A;  1LLR D;  4M7E A;  5BN4 A;  4ZUI A;  1HR0 W;  2EY1 A;  4FS2 A;  4KKT A;  5K2M A;  3SK6 A;  4MV7 A;  4QL5 A;  2ZDH A;  1G91 A;  2F3V A;  5IYD G;  4ECX A;  4DV6 H;  1PTO D;  2JEI A;  5KFN A;  3TQT A;  5BR8 L;  5E4X A;  4DV4 L;  2X0S A;  1UE1 A;  4GN5 A;  2NU8 B;  5M5X H;  5C0X H;  1XMO H;  2UUA H;  3CCM A;  2AMC B;  5LMU L;  5LL6 b;  2NTS A;  3L2P A;  3J80 c;  2VQD A;  2BH8 A;  2SEB D;  4JI5 L;  4WD3 A;  1WTQ A;  3CCR A;  4LF5 Q;  3V6H A;  5JAV A;  2W6Q A;  5FPR A;  3V96 A;  3KYH C;  2JEF A;  2DLN A;  4ZKB B;  4DLK A;  1G2T A;  2GPW A;  3Q8S B;  4QWB A;  5IYD H;  1VDZ A;  1PHJ A;  1CQJ B;  1KBL A;  1SFO A;  4JI7 L;  2UXB L;  2JEA I;  3N42 B;  1A15 A;  4B3R Q;  1S0N A;  1EQQ A;  1CSP A;  5KRU A;  3KUP A;  2A8V A;  2R93 B;  1V51 A;  3AYH B;  3RNU A;  4TRD A;  2AUJ D;  2XRS D;  2IA6 A;  2YTV A;  1F2L A;  2MNA A;  4LF4 H;  2KA7 A;  5DG7 A;  1K3B C;  2R85 A;  3RAQ A;  4IRD A;  4C56 C;  2R7D A;  2QCP X;  3TRZ A;  1UNS A;  1LUZ A;  3VPD A;  2XRQ D;  1HNX Q;  2NVY B;  4DNT B;  4Y52 H;  5L1J A;  4IUR A;  3OHB A;  4A3M H;  2IJ0 A;  1S5D D;  4K0K H;  1ENF A;  3R3O A;  2F0F A;  3RGZ A;  3U4V A;  2R6F A;  1SYD A;  4J9S A;  3N52 A;  1SE4 A;  2NZO A;  3L3O C;  1GSO A;  3CME A;  2NVX A;  3CAM A;  2Z6B A;  1U0L A;  1EQV A;  1SE2 A;  4K2L A;  1W96 A;  5DG9 A;  1CI3 M;  3I73 A;  3T1H L;  4MV1 A;  4FF1 A;  1XTC D;  1IKL A;  2OF1 A;  2VUM B;  5DGB A;  2C2R A;  4IRK A;  2IX0 A;  4MV3 A;  5CR3 A;  4X64 H;  4RUC A;  4QIW A;  4EQN A;  4OEL B;  2KJX A;  3SEB A;  3IRB A;  3PV0 A;  2FPI B;  1MSH A;  2JA5 B;  3KHR A;  3PO3 H;  2CW8 A;  2YRX A;  1Y1V B;  3S1N H;  1VQE A;  1ENC A;  3PF4 A;  1AE3 A;  1V1O A;  4TV9 F;  4YHH L;  3E5N A;  1PLF A;  4LFA L;  5C4J H;  2E2J H;  1YVC A;  5IE8 A;  2B8G A;  3SR1 A;  4U67 3;  5GQO A;  2WP8 J;  3CU7 A;  5LMN L;  4QUC A;  1H9K A;  4DUY L;  1IYV A;  2KHJ A;  1BOS A;  3IFT A;  1QG7 A;  1X6O A;  2K5V A;  5M3F G;  3G7L A;  3LWU A;  4ED3 A;  3A8I E;  2FXQ A;  5FO8 B;  1DON A;  1W93 A;  2ZXR A;  1Q8I A;  4Q5V A;  5M5X B;  1VBH A;  1AE2 A;  1PH3 A;  2V1C C;  4ZI7 F;  4PZ7 A;  1STG A;  3VA7 A;  1N32 L;  2JA6 A;  2KHI A;  2F0S A;  3CC4 A;  3ICE A;  2AHO B;  4A3B G;  1IBL Q;  5EJW A;  1L0X B;  3VYS A;  3GLK A;  1Z7T A;  2C35 B;  4ZKC B;  4KV6 A;  1I6H H;  3MFI A;  2K33 A;  1IL2 A;  4J1M A;  5JEA G;  4RNO A;  4YR2 A;  1YJ9 A;  3BG5 A;  3K5M A;  3MVV A;  3CKI B;  1FL0 A;  2LFN A;  3AQQ A;  5FLX L;  4DV7 H;  1WYD A;  2DUD A;  4DR4 Q;  3F1Z A;  1K3R A;  4B3M L;  1Q81 C;  1JIH A;  5HY6 A;  4FP5 D;  1KC8 C;  3V4Z A;  1HA5 A;  3KHH A;  5DEH A;  1FD7 D;  3NSW A;  1VQM A;  2F1M A;  4A3B H;  3D6W A;  5KND A;  2VQF H;  5KFQ A;  1YIT A;  3IG0 A;  4CJ1 B;  4G4K A;  1Q8K A;  2R7Z G;  4GN3 B;  1WTO A;  2MFI A;  1D5X C;  5AFW A;  5JEA H;  1TT2 A;  2K1B A;  1RK5 A;  2JA7 A;  4JI1 L;  4A3M B;  1EWH A;  4BY1 G;  4U68 A;  3SGI A;  1HNZ Q;  1S10 A;  1WTX A;  1SNC A;  2MPM A;  1VMP A;  2CWA A;  2AQ2 B;  3DLL A;  4LK1 C;  4A3L G;  1X32 A;  2IY5 B;  4GC7 A;  2JA5 A;  2E2D C;  1Y1V A;  3BS1 A;  1EY4 A;  1GUS A;  5FPO A;  5L37 A;  2R7Z H;  4A3E H;  2AWO A;  2TMP A;  5CV7 A;  3TII A;  3GTG A;  3K5I A;  4QUF A;  4KD4 A;  2ZT9 C;  1I7L A;  2AGQ A;  5GAE C;  1QVG A;  4BY1 H;  3KLS X;  1W2B A;  3PO3 B;  4WBN F;  3K5N A;  1Q3L A;  1E2Z A;  4FF4 A;  4LMQ D;  3S1N B;  4FBU A;  1STA A;  3OIQ A;  4DUZ Q;  2XCA A;  1YHA A;  3ZYY X;  2PO4 A;  4QY7 A;  5C4J B;  4KMU C;  4LFB L;  2E2J B;  4DR2 Q;  4JW0 A;  4OEM B;  2HCC A;  2N55 A;  3I4M H;  3KAL A;  3BZD B;  1PH1 A;  2AGP A;  1RCV D;  3Q6S A;  3P20 A;  1SRO A;  1N36 L;  1KQS A;  4A3G H;  3C1F A;  4GOP B;  3J80 i;  2FKL A;  3LNN A;  2HHH Q;  3QFF A;  4UPA A;  4XZ3 B;  2MJ8 A;  1LTA D;  1M0W A;  1I4Q A;  3GP7 A;  2DJG C;  3DUZ A;  3HKZ E;  3VDY A;  2K05 A;  2PQA A;  4XQQ A;  1I6H B;  2Q2I A;  5KFA A;  2B39 A;  3NEN A;  4TVA B;  1NCV A;  3X3N A;  5HBR B;  3T5K A;  2D2C C;  2HVR A;  2Z6K C;  1EY8 A;  4GZY C;  3W1G A;  2EYL A;  5FJ8 G;  2OXP A;  4G7Z C;  1H9S B;  4WJ4 A;  1JCK B;  5EKL A;  2JEJ A;  2FMA A;  3CP0 A;  4A3B B;  1D7Q A;  1PDQ A;  3M7N A;  1A3U A;  4DGZ A;  2YW2 A;  4KHV A;  2FLN A;  3PUX A;  4LUO A;  5I6W A;  4ED6 A;  5A35 A;  5IGE A;  3TME A;  3RJ0 A;  2HGS A;  3CPF A;  4L6T B;  3LML A;  1NTG A;  1JDB B;  3BQ0 A;  1H9R A;  3HOY G;  4A3I G;  1TAE A;  3EPG A;  1GM5 A;  4TQR A;  1FGB D;  2GVB A;  2HCI A;  4DK1 A;  3RZD H;  1C7Y A;  1OWT A;  5JVD F;  2FLP A;  2IHF A;  1SDF A;  4A3J H;  4CKE A;  2UVU A;  1Z2P X;  3H0G G;  4QW9 A;  2CH4 W;  4IOC A;  4MTN A;  4RB2 C;  2OT2 A;  5IT9 c;  4EVO A;  3CCS A;  2EOT A;  4RAU C;  5E3F A;  2R7Z B;  4A3E B;  1HZB A;  1YHB A;  2VB2 X;  2FB9 A;  2RDG A;  2R3Z A;  4V0B A;  4A3I H;  3N40 P;  3TIN A;  3H15 A;  4BY1 B;  1U9R A;  3M4O H;  4NXN H;  4P2C B;  2NUA B;  3I90 A;  1YHQ A;  2YRW A;  1B53 A;  3IKJ A;  4KKS A;  4K8I A;  3HXL A;  3H0G H;  3QZ8 A;  4P75 A;  5CGK A;  1WCM G;  1YBY A;  1E4G T;  2X6G A;  4NB3 A;  3OUZ A;  5KFV A;  2MGS A;  4IFD G;  2R7F A;  1OXX K;  2RKS A;  3E9I A;  3I4M B;  1B44 D;  4CKC A;  1PYW D;  1TKW B;  3R93 A;  3WOE A;  5K36 H;  2KEE A;  1RTN A;  1K0S A;  2OQ0 A;  4A3G B;  3MR3 A;  4JI8 