4A3LG

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid and soaked with ampcpp
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 32
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3lG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3lG01
4IO9A 3ER0A 1K0RA 3H0GH 4DK6C 3K81C 5IP9G 4B3SL 1PH9A 2B63H 4JV5L 1YHQA 4OO1I 4YY3Q 1EIFA 3PO2H 1K3RA 3OW2A 2Y0SG 1VQNA 3K7UC 5IYBG 4DV3L 2JA5G 2OTLA 2I5HA 3GDEA 5C3EG 1GD7A 1NMFA 1VQJA 2B29A 3I4MH 1MIUA 4A93G 1IL2A 2Q2TA 4JI4L 4A3MH 1L1OB 1XTDA 1NMGA 3UDGA 3S14H 4X66L 3CPWA 2BH2A 1AH9A 4R4QA 1S72A 1E22A 2ZM6Q 4HJAA 3M9BA 4H02A 3RN5A 3GTGH 1K73C 1X3FA 3J81j 3ICEA 1NBWA 2IHFA 4UP7A 4BXXH 2EIFA 5C4JH 1MJEA 1X3GA 1YHAA 4JI6L 4JC0A 1LYLA 4BY1H 1QVCA 1VQ4A 1PYBA 4A3EH 1CKNB 2XGTA 3E9HA 4OXPA 2E5LQ 4DR2L 1G51A 4L5SA 3CC4A 5FLMH 4DR1Q 4C3IH 1QUQA 4UY8C 2WAQE 4IOAA 1X65A 2NZHA 1TWAH 4GLXA 2YV5A 5LMUQ 3HFZB 1YEZA 3M3YH 2H5XA 3UDIA 2ALYB 4C3HH 4GN3B 1KQSA 2WAQG 4A3CH 2Q2UA 4A3LH 3E9IA 1HNWL 4FDBA 2UUAQ 2VNUD 2VQFQ 3HKSA 5HGQA 4DR6Q 4JI0L 4B3RQ 3GTMH 1Z47A 4DUYQ 2Z6KC 1H95A 4LF5Q 1XPUA 2HIVA 3U4VA 2GVAA 4AQYL 4GOPA 2KHJA 2ZTCA 2R7ZH 3I4NG 2HIXA 2JEBI 4YCVA 1WOCA 4DV7L 4K0KL 5K36G 2LSSA 5IT9c 2F4VQ 4A3EG 3KJPA 1PHJA 4IFDJ 3W1GA 2L15A 5M5XH 1IXRA 4LF8L 4A3BG 5IYDH 4A3KH 1XNQQ 3G48A 4LFCL 4X6AH 2E2IH 3D0FA 3MEFA 2CQOA 2AHOB 3AYHB 1BBUA 2C35B 2MO1A 3HOZH 2IX0A 4LWCA 3HOZG 2JA5H 2HHHQ 2WP8J 2VUMH 1EQRA 3RN2A 4MNOA 5LMNW 2Q2HA 1OTCA 4LUOA 1Q12A 5E7NA 1VQFA 1JE5A 5FLMG 2E2HH 4RG1A 2UUBQ 2GN5A 1WCMG 4GS3A 1K83H 4PG3A 4BBRG 1R9TH 1TWFH 4GN4B 4PZ6A 1LTLA 5H1SE 4JBJA 3PV0A 3VDYA 1WFQA 4A93H 4YHHQ 2IY5B 1SN8A 2R7DA 2RCNA 2OWOA 2MO0A 5M3FH 3S15H 2LXKA 3DM3A 3STBC 2K5VA 1TWHH 1VQKA 4JYAL 3PF5A 2Q2IA 3NENA 4A3GH 5IWAL 3PUVA 4KLKA 1EQQA 4XIGS 1YZ6A 1N9WA 1HR0W 2JK8A 3PUYA 4DR5Q 1YJ9A 3A0JA 3ULPA 3CF5A 3HKZG 1I94L 1GO3E 4IJLA 1YJNA 3K80C 2KCTA 4QGUA 1NY4A 2GVBA 4A3DG 2XTIA 2JJQA 1VQCA 3BU2A 3HOYG 4YY3L 4BA2I 4RMFA 4DPGA 4YCUA 4QQBX 2BA1A 4X62L 1YBYA 3CMEA 1XMOL 4C2MH 2OQKA 4KHPQ 1CKMA 2FXQA 3KDFA 4JCVE 2I5MX 4X64L 1HZCA 4OONA 3CQZH 1HR0Q 1LM0A 1VQ7A 2CCZA 3CC2A 1WJJA 3L0OA 3GO5A 3CXCA 4LFBL 1YNXA 1IBLL 1X54A 4JI6Q 1XPRA 1PH7A 2NVXH 3KF8B 1G291 2ZM6L 2I0QA 3CMAA 2NN6G 3NELA 2R6GA 3S17H 1EOVA 4GLAC 4HIMA 3U58A 4BY7G 4POGA 1X56A 4GKJQ 4JI0Q 4B3RL 2K52A 3GTPH 1KC8C 1BKBA 3CD6A 3JAMi 3J80c 1IBMQ 3M85A 1Y14B 2UUCQ 2JE6I 2PQAB 3PO3H 4EQ5A 4LFBQ 1SRUA 1PFSA 1OXXK 3OTOQ 4DK3C 1U0LA 1QVGA 5C0XI 3HKZE 3CCUA 1IBML 3H3VH 1BBWA 2A1AA 2ATWA 3TS2A 1XNQL 1CSQA 3T1YQ 2YTVA 2E8GA 1M90C 2B63G 2AWNA 2R7FA 5JJKA 1WCMH 4BBRH 2PI2A 5C0XJ 1PH8A 1LUZA 1SFOH 4KI0A 4AIMA 4L5RC 4WJ4A 4DV3Q 1QVFA 1JJCB 1OXSC 4Y7NH 2MQHA 3BZCA 1Q86C 3FHWA 3J7ZC 2LXJA 4KHPL 3U50C 2UXDQ 2HQLA 1KAWA 4KHZA 3TRZA 2N78A 3ERSX 2DUDA 5BR8L 1JJ2A 4X65L 3TREA 1GM5A 1HNXL 2IX1A 1VQMA 4DR7L 2AKWB 4HJ7A 4X66Q 4BA1I 1VQ8A 3KLWA 4LUVA 1V43A 3EIVA 2A19A 3KF6A 2RHQB 4IPGA 4YHHL 1XMQL 1KRTA 1PH4A 4OO1G 2YU9H 4GKJL 2ZJRA 3W5OA 4OWWB 3H3VI 4DAYB 1YHBA 3GTJH 1G6PA 1O7IA 4ALPA 4LUZA 2N8NA 5M3MH 3HOXH 1PH2A 4NXML 3T1HQ 5C4XG 4DR2Q 4IFDI 4BBSG 4LNQA 4UP9A 2VQEQ 2Z6KA 4OX9L 1VQ5A 3CW2C 4NXNQ 4YWMA 1N36L 5FJ8G 4XTCS 1VCIA 2UU9Q 4DR5L 1QZHA 4NB3A 1FGUA 4DV4L 5HY6A 2QA4A 2NVQH 3ULJA 2K14A 3KDFB 4R1JA 4P71A 1JJGA 1N34L 2UUBL 4R4OA 3PIOA 4DUYL 2MFIA 4B3ML 2VQFL 1YJWA 3U4ZA 5IYCH 3S1NH 3S1RH 3MXNB 4DV7Q 1N33L 4K0KQ 2D62A 2AMCB 1UWVA 3Q8DA 4JI1L 3A74A 2WB1G 5BR8Q 5JEAG 3H0GG 3G6EA 4LF8Q 2JEAI 2CKZB 4GN5A 3HOVH 4PZ8A 1HZBA 1OXUA 1S3OA 1VQDA 2NVTH 3UE0A 4DV1L 2NZOA 4J15A 1RIPA 1SLJA 3RR5A 1UE1A 5FLXc 3J81c 3CCJA 2BA0A 3FKIG 3CCLA 1X55A 1BVSA 1IZ6A 2ID0A 4GNXA 1Z9FA 4HJ8A 3M7NA 1E7ZA 1T9HA 1UE6A 3PUWA 3K7AH 4GKKQ 5JJIA 5LMUL 5M5YH 4AQYQ 1XMOQ 4JOIC 4A3FH 2VQEL 1CKOA 1KXLA 4O0AA 1OXTA 4LF4L 4DUZQ 3GTQH 3HOVG 1C0AA 2UXCL 2I5LX 4JI1Q 1L0WA 3RZDH 1E24A 1Q81C 2R92G 1W2BA 3GTOH 1I6HH 1N32Q 4DV4Q 1WYDA 4HIOA 1E1TA 3S24A 3A5ZB 1QUQB 4LF5L 1WI5A 4AYBE 1N32L 5ELNA 3TEHB 4YWLA 1YIJA 1Y1WG 5AJ3Q 1VQIA 1HZ9A 2PMZE 2VZAA 4JI5Q 4B3TL 3PO2G 4LF4Q 1GVPA 2YTXA 5C44H 1PH5A 4JYAQ 3M4PA 1FL0A 4HIKA 1PVOA 2R7ZG 4QL5A 3AFQA 4QY7A 1VS0A 2EXDA 5ELOA 3LGJA 3KJOA 1YI2A 1I94Q 1KL9A 3D31A 2KCMA 2PQAA 3K8AA 4DV2L 2IT1A 1E3PA 1GKHA 4POFA 4A3DH 1HH2P 1VQGA 4GOPB 2VS1A 2WFWA 3HOWG 4JI5L 3STBD 4LF9L 4NXMQ 3CCRA 3HOYH 4APVA 1Q8KA 2N3SA 3IRBA 4QIWE 1Q82C 2RF4A 1AE2A 3RLNA 2K5HA 3OTOL 4HJ9A 4JI4Q 4P75A 3I4NH 3PF4A 1L2FA 4JBWA 4A3IG 4AH6A 2K4KA 3CC7A 1Y1WH 3H15A 1PH3A 3PO3G 4WJ3M 5M3FG 4DUZL 2Y0SE 4JI2Q 3NEMA 4B3SQ 3PIPA 4PZ7A 4P72A 4R4CA 3TQYA 2CFMA 5IP7G 4LFCQ 3KFUA 4DR4Q 4Y52H 2MNAA 5C44G 4LF9Q 1N34Q 3ZJYC 4ME3A 2UXBQ 2R92H 1PA6A 5LMNL 1J6QA 3E0EA 3KF6B 5GROA 4A3JG 4A3JH 1VQPA 2HHHL 4JBMA 1N33Q 3AEVA 1J5EQ 5DLQE 1VQBA 1KHIA 3PUZA 1P16A 1JMCA 4A3CG 4L5QA 2A8VA 1Y1VH 3RZOH 1PH1A 1Q1BA 1NJIC 1L1OC 1VQEA 4DNIA 1Q7YC 1X6OA 1N8RC 5IP7H 1K8AC 1YVCA 2VY3A 3F8TA 3I4OA 3EBEA 2JA9A 4R4IA 4DV2Q 1NE3A 4A76A 3TS0A 4A3IH 4BXXG 4DR3Q 3S1MH 5IE8A 4DV6Q 4LF7L 3PUXA 3CCQA 2JA7H 3K0XA 4LW1A 1D8LA 4TVAB 1IBKL 4OX9Q 5IP9H 2B3GA 4BY1G 3UDXA 4DV5L 3HOWH 4DR1L 1HNZL 4GLVB 4X65Q 1HNXQ 1VQHA 3F2CA 2R93H 1B70B 4JI7Q 3S2DH 1PV4A 3DLLA 1PH6A 1U5KA 4LFAL 3WWVA 1J5EL 1KRSA 2K5NA 1P8LA 2K75A 5IY0A 2KBNA 3I7FA 4IOCA 1I5FA 5FJ8H 2OTJA 1KD1C 1XMQQ 2QEXA 2KHIA 3PCOB 4JI7L 2JA6H 3F2DA 5M3MG 2K50A 4MTNA 5M5WH 2ZJPA 4DV0L 4A3MG 1TXYA 1EIYB 1EUJA 1A63A 1HNWQ 4DR6L 1YITA 1NTGA 3T1HL 5C4XH 1XJVA 4B3TQ 4YCWA 2PNHA 2VL6A 1FJGL 3M4OH 4DV0Q 2UXDL 2V1CC 4DV5Q 3S16H 2DGYA 1B8AA 4A4IA 2ZTDA 2QGQA 3KOJA 2YTYA 2BH8A 3AFPA 5GQOA 1EWIA 5IYBH 4GNXB 4IJHA 4HIDA 4NXNL 2WB1E 1X9NA 4TQUS 4NPSA 2JA7G 2JA8G 1IYJB 1VQ9A 3BZKA 2JA8H 1XPOA 3CAMA 3J81i 3L7ZC 2E2JH 4IPHA 4HJ5A 1VQLA 5JEAJ 1X3EA 1CSPA 3UE1A 3I55A 4BY7H 3J80i 5IYDG 2R93G 1IBKQ 1Q46A 3G71A 4A3KG 1W3SA 1Q1EA 3SGIA 4DAMA 3CCEA 1FJGQ 3HOUG 4MZ9A 4UP8A 5J3BA 2D0OA 4DV6L 2F3IA 3B6YA 1MJCA 4LF7Q 2JQOA 3M4QA 4QJFA 3FP9A 5EAYA 1TWCH 2KENA 3FKIH 2JA6G 3L2PA 3S1QH 3JAMc 1UE7A 4LF6L 5GAHC 1C7YA 4JI3Q 1XNRQ 1HR0L 3T1YL 4DKAC 4DR4L 3PSIA 2Z0SA 3CCMA 4JI2L 2F52A 1A62A 2UUAL 2HT1A 1RL2A 4LF6Q 4UPAA 4JI8L 3KYHC 4EX5A 1L1OA 1DGSA 3EN2A 3RNUA 3I4MG 4IFDG 1JT8A 1PYSB 4YWKA 1VQAA 2CWPA 4OWXB 4DV1Q 4JI8Q 4R4TA 1EFWA 1UEBA 4X62Q 3UDFA 1N36Q 4GOPC 2CWAA 4X64Q 2OQ0A 4A3FG 2IHEA 1M1KC 2OCEA 1XNRL 4DR7Q 5JJLA 5IWAQ 4OWTB 1HZAA 2UXCQ 2N49A 3I2ZA 4GNXC 1CKNA 3PGZA 3S2HH 2EQSA 2RHSB 1OXVA 4O2DA 4A75A 1VQOA 1SE8A 1EYGA 3GTKH 3OYYA 1K8GA 4DR3L 3CP0A 1ASYA 3AQQA 4L5TA 2ZTEA 3J7A5 1UE5A 3F1ZA 3HOXG 3CPFA 1FVIA 4JOIA 4P74A 5LMNQ 1A0IA 4BBSH 1I50H 2UXBL 3BJUA 3JC66 4IPCA 4AYBG 1AE3A 5AJ3L 1QZGA 1HNZQ 3I56A 3GD7A 1IBLQ 4PMWA 1K9MC 2NVYH 4JI3L 3CCVA 2UU9L 2D0PA 3A5UA 1ASZA 5IYCG 1SR3A 2ZJQA 5GAEC 3RLFA 1C9OA 4LFAQ 1HJPA 1E1OA 1MKHA 5C3EH 5C0XG 2NN6I 2F4VL 1SMXA 1D7QA 3CCSA 1KIXA 5GADC 1S40A 2VUMG 1V1QA 2VW9A 3W1BA 1I3QH 2ASBA 1TWGH 3F2BA 1Y1VG 4IPDA 4JG2A 3GTLH 4A3GG 4A3LG 3G4SA 2E5LL 4B3MQ 4P73A 3RLOA 4A3BH 1CUKA 4GKKL 1VQ6A 4JBKA 1B7YB 5GAGC 2YYZA 2ES2A 1SROA 2AWOA 3NBHB 3HOUH 1V9PA 2UUCL 4JV5Q 2PI2E 1JB7A 4C3JH 3ULLA 1A8VA
chains in the Genus database with same CATH superfamily
2M9VA 4ME5A 5IGFA 1EUCB 4JV5L 1PH9A 5CB4F 2R93A 3TDQA 3VA5A 1M4VA 2MCTA 1VQNA 3MR2A 2R7KA 5C5JA 1KDCA 2L5TA 3K7UC 5CBAE 4DV3L 2NU8B 3GQCA 2I5HA 3GDEA 1VQJA 2B29A 2F0SA 3NQTA 1QNUA 3FEWX 4C2MB 3GTQB 4RNMA 1MIUA 3E3XA 1SNMA 2K5QA 4A3MH 3UDGA 3S14H 2MPMA 4X66L 4FYDA 4DAPA 4WORA 1S5BD 1LT4D 4J9KA 3SK5A 3GTGH 2D2CC 3K57A 4XQQA 2R84A 3ND9A 1DOLA 2CZGA 3PW2A 3A56A 2K05A 3GTPA 4BY1H 4Q8EA 3FDSA 3BDCA 2ZXRA 4XYMB 4JUZA 2EJMA 3SVMA 3I12A 4DR1Q 4IWYA 3ETJA 4ED2A 1CZWA 2XCLA 2A69C 4IOAA 4HR7A 2QF7A 4O2AF 1SXTA 4GLXA 3HBLA 1A3UA 3NXWA 1SYXB 1X3QA 1UC8A 2ALYB 4XXEA 2XGQA 1BCPF 4C3HH 2FJZA 1RJRA 2F1MA 2VQFQ 3K5LA 2M05A 4JI0L 4B3RQ 1Z47A 4ED3A 3RF2A 1H95A 1V4YA 5IWAH 4XYQA 3E0JA 1DV1A 4GOPA 2ICIA 2ZTCA 4N9PA 2JEBI 3EPGA 4K0KL 2O03A 4A3EG 3KJPA 4JV5H 1PHJA 4DL6A 3VR3A 2L15A 5C4ZA 4C3HB 5EZYF 1S4ZA 1XNQQ 4OEMB 4LFCL 2V4RA 3VR5A 3D0FA 1SNQA 4QIWB 2W71A 4UCTA 5C1PA 2C35B 1I94H 2MO1A 4MV4A 1QB5D 2FPIB 2VUMH 3HB9A 2UUAH 4U673 5LMNW 4O3QA 4UCUA 5KG0A 4LUOA 3GTOA 1JWMD 4S3SA 4RG1A 1S5ED 1WCMG 1K83H 1R9TH 5H1SE 3GTQA 1SYFA 3PIP3 2JA5A 4EEYA 1LTAD 4K2KA 5K36H 1T5EA 5DM63 4J6HA 5G3LF 3BABA 4A93H 3DWAA 4YHHQ 2YS7A 2R7DA 2RCNA 3ORRA 1SJED 2J6UA 1QNKA 1DOKA 2JEJA 2EYMA 1SYBA 2LXKA 2DJFC 2K5VA 3CRKC 1TS2A 3NENA 1GUSA 1GXDC 4J9PA 1B53A 3TIIA 1N9WA 1K83B 2XRQD 5DEHA 1NY4A 3URYA 2GVBA 4A3DG 5IGEA 2JJQA 2F0DA 3VYRA 4DNRB 1O75A 2I46A 4YY3L 4RMFA 4DPGA 4QQBX 4OIKA 3J7AF 5KFTA 1TWHB 3CMEA 2F4VH 4C2MH 2OQKA 1KJJA 1HZCA 3CQZH 2CCZA 1GUNA 2FJ2A 2B63A 5JAVA 3TN2A 4G7HC 2K5WA 4K5XA 4A3BB 1L0YB 4LF8H 2EVBA 3KF8B 1MGSA 4FF3A 4QWDA 4BY7G 3U58A 2FLNA 5IGGA 3J7AK 1VF7A 4N8FA 5IODA 3R8BA 2AQ4A 4KD3A 3J81L 4YR2A 3VPCA 1II3A 1F77A 5EBCA 2PQAB 1TWGA 2R8HA 4EQ5A 2RDJA 3JSLA 3D8GA 3OTOQ 4ECTA 3ONAB 5C0XI 3QO2A 1BBWA 1N33H 1I3QB 4TV9F 1HA5A 1JWUD 1JE4A 1WCMH 2EZVA 5F9LA 3R3OA 4GC6A 1AEXA 1SMYC 2LFNA 1SFOH 4KI0A 2R92A 5IOCA 1A3VA 4Y7NH 1SYCA 2E74C 2W6MA 3BZCA 1Q86C 3FHWA 1OO9B 3J7ZC 5JVG3 4X66H 3PR5B 4KHPL 3DWPA 3IKJA 2UXDQ 4Q43A 2UVUA 4KHZA 3TRZA 4CC5A 5KNCA 1SFOA 3H4BA 1KBLA 5C5MA 2VUMA 1HHVA 1VQMA 4DN4M 5KFPA 3GILA 1JKJB 3KLWA 2ZT9C 1J5EQ 4KY6A 1KRTA 4GKJL 3H3VI 4DAYB 1YHBA 2KUMA 3GTJH 2UVRA 5M3MH 3HOXH 4LF5H 4X62H 2X6GA 3V4SA 5LL6X 3G6YA 5LMUH 4O3OA 4DV1H 3M4OB 3CW2C 4A2BA 3ND8A 4EBCA 4LF4H 1EY0A 4DR6H 1N36L 4I55F 4HQ6A 1YNJC 1IBMH 4DR5L 1PFBA 3HRZC 2Y0SA 3Q23A 1LT5D 4DV4L 3D3RA 4GZYC 1LT6D 5HY6A 4BY7B 2NVQH 3ULJA 1RTNA 4P71A 1K28A 2R3ZA 1N34L 2UUBL 1IHZA 4R4OA 3PIOA 2RVLA 1MD2D 3ITPA 4FVMA 4B3ML 3HOWB 1SEBD 4ILWA 1KABA 2NTSA 3DMUA 3SK4A 1XWEA 3N8DA 1B2TA 3AB9A 3KHLA 3MXNB 4DV7Q 1N33L 3JRWA 2I80A 2D62A 3N40P 4YP3A 5BR8Q 2WB1G 3HOVB 2L4NA 5JEAG 3G6EA 4LF8Q 5KFDA 1B04A 4PZ8A 2JA6B 4EBEA 1OXUA 3F2UA 2IMWP 1VQDA 1TS4A 3GIDA 4LF9H 4J15A 1SLJA 3CCJA 2BA0A 3CCLA 4FF4A 2ID0A 3GTGA 4ZUIA 3PW7A 5JQWA 4ECSA 4A3MB 1TY2A 1T9HA 1CK1A 5KG3A 3S14B 4AQYQ 2VQEL 4IUQA 4X3TA 1KXLA 1OXTA 3WDNA 5KYLA 4DUZQ 3GTQH 2R8IA 2EYLA 4JI1Q 1L0WA 2PW7A 3I90A 2J7ZA 1Q81C 3RJ0A 1HFGA 1I6HH 1SNCA 3C0FB 4HIOA 1E1TA 5CV8A 5KFFA 1STHA 1QUQB 4IUUA 4LF5L 3KXYT 5ELNA 4YWLA 2X6LA 1VDZA 1HZ9A 1PLFA 2V58A 4ED1A 4O4IF 2A6HD 3U9SA 2HQEA 1C3OA 5DQGA 2YTXA 4JYAQ 2WKCA 5FO8B 4HIKA 2HHHH 3HOXB 4QY7A 3AFQA 5ELOA 1VS0A 2EYOA 2VB3X 3KJOA 3D31A 4DV2L 2IT1A 2XIGA 2FMCA 1CM9A 1HUNA 1N34H 4GOPB 2EE1A 3PW4A 4JI5L 3HOYH 4DV0H 1LLRD 1EIGA 5LP6F 2VA2A 4QIWE 2K5HA 4JI4Q 4X3KA 4P75A 4NP5A 3PF4A 3PVXA 3OWEB 2K01A 2WE6A 3P7JA 1DOMA 4CDEC 2I8CA 4AH6A 3N41B 4FXKC 5JPMC 4L63B 1GHJA 2TMPA 3BDLA 4JI2Q 4B3SQ 3RZDB 1PK8A 2JA8B 2O5JC 3HZXA 4MV1A 3KFUA 2XWJB 5KFRA 2BQ3A 4LF9Q 4CHTB 5C44G 1N34Q 2F0EA 3X3MA 1CQJB 1S5CD 4A3JH 2W7PA 2WINB 3AEVA 5DLQE 4BY1B 2CQYA 4RHRA 3VYSA 4A3CG 3MR5A 5J1ZA 1Q1BA 1Q7YC 2R7MA 3I4LA 2F0TA 1VF5C 5EKIA 1K8AC 4ECWA 3F8TA 3I4OA 3MAQA 1JJGA 5FLXW 1NE3A 1QJOA 5DLGA 3CRLC 3OSNA 2A5HA 2XIWA 3PUXA 2JA7H 1F9QA 4LW1A 1B9MA 5L9XA 3J81E 4ECZA 4HNUA 3HOWH 3DM1A 3UDXA 1JR0D 2K04A 4ZUJA 4GLVB 5LL6S 1VQHA 2FLLA 1B70B 2B2UC 4JI7Q 3DLLA 1J5EL 5EJWA 5LMNH 1P8LA 2AGPA 2OTJA 4J1MA 3I7FA 