Q;  1I3Q H;  3WO0 A;  2UXD H;  4HIK A;  1WTV A;  3EIV A;  1HZ9 A;  5T1G A;  2XWJ B;  4CDF C;  1I4R A;  3KF8 B;  1CUK A;  1GUG A;  1WCM H;  2QK4 A;  3BJY A;  2IBK A;  4JBJ A;  4K6L A;  3I2Z A;  4AYB E;  3KBX A;  4IFD H;  4EBC A;  3M4Y A;  3GV3 A;  1D8L A;  4MNO A;  5J39 A;  3CXC A;  3S2D H;  1PZI D;  2CQO A;  1RK6 A;  1CKO A;  3G48 A;  4YCV A;  3NEM A;  4KN7 C;  3N6X A;  3PIP 3;  4DL5 A;  1IKM A;  2JEG A;  1G8Z D;  3J80 W;  1CZG A;  3TP6 A;  3FKI H;  1ILQ A;  5EKK A;  4XYM B;  4HIO A;  3M9B A;  1KXL A;  1IBK L;  3Q1K A;  1JOQ A;  3SE0 A;  1J6Q A;  3W3A A;  3JAM L;  4LF5 L;  1HQR D;  2QKI C;  4F8M A;  1GSH A;  3RZD B;  4YQW A;  1ML0 D;  3H94 A;  5IP9 G;  5BR8 Q;  4DV4 Q;  4A3J B;  1DOL A;  2F0H A;  1EIG A;  1JT8 A;  4B3R L;  1ZXT A;  1JC7 A;  5LMU Q;  4JI2 H;  4AQY H;  1TA8 A;  2RQX A;  1J8I A;  5EOY A;  4JI5 Q;  1UE7 A;  3E0J A;  2O5J C;  3NQI A;  3HOW G;  4OWX B;  5FO9 B;  4MZ9 A;  4A3I B;  2C2D A;  3KK7 A;  1L0W A;  4B9W A;  1BKB A;  2F0U A;  3M4O B;  4M8A A;  1E24 A;  4UP9 A;  4JV5 Q;  2UUB H;  4I50 F;  1J5E H;  4DV3 Q;  5KG5 A;  1HNX L;  3R8B A;  5IP9 H;  3T16 A;  3S1M H;  2UXB Q;  1HXY D;  3RB4 A;  2F0G A;  1XXG A;  2CZG A;  1MHW C;  1XTD A;  5COR A;  4LF8 L;  1QB5 D;  3T51 B;  2XD4 A;  3MXN B;  3A74 A;  3H0G B;  4O3R A;  4UAI A;  1T36 A;  4X66 H;  1B4O A;  4IWY A;  3H3V I;  1GKH A;  4LSX A;  3TBI B;  3L9A X;  3UI2 A;  1XJV A;  1ICF B;  3OW2 A;  5J1Z A;  3HOW H;  4EBD A;  4DR1 Q;  2JA8 G;  3F8T A;  3CCV A;  4MA5 A;  1JDE A;  1TS4 A;  4ZAI A;  3K0Y A;  1JMC A;  1I3Q B;  2W9C A;  1CQF A;  5KFK A;  3KLS A;  4BY7 G;  4X3K A;  5ELF A;  4O2A F;  4RZQ A;  2V9W A;  2I5H A;  1RJQ A;  5D1O B;  1WCM B;  1XNQ H;  3D4R A;  4YB8 B;  1VQ6 A;  3TP8 A;  1PRT F;  4LJZ C;  1AN7 A;  1VQH A;  4LFC H;  3S2D B;  4TQU S;  1I94 Q;  3NE5 B;  2Z6K A;  1JB3 A;  2EJG C;  4GLA C;  1K83 H;  1K8M A;  2EYF A;  3Q8D A;  2F4V H;  4CDD C;  2K5Q A;  1PRT B;  4B9X A;  3S9W A;  1B8A A;  2SNM A;  4ID6 A;  4NDX A;  3E0E A;  5JH7 F;  4DV0 H;  4BY7 H;  1ET9 A;  3SI8 A;  4OIK A;  1DOK A;  1TWA H;  4O4L F;  3FKI B;  2ATL A;  4YHH Q;  3DXJ C;  3KLR A;  3LP8 A;  2W7O A;  4XIG S;  2J6T A;  1BXR A;  4KY5 A;  3GTO H;  3R5F A;  2I80 A;  5LP6 F;  1WOC A;  2EYH A;  4LWC A;  4LF9 H;  3CD6 A;  1B50 A;  5JQW A;  3MJF A;  3BQ1 A;  1C3O A;  2NYZ D;  3MZ5 A;  1YNN C;  3LGJ A;  4DR4 L;  2F0J A;  3RLN A;  1XPR A;  1XMQ H;  1N32 Q;  2A69 C;  1LV9 A;  1T5X D;  3H91 A;  2E75 C;  3DMU A;  3KDF B;  4X3U A;  2WE6 A;  4O2D A;  2L9H A;  2FPP B;  2E2I A;  2LXJ A;  4HNV A;  4JYA Q;  3KXY T;  4R8U A;  3KLW A;  2NWG A;  1UEA B;  2E5L H;  3OMG A;  2YS7 A;  3IL8 A;  4CJ0 B;  2N8N A;  2IP4 A;  4NXM L;  5K5P A;  5T1I A;  4EFB A;  5KFW A;  4X65 H;  2LKV A;  3CCU A;  3S1M B;  5LXT F;  1TWF A;  4DK3 C;  1K73 C;  5C4X G;  1CA6 A;  4LF6 H;  1U5K A;  3MFH A;  4HCE A;  3NBH A;  3V05 A;  3KAK A;  4YAK B;  1I3Q A;  1PH7 A;  1U4L A;  4Q0Y A;  2ZDQ A;  3O13 A;  4H0L C;  2EYJ A;  4YY3 L;  2CW7 A;  5GAH C;  1C0A A;  4X62 Q;  1EUC B;  1S4Z A;  2YS6 A;  4J9R A;  3HOW B;  5EDW A;  2FMM A;  1X3P A;  2DNC A;  2HUG A;  4RMF A;  5CYU A;  4JI1 Q;  4OGQ C;  4DV2 Q;  4OO1 H;  3GTP H;  2W9B B;  5LMN W;  4EGJ A;  3BVG A;  3TP7 A;  3HOX G;  2CKZ B;  4BXX G;  2E2H H;  3GIK A;  1B9M A;  5C4X H;  1TWG H;  1T94 A;  3AB9 A;  2Q2H A;  4CKB A;  2VNU D;  3KF6 B;  4S3S A;  3WNZ A;  4FF3 A;  1A6X A;  4F4Z A;  2H5X A;  2FE3 A;  3FKI A;  5DQH A;  5C5J A;  2C28 A;  1EFW A;  2AUK A;  1AUX A;  1K83 B;  4RU9 A;  1TY0 A;  4R4C A;  3VR2 A;  4EG0 A;  1VQN A;  5KFY A;  4DR5 L;  4L5Q A;  1G2S A;  3RV3 A;  2WB1 G;  3EFX D;  4BY7 B;  4OX9 L;  5GON F;  1OXU A;  4BXX H;  1TWA B;  4DAP A;  1TVX A;  2A73 B;  1LT4 D;  5KFR A;  2G9H D;  3B6Y A;  5FLX W;  4Q43 A;  3JRX A;  5CA0 F;  1WD1 A;  1O7L A;  2AQ1 B;  4J9Q A;  5LYJ F;  3GTO B;  3FEW X;  1EQT A;  5CV5 A;  5I6Y A;  1DIK A;  4YWM A;  2XVS A;  2WAQ G;  1F2Y A;  1B3Q A;  3W2D A;  2V58 A;  3UDX A;  5D3I B;  4OL7 A;  2W7P A;  1Q1B A;  3G6E A;  1J9O A;  2PQE A;  4R4O A;  3A5U A;  3J81 i;  4HED A;  2EE1 A;  3E9H A;  1XYI A;  1K9M C;  2V5A A;  5IWA L;  2UUC Q;  3ER0 A;  5HGT A;  3HKZ A;  1VQJ A;  2MUY A;  3CCJ A;  1JE5 A;  3MA2 B;  1Y1W G;  3K5O A;  5BPH A;  3CW2 C;  2YL2 A;  1ESR A;  2JA9 A;  3W5O A;  2UU9 Q;  3M85 A;  4UCT A;  1DV2 A;  2AQ3 B;  1AN8 A;  1GUN A;  3K5L A;  5DLQ E;  4BA2 I;  3RLO A;  1FJG H;  4IR9 A;  1F2Z A;  3MEF A;  3I91 A;  5IT9 W;  4AYB B;  2R82 A;  4ABN A;  4DR6 H;  2K14 A;  1IBM L;  3S2H H;  2KSW A;  1W6K A;  1GLV A;  1WTP A;  3J7Z C;  2N49 A;  1HHV A;  3MWE A;  1Y1W H;  4EQP A;  4RB3 C;  2B2T A;  2AKW B;  4RAZ A;  1MKH A;  4DV5 L;  5EQ0 A;  2LSS A;  4C3I G;  3NQT A;  3CCE A;  4M1U B;  4DAY B;  4RWS C;  4DK0 A;  4RGO S;  3GTP B;  1KJ9 A;  2F0O A;  2E2H B;  2N3S A;  2YU9 A;  4CDE C;  1CKM A;  5C4X B;  1TWG B;  1U4R A;  5J3B A;  3L4J A;  2FJ2 A;  4C1N I;  1M4V A;  4ETS A;  3OSN A;  2R84 A;  1PZK D;  3UE1 A;  3I12 A;  3R2I A;  4HCS A;  2C22 A;  1RYR A;  4JI3 H;  5KT4 A;  3RMH A;  5I4D A;  1YNN D;  2NU9 B;  1VF5 C;  5KFP A;  3GTQ B;  4GNX B;  1L2Z A;  2A69 D;  4IJL A;  5IOC A;  1XNR Q;  2EYO A;  1IXR A;  3JAM i;  