1I5FA 5EPJA 1LTID 2YRWA 1KD1C 5FD6A 2RDFA 4JI7L 1SNPA 2XCPA 2K50A 4MTNA 2PZTA 4DV0L 3RV4A 1EUJA 1TKWB 1MSGA 4DR6L 1NTGA 3M4OH 3OUUA 3JSNA 2UXDL 4DV5Q 3X3NA 4ZOLF 3KF8A 4A4IA 2ZTDA 4R7RA 1ESRA 3RB6A 5IYBH 1EWIA 2W70A 3RB0A 2WB1E 4TQUS 1KJ9A 2JA8G 1O7YA 2UVVA 5GONF 2E2JH 1XNRH 4IPHA 5KRUA 1Z7TA 3MWMA 1X3EA 1CSPA 2F0FA 3MFIA 3G6JB 5IYDG 2RA4A 4DR1H 2QW7A 2VUGA 1Q46A 4A3KG 3HKZA 1W3SA 1Q1EA 2WIIB 1I50B 1FJGQ 2D5DA 3I72A 3HOUG 2E5LH 4LF7Q 4ZHQF 2DNCA 4TRDA 5EAYA 1TWCH 5ELDA 1CI3M 1O7ZA 2E2IB 1MI2A 5EWFA 1CHPD 1UE7A 3P20A 1C7YA 4EVOA 4DKAC 5I2XA 3CCMA 4JI2L 2F52A 4JI6H 1RL2A 1TS5A 1L1OA 3EN2A 4J0MA 4OO1H 4DV1Q 1DJRD 1EFWA 2R7NA 3K3VA 2CW7A 1H9SB 1N36Q 4GOPC 1PRTF 2BQRA 1JICA 3D4RA 4DR7Q 5JJLA 1FNUA 1PMRA 1EZ8A 2YYAA 2C28A 2A68C 3PGZA 3S2HH 2F0OA 4RB0A 2FB9A 4G57A 2CH4A 1CFMA 3JRXA 4DR3L 1ASYA 1VMPA 4O3PA 1ZYRD 3DXJC 4CDFC 3HOXG 3CPFA 2SNSA 5LMNQ 3I70A 1H9RA 1A0IA 3GV6A 4RB2C 4LSAA 4DV6H 4AYBG 5AJ3L 1AE3A 3E6ZX 2XGPA 4RAUC 1K9MC 1ICWA 4JI3L 4YB8B 4DV3H 2D0PA 3DWQA 1ASZA 3KK7A 2UVWA 3G6XA 1IW7C 1E1OA 3T1YH 4HEDA 1D7QA 5C8YF 2W7OA 3S17B 2KJXA 2QILA 1CQFA 1TY0A 5GADC 2CHBD 2F0VA 4I4TF 5D1OB 4A3GG 4U68A 1K3BC 2J0TD 2E5LL 1WCMB 4KD4A 2NWGA 4B3MQ 4DR2H 1GYFA 1JCKB 3PO3B 3SR1A 4JBKA 5GAGC 1EU3A 5C3WA 1I4PA 2W9BB 3NBHB 2WAQA 2UUCL 1AZQA 3RB4A 2F0JA 3A7LA 5C1OA 1JB7A 4HJ8A 2NVYA 4BS9A 1CE8A 2NVTB 1RKNA 4DK6C 3K81C 1GHKA 1UNNC 2ZDQA 5BN5A 3L9AX 3FVQA 3SI8A 3MVVA 4HNVA 2XSCA 2LMCB 2OTLA 1HCZA 5KFEA 4NDXA 1NMFA 2FK1A 5HBRB 4QF4A 4A93G 1PZID 4HSVA 1IL2A 4K0KH 1AN8A 2IJ0A 3CPWA 2BH2A 3VA7A 3Q0AA 4R4QA 3K5MA 4KHVA 1CQIB 1XDNA 1E22A 4O4LF 2ZM6Q 4HJAA 3RN5A 3VMMA 2ASJA 2VOBA 1F9SA 5BR8H 1X3FA 4MIUA 1BCPD 1NBWA 2EIFA 2MP1A 1MJEA 2KCCA 1LYLA 4K6DA 4O3SA 4F87A 1QVCA 1VQ4A 1PYBA 3RMHA 3CC4A 3OIPA 4C3IH 1FNWA 3R5HA 3S1NB 3V4ZA 2NVXA 2NZHA 3C1EA 2PZUA 5J2UF 3CQZA 3M3YH 4RHSA 2H5XA 2JEFA 1T5XD 2WAQG 4A3LH 2B63B 2UUAQ 2VNUD 1I7LA 4X3UA 1ZKOA 2Z6KC 2JEIA 5IIFA 4LF5Q 2R85A 3U4VA 4I7AA 2KHJA 2R7ZH 5K36G 5IGCA 1WTVA 4ED7A 1RDPD 3Q24A 2LSSA 3BG5A 1EHIA 4A3KB 4FS2A 4G7OC 1IL8A 2RBMA 2V9WA 3W1GA 5IYZF 4A3BG 4J9QA 1I4QA 2R7ZA 4X6AH 3NTKA 3P1HA 5EBDA 2E2IH 3JAMW 4RU9A 4YY3H 2B2YA 2O4XA 5EPKA 4H44C 5LOVF 3CHBD 2HHHQ 4H0LC 3BQ1A 2WP8J 1GUWA 4C3IB 4LFBH 4I7ZC 2GA4B 4K8IA 2EPBA 2Q2HA 5C3XA 4V190 4MAMA 2W9AA 1OTCA 2CW0C 1Q12A 5FLMG 1JE5A 2E2JB 2E2HH 2AQ3B 2W6OA 3GQBA 4PG3A 5KYIA 4JV1A 4JBJA 2GPWA 5DG7A 1F2ZA 2R6FA 4IZOA 2MO0A 3S15H 4F7XA 3DM3A 1PX2A 1S68A 2MHVA 1TWHH 1NR4A 1VQKA 3PF5A 1GUOA 5IWAL 2G9DA 3PUVA 4KLKA 1EQQA 2IBKA 2BR0A 1HR0W 1MSHA 4DR5Q 1YJ9A 1RF2D 2V4DA 1LABA 3IFTA 3JAME 2FK3A 4B3TH 3CF5A 5LXTF 2PMZB 2M2LA 4IJLA 3QJYA 4I50F 4QGUA 2M00A 1Z2NX 4ECRA 5LA6F 1XMQH 1GUTA 2XTIA 3HOYG 1G2TA 1GLVA 1YBYA 2CW0D 5M5YB 3VPDA 2FXQA 3KDFA 2DPJA 2I5MX 4X64L 1DD2A 1WJJA 3L0OA 3GO5A 1LTBD 3MR6A 4JI6Q 3RAXA 1XPRA 1QOHA 4YJ3F 1FD7D 2NVXH 3TIGA 5A2QE 3HKZB 5E3FA 2AUJD 1G291 2ZM6L 2OF1A 3A54A 2YZGA 3T16A 3MFYA 4FO2A 2R6GA 3C1FA 3S17H 3M4YA 4GLAC 4POGA 1UNSA 4QCLA 4JI0Q 4B3RL 3GTPH 3J80c 1IBMQ 5L1JA 4GKJH 1Q90A 2G9HD 5IGBA 3PO3H 4LFBQ 1SRUA 4EYHB 1U4MA 1QG7A 1U0LA 4RGOS 1IBML 4PWQA 3CCUA 1JXLA 2A1AA 5IGDA 2ATWA 3TP7A 1EIHA 4ECUA 1CSQA 1M90C 4KKSA 2AWNA 3MXUA 4K6LA 2JP1A 2F0WA 2R7FA 4BBRH 5JJKA 1ZHSA 2PI2A 1LUZA 1H9SA 2JN4A 4AIMA 4L5RC 1JJCB 3GP7A 5D3IB 5KFWA 4FF1A 2HQLA 5KFNA 1ZQ7A 4J9SA 2N78A 2B2TC 1Y1WA 2DUDA 4TQRA 3GTMB 1BF4A 1SE4A 2VB2X 1JJ2A 3TREA 1GM5A 2IX1A 1WVLA 4DR7L 1WCMA 2C2EA 2AKWB 4HJ7A 1NR2A 3GTKB 5KFBA 4X66Q 1VQ8A 3UQ8A 1V43A 3EIVA 1EEFD 3KF6A 4IPGA 4RGMA 1XMQL 4FBUA 5LYJF 2YU9H 2B8FA 2FFKB 5F9NA 3ORQA 2AU0A 4NXML 2RDIA 3T1HQ 3PN1A 5KT6A 3Q22A 3EA6A 4BBSG 3RBDA 1VQ5A 2LY7A 4NXNQ 4AYBA 1DV2A 3C46A 1Q8IA 1VCIA 1I4RA 1LT3D 1QZHA 3NGDA 4NB3A 3I3CA 1S97A 1I6UA 3RFCA 2MUYA 5CORA 4KN4C 5ELEA 2YU9B 2EJFC 4HMIA 3NWTA 4NXNH 1S0NA 3A8JE 3M3YB 5CAEB 4O3RA 5EOYA 1YJWA 1EU4A 1DM0B 1TWAB 5IYCH 2PQEA 2RCFA 3K7AB 3N6RA 5EQ0A 3S1MB 3CU7A 2Z4IA 2DJGC 1UWVA 4MV7A 3Q8DA 3A74A 4DL5A 3H0GG 2JEAI 2CKZB 3HOVH 1M0TA 4FXDA 4IUTA 1PFNA 2ENBA 1UEAB 4PDBA 2F0LA 1EY8A 4DV1L 2NZOA 1RIPA 2AGOA 1W6JA 3IFDA 5DG9A 3FKIG 1X55A 1IZ6A 1RCVD 2FMAA 1IW7D 4QWBA 1ET6A 3K3PA 3MA2B 1MBYA 3K7AH 3T53B 5LMUL 4K5WA 5JJIA 5DQIA 1SJHD 3J81W 4X65H 2KECA 1HA6A 1CKOA 2F0HA 1TWFA 4LF4L 3HOVG 4J9RA 1C0AA 1MHWC 1N36H 2J6SA 3I8ZA 2R92G 3GTOH 4EBDA 2P5ZX 4B3MH 4R8IA 4KMUC 4DV4Q 1WYDA 4B08A 2W6PA 1I6HB 4QB4A 1WI5A 1N32L 3TEHB 1YIJA 2A68D 2VPQA 1VQIA 1FYCA 2PMZE 3GIJA 5L37A 5C44H 1PH5A 3M4PA 1I4XA 4A3DB 1FL0A 1PVOA 5L1KA 1X32A 4RWSC 1YI2A 3LGJA 1I94Q 4JI1H 1JX4A 4ZRZA 2YW2A 1E3PA 3HEJA 4IALA 4QMGA 5C6AA 2PO4A 4A3DH 5KFLA 3QZ8A 3IN5A 3JZIA 1IYVA 2RDGA 4LF9L 4NXMQ 3CCRA 3GIPA 4O3NA 5COYA 4APVA 5KFMA 1LTSD 3H6MA 1Q82C 3IRBA 4A3JB 1AE2A 2RF4A 2IWHA 3RLNA 3WO1A 1D5XC 4OIJA 4A3GB 4X3SA 2YCHA 3H4DA 1ZETA 4JBWA 4A3IG 4Q8FA 3TZDA 2Z9HA 1J8IA 2HVRA 1Y1WH 3H15A 1KJIA 1IOWA 1I50A 2Y0SE 3NEMA 4MV8A 3PIPA 3TQYA 4M8AA 4P72A 1B6RA 4DR4Q 3M9OB 1KAAA 2JA7A 1PA6A 5LMNL 3S16B 3E0EA 3S1QB 3KF6B 4TUYF 4ME6A 2B2UA 1S0OA 4APMA 4QW9A 1UUPA 3PUZA 1JMCA 4DV2H 4F4ZA 1VQEA 4C1NI 5H80A 1X6OA 2IX3A 3HGBA 5CA0F 3RUPA 1JOKA 2VY3A 3RD4A 2E76C 3EBEA 2JA9A 3OTOH 4DL2A 3BVMA 1N32H 2EDGA 3OSOA 5C0XH 1D8LA 5JPNC 3OWFA 5T1GA 1SEIA 1WTRA 5D3DA 2PBZA 4DR1L 3KHGA 4X65Q 1EEID 5CV9A 1A2TA 2R93H 2E75C 4RZQA 3S2DH 1LACA 1PH6A 3H0GA 1TWAA 4JVZA 3WWVA 2JXMB 5DM73 4LH6A 2K75A 3RV3A 2KBNA 3K59A 1I7NA 1SDFA 3V05A 1F9PA 2AQ1B 3PCOB 2EXZA 3QIAA 3VYTA 2JA6H 2C00A 2FE3A 3S2DB 1A63A 3OUZA 4RZRA 1HNWQ 5EPLA 1ML0D 1FJGL 3TZUA 4EQNA 5C4XH 2V1CC 1EL0A 2RQXA 1CS0A 2NU6B 2R61A 3UFXB 5KFHA 2R92B 2EY5A 4LMQD 2YTYA 4HCSA 1K8OA 1BCPC 1CTMA 1D2BA 2JA7G 1X9NA 3EVQA 1TWHA 1IYJB 4XZ3B 4LMYA 3CAMA 3J81i 2BDOA 2Q8IB 4DUYH 1LTGD 3BDOA 4DR3H 1ONLA 1B50A 1D5ZC 3GTMA 1IBKQ 2E2HB 1K8MA 2WACA 1B6SA 2ASLA 1Y1VB 3SGIA 4C1NK 3CCEA 4MV9A 4KTAA 4DV6L 3NTIA 3EPIA 1K83A 4WD3A 3M4QA 3AMUA 3OHBA 3CQZB 5BPHA 4C5BA 2NB0A 4L6TB 1HR0L 3T1YL 5KT7A 4EFEA 1BBXC 2R82A 2W8KA 1A62A 5FLXE 2UUAL 5KFUA 3GTLB 2V4QA 4LF6Q 3KYHC 4EX5A 4IRKA 3NQIA 3DF7A 4PV1C 3D4WA 1VQAA 3G8CA 4ODGA 5FD5A 3T13A 4TKOB 5JVH3 1UEBA 1G91A 1KLUD 4ZI7F 3D6WA 2CWAA 2OQ0A 2IHEA 1UAPA 2A6HC 5DLFA 1HZAA 2UXCQ 3I2ZA 5EKLA 4DAYA 3IAYA 2EQSA 2RHSB 3BYYB 3OSPA 4A75A 1F9RA 1VQOA 1EYGA 1JWSD 1RHPA 1Z6HA 2GLTA 4ZKBB 1E4EB 3PIO3 2ZTEA 2B2YC 4O4HF 2EY1A 1FVIA 1I50H 1ZYRC 3RTXA 4EQPA 3I56A 3GD7A 2NVYH 5F2DA 3CCVA 3A5UA 5IYCG 5KT2A 1ICFB 2ZJQA 3PW5A 5GAEC 2FMMA 1C9OA 3GTGB 1HJPA 2F4VL 2NN6I 5IT9L 1C48A 1KIXA 2IA6A 5C4JB 2VUMG 4DR6Q 2R7LA 1I3QH 4XT3B 1TWGH 3MWDA 4IPDA 1A15A 2VA3A 4BBRB 1EY5A 2OT2A 3SHLA 1GSOA 2R87A 3H94A 4GKKL 2L11A 1R4PB 3PZPA 4IRDA 3GTJA 4ED0A 2YYZA 5M3FB 2F0NA 4U7CA 2AWOA 3HOUH 1V9PA 2DY7A 3SEBA 5L1LA 4PQXA 4AQYH 2PI2E 1A8VA 4RA8A 3ER0A 5FPRA 5IP9G 3MWYW 4B3SL 2Q8RE 2F0MA 5CV4A 1YHQA 4OHJA 1I4HA 1HFNA 1AP0A 4YY3Q 3KUPA 3PO2H 1K3RA 1T36A 1IKLA 1DXMA 4CKCA 2Y0SG 3OW2A 3FMAA 3V2TA 2E2DC 4LFCH 1TAEA 4RFBA 5C3EG 3GLKA 5HURA 4A3FB 3QFFA 4EFBA 2TSSA 1YNJD 1LTTD 3NP8A 5BMVF 2WTFA 2Q2TA 4JI4L 5JUMA 4DV7H 1L1OB 5DG8A 4KY7A 1B1ZA 1JORA 1BGWA 2NZ1D 5JJZA 4G7ZC 1S72A 5M5XB 4IN3A 3OMGA 2DZDA 3M9BA 4H02A 4CDCC 1K73C 3H3VC 2IHFA 4UP7A 3TP8A 4K14A 4XDXA 1YHAA 2XVSA 4JC0A 4WJWA 5D65A 5C3EB 5J22A 2WDTA 1CKNB 2F0IA 2XGTA 3E9HA 3QWNA 4DR2L 1G51A 2E5LQ 1GJXA 2GPSA 5FLMH 4UFZA 3FPUB 1DCZA 1CZGA 1X65A 4DXGA 2EY6A 1MZBA 5KX5F 1KDBA 2KVMA 5LMUQ 2RGRA 1JC7A 4WBNF 4YAJB 1FJGH 3UDIA 4C3JG 1DONA 4A3CH 2Q2UA 3E9IA 1HNWL 4ECXA 4FDBA 2ASDA 4DV4H 1AFPA 1ZXTA 1J9OA 3GTMH 3Q2OA 1PTOF 4RKBA 4YIJA 4CDDC 3HOYB 2GVAA 4AQYL 3I4NG 3EYYA 2HIXA 1WOCA 1D1IA 4NW2A 3A7AB 2F4VQ 4B3SH 3LMLA 4KKTA 2ALZA 3RBEA 1IXRA 4LF8L 3D6CA 4OL7A 3FRPB 3M9MB 4UCRA 1LTRD 2HDLA 1EQVA 2AHOB 3HXLA 4I7HA 3H09A 3HOZH 2IX0A 4LWCA 5DAUA 2JA5H 2N88A 1QCBD 3RGXA 1SYGA 4MNOA 3GV5B 3L4KA 1WD1A 2W9CA 1VQFA 1BQQT 3H91A 1D1KA 2GN5A 4GS3A 2UUBQ 3TP5A 4FXGC 2ZDGA 1G8ZD 4GN4B 4UAIA 1LTLA 1TIID 1WFQA 1SNDA 2WKDA 1WTOA 1BJTA 3MXNA 1SN8A 1W6KA 2ZM6H 4HSPA 1BUVT 1HTPA 2F0PA 2Q2IA 5JVLA 3WO0A 4XIGS 3JAML 5K2MA 3PUYA 1T3NA 5KG7A 2HCIA 3ULPA 3PO2B 2KCTA 1STGA 4AYBB 3SE7A 1ULZA 1X3PA 3KLRA 1XNQH 4UDUC 3BU2A 1U4PA 2SNMA 3R2TA 2BA1A 1PZKD 4X62L 1RJPA 4KHPQ 5KFJA 1CKMA 4JCVE 4DF7A 4QUCA 3CC2A 3KLSA 3FKIB 1LM0A 4DR7H 2B2VA 2B2VC 5A2QL 4LFBL 3K58A 1X54A 1IBLL 2NVQB 4RB3C 2KEEA 4KJOA 1K1QA 4JW0A 4DR5H 4EEQA 2I0QA 3PR4A 3CMAA 2NN6G 1EY9A 3N44B 1EOVA 4O1NA 1H9MA 4GKJQ 4E6IA 4HTHA 2UUBH 1BKBA 3M85A 2UUCQ 4IHJF 3TBIB 4JYAH 1OXXK 5FO7B 1QVGA 2QDLA 3HKZE 3BS1A 1S10A 1RJTA 1NAPA 2PN1A 3T1YQ 4CJ2C 3L3OC 2YTVA 2E8GA 2B63G 1R4QB 3K5OA 1E4FT 3OHAA 4RGNA 5C0XJ 5FOBB 1PH8A 3K5HA 1XMOH 1QE6A 4DV3Q 5NUCA 2MQHA 4G3IA 2L0CA 2FINB 2V59A 1PDQA 2SCUB 5KFOA 4WFN3 1BXRA 4BWGB 5M9OA 2A69D 5D1OA 4X64H 1HNXL 5EDWA 1B9NA 4ECYA 4Q0FA 4B3RH 4MV3A 4LUVA 2RHQB 4OO1G 1S03G 4U6PA 1TQOA 2EOTA 2ZJTA 4IWXA 2E2IA 3LX0A 4OWWB 1AUXA 1O7IA 4LUZA 2YRXA 5C4XG 4JV0A 4LNQA 3MXPA 4IRCA 3GTLA 2VQEQ 4OX9L 1JDEA 1AW7A 2DN8A 2HD3A 1QILA 5JOBA 5FJ8G 4O2BF 4Q45A 3J80L 1FGUA 3NPPA 4JI0H 1NUCA 3KLSX 2ICEC 2KCNA 4R1JA 3MHBA 1VKZA 4J8QA 4B9XA 4F8MA 2MFIA 2VQFL 3R23A 5CV6A 3BQ2A 3P75A 3S1RH 4CBVA 2SOBA 1SMYD 1E4EA 3GTPB 4JI1L 3U9OA 3T4AC 5KG2A 5CA1F 4GN5A 3RGZA 2C9OA 1HZBA 1S3OA 1RTOA 1LO5D 2NVTH 3LWEA 3UE0A 1RJQA 3J81c 3RR5A 5FLXc 4MA5A 1KEEA 1EWHA 4IZ8A 4KHPH 4HN7A 4UCOA 4B9WA 1M6VA 4JI8H 4NXMH 3M7NA 3PUWA 1E7ZA 1BDOA 1UE6A 2VR1A 5EKKA 5M5YH 3HG9A 1XMOQ 3R93A 1HNXH 1RK6A 2BCOA 4A3FH 4RAYA 5KFGA 3MR3A 3OMCA 2PPBC 1F2YA 3N52A 3RZDH 4ABNA 3GIQA 5AFWA 3BA8A 1E24A 4EGQA 2HCCA 1VAJA 4XQJA 5KKNB 2W9BA 5KG5A 3S24A 3A5ZB 4P2CB 5DQHA 2K7VA 4KJNA 5DGAA 1V1OA 3GTKA 1Y1WG 1E2WA 5AJ3Q 4J9MA 4OX9H 4J9NA 2HGSA 2LKVA 1IBKH 4PMBA 3TMEA 1RYRA 3VR4A 5I2YA 3PO2G 1GVPA 3W3AA 1DIKA 3HOUB 1BCPB 4DGZA 1ILQA 2QEJC 1XTCD 4QL5A 2XD4A 2FLPA 1D6EC 2EXDA 1VBHA 1KL9A 2KCMA 1TWGB 3K8AA 2FKLA 3GV8B 1GKHA 4PNYA 2IL8A 4POFA 1WTXA 1HH2P 1VQGA 5A2QW 2VS1A 1I3QA 3DHQA 2PVPA 2B2WA 4FP5D 2H1EA 3MTSA 3GIKA 1Q8KA 1STEA 5DNFA 2UXCH 3OTOL 3I4NH 1Y8PB 2OXPA 5KFXA 2K03A 1S5DD 1W93A 2W57A 1L0XB 5ELCA 1RYSA 1M8AA 5M3FG 4JV5Q 4R4CA 4ZYSA 4Y52H 5IP7G 4CKBA 2QYZA 4IUPA 1VMCA 1STBA 4ME3A 2UXBQ 3S9WA 2R92H 3OPOA 4N8X1 4HYKA 1WH2A 1VQPA 4HNTA 4F50A 2Z8LA 2PMZA 1GSHA 4MTDA 1VQBA 1KHIA 4OGQC 4L5QA 2A8VA 4IR1A 3RZOH 1PH1A 1NJIC 2SEBD 2JA5B 5A35A 1ENAA 1N8RC 5IP7H 5FPOA 3SXHA 2Z1CA 4ECQA 3BJYA 2I87A 3TS0A 4WJ3M 4BXXG 4DV2Q 4RB1A 3K5NA 4A3IH 4DR3Q 4A2AA 3MEHA 5IE8A 4DV6Q 2XCAA 1I6VC 1IBKL 4OX9Q 4IAJA 4F4WA 4DV5L 2B3GA 2F0UA 1DYQA 1KDAA 4CJ1B 1CA6A 3V96A 4Q0YA 1BR9A 1HNZL 1HNXQ 3M9NB 3FDTA 1N48A 3KAKA 3NE5B 2I07B 1EWCA 4LFAL 2K5NA 2YZMA 3QOLA 5FJ8H 2A6EC 4DUZH 1XMQQ 1YNND 4FM9A 5M3MG 1TXYA 1XX8A 3FMCA 2N55A 2ZXPA 4RCNA 1CHQD 4IUNA 3A8KE 3T1HL 4B3TQ 3S15B 2PNHA 2VL6A 1H9JA 3NTHA 3QOJA 3S16H 2DGYA 5HGTA 1B8AA 4DNTB 3HP3A 3M7GA 2OH2A 3AFPA 5GQOA 1F2MA 4GNXB 4IJHA 3QG1A 2F3VA 4NPSA 1E2VA 1WTHA 1Y8OB 1VQ9A 3LWBA 1XPOA 1QWYA 2A74C 4ZK9B 3OIQA 4RAZA 1Y1WB 5L1IA 4YR3A 5M5WB 5JEAJ 4LJZC 2R93G 1RODA 4H7BA 3I91A 3G71A 2NVXB 3LP8A 1RD9D 4DAMA 4MZ9A 1EY7A 4UP8A 2D0OA 1K0SA 2F3IA 3B6YA 1MJCA 5T1IA 1IKMA 1Y69U 4QJFA 2JA6G 5J39A 5GAHC 2F0KA 2IW3A 1XNRQ 