4GKK L;  4H02 A;  4RCN A;  5ELO A;  4OWT B;  2JE6 I;  1A63 A;  3T13 A;  1HA6 A;  4A3D G;  5KFI A;  4FXG C;  3G4S A;  4JI8 L;  4WJ3 M;  3LWB A;  3T1H H;  1QOH A;  2L15 A;  4EYI B;  3RAX A;  5LHY 1;  5DNF A;  1EY6 A;  4JBM A;  5FO7 B;  2RGV A;  2PNR C;  2ATW A;  5KFT A;  4ZLT F;  2WB1 B;  4A3D H;  3R5H A;  1GUO A;  1S0M A;  3VR3 A;  1HNW H;  1B3A A;  1S97 A;  4LFA H;  4HSP A;  4L1K A;  1QUQ B;  2NTT A;  5FD6 A;  4DL4 A;  1QNU A;  2EZV A;  4L8J A;  1Z47 A;  2XCP A;  1I6U A;  2PVP A;  3BDC A;  4A4I A;  4YR3 A;  3HB9 A;  5LMN H;  4R9W A;  3TQ1 A;  4AYB A;  4DUY H;  4YR0 A;  3HEJ A;  2WAQ B;  2O4X A;  4A3K G;  3S14 H;  2B3G A;  1EYZ A;  5EPK A;  4CDC C;  1KL9 A;  3LX0 A;  3N44 B;  4JBK A;  2RDJ A;  3PGZ A;  1AUV A;  1E1O A;  1Q82 C;  1YNJ C;  1TU2 B;  3EBE A;  1CS0 A;  3S2H B;  2WKD A;  3T1Y L;  4FNF A;  3HOU G;  4Y7N H;  2DWC A;  3J81 W;  1S03 G;  3EJI A;  1B6S A;  5C1O A;  1GVP A;  5IIF A;  1Y1W B;  1IBK Q;  2Z8L A;  3I7F A;  2VA3 A;  2K4K A;  1Q12 A;  2JXM B;  4DR7 L;  1Z2N X;  1Q46 A;  1T3N A;  4B3M H;  4A3K H;  4ZRZ A;  1QVF A;  3J7A 5;  1EYG A;  1PFS A;  1N48 A;  5A2Q L;  1QZH A;  1BGW A;  3NUC A;  2NVQ H;  4JV5 L;  1QNK A;  2G9D A;  1YI2 A;  4DV3 L;  5E1F A;  4JI0 H;  1UNN C;  1SNQ A;  1D2B A;  1MD2 D;  3A0J A;  4IUN A;  1SYG A;  3HOU H;  2NU7 B;  2D9U A;  3MR6 A;  3ONA B;  3FDS A;  1Q1E A;  1IOV A;  4KJO A;  3OTO H;  4QB4 A;  4R4I A;  3PW5 A;  3J7A V;  4RGN A;  3T4A C;  2RSO A;  3S17 H;  2BQR A;  4DR1 L;  3K80 C;  4LSA A;  2K28 A;  3DWA A;  1JIC A;  4IZ8 A;  5C3X A;  4XYL B;  2B2V C;  4HYK A;  2BR0 A;  1SYC A;  3C46 A;  3E3X A;  4LF8 Q;  3RIZ A;  4WJW A;  1VF7 A;  3UDF A;  2UVR A;  1NY4 A;  2DY8 A;  1I5F A;  4HAE A;  3C3L A;  1RJT A;  4KY7 A;  2FK2 A;  4A3C G;  4H44 C;  1QUQ A;  4CHT B;  5EWG A;  2ZJP A;  2IW3 A;  3I72 A;  2EXZ A;  1D1I A;  3L4K A;  2J4X A;  3ITP A;  1O7Z A;  2SDF A;  1I94 L;  1E1T A;  2IPK D;  2OWO A;  1BCP F;  3WOF A;  4F88 A;  1VQA A;  3RGX A;  2B2U C;  4A3D B;  3EYY A;  4JI4 H;  5KT3 A;  1SYB A;  3JAM W;  3SE7 A;  4UHV A;  4E4T A;  4LFB H;  3RZO H;  1EIY B;  1BVS A;  1MJC A;  1A0I A;  2YYA A;  3GTJ H;  5JUM A;  1BCP B;  2HIV A;  1NR4 A;  1JJG A;  3I3C A;  3Q8R B;  2W71 A;  1LT6 D;  1I4G A;  2AWN A;  1ULZ A;  3JSL A;  1TXY A;  1DOM A;  4GOP C;  3H3V H;  3S14 B;  5EZY F;  1HTL D;  4U6P A;  1CHQ D;  4RGM A;  4B3T L;  4FDB A;  3HGB A;  1R4P B;  4ED2 A;  1B9N A;  3RLF A;  2OEO A;  3OSO A;  3GID A;  4MAM A;  3RUZ A;  2PZT A;  4AH6 A;  4Y7N B;  2CHB D;  1MSG A;  4LF7 Q;  4KHP Q;  5L1I A;  5IYB G;  3BA8 A;  3SDZ A;  1CT1 D;  2MP1 A;  2F0L A;  3G6Y A;  5C8Y F;  2V4D A;  3MFG A;  3T5L A;  4JYA L;  2R93 A;  3Q2O A;  4K2K A;  3DM3 A;  4A3K B;  3GQB A;  5EPJ A;  2OQK A;  3SK5 A;  3PUY A;  1K1Q A;  2F0N A;  2NVQ B;  4Q45 A;  4RNM A;  4J9L A;  3VR5 A;  2ALY B;  3K5H A;  2W6O A;  1UUP A;  2LXK A;  5M3F H;  1PZJ D;  4O1N A;  3HOU B;  2NVY A;  5IYB H;  2HDL A;  1ET6 A;  1EEI D;  4MN3 A;  4DV6 L;  1IYU A;  1IHZ A;  1RD9 D;  5I2X A;  5IGC A;  1VMC A;  5CV4 A;  4X62 L;  3S17 B;  1M0T A;  4NXM Q;  4TV8 F;  1RDP D;  2VQE Q;  1V9P A;  1XMO L;  2DGY A;  2UUA L;  2W6Z A;  3TIG A;  2F0W A;  4DV2 L;  1EZ6 A;  2JN4 A;  4A93 G;  2P0A A;  1HR0 H;  5EBD A;  2VUM A;  4MTD A;  3HZX A;  2ALZ A;  1G29 1;  1BXT A;  1Q86 C;  2VXW A;  1E0B A;  5KT5 A;  4YY3 Q;  3RD4 A;  2CWP A;  4KKU A;  2WDT A;  1YNJ D;  3ORR A;  3D8G A;  4HJA A;  2QEJ C;  4IPC A;  1YNX A;  4ZHQ F;  1E4E B;  3J7A K;  3RR5 A;  1X55 A;  2LS0 1;  1PH9 A;  4AQY Q;  3SXH A;  5C4H A;  2PPB C;  4JI6 H;  4X6A H;  3RZO B;  4A93 H;  3DF7 A;  4J8Q A;  4LF4 L;  2R61 A;  2NB0 A;  3GTJ B;  4PDB A;  3QJY A;  3BU2 A;  4DK6 C;  5KGU A;  5KIX A;  4EYH B;  1SR3 A;  1EFI D;  4RGT A;  4GN4 B;  5IOD A;  1KDB A;  5C1P A;  4A3L H;  4RG1 A;  2CVR A;  4RCO A;  4K0K L;  3CCQ A;  2JJQ A;  4B3S Q;  4RFB A;  1WTW A;  1C30 A;  3U4Z A;  4P72 A;  2IWH A;  4QWD A;  2PN1 A;  4DR5 Q;  2K5N A;  4G57 A;  4UCR A;  1LTB D;  4OX9 Q;  3T53 B;  5KFU A;  1EUD B;  4O3O A;  2F0E A;  3K7A H;  1N34 Q;  2D62 A;  5KFS A;  2DIK A;  4X64 L;  4DFA A;  2UUC L;  4XYQ A;  2B63 G;  2HQE A;  1A8V A;  1EY5 A;  5KYI A;  5FLX c;  2RDH A;  2A1A A;  1SJE D;  1UEB A;  1I50 H;  1LTS D;  1BBW A;  4DXG A;  2R7K A;  2VY3 A;  4YJ2 F;  2UU9 L;  3RTX A;  5M3F B;  1GOZ A;  3D4D A;  3STB C;  2AGO A;  5JPM C;  3T5J A;  2QDL A;  4HR7 B;  5IWA Q;  4F50 A;  1E2V A;  2LMC B;  3NWS A;  1BNZ A;  5CAE B;  3C0F B;  1IOW A;  1KJJ A;  4I7H A;  2FHT A;  2B63 H;  1W3S A;  4DV0 Q;  3A54 A;  3FP9 A;  3IAY A;  2B2V A;  2R92 G;  1E22 A;  2AQ4 A;  5IGB A;  1C48 A;  1BQQ T;  2OLS A;  4YJ3 F;  4B3R H;  5F2D A;  4ECZ A;  5LOV F;  1Q90 A;  1E4E A;  3PO2 G;  4TUY F;  2F4I A;  5FJ8 H;  4F7X A;  1RYS A;  3EVQ A;  1IBM Q;  1Y8O B;  1F9S A;  2DNE A;  1JKJ B;  3E6Z X;  4JCV E;  1WH2 A;  4DKA C;  2I5L X;  2F0T A;  4N9T A;  1EY7 A;  1SE8 A;  2X6L A;  1IYJ B;  5C44 G;  4DV5 Q;  2B2U A;  1AZQ A;  1HNX H;  4R4T A;  2IHE A;  2R92 H;  3ERQ A;  1XNR L;  2EY5 A;  3HOY H;  1CKN B;  1NR2 A;  1AH9 A;  1R9T H;  4A93 B;  3QZ7 A;  3R5X A;  2YCH A;  2PZW A;  3SK4 A;  5KFE A;  3ETH A;  4X3T A;  2MQH A;  2PYK A;  2F0I A;  