5KG6A 4ZQIA 3OW7A 4JK1C 3T5JA 1ESFA 4UPAA 4JI8L 1TS3A 5KGUA 4IURA 1V1PA 1B44D 1DGSA 3RNUA 3KTMA 4GKKH 1PYSB 4DK0A 5C4HA 2VQEH 2QCPX 1FKAH 2Y0SB 4X62Q 4F4YA 5I47A 1STAA 4X64Q 1PRTC 3EQLC 1HPCA 2MGSA 2OCEA 1LV9A 4DAVA 4C56C 2N49A 4GNXC 5M3MB 4JI7H 1OXVA 4O2DA 5FKAC 3GTKH 3G6VA 5KFQA 1K8GA 3S2HB 3CP0A 1DZ1A 1UE5A 3F1ZA 1ENCA 5FO9B 3NUCA 2Z4HA 4RKLA 4P74A 3L4JA 3AU7A 4UHVA 3EROA 5BN4A 4BBSH 2UXDH 2KA7A 1S9FA 1TU2B 3BJUA 3JC66 1TA8A 1QZGA 1BOSA 1IBLQ 5D8DA 4PMWA 2UU9L 4ZLTF 2HVSA 4RNOA 4LFAQ 5C3EH 1MKHA 5IT9W 3CCSA 3I73A 1V8QA 5ISRA 2NU9B 1A9XA 1V1QA 3W1BA 4A3LG 3F2BA 1SFOB 4JG2A 1PZJD 3G4SA 4P73A 3RLOA 5KFCA 1KC7A 1CUKA 2L1BA 4CGYB 2VQDA 1B7YB 2X0SA 4A93B 4EG0A 1GSAA 2K5DA 2NU7B 2J9GA 4C3JH 3ERQA 3NHHA 4M9UA 4IO9A 2KEDA 1K0RA 3H0GH 2YS6A 2B63H 4OO1I 5LHY1 5KT4A 3U9TA 3SE0A 1BO0A 3R5XA 1EIFA 2F0GA 2UXBH 1SSOA 2K32A 2AGQA 5IYBG 2JA5G 3K0YA 5C5LA 5EWEA 1GD7A 3I4MH 4IFDH 4L1KA 2DPIA 1XTDA 2PNRC 1NMGA 4ZAIA 2PZWA 1AH9A 4C3IG 5I9PA 2EY2A 2L9HA 4KN7C 3DEPA 4YAKB 5BPFA 3KAJA 2R8KA 3A55A 2K33A 1G6ZA 5LL6b 4V0BA 5CV5A 3J81j 3WOEA 3ICEA 1JDBB 5C4JH 1X3GA 4ETSA 4A3EH 4OXPA 3OHXC 4L5SA 4FF2A 5T14A 2JA6A 2PYKA 4JI3H 1QUQA 3VR2A 4UY8C 2WAQE 2FK2A 2BE5C 1TWAH 1FNVA 2YV5A 4KKUA 5D14A 3HFZB 5CR3A 3PW0A 1V51A 1YEZA 4R8NA 4ZCKA 3GIMA 2ATLA 4C3HG 4GN3B 1KQSA 2CQAA 3J80E 1ILPA 3HKSA 5HGQA 1JLLB 3IG0A 3MC0B 4M1UB 4DUYQ 1S0MA 4RH6A 1B3QA 1L2ZA 1XPUA 5E4WC 2HIVA 5E1FA 2HUGA 3WOFA 3K5IA 3NK9A 1GOZA 4YCVA 4DV7L 4JI4H 4J9LA 3K6OA 4R8UA 2L55A 2F0QA 1IOVA 2XC9A 5IT9c 4IFDJ 5EWGA 4ED8A 1PRTB 2Z6BA 5M5XH 5IYDH 3T5LA 4NMZA 4J9OA 4A3KH 1U9RA 3G48A 2CVRA 2NTTA 3MFGA 1T94A 3MEFA 1EYCA 2CQOA 3AYHB 3T51B 1BBUA 2QKIC 1RK5A 4DK1A 1SBBB 4XYOA 3HOZG 5JVDF 1O7LA 3WNZA 4QWEA 2K28A 4NKLA 1EQRA 3RN2A 3N6XA 4HMJA 4TQSA 4QUFA 3MWEA 4BBSB 2LS01 4A3EB 5E7NA 3KALA 3ZYYX 2KSWA 1FGBD 2W6QA 4WRDA 2EYPA 3BA9A 4BBRG 2C2DA 3F8NA 1IYUA 1TWFH 4PZ6A 5KFYA 3G7LA 4YQWA 3PV0A 3VDYA 2W6NA 1E4GT 2EYJA 1VBGA 2IP4A 4HAEA 2IY5B 2OWOA 2RGVA 5KFVA 5M3FH 4XX0B 1SNOA 1NSNS 3STBC 3NSWA 4JYAL 3E5NA 4A3GH 1TT2A 2C5CA 1Z2OX 1YZ6A 3VPBA 2B2WC 5KIXA 4Q44A 2JK8A 2CH4W 5KNBA 3NBHA 1SE3A 2WAQB 3A0JA 3HKZG 1I94L 1GO3E 1YJNA 2A73B 1PXUA 2EJGC 3K80C 4HR7B 2NVYB 3H0GB 3SDZA 2HJWA 2P0AA 3GIIA 1VQCA 4ECVA 3V6HA 3C3LA 4BA2I 3N43B 4YCUA 5KT3A 2C2RA 1XMOL 4ZQ3A 1SCUB 1HR0Q 1VQ7A 5C4XB 4OONA 4K2LA 4QWCA 3CXCA 3NWSA 5KEEA 3Q8SB 1YNXA 4C2MA 2ZDHA 2RSOA 3DUZA 1PH7A 1HRJA 5TSSA 4CKEA 1R9TB 2WB1A 3NELA 1CQVA 2CW8A 3J7AV 3RZOB 4HIMA 4FU0A 2JEGA 1X56A 2EYFA 2UUCH 2K52A 3EFXD 1KC8C 3CD6A 3O13A 3JAMi 2OLSA 1JIHA 1Y14B 3HS0C 2FPGB 1KNAA 2JE6I 1C30A 3H40A 1PFSA 4DU9A 1Y1VA 4XYLB 4DK3C 4CJ0B 4OELB 3H3VH 4QIWA 3TS2A 1XNQL 4MA0A 2QK4A 1JB3A 3V6JA 1HTLD 4DL7A 2NBFA 1QVFA 1OXSC 3I4NB 2XNAC 1H9KA 3T56B 1SYEA 2LXJA 3PMFA 3U50C 3LNNA 1V1PB 1KAWA 1HXYD 4TV8F 4ZKCB 2BE5D 3ERSX 4EGVA 3MJFA 5BR8L 4H13C 5CV7A 2K6AA 4C5CA 4X65L 1GGOA 5KFAA 3RUZA 4KV6A 4LK1C 4BA1I 4RCOA 4K8JA 4HCEA 3Q8PB 3Q1KA 3BYTB 2A19A 4YHHL 1PH4A 4LH7A 2ZJRA 3W5OA 2NYZD 1E2ZA 1G6PA 4ALPA 2D9UA 2N8NA 2NN6H 1PH2A 2PCFB 3C2PA 1PTOD 1PTOC 4DR2Q 4IFDI 2H4OA 5C44B 1S5FD 2DWCA 4UP9A 3MFHA 2Z6KA 4YBZB 4GC7A 1TWCB 1EYAA 1BNCA 4IUVA 4YWMA 5FK9C 4O42A 1NCVA 2KHSA 4XTCS 2UU9Q 2AUKA 1Z2PX 5KG4A 5KFSA 3QZ7A 2QA4A 4FBTA 2K14A 3KDFB 1TR5A 1KJ8A 4RNNA 1D5MC 3FKIA 4ULLA 4EQOA 4PMCA 3LWUA 4DUYL 1AZPA 5ELFA 2JSOA 4XT1B 3U4ZA 5KFIA 3RB3A 3BZDB 1KLGD 2VXWA 3S1NH 2J4XA 4L8JA 4K0KQ 2AMCB 1N56A 2BOSA 4YJ2F 4DA2A 2DY8A 3PQIA 1WR2A 4M7EA 2WV6D 1W96A 5HV6A 1U4RA 1GUGA 3W2DA 5CBEE 3N42B 1KTKA 4YR0A 1B33N 3UI2A 2F03A 2RKSA 1ENFA 1UE1A 5I6YA 1Y8NB 2SDFA 3J80W 1BVSA 1SE2A 4GNXA 4F88A 1NNXA 1Z9FA 1UC9A 3T5KA 3QB3A 4IQZA 2PW5A 3SK8A 4GKKQ 1EZ1A 1B4OA 3OOCA 4JOIC 3I4MB 4MV6A 4IR9A 3D4DA 4O0AA 1JQYD 2F4IA 1EYDA 1FR3A 2RSNA 2UXCL 2I5LX 5D1PA 5KT5A 3DEOA 4YHHH 4ID6A 1W2BA 2ZXOA 3IL8A 1N32Q 1B3AA 2VQFH 3KBXA 1CT1D 1EY6A 2BDNA 2FP4B 4R8UB 4AYBE 4LF7H 3R5FA 4JI5Q 2VZAA 2MJ8A 4BWSC 2R93B 4B3TL 2BQUA 4LF4Q 5ELBA 1PRTD 4Z9CB 5J2TF 1K1SA 4A3IB 2DNEA 5I9OA 2R7ZG 4WJ4A 1EQTA 1OWTA 2PQAA 2C22A 1I4GA 4Y8VB 5BN3A 1WTPA 1PTOB 3HOWG 2WFWA 4K5VA 5KNDA 3STBD 5CYUA 3T5HA 1XXGA 1F2LA 4C5AA 3CKIB 2N3SA 3GV7B 4MN3A 4HJ9A 2B2TA 1C8CA 1L2FA 2E2HA 1J5EH 1ET9A 2K4KA 3CC7A 1PH3A 3PO3G 3TINA 4DV5H 3MZ5A 4DUZL 4DL4A 3RIZA 4PZ7A 2CFMA 2B8GA 4LFCQ 4KY5A 2MNAA 3NBIA 3ZJYC 1U4LA 2XWBB 1WSCA 5EGTA 2YZNA 1BNZA 4KK7A 1O80A 1J6QA 2HHHL 4JBMA 5GROA 4A3JG 4DLKA 1N33Q 4ED6A 3TQTA 4E4TA 4DXFA 3TQ1A 2B39A 1KNEA 1P16A 5JEAH 1Y1VH 1L1OC 1JOQA 4DNIA 4N9TA 4LF6H 1STYA 2K1BA 3GTJB 2R8GA 1YVCA 5FLXL 4A76A 4R4IA 4BXXH 1PTOH 4QW8A 1O78A 2XN9C 3RAQA 1YNNC 3S1MH 4DFAA 2JYOA 4LF7L 1JOOA 2A6ED 3TSSA 3CCQA 3KHRA 3K0XA 4TVAB 4JI5H 3SK6A 5IP9H 4BY1G 2WB1B 1R9TA 1WTQA 4RGTA 2FHTA 2R7ZB 1PFMA 4RUCA 3F2CA 2NUAB 4NLGA 3BVZA 4JI2H 1PV4A 3QR8A 1U5KA 2V5AA 1KRSA 2XRSD 5IY0A 4Y7NB 4IOCA 1AN7A 1E0BA 2QEXA 2KHIA 2KOLA 1G2SA 3F2DA 2ZJPA 1EIYB 4A3MG 5M5WH 5E4XA 4QWAA 3GTOB 1YITA 1XJVA 2HDMA 4YCWA 3Q6SA 2YL2A 4JV2A 4Q5VA 5KG1A 4DV0Q 5JH7F 3J7YW 1HNWH 4TSSA 2QGQA 3KOJA 2O5IC 2BH8A 1WD0A 3ETHA 4HIDA 4NXNL 2JA8H 3BZKA 1KJQA 2J6TA 1EFID 3L7ZC 5CGKA 4XQNA 4HJ5A 3A8IE 3BAAA 1VQLA 5IT9E 4EYIB 1TWFB 3UE1A 3I55A 4BY7H 4DL3A 3J80i 2VUMB 5CC4A 1ZHQA 3BG3A 5J3BA 1WTWA 2HVQA 1M0WA 2JQOA 2OEOA 3FP9A 3E5SA 3H20A 2KENA 3FKIH 3L2PA 3S1QH 3JAMc 3VR6A 4LF6L 1HNZH 2JA7B 1AUVA 1EYZA 4JI3Q 4DR4L 2DIKA 1SYDA 3PSIA 1ZEQX 2F3WA 2Z0SA 3KHHA 2DLNA 2FPPB 4MTKA 2HT1A 1EY4A 1EUDB 4LFAH 2UU9H 1HQMC 4R9WA 2WYOA 1C4QA 4I65A 3VYUA 3V6KA 3I4MG 4IFDG 1JT8A 4YWKA 2R86A 2CWPA 4OWXB 4RUAA 4FS1A 4JI8Q 1Q3LA 2RDHA 4R4TA 4C3JB 5I4DA 3T1HH 3GV3A 3UDFA 3MXGA 2NUCA 5G3LD 4A3FG 1SAPA 1A3TA 1M1KC 1XNRL 1EOTA 5IWAQ 4OWTB 5DGBA 4LAAA 2G5DA 1CKNA 2Q8TA 1A2UA 5CMDA 4UCSA 4MTEA 1SE8A 4JPBW 3OYYA 1EZ6A 1A6XA 3AQQA 4L5TA 1TWCA 3CVZA 3J7A5 3KBGA 2X69A 3R2IA 4JOIA 2O2LD 1CA5A 3M4IA 3BVGA 2W9CB 4G4KA 2UXBL 1TVXA 2KQ3A 4IPCA 1HNZQ 4JI6L 5K5PA 2AQ2B 3EJIA 1PYWD 1SR3A 3HOZB 1BXTA 3RLFA 4FNFA 3Q8QB 3TP6A 5C0XG 4EGJA 2R8JA 1SMXA 2IPKD 5KFZA 2EYHA 5KFKA 2QDBA 1S40A 1HQRD 2VW9A 2ASBA 3GTLH 1XYIA 4UCVA 1Y1VG 5I6WA 1IBLH 3S1RB 4A3BH 2W8LA 4F4XA 2W6ZA 3FPPA 1VQ6A 4CC6A 2YU9A 1M7JA 2ES2A 1SROA 1HUMA 3BQ0A 1STNA 4MHEA 3Q8RB 4LSXA 1HR0H 2VPSA 4DR4H 2L12A 3ULLA