1X65 A;  3I4O A;  1C8C A;  2I8C A;  4IUT A;  4GOP A;  3GII A;  4N8F A;  1EWC A;  2KEN A;  1TS3 A;  2F0K A;  3I56 A;  2FJZ A;  1KC7 A;  2K7V A;  4ED7 A;  5ISR A;  2GN5 A;  2BA0 A;  4GKK Q;  1GSA A;  1WD0 A;  1J5E Q;  1NMG A;  4XX0 B;  1V1Q A;  2NUC A;  3PIO A;  2XWB B;  3K7A B;  3TN2 A;  3VYU A;  4PV1 C;  4KK7 A;  3PQI A;  4JC0 A;  1M1K C;  5KX5 F;  1TY2 A;  2B2Y C;  4ZUJ A;  2K01 A;  2WYO A;  3PW0 A;  4FU0 A;  4PG3 A;  1JXL A;  4OXP A;  4C2M H;  1H9S A;  5JVG 3;  3JSN A;  2VB3 X;  3U50 C;  2A5H A;  1NMF A;  1PRT C;  5G3L F;  2R87 A;  2J6U A;  5BN3 A;  1I50 B;  3TZD A;  2OH2 A;  4YIJ A;  2XIG A;  3U58 A;  4ILW A;  2R8G A;  3HS0 C;  3A8J E;  3DWP A;  4K6D A;  3J80 E;  1IBL H;  1AW7 A;  2UXC Q;  3MXG A;  1PYB A;  5ELD A;  5KFC A;  5C0X I;  2JQO A;  3OW7 A;  1N33 Q;  1EYC A;  3M7G A;  2B63 B;  2RHQ B;  4Q0F A;  1JWM D;  4FYD A;  2VW9 A;  1ZKO A;  4UP7 A;  1VQD A;  4DR4 H;  5ELC A;  2VZA A;  2M2L A;  2NVT H;  1BDO A;  4BBR G;  1HH2 P;  5IYC G;  2R7Z A;  4DAM A;  1OTC A;  3OHX C;  1SEB D;  4APV A;  1HTP A;  5KNB A;  2KHS A;  4HJ8 A;  1STE A;  4BBS G;  5COY A;  3T1Y Q;  5J2U F;  5FKA C;  2DPJ A;  2DN8 A;  4C3J G;  2CQY A;  3EN2 A;  5JJL A;  4O0A A;  2W57 A;  2YV5 A;  2YTX A;  4DR7 Q;  3V2T A;  3S1R H;  2XNA C;  1C4Q A;  3J81 c;  1JX4 A;  3QOL A;  4POF A;  1EIF A;  3MWY W;  2JK8 A;  4DXF A;  2R92 B;  1HNZ H;  1HJP A;  2BA1 A;  1IW7 C;  3HOY B;  2SCU B;  4RZR A;  1R9T B;  5M9O A;  1L1O B;  1N56 A;  5IYC H;  3M9O B;  4DAV A;  2PCF B;  4V19 0;  3T5H A;  1FGU A;  2DZD A;  3JC6 6;  3HOV G;  3A55 A;  4XXE A;  1WI5 A;  4C3J H;  5KNC A;  3TDQ A;  1NBW A;  1HZA A;  4BWG B;  3BQ2 A;  5D8D A;  1JLL B;  4UCO A;  2WB1 E;  2HVS A;  1F9Q A;  2ZM6 Q;  2CFM A;  3AFQ A;  3RB0 A;  4H13 C;  4JVZ A;  3STB D;  2VPQ A;  2FFK B;  1EU3 A;  3SVM A;  1EHI A;  3H4D A;  3K7U C;  4IUU A;  2PZU A;  5C6A A;  2J6S A;  3KF8 A;  1RL2 A;  4MV4 A;  1LM0 A;  4HNU A;  1ZHQ A;  2K5D A;  2B2T C;  2IX1 A;  5I47 A;  4DUZ H;  2KBN A;  1STB A;  4E6I A;  2MCT A;  5KEE A;  2WAQ E;  2AU0 A;  5KFB A;  4CJ2 C;  4DR2 H;  3NPP A;  4UDU C;  4J0M A;  3CPW A;  4C2M B;  1II3 A;  1CZW A;  2ZTD A;  4WOR A;  2K50 A;  4NXN L;  1OXS C;  1PK8 A;  1EEF D;  1RTO A;  2NBF A;  3TRE A;  1GYF A;  2JA8 H;  4APM A;  3KOJ A;  2HHH H;  1JWS D;  2GPS A;  3M9N B;  3OIP A;  1OO9 B;  4POG A;  2NZH A;  4R7R A;  5A2Q W;  5KFF A;  5E4W C;  1VQB A;  3JAM c;  1EL0 A;  1FR3 A;  4LF7 L;  4KHP L;  3H4B A;  4GLX A;  1JJ2 A;  3RB3 A;  2UVV A;  2K52 A;  3R2T A;  3D4W A;  5CV6 A;  2Z9H A;  2NVT B;  4JUZ A;  4B3T Q;  1ZHS A;  5DLG A;  1SNM A;  1EU4 A;  3F2U A;  4DR3 Q;  3U9T A;  1HFN A;  4ALP A;  3OYY A;  3VR4 A;  4O3P A;  4KJN A;  1PFN A;  4GKJ Q;  3PR5 B;  2WV6 D;  4MIU A;  4P73 A;  4LUV A;  2WKC A;  5EBC A;  2F03 A;  3S1R B;  4ECT A;  4KN4 C;  3MXN A;  3H0G A;  3FMC A;  1O78 A;  1PYS B;  3Q0A A;  3Q22 A;  1M90 C;  4IR1 A;  4BBR B;  4DV1 Q;  4LH6 A;  4O42 A;  2VQE L;  5LA6 F;  3I8Z A;  1PRT D;  3ULJ A;  4HNT A;  3VPB A;  4TQS A;  3EA6 A;  4DF7 A;  4C3J B;  2C00 A;  4XT1 B;  4C3H G;  2Y0S G;  2Q8R E;  5M5W H;  2MO1 A;  2ZJQ A;  5ELB A;  2K75 A;  4DV6 Q;  2M9V A;  4PQX A;  2ICI A;  2RHS B;  3MAQ A;  2FK1 A;  3PW4 A;  3A56 A;  3PUV A;  5D1O A;  1WCM A;  1SAP A;  1LT5 D;  1HZC A;  2KVM A;  1XMO Q;  2UUA Q;  4FVM A;  1LTR D;  2KCM A;  3K59 A;  1XDN A;  4AQY L;  4JI2 L;  2B2Y A;  1SMX A;  2BQU A;  4A2A A;  1Y8N B;  4PWQ A;  2RA4 A;  1TWC H;  4BWS C;  4GNX C;  1TS2 A;  5TSS A;  3KBG A;  4C5A A;  3BYY B;  3G71 A;  4IUV A;  5T14 A;  3WO1 A;  2L12 A;  1N8R C;  5H80 A;  2W70 A;  1FNU A;  1K8A C;  4DNI A;  2RDI A;  3RBD A;  1LO5 D;  3KHL A;  3K81 C;  1JOR A;  4KY6 A;  3S24 A;  3WWV A;  3GTQ H;  2JA8 B;  2EJM A;  4B3S L;  4ECY A;  4JI8 H;  3NEL A;  5ELE A;  3PW2 A;  5HUR A;  1DXM A;  1LT3 D;  4X66 L;  4O4H F;  4LF4 Q;  2GVA A;  3OPO A;  5FLX E;  4ECR A;  4UFZ A;  3PVX A;  1NJI C;  2RBM A;  3UE0 A;  3HOX H;  4HJ7 A;  4GLV B;  1IW7 D;  1BUV T;  1N34 L;  2IX3 A;  4IPD A;  4IPG A;  2JSO A;  5JPN C;  1K28 A;  5CBA E;  2GLT A;  2EY2 A;  1WR2 A;  1AZP A;  3MFY A;  4K0K Q;  2OTL A;  3KDF A;  4RH6 A;  1UWV A;  3CCL A;  1LAB A;  3QO2 A;  2HT1 A;  3GIM A;  3F2C A;  3FMA A;  5GRO A;  1VQ5 A;  1MGS A;  1ROD A;  1SFO H;  1P16 A;  4HSV A;  3W1B A;  4EGV A;  5BN5 A;  2RCF A;  1PTO H;  4IN3 A;  2D5D A;  3PN1 A;  1BR9 A;  4X64 Q;  2RDF A;  3I4N G;  1X9N A;  5KFG A;  5D14 A;  4K8J A;  1QIL A;  3GTM H;  3VMM A;  4ECQ A;  3H20 A;  4XYO A;  4DV0 L;  1G6P A;  3MXP A;  3IFD A;  1OXV A;  1E4F T;  5BR8 H;  2VPS A;  3DEO A;  4DV4 H;  3L0O A;  1AEX A;  2XGT A;  4LUZ A;  5IT9 E;  1U4P A;  2FPG B;  4J9K A;  4RB0 A;  5LMU H;  2NVX H;  3ULP A;  5M5W B;  1SND A;  3KHG A;  4ME6 A;  3RUP A;  4YCW A;  4JI5 H;  2W9B A;  1MI2 A;  3I4N H;  4LF9 L;  4K14 A;  5F9L A;  3AMU A;  4AIM A;  2XIW A;  4LH7 A;  1SJH D;  2EVB A;  4JV5 H;  1RKN A;  1M6V A;  4ECW A;  4DV3 H;  1XMQ L;  3KF6 A;  2BQ3 A;  2UVW A;  3HOZ G;  4JI7 H;  2UXB H;  4R8I A;  1TR5 A;  3KJP A;  4L5R C;  4FF2 A;  2CH4 A;  2ASL A;  3OWF A;  4KD3 A;  1K83 A;  3HBL A;  1TWC B;  4Z9C B;  2JA6 G;  2Y0S B;  1GUW A;  4IUQ A;  1EYD A;  3DEP A;  2V4Q A;  3PW7 A;  1Y69 U;  4X65 L;  1TWA A;  4DV7 Q;  1KDA A;  3NGD A;  4L63 B;  1JR0 D;  5KG7 A;  1KAB A;  1ENA A;  2F3I A;  1S72 A;  3HOZ H;  3GTO A;  4DL6 A;  4C3I H;  2ASB A;  3M3Y H;  1B33 N;  1GGO A;  2K04 A;  2VQF Q;  3HOX B;  3RB6 A;  2JA6 H;  3J80 L;  3OHA A;  2H4O A;  2P5Z X;  1PH8 A;  1I94 H;  1SSO A;  1S40 A;  1V4Y A;  4IFD I;  3M4I A;  3RF2 A;  1PTO F;  1LAC A;  3GQC A;  2JA7 G;  3AU7 A;  2I07 B;  1BCP C;  2QA4 A;  1SFO B;  3HP3 A;  3F2D A;  1PH6 A;  4YHH H;  1KJI A;  5JVL A;  3TQY A;  1PTO B;  4HJ5 A;  5M5Y H;  1ILP A;  5C3W A;  5KFO A;  4HIM A;  2F52 A;  1XX8 A;  2UXC L;  3D6C A;  3UFX B;  2JA5 G;  3GTM B;  1N33 L;  1Y1V G;  2LY7 A;  3QIA A;  2DY7 A;  1EY9 A;  2JP1 A;  1PFM A;  2YYZ A;  2L5T A;  1GO3 E;  2JA7 H;  1HCZ A;  2WFW A;  4QW8 A;  1UE5 A;  1AFP A;  1N32 H;  1KHI A;  5C5L A;  4YAJ B;  1JOO A;  3J81 E;  2NVX B;  1Z9F A;  3VA5 A;  1MJE A;  4DAY A;  3GTP A;  2ZXO A;  2J9G A;  3Q8Q B;  3HRZ C;  4JYA H;  3FPU B;  3I4N B;  1CA5 A;  4HMJ A;  2C2E A;  2E2H A;  1EOV A;  1FVI A;  4ZK9 B;  1VQ7 A;  3G6J B;  1TWG A;  5C0X G;  2K6A A;  1WJJ A;  3K8A A;  1A3T A;  3MWM A;  4I55 F;  2I46 A;  1KLU D;  2ZDG A;  3GTG H;  2K5W A;  2QW7 A;  4QIW B;  5JVH 3;  3S1Q H;  3A7L A;  1TWH H;  4U7C A;  3TEH B;  4JBW A;  4GNX A;  2L55 A;  3GTQ A;  1R4Q B;  3CVZ A;  2RF4 A;  5IY0 A;  3H09 A;  3GTK H;  4DL2 A;  3P7J A;  4J9N A;  2NN6 I;  4XTC S;  4IWX A;  5KYL A;  4X62 H;  1Z2O X;  3VYR A;  3GIP A;  4C5B A;  2XGP A;  4N8X 1;  4JI1 H;  4NPS A;  3TP5 A;  2J0T D;  2ZM6 L;  4DV2 H;  2HVQ A;  1FJG L;  4JPB W;  3HOZ B;  2RVL A;  4DR6 L;  4C3I B;  4I4T F;  3M3Y B;  4Q44 A;  1NAP A;  1STN A;  2DJF C;  3MC0 B;  1EZ1 A;  4GS3 A;  5EGT A;  3ULL A;  2JA6 B;  4A3M G;  4Q8F A;  4UCS A;  4Y8V B;  2WB1 A;  4QGU A;  1XPU A;  4PZ6 A;  3U9O A;  1JJC B;  4RB1 A;  1Z6H A;  5JJI A;  3GV6 A;  3GTM A;  4OON A;  1E7Z A;  4ZQ3 A;  1EUJ A;  2PMZ E;  4ECV A;  2MO0 A;  3JAM E;  1DGS A;  2EDG A;  5CV9 A;  2VL6 A;  3BDL A;  4JI3 L;  4ME3 A;  2WAQ A;  1D5Z C;  3HG9 A;  4RHR A;  4JV2 A;  2O5I C;  5M5Y B;  4PZ8 A;  3PUZ A;  3H3V C;  1H95 A;  1HUN A;  3PO3 G;  5J2T F;  2R7N A;  4YCU A;  4NXN Q;  3BVZ A;  4A3C H;  3NBI A;  4PMB A;  1F9P A;  1N36 H;  1HRJ A;  2KUM A;  2JA7 B;  4WRD A;  3BAA A;  1Y1W A;  1KTK A;  2QIL A;  2FK3 A;  3FRP B;  2XSC A;  4QWE A;  2GA4 B;  4F4Y A;  2UUC H;  1D6E C;  4DR3 L;  2R7M A;  1VQF A;  3Q23 A;  1KRT A;  3OOC A;  3BJU A;  1ASY A;  2ASJ A;  2R8H A;  2L1B A;  4GKJ L;  4ZQI A;  4UP8 A;  4C1N K;  1VQK A;  1PVO A;  1NNX A;  1Q7Y C;  1HNW L;  2UXD Q;  2UU9 H;  3GTG B;  2QGQ A;  3S1Q B;  4KHZ A;  1TWH B;  2EPB A;  4KLK A;  3F2B A;  5C3E G;  4RKL A;  3S16 H;  4DV1 L;  3GTK B;  1JOK A;  1V8Q A;  4HTH A;  4XT3 B;  5DAU A;  1QE6 A;  2PW5 A;  5DQG A;  2QDB A;  1BCP D;  3E5S A;  4DN4 M;  5EWF A;  2CCZ A;  1GXD C;  1X3Q A;  2BDN A;  3DWQ A;  4EX5 A;  2Z0S A;  2W6P A;  2C9O A;  2WTF A;  1UC8 A;  4IAL A;  3NHH A;  2B29 A;  5C3E H;  4OO1 I;  1BBX C;  1BNC A;  3OUU A;  1SNO A;  2D0O A;  4LMY A;  5KKN B;  3CC2 A;  4QCL A;  3NK9 A;  1STH A;  2A68 C;  5DM7 3;  2ID0 A;  1XNR H;  1RIP A;  1S5B D;  2PQA B;  2PI2 E;  1FKA H;  2KOL A;  4JI0 L;  1EWI A;  3FVQ A;  3N41 B;  1JWU D;  4JOI C;  1X56 A;  2I5M X;  3DM1 A;  4NP5 A;  3ETJ A;  4A3E G;  4JI2 Q;  5CBE E;  1ZYR C;  3M9M B;  4EBE A;  2VA2 A;  3OTO L;  2M00 A;  4ODG A;  1VQ4 A;  2QEX A;  3VR6 A;  1ESF A;  4IO9 A;  1S5F D;  1BO0 A;  1NE3 A;  2VR1 A;  3H40 A;  4IUP A;  1IZ6 A;  2UUB Q;  1GJX A;  4XQJ A;  2B2W C;  3NWT A;  4IJH A;  3MHB A;  1MBY A;  4OHJ A;  1T5E A;  3T56 B;  5AJ3 Q;  1G51 A;  1SXT A;  2R8I A;  1C9O A;  1NSN S;  3NP8 A;  4J9P A;  1CTM A;  3G8C A;  3BVM A;  3V6J A;  2CW0 C;  3GIL A;  1PH4 A;  3I4M G;  3RN5 A;  2SNS A;  4X66 Q;  5J22 A;  2ZJT A;  4MHE A;  1EYA A;  1TWH A;  1CQI B;  3L7Z C;  3UQ8 A;  5IT9 L;  3PIO 3;  4A3G G;  3V4S A;  2TSS A;  4CC5 A;  3K3V A;  2HDM A;  3GTK A;  2QYZ A;  2F0V A;  4XDX A;  1PV4 A;  5KT2 A;  3PR4 A;  1JE4 A;  4IRC A;  4JI4 L;  2F0D A;  5D1P A;  5C5M A;  5KT6 A;  5L9X A;  4ED8 A;  1M8A A;  1VQL A;  2HQL A;  4MTK A;  2A19 A;  2W6N A;  4N9P A;  3K58 A;  3S16 B;  1XNQ Q;  1CQV A;  1PH5 A;  5IYZ F;  1KLG D;  5FD5 A;  1O7Y A;  2VUG A;  4LFC Q;  4DU9 A;  2K5H A;  5I9O A;  4QWA A;  5KFD A;  1IBK H;  1PFB A;  4EQO A;  2RSN A;  4IPH A;  1CK1 A;  4YWK A;  3PMF A;  2ES2 A;  1RJR A;  1RJP A;  2FP4 B;  3CF5 A;  2F4V Q;  1S5E D;  4LF5 H;  1UAP A;  1RHP A;  3FPP A;  1F77 A;  5JJK A;  3MTS A;  2CQA A;  3JZI A;  4LAA A;  4Q8E A;  5IGG A;  3QOJ A;  1WTR A;  4KTA A;  5C3E B;  4TSS A;  4UY8 C;  4UCV A;  4FBT A;  2X69 A;  3D31 A;  1ICW A;  4J6H A;  3RV4 A;  4LF9 Q;  4A3J G;  3GV7 B;  1P8L A;  1CM9 A;  1SYE A;  4PMW A;  3MR5 A;  1K1S A;  4ED1 A;  3GTJ A;  5CA1 F;  1L1O C;  5CB4 F;  4DV7 L;  3RFC A;  1XMQ Q;  3GO5 A;  1YZ6 A;  2E76 C;  5LL6 S;  1X3G A;  3WDN A;  4DA2 A;  2OTJ A;  4LF8 H;  4QF4 A;  1YEZ A;  3K0X A;  3PO2 H;  5L1K A;  2E5L Q;  2VQF L;  3TSS A;  2A74 C;  1H9J A;  4X65 Q;  1S3O A;  1HR0 L;  2BH2 A;  4MV9 A;  4RHS A;  1SNP A;  3GDE A;  4LF6 Q;  2WIN B;  5C44 H;  1VBG A;  1M7J A;  1W6J A;  1VQ8 A;  2ASD A;  1I6V C;  3BZC