chains in the Genus database with same CATH topology
4IO9A 3ER0A 1K0RA 3H0GH 4DK6C 3K81C 5IP9G 4B3SL 1PH9A 2B63H 4JV5L 1YHQA 4OO1I 4YY3Q 1EIFA 3PO2H 1K3RA 3OW2A 2Y0SG 1VQNA 3K7UC 5IYBG 4DV3L 2JA5G 2OTLA 2I5HA 3GDEA 5C3EG 1GD7A 1NMFA 1VQJA 2B29A 3I4MH 1MIUA 4A93G 1IL2A 2Q2TA 4JI4L 4A3MH 1L1OB 1XTDA 1NMGA 3UDGA 3S14H 4X66L 3CPWA 2BH2A 1AH9A 4R4QA 1S72A 1E22A 2ZM6Q 4HJAA 3M9BA 4H02A 3RN5A 3GTGH 1K73C 1X3FA 3J81j 3ICEA 1NBWA 2IHFA 4UP7A 4BXXH 2EIFA 5C4JH 1MJEA 1X3GA 1YHAA 4JI6L 4JC0A 1LYLA 4BY1H 1QVCA 1VQ4A 1PYBA 4A3EH 1CKNB 2XGTA 3E9HA 4OXPA 2E5LQ 4DR2L 1G51A 4L5SA 3CC4A 5FLMH 4DR1Q 4C3IH 1QUQA 4UY8C 2WAQE 4IOAA 1X65A 2NZHA 1TWAH 4GLXA 2YV5A 5LMUQ 3HFZB 1YEZA 3M3YH 2H5XA 3UDIA 2ALYB 4C3HH 4GN3B 1KQSA 2WAQG 4A3CH 2Q2UA 4A3LH 3E9IA 1HNWL 4FDBA 2UUAQ 2VNUD 2VQFQ 3HKSA 5HGQA 4DR6Q 4JI0L 4B3RQ 3GTMH 1Z47A 4DUYQ 2Z6KC 1H95A 4LF5Q 1XPUA 2HIVA 3U4VA 2GVAA 4AQYL 4GOPA 2KHJA 2ZTCA 2R7ZH 3I4NG 2HIXA 2JEBI 4YCVA 1WOCA 4DV7L 4K0KL 5K36G 2LSSA 5IT9c 2F4VQ 4A3EG 3KJPA 1PHJA 4IFDJ 3W1GA 2L15A 5M5XH 1IXRA 4LF8L 4A3BG 5IYDH 4A3KH 1XNQQ 3G48A 4LFCL 4X6AH 2E2IH 3D0FA 3MEFA 2CQOA 2AHOB 3AYHB 1BBUA 2C35B 2MO1A 3HOZH 2IX0A 4LWCA 3HOZG 2JA5H 2HHHQ 2WP8J 2VUMH 1EQRA 3RN2A 4MNOA 5LMNW 2Q2HA 1OTCA 4LUOA 1Q12A 5E7NA 1VQFA 1JE5A 5FLMG 2E2HH 4RG1A 2UUBQ 2GN5A 1WCMG 4GS3A 1K83H 4PG3A 4BBRG 1R9TH 1TWFH 4GN4B 4PZ6A 1LTLA 5H1SE 4JBJA 3PV0A 3VDYA 1WFQA 4A93H 4YHHQ 2IY5B 1SN8A 2R7DA 2RCNA 2OWOA 2MO0A 5M3FH 3S15H 2LXKA 3DM3A 3STBC 2K5VA 1TWHH 1VQKA 4JYAL 3PF5A 2Q2IA 3NENA 4A3GH 5IWAL 3PUVA 4KLKA 1EQQA 4XIGS 1YZ6A 1N9WA 1HR0W 2JK8A 3PUYA 4DR5Q 1YJ9A 3A0JA 3ULPA 3CF5A 3HKZG 1I94L 1GO3E 4IJLA 1YJNA 3K80C 2KCTA 4QGUA 1NY4A 2GVBA 4A3DG 2XTIA 2JJQA 1VQCA 3BU2A 3HOYG 4YY3L 4BA2I 4RMFA 4DPGA 4YCUA 4QQBX 2BA1A 4X62L 1YBYA 3CMEA 1XMOL 4C2MH 2OQKA 4KHPQ 1CKMA 2FXQA 3KDFA 4JCVE 2I5MX 4X64L 1HZCA 4OONA 3CQZH 1HR0Q 1LM0A 1VQ7A 2CCZA 3CC2A 1WJJA 3L0OA 3GO5A 3CXCA 4LFBL 1YNXA 1IBLL 1X54A 4JI6Q 1XPRA 1PH7A 2NVXH 3KF8B 1G291 2ZM6L 2I0QA 3CMAA 2NN6G 3NELA 2R6GA 3S17H 1EOVA 4GLAC 4HIMA 3U58A 4BY7G 4POGA 1X56A 4GKJQ 4JI0Q 4B3RL 2K52A 3GTPH 1KC8C 1BKBA 3CD6A 3JAMi 3J80c 1IBMQ 3M85A 1Y14B 2UUCQ 2JE6I 2PQAB 3PO3H 4EQ5A 4LFBQ 1SRUA 1PFSA 1OXXK 3OTOQ 4DK3C 1U0LA 1QVGA 5C0XI 3HKZE 3CCUA 1IBML 3H3VH 1BBWA 2A1AA 2ATWA 3TS2A 1XNQL 1CSQA 3T1YQ 2YTVA 2E8GA 1M90C 2B63G 2AWNA 2R7FA 5JJKA 1WCMH 4BBRH 2PI2A 5C0XJ 1PH8A 1LUZA 1SFOH 4KI0A 4AIMA 4L5RC 4WJ4A 4DV3Q 1QVFA 1JJCB 1OXSC 4Y7NH 2MQHA 3BZCA 1Q86C 3FHWA 3J7ZC 2LXJA 4KHPL 3U50C 2UXDQ 2HQLA 1KAWA 4KHZA 3TRZA 2N78A 3ERSX 2DUDA 5BR8L 1JJ2A 4X65L 3TREA 1GM5A 1HNXL 2IX1A 1VQMA 4DR7L 2AKWB 4HJ7A 4X66Q 4BA1I 1VQ8A 3KLWA 4LUVA 1V43A 3EIVA 2A19A 3KF6A 2RHQB 4IPGA 4YHHL 1XMQL 1KRTA 1PH4A 4OO1G 2YU9H 4GKJL 2ZJRA 3W5OA 4OWWB 3H3VI 4DAYB 1YHBA 3GTJH 1G6PA 1O7IA 4ALPA 4LUZA 2N8NA 5M3MH 3HOXH 1PH2A 4NXML 3T1HQ 5C4XG 4DR2Q 4IFDI 4BBSG 4LNQA 4UP9A 2VQEQ 2Z6KA 4OX9L 1VQ5A 3CW2C 4NXNQ 4YWMA 1N36L 5FJ8G 4XTCS 1VCIA 2UU9Q 4DR5L 1QZHA 4NB3A 1FGUA 4DV4L 5HY6A 2QA4A 2NVQH 3ULJA 2K14A 3KDFB 4R1JA 4P71A 1JJGA 1N34L 2UUBL 4R4OA 3PIOA 4DUYL 2MFIA 4B3ML 2VQFL 1YJWA 3U4ZA 5IYCH 3S1NH 3S1RH 3MXNB 4DV7Q 1N33L 4K0KQ 2D62A 2AMCB 1UWVA 3Q8DA 4JI1L 3A74A 2WB1G 5BR8Q 5JEAG 3H0GG 3G6EA 4LF8Q 2JEAI 2CKZB 4GN5A 3HOVH 4PZ8A 1HZBA 1OXUA 1S3OA 1VQDA 2NVTH 3UE0A 4DV1L 2NZOA 4J15A 1RIPA 1SLJA 3RR5A 1UE1A 5FLXc 3J81c 3CCJA 2BA0A 3FKIG 3CCLA 1X55A 1BVSA 1IZ6A 2ID0A 4GNXA 1Z9FA 4HJ8A 3M7NA 1E7ZA 1T9HA 1UE6A 3PUWA 3K7AH 4GKKQ 5JJIA 5LMUL 5M5YH 4AQYQ 1XMOQ 4JOIC 4A3FH 2VQEL 1CKOA 1KXLA 4O0AA 1OXTA 4LF4L 4DUZQ 3GTQH 3HOVG 1C0AA 2UXCL 2I5LX 4JI1Q 1L0WA 3RZDH 1E24A 1Q81C 2R92G 1W2BA 3GTOH 1I6HH 1N32Q 4DV4Q 1WYDA 4HIOA 1E1TA 3S24A 3A5ZB 1QUQB 4LF5L 1WI5A 4AYBE 1N32L 5ELNA 3TEHB 4YWLA 1YIJA 1Y1WG 5AJ3Q 1VQIA 1HZ9A 2PMZE 2VZAA 4JI5Q 4B3TL 3PO2G 4LF4Q 1GVPA 2YTXA 5C44H 1PH5A 4JYAQ 3M4PA 1FL0A 4HIKA 1PVOA 2R7ZG 4QL5A 3AFQA 4QY7A 1VS0A 2EXDA 5ELOA 3LGJA 3KJOA 1YI2A 1I94Q 1KL9A 3D31A 2KCMA 2PQAA 3K8AA 4DV2L 2IT1A 1E3PA 1GKHA 4POFA 4A3DH 1HH2P 1VQGA 4GOPB 2VS1A 2WFWA 3HOWG 4JI5L 3STBD 4LF9L 4NXMQ 3CCRA 3HOYH 4APVA 1Q8KA 2N3SA 3IRBA 4QIWE 1Q82C 2RF4A 1AE2A 3RLNA 2K5HA 3OTOL 4HJ9A 4JI4Q 4P75A 3I4NH 3PF4A 1L2FA 4JBWA 4A3IG 4AH6A 2K4KA 3CC7A 1Y1WH 3H15A 1PH3A 3PO3G 4WJ3M 5M3FG 4DUZL 2Y0SE 4JI2Q 3NEMA 4B3SQ 3PIPA 4PZ7A 4P72A 4R4CA 3TQYA 2CFMA 5IP7G 4LFCQ 3KFUA 4DR4Q 4Y52H 2MNAA 5C44G 4LF9Q 1N34Q 3ZJYC 4ME3A 2UXBQ 2R92H 1PA6A 5LMNL 1J6QA 3E0EA 3KF6B 5GROA 4A3JG 4A3JH 1VQPA 2HHHL 4JBMA 1N33Q 3AEVA 1J5EQ 5DLQE 1VQBA 1KHIA 3PUZA 1P16A 1JMCA 4A3CG 4L5QA 2A8VA 1Y1VH 3RZOH 1PH1A 1Q1BA 1NJIC 1L1OC 1VQEA 4DNIA 1Q7YC 1X6OA 1N8RC 5IP7H 1K8AC 1YVCA 2VY3A 3F8TA 3I4OA 3EBEA 2JA9A 4R4IA 4DV2Q 1NE3A 4A76A 3TS0A 4A3IH 4BXXG 4DR3Q 3S1MH 5IE8A 4DV6Q 4LF7L 3PUXA 3CCQA 2JA7H 3K0XA 4LW1A 1D8LA 4TVAB 1IBKL 4OX9Q 5IP9H 2B3GA 4BY1G 3UDXA 4DV5L 3HOWH 4DR1L 1HNZL 4GLVB 4X65Q 1HNXQ 1VQHA 3F2CA 