A;  5M3M G;  4R8N A;  1QWY A;  4I7Z C;  4O3S A;  2E8G A;  5K36 G;  4JG2 A;  2XTI A;  5KG6 A;  2F0M A;  3ORQ A;  1KEE A;  1JQY D;  1KRS A;  3J81 L;  4EGQ A;  2WAC A;  1SBB B;  1VCI A;  4CBV A;  3Q24 A;  2Q8I B;  3J7Y W;  1RF2 D;  2E2I H;  1B1Z A;  2I0Q A;  2V4R A;  4EQ5 A;  4JI6 L;  4RKB A;  4A3F G;  4HR7 A;  5CMD A;  4HQ6 A;  4RAY A;  4QJF A;  1D5M C;  2A68 D;  3QB3 A;  1AP0 A;  2J7Z A;  5IGD A;  4P74 A;  5M3M H;  4LF7 H;  4KHP H;  1TWF H;  3A5Z B;  3BDO A;  5I9P A;  5JJZ A;  2L11 A;  3UDI A;  3RBE A;  1PXU A;  2PMZ B;  3PUW A;  5FOB B;  2F0Q A;  1VAJ A;  5LL6 X;  4IOA A;  1ZYR D;  4OWW B;  3PF5 A;  1E3P A;  3FKI G;  3M4Q A;  1YIJ A;  4A3F H;  1S68 A;  3G6V A;  2R7L A;  4ZOL F;  2EIF A;  2Y0S E;  2A6E C;  2A6H C;  1HQM C;  3TS2 A;  4JK1 C;  2W9C B;  4NMZ A;  2KED A;  2H1E A;  2OCE A;  1U4M A;  5CC4 A;  4FXD A;  4QWC A;  1O75 A;  1CKN A;  2L0C A;  4HID A;  4ZCK A;  4IAJ A;  2CW0 D;  2XCL A;  5I2Y A;  4JOI A;  4NXM H;  4G7H C;  1QVC A;  2VQE H;  4BS9 A;  3HFZ B;  4O4I F;  2PNH A;  1VQI A;  3N8D A;  2Q8T A;  3K57 A;  5C0X J;  2O2L D;  4A75 A;  1WVL A;  2ENB A;  3K3P A;  2MHV A;  4BBR H;  3PO2 B;  2B8F A;  3I4L A;  1DYQ A;  3G6X A;  1XPO A;  5G3L D;  2R86 A;  2B2W A;  3TZU A;  4BBS H;  4ME5 A;  2RCN A;  4YY3 H;  3HKZ G;  1ZET A;  1B70 B;  1LTG D;  2NN6 G;  1B04 A;  5KG3 A;  1D1K A;  3MR2 A;  3GV8 B;  4FO2 A;  4XQN A;  1KDC A;  1I4H A;  3A7A B;  3CMA A;  1FJG Q;  4EFE A;  5C44 B;  1A3V A;  4CGY B;  4DR6 Q;  3S15 H;  2Q2T A;  1JB7 A;  1KJ8 A;  3ND9 A;  1VQO A;  1I50 A;  1A2U A;  3K6O A;  4IHJ F;  5CV8 A;  2EJF C;  1PX2 A;  3RN2 A;  4JI7 Q;  3MWD A;  3HOV H;  2E2I B;  1QCB D;  3QG1 A;  1DM0 B;  4OIJ A;  4ZYS A;  1EIH A;  4B3S H;  3BA9 A;  3BAB A;  4R8U B;  2NN6 H;  1LTI D;  4UCU A;  4TKO B;  2R6G A;  3OWE B;  4QMG A;  2PMZ A;  1K8O A;  4DR5 H;  5HGQ A;  1YJW A;  2EY6 A;  2B63 A;  3GIQ A;  1STY A;  4IQZ A;  4OX9 H;  2N88 A;  4DNR B;  1KNA A;  3GIJ A;  5M3M B;  4PNY A;  5E7N A;  4JI3 Q;  1N34 H;  1TWF B;  3QWN A;  3A8K E;  5A2Q E;  4K5X A;  1I7N A;  4X3S A;  3C2P A;  3NBH B;  2M05 A;  4DL7 A;  1DCZ A;  4HMI A;  4QIW E;  5KFL A;  4M9U A;  4DPG A;  2O03 A;  3P75 A;  3GV5 B;  1GD7 A;  4A3F B;  1L0Y B;  1S5C D;  2ZJR A;  2FMC A;  3GTL H;  2UXD L;  2PW7 A;  3T1H Q;  4NW2 A;  4JV1 A;  1CFM A;  1F9R A;  1UE6 A;  2BDO A;  3NXW A;  1KJQ A;  5IWA H;  2IL8 A;  1EZ8 A;  2R92 A;  2YU9 H;  4MV6 A;  3ERS X;  3PIP A;  3QR8 A;  1R9T A;  3J81 j;  1KIX A;  5EWE A;  2V59 A;  1L1O A;  3J7A F;  3CQZ H;  1GHK A;  1MZB A;  5HV6 A;  3JRW A;  5KFH A;  1HNW Q;  3KFU A;  4MTE A;  1ONL A;  4F4X A;  4LFA Q;  1IBL L;  2ICE C;  5KT7 A;  2R8K A;  1VS0 A;  2W9A A;  5LMN Q;  1IBM H;  4DUY Q;  1YJN A;  4JV0 A;  1QJO A;  1VQC A;  2KCT A;  5GAD C;  2KCN A;  2XGQ A;  4BBS B;  5L1L A;  3VPC A;  3V6K A;  1KAA A;  4FS1 A;  1V1P B;  3ERO A;  3NTI A;  1L2F A;  3KAJ A;  1A2T A;  1SE3 A;  2BE5 C;  2W6M A;  4DV5 H;  4FXK C;  4AYB G;  5KG1 A;  4IZO A;  4YBZ B;  1O80 A;  2DPI A;  1TQO A;  1SCU B;  4L5S A;  3ZJY C;  2VS1 A;  4C2M A;  2FLL A;  1LTL A;  3S15 B;  1VQG A;  1FNW A;  3KTM A;  4RNN A;  1MIU A;  4ECU A;  3PSI A;  2K32 A;  4HN7 A;  1SMY C;  4OO1 G;  3I70 A;  4FM9 A;  1ZEQ X;  2A6E D;  1V43 A;  2KCC A;  1WTH A;  1X3F A;  1N9W A;  2A6H D;  3HKZ B;  1BF4 A;  1HNZ L;  4B3M Q;  3HOV B;  4O3Q A;  4C3H H;  5JEA J;  3D0F A;  4G3I A;  3SK8 A;  1S9F A;  2PI2 A;  5JOB A;  4KI0 A;  1A62 A;  2RGR A;  1EQR A;  4GKK H;  2UUB L;  1J5E L;  1BBU A;  5KFZ A;  5F9N A;  4JI0 Q;  5AJ3 L;  4J9O A;  4QQB X;  5DGA A;  3H6M A;  5KG2 A;  3OTO Q;  1PH2 A;  3X3M A;  5D3D A;  2E74 C;  3BZK A;  3N43 B;  1HUM A;  5DM6 3;  1DD2 A;  3EQL C;  1XWE A;  3CRK C;  3GD7 A;  1K0R A;  4BA1 I;  1OXT A;  1HPC A;  4O3N A;  5DG8 A;  2FIN B;  5BPF A;  5H1S E;  1HFG A;  1ZQ7 A;  3UDG A;  3GTL B;  4DUZ L;  3FHW A;  1SLJ A;  4DL3 A;  2VOB A;  1PTO C;  1SYX B;  5EAY A;  4DR2 L;  5BMV F;  4B08 A;  3Q8P B;  2UXC H;  1XNQ L;  2YU9 B;  4MA0 A;  2NU6 B;  2W8L A;  2KQ3 A;  2BCO A;  2XN9 C;  2QF7 A;  1N33 H;  5FK9 C;  4CC6 A;  4NKL A;  2XC9 A;  1PA6 A;  4LFC L;  3CQZ B;  4O2B F;  2EYP A;  3D3R A;  2Z4I A;  3VYT A;  3AEV A;  4I7A A;  4JI4 Q;  4F4W A;  1GHJ A;  2HHH L;  2JYO A;  2F4V L;  3R23 A;  1KD1 C;  2YZM A;  2G5D A;  1V1P A;  4P71 A;  5IP7 G;  4LFB Q;  4K5W A;  1I4P A;  3C1E A;  1PMR A;  1E2W A;  1O7I A;  5GAG C;  1B2T A;  1TS5 A;  3OSP A;  1LTT D;  2IT1 A;  4K5V A;  2D0P A;  5EPL A;  1Y14 B;  5FLM G;  5IGF A;  3T1Y H;  5KFJ A;  1X54 A;  1N36 Q;  5DLF A;  1NUC A;  1GUT A;  3CC7 A;  2PBZ A;  1DJR D;  4DR7 H;  3TS0 A;  2EQS A;  1VQP A;  1FYC A;  4H7B A;  1SRU A;  4ED0 A;  2F3W A;  4F87 A;  5IP7 H;  2F0P A;  3I55 A;  1QZG A;  5NUC A;  2HIX A;  2YZG A;  1A9X A;  3IN5 A;  3N6R A;  4RA8 A;  5ELN A;  5FLM H;  2EYM A;  2YTY A;  2Q2U A;  1UC9 A;  1DV1 A;  4C5C A;  1VQ9 A;  1WSC A;  2JEB I;  1B7Y B;  1CSQ A;  2ZM6 H;  3AFP A;  4C3H B;  2E5L L;  1K8G A;  2I87 A;  4YWL A;  5C4Z A;  2WII B;  1KAW A;  3FDT A;  4DR1 H;  2R93 G;  3P1H A;  2EXD A;  5KG0 A;  1EOT A;  2C5C A;  3ND8 A;  1ASZ A;  3BG3 A;  4LF6 L;  1S0O A;  1FNV A;  1I4X A;  3NTH A;  1CE8 A;  2IMW P;  3GTL A;  2W8K A;  1SYF A;  2ZTC A;  2HD3 A;  2ZXP A;  4A2B A;  4ULL A;  2R8J A;  3M4P A;  4L5T A; 
#chains in the Genus database with same CATH homology
 4LW1 A;  2QGQ A;  3PCO B;  3GTO H;  4KHZ A;  2MQH A;  2N78 A;  4KLK A;  3F2B A;  1WOC A;  2ZTE A;  1X65 A;  3I4O A;  5C3E G;  3S16 H;  4LWC A;  1HR0 Q;  4GOP A;  4DV1 L;  3CD6 A;  2KEN A;  3I56 A;  2R93 H;  1SN8 A;  4A76 A;  3LGJ A;  4DR4 L;  2GN5 A;  3RLN A;  2BA0 A;  1XPR A;  4GKK Q;  1N32 Q;  1NMG A;  1X3E A;  2VUM G;  3KDF B;  4R4Q A;  1V1Q A;  4O2D A;  2CCZ A;  3PIO A;  2LXJ A;  4EX5 A;  2NVY H;  4JYA Q;  3KLW A;  2Z0S A;  4JC0 A;  1M1K C;  4R1J A;  1WFQ A;  4JI6 Q;  2B29 A;  5C3E H;  2N8N A;  4OO1 I;  4NXM L;  4PG3 A;  4OXP A;  4HJ9 A;  4C2M H;  3KJO A;  3U50 C;  2D0O A;  3CCU A;  1NMF A;  3CC2 A;  4DK3 C;  1K73 C;  5C4X G;  1U5K A;  2ID0 A;  4J15 A;  3U58 A;  1PH7 A;  2VUM H;  1RIP A;  1T9H A;  2PQA B;  3HKS A;  2PI2 E;  4IFD J;  4YY3 L;  4JI0 L;  1EWI A;  5GAH C;  1C0A A;  4X62 Q;  4JOI C;  2UXC Q;  1X56 A;  1PYB A;  1LYL A;  2I5M X;  5C0X I;  2JQO A;  4A3E G;  2JA5 H;  1N33 Q;  3S2D H;  4RMF A;  4JI1 Q;  4JI2 Q;  2RHQ B;  4DV2 Q;  1Y1V H;  4LNQ A;  3OTO L;  3GTP H;  5LMN W;  1VQ4 A;  2QEX A;  4IO9 A;  3HOX G;  2VW9 A;  2CKZ B;  4BXX G;  2E2H H;  1HR0 W;  1NE3 A;  5C4X H;  4UP7 A;  1TWG H;  1VQD A;  2VZA A;  1IZ6 A;  2NVT H;  2UUB Q;  1J5E Q;  4IJH A;  4BBR G;  1HH2 P;  5IYC G;  2Q2H A;  5AJ3 Q;  4DAM A;  1G51 A;  4QL5 A;  3KF6 B;  1OTC A;  2VNU D;  1C9O A;  4APV A;  4HJ8 A;  2H5X A;  5IYD G;  4BBS G;  3T1Y Q;  1EFW A;  5BR8 L;  4DV4 L;  1PH4 A;  1UE1 A;  4GN5 A;  3EN2 A;  4R4C A;  5M5X H;  3RN5 A;  4X66 Q;  3I4M G;  4O0A A;  5JJL A;  1VQN A;  2YV5 A;  2YTX A;  4DR5 L;  4DR7 Q;  4L5Q A;  3L7Z C;  3S1R H;  3CCM A;  2AMC B;  2WB1 G;  3J81 c;  5LMU L;  4POF A;  1EIF A;  2JK8 A;  1OXU A;  3J80 c;  2BH8 A;  3L2P A;  4OX9 L;  1HJP A;  4JI5 L;  2BA1 A;  4BXX H;  3CCR A;  3B6Y A;  1PV4 A;  4LF5 Q;  4JI4 L;  1L1O B;  3KYH C;  5IYC H;  4GKK L;  1VQL A;  5IYD H;  1PHJ A;  2HQL A;  1FGU A;  2A19 A;  1VQK A;  3JC6 6;  4YWM A;  4JI7 L;  2JEA I;  3HOV G;  2WAQ G;  4B3R Q;  1WI5 A;  4C3J H;  1PH5 A;  1XNQ Q;  1NBW A;  1HZA A;  3UDX A;  1CSP A;  1EQQ A;  2A8V A;  1Q1B A;  2WB1 E;  3AYH B;  2ZM6 Q;  3G6E A;  2CFM A;  3AFQ A;  3RNU A;  4LFC Q;  3STB D;  4R4O A;  3A5U A;  2K5H A;  2YTV A;  2MNA A;  3J81 i;  3K7U C;  3E9H A;  1RL2 A;  1K9M C;  4IPH A;  2ES2 A;  4YWK A;  1LM0 A;  3CF5 A;  5IWA L;  2R7D A;  3ER0 A;  2UUC Q;  2F4V Q;  3TRZ A;  1VQJ A;  3CCJ A;  1LUZ A;  1JE5 A;  2IX1 A;  1HNX Q;  4Y52 H;  5JJK A;  2KBN A;  1Y1W G;  4A3M H;  3CW2 C;  2WAQ E;  3U4V A;  2JA9 A;  3W5O A;  2NZO A;  4UY8 C;  3CME A;  3CPW A;  3CAM A;  2UU9 Q;  2ZTD A;  3M85 A;  1U0L A;  2K50 A;  4NXN L;  1OXS C;  3D31 A;  4BA2 I;  5DLQ E;  3RLO A;  3MEF A;  3T1H L;  4LF9 Q;  4A3J G;  2K14 A;  3TRE A;  1IBM L;  1P8L A;  3KOJ A;  2JA8 H;  2IX0 A;  3S2H H;  4PMW A;  1L1O C;  3J7Z C;  4POG A;  2N49 A;  4DV7 L;  1Y1W H;  2NZH A;  3IRB A;  1XMQ Q;  3PV0 A;  2AKW B;  3GO5 A;  1YZ6 A;  1MKH A;  1X3G A;  4DV5 L;  2OTJ A;  2LSS A;  1VQB A;  3JAM c;  3PO3 H;  4LF7 L;  4KHP L;  4GLX A;  1JJ2 A;  3S1N H;  3CCE A;  1VQE A;  4DAY B;  2K52 A;  1AE3 A;  1YEZ A;  3K0X A;  3PF4 A;  3PO2 H;  4YHH L;  2E5L Q;  2N3S A;  2VQF L;  5C4J H;  4LFA L;  1CKM A;  5J3B A;  2E2J H;  1YVC A;  5IE8 A;  1PVO A;  5GQO A;  4B3T Q;  2WP8 J;  4X65 Q;  5LMN L;  3UE1 A;  4DR3 Q;  1S3O A;  4DUY L;  4ALP A;  3OYY A;  2KHJ A;  1HR0 L;  2BH2 A;  2K5V A;  1X6O A;  3GDE A;  5C44 H;  5M3F G;  4LF6 Q;  2FXQ A;  4GNX B;  4GKJ Q;  4IJL A;  1VQ8 A;  1XNR Q;  1AE2 A;  1IXR A;  2V1C C;  3BZC A;  4PZ7 A;  4H02 A;  5M3M G;  3JAM i;  1PH3 A;  4P73 A;  2KHI A;  2E8G A;  4LUV A;  5ELO A;  4JG2 A;  2AHO B;  2JE6 I;  2XTI A;  4OWT B;  3CC4 A;  1IBL Q;  4A3B G;  4A3D G;  1A63 A;  3G4S A;  1KRS A;  1VCI A;  4JI8 L;  1PYS B;  2C35 B;  4WJ3 M;  1I6H H;  1M90 C;  1IL2 A;  2E2I H;  4DV1 Q;  2I0Q A;  5JEA G;  4EQ5 A;  4JI6 L;  2VQE L;  2L15 A;  1YJ9 A;  4A3F G;  3ULJ A;  1FL0 A;  3AQQ A;  1WYD A;  2DUD A;  4DR4 Q;  4QJF A;  4JBM A;  3F1Z A;  1K3R A;  4B3M L;  2Y0S G;  1Q81 C;  5M5W H;  2MO1 A;  5HY6 A;  1KC8 C;  2ATW A;  2ZJQ A;  4P74 A;  5M3M H;  1TWF H;  1VQM A;  3A5Z B;  2K75 A;  4DV6 Q;  4A3B H;  2RHS B;  3UDI A;  4A3D H;  3PUV A;  1YIT A;  3PUW A;  1HZC A;  1Q8K A;  1QUQ B;  4GN3 B;  1XMO Q;  2R7Z G;  4IOA A;  4OWW B;  2MFI A;  2UUA Q;  1Z47 A;  3ICE A;  2KCM A;  4A4I A;  1E3P A;  3FKI G;  3M4Q A;  4JI1 L;  4AQY L;  4A3F H;  3PF5 A;  1YIJ A;  4JI2 L;  1SMX A;  4BY1 G;  1HNZ Q;  3SGI A;  2EIF A;  2Y0S E;  1TWC H;  4GNX C;  2CWA A;  4A3K G;  3S14 H;  3DLL A;  3TS2 A;  2B3G A;  3G71 A;  1KL9 A;  1N8R C;  4A3L G;  2IY5 B;  2OCE A;  1K8A C;  4DNI A;  4JBK A;  3PGZ A;  1E1O A;  1CKN A;  3K81 C;  4HID A;  1Q82 C;  3EBE A;  3S24 A;  3WWV A;  3T1Y L;  2R7Z H;  4A3E H;  4B3S L;  2AWO A;  4Y7N H;  3NEL A;  3GTQ H;  3HOU G;  1GVP A;  4JOI A;  1QVC A;  4X66 L;  4LF4 Q;  2GVA A;  5GAE C;  1IBK Q;  3I7F A;  3HFZ B;  1QVG A;  2K4K A;  1Q12 A;  2PNH A;  1VQI A;  3UE0 A;  3HOX H;  4HJ7 A;  1W2B A;  4BY1 H;  4DR7 L;  4GLV B;  1N34 L;  