2R93H 1B70B 4JI7Q 3S2DH 1PV4A 3DLLA 1PH6A 1U5KA 4LFAL 3WWVA 1J5EL 1KRSA 2K5NA 1P8LA 2K75A 5IY0A 2KBNA 3I7FA 4IOCA 1I5FA 5FJ8H 2OTJA 1KD1C 1XMQQ 2QEXA 2KHIA 3PCOB 4JI7L 2JA6H 3F2DA 5M3MG 2K50A 4MTNA 5M5WH 2ZJPA 4DV0L 4A3MG 1TXYA 1EIYB 1EUJA 1A63A 1HNWQ 4DR6L 1YITA 1NTGA 3T1HL 5C4XH 1XJVA 4B3TQ 4YCWA 2PNHA 2VL6A 1FJGL 3M4OH 4DV0Q 2UXDL 2V1CC 4DV5Q 3S16H 2DGYA 1B8AA 4A4IA 2ZTDA 2QGQA 3KOJA 2YTYA 2BH8A 3AFPA 5GQOA 1EWIA 5IYBH 4GNXB 4IJHA 4HIDA 4NXNL 2WB1E 1X9NA 4TQUS 4NPSA 2JA7G 2JA8G 1IYJB 1VQ9A 3BZKA 2JA8H 1XPOA 3CAMA 3J81i 3L7ZC 2E2JH 4IPHA 4HJ5A 1VQLA 5JEAJ 1X3EA 1CSPA 3UE1A 3I55A 4BY7H 3J80i 5IYDG 2R93G 1IBKQ 1Q46A 3G71A 4A3KG 1W3SA 1Q1EA 3SGIA 4DAMA 3CCEA 1FJGQ 3HOUG 4MZ9A 4UP8A 5J3BA 2D0OA 4DV6L 2F3IA 3B6YA 1MJCA 4LF7Q 2JQOA 3M4QA 4QJFA 3FP9A 5EAYA 1TWCH 2KENA 3FKIH 2JA6G 3L2PA 3S1QH 3JAMc 1UE7A 4LF6L 5GAHC 1C7YA 4JI3Q 1XNRQ 1HR0L 3T1YL 4DKAC 4DR4L 3PSIA 2Z0SA 3CCMA 4JI2L 2F52A 1A62A 2UUAL 2HT1A 1RL2A 4LF6Q 4UPAA 4JI8L 3KYHC 4EX5A 1L1OA 1DGSA 3EN2A 3RNUA 3I4MG 4IFDG 1JT8A 1PYSB 4YWKA 1VQAA 2CWPA 4OWXB 4DV1Q 4JI8Q 4R4TA 1EFWA 1UEBA 4X62Q 3UDFA 1N36Q 4GOPC 2CWAA 4X64Q 2OQ0A 4A3FG 2IHEA 1M1KC 2OCEA 1XNRL 4DR7Q 5JJLA 5IWAQ 4OWTB 1HZAA 2UXCQ 2N49A 3I2ZA 4GNXC 1CKNA 3PGZA 3S2HH 2EQSA 2RHSB 1OXVA 4O2DA 4A75A 1VQOA 1SE8A 1EYGA 3GTKH 3OYYA 1K8GA 4DR3L 3CP0A 1ASYA 3AQQA 4L5TA 2ZTEA 3J7A5 1UE5A 3F1ZA 3HOXG 3CPFA 1FVIA 4JOIA 4P74A 5LMNQ 1A0IA 4BBSH 1I50H 2UXBL 3BJUA 3JC66 4IPCA 4AYBG 1AE3A 5AJ3L 1QZGA 1HNZQ 3I56A 3GD7A 1IBLQ 4PMWA 1K9MC 2NVYH 4JI3L 3CCVA 2UU9L 2D0PA 3A5UA 1ASZA 5IYCG 1SR3A 2ZJQA 5GAEC 3RLFA 1C9OA 4LFAQ 1HJPA 1E1OA 1MKHA 5C3EH 5C0XG 2NN6I 2F4VL 1SMXA 1D7QA 3CCSA 1KIXA 5GADC 1S40A 2VUMG 1V1QA 2VW9A 3W1BA 1I3QH 2ASBA 1TWGH 3F2BA 1Y1VG 4IPDA 4JG2A 3GTLH 4A3GG 4A3LG 3G4SA 2E5LL 4B3MQ 4P73A 3RLOA 4A3BH 1CUKA 4GKKL 1VQ6A 4JBKA 1B7YB 5GAGC 2YYZA 2ES2A 1SROA 2AWOA 3NBHB 3HOUH 1V9PA 2UUCL 4JV5Q 2PI2E 1JB7A 4C3JH 3ULLA 1A8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IO9 A;  3ER0 A;  1K0R A;  3H0G H;  4DK6 C;  3K81 C;  5IP9 G;  4B3S L;  1PH9 A;  2B63 H;  4JV5 L;  1YHQ A;  4OO1 I;  4YY3 Q;  1EIF A;  3PO2 H;  1K3R A;  3OW2 A;  2Y0S G;  1VQN A;  3K7U C;  5IYB G;  4DV3 L;  2JA5 G;  2OTL A;  2I5H A;  3GDE A;  5C3E G;  1GD7 A;  1NMF A;  1VQJ A;  2B29 A;  3I4M H;  1MIU A;  4A93 G;  1IL2 A;  2Q2T A;  4JI4 L;  4A3M H;  1L1O B;  1XTD A;  1NMG A;  3UDG A;  3S14 H;  4X66 L;  3CPW A;  2BH2 A;  1AH9 A;  4R4Q A;  1S72 A;  1E22 A;  2ZM6 Q;  4HJA A;  3M9B A;  4H02 A;  3RN5 A;  3GTG H;  1K73 C;  1X3F A;  3J81 j;  3ICE A;  1NBW A;  2IHF A;  4UP7 A;  4BXX H;  2EIF A;  5C4J H;  1MJE A;  1X3G A;  1YHA A;  4JI6 L;  4JC0 A;  1LYL A;  4BY1 H;  1QVC A;  1VQ4 A;  1PYB A;  4A3E H;  1CKN B;  2XGT A;  3E9H A;  4OXP A;  2E5L Q;  4DR2 L;  1G51 A;  4L5S A;  3CC4 A;  5FLM H;  4DR1 Q;  4C3I H;  1QUQ A;  4UY8 C;  2WAQ E;  4IOA A;  1X65 A;  2NZH A;  1TWA H;  4GLX A;  2YV5 A;  5LMU Q;  3HFZ B;  1YEZ A;  3M3Y H;  2H5X A;  3UDI A;  2ALY B;  4C3H H;  4GN3 B;  1KQS A;  2WAQ G;  4A3C H;  2Q2U A;  4A3L H;  3E9I A;  1HNW L;  4FDB A;  2UUA Q;  2VNU D;  2VQF Q;  3HKS A;  5HGQ A;  4DR6 Q;  4JI0 L;  4B3R Q;  3GTM H;  1Z47 A;  4DUY Q;  2Z6K C;  1H95 A;  4LF5 Q;  1XPU A;  2HIV A;  3U4V A;  2GVA A;  4AQY L;  4GOP A;  2KHJ A;  2ZTC A;  2R7Z H;  3I4N G;  2HIX A;  2JEB I;  4YCV A;  1WOC A;  4DV7 L;  4K0K L;  5K36 G;  2LSS A;  5IT9 c;  2F4V Q;  4A3E G;  3KJP A;  1PHJ A;  4IFD J;  3W1G A;  2L15 A;  5M5X H;  1IXR A;  4LF8 L;  4A3B G;  5IYD H;  4A3K H;  1XNQ Q;  3G48 A;  4LFC L;  4X6A H;  2E2I H;  3D0F A;  3MEF A;  2CQO A;  2AHO B;  3AYH B;  1BBU A;  2C35 B;  2MO1 A;  3HOZ H;  2IX0 A;  4LWC A;  3HOZ G;  2JA5 H;  2HHH Q;  2WP8 J;  2VUM H;  1EQR A;  3RN2 A;  4MNO A;  5LMN W;  2Q2H A;  1OTC A;  4LUO A;  1Q12 A;  5E7N A;  1VQF A;  1JE5 A;  5FLM G;  2E2H H;  4RG1 A;  2UUB Q;  2GN5 A;  1WCM G;  4GS3 A;  1K83 H;  4PG3 A;  4BBR G;  1R9T H;  1TWF H;  4GN4 B;  4PZ6 A;  1LTL A;  5H1S E;  4JBJ A;  3PV0 A;  3VDY A;  1WFQ A;  4A93 H;  4YHH Q;  2IY5 B;  1SN8 A;  2R7D A;  2RCN A;  2OWO A;  2MO0 A;  5M3F H;  3S15 H;  2LXK A;  3DM3 A;  3STB C;  2K5V A;  1TWH H;  1VQK A;  4JYA L;  3PF5 A;  2Q2I A;  3NEN A;  4A3G H;  5IWA L;  3PUV A;  4KLK A;  1EQQ A;  4XIG S;  1YZ6 A;  1N9W A;  1HR0 W;  2JK8 A;  3PUY A;  4DR5 Q;  1YJ9 A;  3A0J A;  3ULP A;  3CF5 A;  3HKZ G;  1I94 L;  1GO3 E;  4IJL A;  1YJN A;  3K80 C;  2KCT A;  4QGU A;  1NY4 A;  2GVB A;  4A3D G;  2XTI A;  2JJQ A;  1VQC A;  3BU2 A;  3HOY G;  4YY3 L;  4BA2 I;  4RMF A;  4DPG A;  4YCU A;  4QQB X;  2BA1 A;  4X62 L;  1YBY A;  3CME A;  1XMO L;  4C2M H;  2OQK A;  4KHP Q;  1CKM A;  2FXQ A;  3KDF A;  4JCV E;  2I5M X;  4X64 L;  1HZC A;  4OON A;  3CQZ H;  1HR0 Q;  1LM0 A;  1VQ7 A;  2CCZ A;  3CC2 A;  1WJJ A;  3L0O A;  3GO5 A;  3CXC A;  4LFB L;  1YNX A;  1IBL L;  1X54 A;  4JI6 Q;  1XPR A;  1PH7 A;  2NVX H;  3KF8 B;  1G29 1;  2ZM6 L;  2I0Q A;  3CMA A;  2NN6 G;  3NEL A;  2R6G A;  3S17 H;  1EOV A;  4GLA C;  4HIM A;  3U58 A;  4BY7 G;  4POG A;  1X56 A;  4GKJ Q;  4JI0 Q;  4B3R L;  2K52 A;  3GTP H;  1KC8 C;  1BKB A;  3CD6 A;  3JAM i;  3J80 c;  1IBM Q;  3M85 A;  1Y14 B;  2UUC Q;  2JE6 I;  2PQA B;  3PO3 H;  4EQ5 A;  4LFB Q;  1SRU A;  1PFS A;  1OXX K;  3OTO Q;  4DK3 C;  1U0L A;  1QVG A;  5C0X I;  3HKZ E;  3CCU A;  1IBM L;  3H3V H;  1BBW A;  2A1A A;  2ATW A;  3TS2 A;  1XNQ L;  1CSQ A;  3T1Y Q;  2YTV A;  2E8G A;  1M90 C;  2B63 G;  2AWN A;  2R7F A;  5JJK A;  1WCM H;  4BBR H;  2PI2 A;  5C0X J;  1PH8 A;  1LUZ A;  1SFO H;  4KI0 A;  4AIM A;  4L5R C;  4WJ4 A;  4DV3 Q;  