5C0X J;  1Q46 A;  4IPD A;  4IPG A;  4A75 A;  4A3K H;  1QVF A;  3J7A 5;  1EYG A;  4DUZ Q;  1PFS A;  4BBR H;  1QZH A;  1YHA A;  1XPO A;  4QY7 A;  4LFB L;  2NVQ H;  4K0K Q;  1YI2 A;  4JV5 L;  2OTL A;  4DV3 L;  4DR2 Q;  3KDF A;  4XIG S;  2RCN A;  4BBS H;  3HKZ G;  1UWV A;  3CCL A;  3A0J A;  3I4M H;  1B70 B;  2HT1 A;  3HOU H;  1PH1 A;  2NN6 G;  3F2C A;  5GRO A;  1Q1E A;  1N36 L;  1SRO A;  3CMA A;  1VQ5 A;  1SFO H;  1FJG Q;  1P16 A;  4R4I A;  3W1B A;  1KQS A;  4A3G H;  4GOP B;  3J80 i;  4DR6 Q;  4A3G G;  2HHH Q;  4X64 Q;  3S15 H;  2Q2T A;  4UPA A;  1JB7 A;  3I4N G;  3S17 H;  1X9N A;  4DR1 L;  3K80 C;  3GTM H;  1VQO A;  3HKZ E;  3VDY A;  4DV0 L;  1G6P A;  4LF8 Q;  3RN2 A;  4JI7 Q;  2PQA A;  2Q2I A;  1OXV A;  3UDF A;  1NY4 A;  3HOV H;  1I5F A;  3NEN A;  4TVA B;  3L0O A;  4A3C G;  2XGT A;  4LUZ A;  2R6G A;  1QUQ A;  5HGQ A;  2ZJP A;  2Z6K C;  1YJW A;  3W1G A;  2NVX H;  5FJ8 G;  3ULP A;  4YCW A;  4WJ4 A;  1I94 L;  5E7N A;  4JI3 Q;  1E1T A;  2OWO A;  3I4N H;  4LF9 L;  1VQA A;  3CP0 A;  1D7Q A;  3M7N A;  4AIM A;  3NBH B;  3PUX A;  4LUO A;  3RZO H;  4QIW E;  1XMQ L;  1EIY B;  1BVS A;  1MJC A;  1A0I A;  3CPF A;  3KF6 A;  4DPG A;  3GTJ H;  3HOZ G;  1NTG A;  2HIV A;  1GD7 A;  3HOY G;  3KJP A;  4A3I G;  1JJG A;  4L5R C;  2ZJR A;  1GM5 A;  2GVB A;  2AWN A;  3RZD H;  3GTL H;  2UXD L;  1C7Y A;  3T1H Q;  2JA6 G;  1TXY A;  2IHF A;  4GOP C;  3H3V H;  1NJI C;  4A3J H;  1UE6 A;  4B3T L;  4FDB A;  3H0G G;  4X65 L;  4IOC A;  4DV7 Q;  2YU9 H;  4MTN A;  3ERS X;  5IT9 c;  3RLF A;  3PIP A;  3CCS A;  3J81 j;  1KIX A;  1L1O A;  3CQZ H;  4AH6 A;  1HZB A;  1YHB A;  2F3I A;  1S72 A;  4LF7 Q;  3HOZ H;  4KHP Q;  5IYB G;  4C3I H;  1HNW Q;  2ASB A;  4A3I H;  3KFU A;  3M3Y H;  3H15 A;  3M4O H;  4LFA Q;  2VQF Q;  1IBL L;  2JA6 H;  4JYA L;  3DM3 A;  1VS0 A;  2OQK A;  5LMN Q;  1YHQ A;  1PH8 A;  4DUY Q;  1YJN A;  3PUY A;  1VQC A;  3H0G H;  4P75 A;  1WCM G;  2KCT A;  1S40 A;  2ALY B;  5GAD C;  1YBY A;  4IFD I;  2UXD Q;  4NB3 A;  2LXK A;  5M3F H;  4IFD G;  1L2F A;  1OXX K;  2R7F A;  3E9I A;  2JA7 G;  4AYB G;  5IYB H;  2QA4 A;  3F2D A;  1PH6 A;  2OQ0 A;  4DV6 L;  4L5S A;  3TQY A;  3ZJY C;  2VS1 A;  4JI8 Q;  1I3Q H;  1LTL A;  4HIK A;  5M5Y H;  4HJ5 A;  1VQG A;  4X62 L;  4HIM A;  2F52 A;  4NXM Q;  2UXC L;  3EIV A;  2JA5 G;  1MIU A;  2VQE Q;  1V9P A;  1HZ9 A;  1XMO L;  1N33 L;  2DGY A;  1Y1V G;  3PSI A;  3KF8 B;  1CUK A;  2UUA L;  4DV2 L;  1WCM H;  4OO1 G;  4A93 G;  1V43 A;  2YYZ A;  1X3F A;  1N9W A;  4JBJ A;  4B3M Q;  1HNZ L;  3I2Z A;  4AYB E;  4C3H H;  1GO3 E;  5JEA J;  1G29 1;  3D0F A;  2JA7 H;  2PI2 A;  1D8L A;  4MNO A;  4KI0 A;  3CXC A;  1Q86 C;  1A62 A;  2CQO A;  1EQR A;  2WFW A;  1CKO A;  1UE5 A;  3G48 A;  4YCV A;  3NEM A;  1KHI A;  1J5E L;  2UUB L;  1BBU A;  4YY3 Q;  4JI0 Q;  2CWP A;  5AJ3 L;  5K36 G;  1Z9F A;  1MJE A;  4HJA A;  4QQB X;  4IPC A;  1YNX A;  3RR5 A;  1X55 A;  1PH9 A;  1EOV A;  1FVI A;  1VQ7 A;  4AQY Q;  1N32 L;  3OTO Q;  5C0X G;  3FKI H;  1PH2 A;  1WJJ A;  3BZK A;  4X6A H;  3K8A A;  4A93 H;  4HIO A;  4LF4 L;  3M9B A;  1KXL A;  1IBK L;  3GD7 A;  1K0R A;  3GTG H;  4BA1 I;  1OXT A;  3S1Q H;  1J6Q A;  3BU2 A;  4DK6 C;  1SR3 A;  1TWH H;  5H1S E;  4GN4 B;  4LF5 L;  3TEH B;  3UDG A;  4A3L H;  4JBW A;  4GNX A;  4DUZ L;  4RG1 A;  3FHW A;  1SLJ A;  2RF4 A;  5IY0 A;  3GTK H;  5IP9 G;  4K0K L;  5BR8 Q;  3CCQ A;  2JJQ A;  4DV4 Q;  5EAY A;  2NN6 I;  4XTC S;  4DR2 L;  4B3S Q;  3U4Z A;  4P72 A;  4B3R L;  1XNQ L;  1JT8 A;  4DR5 Q;  2K5N A;  5LMU Q;  4NPS A;  4OX9 Q;  2ZM6 L;  1PA6 A;  4LFC L;  4JI5 Q;  1UE7 A;  1FJG L;  3K7A H;  1N34 Q;  2D62 A;  3AEV A;  3HOW G;  4OWX B;  4DR6 L;  4JI4 Q;  2HHH L;  4MZ9 A;  1L0W A;  4X64 L;  1BKB A;  2UUC L;  1KD1 C;  2B63 G;  1E24 A;  4P71 A;  2F4V L;  4UP9 A;  5IP7 G;  1A8V A;  4JV5 Q;  4LFB Q;  4GS3 A;  4DV3 Q;  5FLX c;  1HNX L;  1O7I A;  3ULL A;  2A1A A;  5IP9 H;  4A3M G;  3S1M H;  2UXB Q;  5GAG C;  1UEB A;  2IT1 A;  4LF8 L;  1XTD A;  2D0P A;  1Y14 B;  1I50 H;  5FLM G;  4QGU A;  1BBW A;  3MXN B;  4PZ6 A;  3A74 A;  1XPU A;  1X54 A;  1JJC B;  2VY3 A;  1N36 Q;  2UU9 L;  3CC7 A;  2UXB L;  3H3V I;  1GKH A;  3STB C;  5JJI A;  4OON A;  1E7Z A;  3TS0 A;  1XJV A;  1EUJ A;  2PMZ E;  2MO0 A;  5IWA Q;  3OW2 A;  3HOW H;  1DGS A;  2EQS A;  4DR1 Q;  2JA8 G;  1VQP A;  3F8T A;  2VL6 A;  4JI3 L;  1SRU A;  4ME3 A;  3CCV A;  2B63 H;  1W3S A;  5IP7 H;  3I55 A;  4DV0 Q;  1JMC A;  1QZG A;  4PZ8 A;  3PUZ A;  3FP9 A;  4BY7 G;  2HIX A;  2R92 G;  1H95 A;  1E22 A;  5ELN A;  3PO3 G;  5FLM H;  2YTY A;  4YCU A;  2Q2U A;  4NXN Q;  2I5H A;  4A3C H;  1VQ6 A;  1VQ9 A;  3PO2 G;  2JEB I;  1B7Y B;  1CSQ A;  3AFP A;  1VQH A;  2E5L L;  5FJ8 H;  4TQU S;  1I94 Q;  1K8G A;  1IBM Q;  2Z6K A;  4YWL A;  4GLA C;  1K83 H;  4JCV E;  1KAW A;  4DKA C;  2I5L X;  3Q8D A;  2R93 G;  2EXD A;  4DR3 L;  1SE8 A;  1VQF A;  1B8A A;  1IYJ B;  3E0E A;  5C44 G;  1KRT A;  4DV5 Q;  1ASZ A;  4LF6 L;  4R4T A;  3BJU A;  4BY7 H;  2IHE A;  1ASY A;  2R92 H;  4GKJ L;  1TWA H;  2ZTC A;  4UP8 A;  1XNR L;  3HOY H;  1CKN B;  4YHH Q;  1AH9 A;  1R9T H;  3M4P A;  4L5T A;  1Q7Y C;  1HNW L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...