1QVF A;  1JJC B;  1OXS C;  4Y7N H;  2MQH A;  3BZC A;  1Q86 C;  3FHW A;  3J7Z C;  2LXJ A;  4KHP L;  3U50 C;  2UXD Q;  2HQL A;  1KAW A;  4KHZ A;  3TRZ A;  2N78 A;  3ERS X;  2DUD A;  5BR8 L;  1JJ2 A;  4X65 L;  3TRE A;  1GM5 A;  1HNX L;  2IX1 A;  1VQM A;  4DR7 L;  2AKW B;  4HJ7 A;  4X66 Q;  4BA1 I;  1VQ8 A;  3KLW A;  4LUV A;  1V43 A;  3EIV A;  2A19 A;  3KF6 A;  2RHQ B;  4IPG A;  4YHH L;  1XMQ L;  1KRT A;  1PH4 A;  4OO1 G;  2YU9 H;  4GKJ L;  2ZJR A;  3W5O A;  4OWW B;  3H3V I;  4DAY B;  1YHB A;  3GTJ H;  1G6P A;  1O7I A;  4ALP A;  4LUZ A;  2N8N A;  5M3M H;  3HOX H;  1PH2 A;  4NXM L;  3T1H Q;  5C4X G;  4DR2 Q;  4IFD I;  4BBS G;  4LNQ A;  4UP9 A;  2VQE Q;  2Z6K A;  4OX9 L;  1VQ5 A;  3CW2 C;  4NXN Q;  4YWM A;  1N36 L;  5FJ8 G;  4XTC S;  1VCI A;  2UU9 Q;  4DR5 L;  1QZH A;  4NB3 A;  1FGU A;  4DV4 L;  5HY6 A;  2QA4 A;  2NVQ H;  3ULJ A;  2K14 A;  3KDF B;  4R1J A;  4P71 A;  1JJG A;  1N34 L;  2UUB L;  4R4O A;  3PIO A;  4DUY L;  2MFI A;  4B3M L;  2VQF L;  1YJW A;  3U4Z A;  5IYC H;  3S1N H;  3S1R H;  3MXN B;  4DV7 Q;  1N33 L;  4K0K Q;  2D62 A;  2AMC B;  1UWV A;  3Q8D A;  4JI1 L;  3A74 A;  2WB1 G;  5BR8 Q;  5JEA G;  3H0G G;  3G6E A;  4LF8 Q;  2JEA I;  2CKZ B;  4GN5 A;  3HOV H;  4PZ8 A;  1HZB A;  1OXU A;  1S3O A;  1VQD A;  2NVT H;  3UE0 A;  4DV1 L;  2NZO A;  4J15 A;  1RIP A;  1SLJ A;  3RR5 A;  1UE1 A;  5FLX c;  3J81 c;  3CCJ A;  2BA0 A;  3FKI G;  3CCL A;  1X55 A;  1BVS A;  1IZ6 A;  2ID0 A;  4GNX A;  1Z9F A;  4HJ8 A;  3M7N A;  1E7Z A;  1T9H A;  1UE6 A;  3PUW A;  3K7A H;  4GKK Q;  5JJI A;  5LMU L;  5M5Y H;  4AQY Q;  1XMO Q;  4JOI C;  4A3F H;  2VQE L;  1CKO A;  1KXL A;  4O0A A;  1OXT A;  4LF4 L;  4DUZ Q;  3GTQ H;  3HOV G;  1C0A A;  2UXC L;  2I5L X;  4JI1 Q;  1L0W A;  3RZD H;  1E24 A;  1Q81 C;  2R92 G;  1W2B A;  3GTO H;  1I6H H;  1N32 Q;  4DV4 Q;  1WYD A;  4HIO A;  1E1T A;  3S24 A;  3A5Z B;  1QUQ B;  4LF5 L;  1WI5 A;  4AYB E;  1N32 L;  5ELN A;  3TEH B;  4YWL A;  1YIJ A;  1Y1W G;  5AJ3 Q;  1VQI A;  1HZ9 A;  2PMZ E;  2VZA A;  4JI5 Q;  4B3T L;  3PO2 G;  4LF4 Q;  1GVP A;  2YTX A;  5C44 H;  1PH5 A;  4JYA Q;  3M4P A;  1FL0 A;  4HIK A;  1PVO A;  2R7Z G;  4QL5 A;  3AFQ A;  4QY7 A;  1VS0 A;  2EXD A;  5ELO A;  3LGJ A;  3KJO A;  1YI2 A;  1I94 Q;  1KL9 A;  3D31 A;  2KCM A;  2PQA A;  3K8A A;  4DV2 L;  2IT1 A;  1E3P A;  1GKH A;  4POF A;  4A3D H;  1HH2 P;  1VQG A;  4GOP B;  2VS1 A;  2WFW A;  3HOW G;  4JI5 L;  3STB D;  4LF9 L;  4NXM Q;  3CCR A;  3HOY H;  4APV A;  1Q8K A;  2N3S A;  3IRB A;  4QIW E;  1Q82 C;  2RF4 A;  1AE2 A;  3RLN A;  2K5H A;  3OTO L;  4HJ9 A;  4JI4 Q;  4P75 A;  3I4N H;  3PF4 A;  1L2F A;  4JBW A;  4A3I G;  4AH6 A;  2K4K A;  3CC7 A;  1Y1W H;  3H15 A;  1PH3 A;  3PO3 G;  4WJ3 M;  5M3F G;  4DUZ L;  2Y0S E;  4JI2 Q;  3NEM A;  4B3S Q;  3PIP A;  4PZ7 A;  4P72 A;  4R4C A;  3TQY A;  2CFM A;  5IP7 G;  4LFC Q;  3KFU A;  4DR4 Q;  4Y52 H;  2MNA A;  5C44 G;  4LF9 Q;  1N34 Q;  3ZJY C;  4ME3 A;  2UXB Q;  2R92 H;  1PA6 A;  5LMN L;  1J6Q A;  3E0E A;  3KF6 B;  5GRO A;  4A3J G;  4A3J H;  1VQP A;  2HHH L;  4JBM A;  1N33 Q;  3AEV A;  1J5E Q;  5DLQ E;  1VQB A;  1KHI A;  3PUZ A;  1P16 A;  1JMC A;  4A3C G;  4L5Q A;  2A8V A;  1Y1V H;  3RZO H;  1PH1 A;  1Q1B A;  1NJI C;  1L1O C;  1VQE A;  4DNI A;  1Q7Y C;  1X6O A;  1N8R C;  5IP7 H;  1K8A C;  1YVC A;  2VY3 A;  3F8T A;  3I4O A;  3EBE A;  2JA9 A;  4R4I A;  4DV2 Q;  1NE3 A;  4A76 A;  3TS0 A;  4A3I H;  4BXX G;  4DR3 Q;  3S1M H;  5IE8 A;  4DV6 Q;  4LF7 L;  3PUX A;  3CCQ A;  2JA7 H;  3K0X A;  4LW1 A;  1D8L A;  4TVA B;  1IBK L;  4OX9 Q;  5IP9 H;  2B3G A;  4BY1 G;  3UDX A;  4DV5 L;  3HOW H;  4DR1 L;  1HNZ L;  4GLV B;  4X65 Q;  1HNX Q;  1VQH A;  3F2C A;  2R93 H;  1B70 B;  4JI7 Q;  3S2D H;  1PV4 A;  3DLL A;  1PH6 A;  1U5K A;  4LFA L;  3WWV A;  1J5E L;  1KRS A;  2K5N A;  1P8L A;  2K75 A;  5IY0 A;  2KBN A;  3I7F A;  4IOC A;  1I5F A;  5FJ8 H;  2OTJ A;  1KD1 C;  1XMQ Q;  2QEX A;  2KHI A;  3PCO B;  4JI7 L;  2JA6 H;  3F2D A;  5M3M G;  2K50 A;  4MTN A;  5M5W H;  2ZJP A;  4DV0 L;  4A3M G;  1TXY A;  1EIY B;  1EUJ A;  1A63 A;  1HNW Q;  4DR6 L;  1YIT A;  1NTG A;  3T1H L;  5C4X H;  1XJV A;  4B3T Q;  4YCW A;  2PNH A;  2VL6 A;  1FJG L;  3M4O H;  4DV0 Q;  2UXD L;  2V1C C;  4DV5 Q;  3S16 H;  2DGY A;  1B8A A;  4A4I A;  2ZTD A;  2QGQ A;  3KOJ A;  2YTY A;  2BH8 A;  3AFP A;  5GQO A;  1EWI A;  5IYB H;  4GNX B;  4IJH A;  4HID A;  4NXN L;  2WB1 E;  1X9N A;  4TQU S;  4NPS A;  2JA7 G;  2JA8 G;  1IYJ B;  1VQ9 A;  3BZK A;  2JA8 H;  1XPO A;  3CAM A;  3J81 i;  3L7Z C;  2E2J H;  4IPH A;  4HJ5 A;  1VQL A;  5JEA J;  1X3E A;  1CSP A;  3UE1 A;  3I55 A;  4BY7 H;  3J80 i;  5IYD G;  2R93 G;  1IBK Q;  1Q46 A;  3G71 A;  4A3K G;  1W3S A;  1Q1E A;  3SGI A;  4DAM A;  3CCE A;  1FJG Q;  3HOU G;  4MZ9 A;  4UP8 A;  5J3B A;  2D0O A;  4DV6 L;  2F3I A;  3B6Y A;  1MJC A;  4LF7 Q;  2JQO A;  3M4Q A;  4QJF A;  3FP9 A;  5EAY A;  1TWC H;  2KEN A;  3FKI H;  2JA6 G;  3L2P A;  3S1Q H;  3JAM c;  1UE7 A;  4LF6 L;  5GAH C;  1C7Y A;  4JI3 Q;  1XNR Q;  1HR0 L;  3T1Y L;  4DKA C;  4DR4 L;  3PSI A;  2Z0S A;  3CCM A;  4JI2 L;  2F52 A;  1A62 A;  2UUA L;  2HT1 A;  1RL2 A;  4LF6 Q;  4UPA A;  4JI8 L;  3KYH C;  4EX5 A;  1L1O A;  1DGS A;  3EN2 A;  3RNU A;  3I4M G;  4IFD G;  1JT8 A;  1PYS B;  4YWK A;  1VQA A;  2CWP A;  4OWX B;  4DV1 Q;  4JI8 Q;  4R4T A;  1EFW A;  1UEB A;  4X62 Q;  3UDF A;  1N36 Q;  4GOP C;  2CWA A;  4X64 Q;  2OQ0 A;  4A3F G;  2IHE A;  1M1K C;  2OCE A;  1XNR L;  4DR7 Q;  5JJL A;  5IWA Q;  4OWT B;  1HZA A;  2UXC Q;  2N49 A;  3I2Z A;  4GNX C;  1CKN A;  3PGZ A;  3S2H H;  2EQS A;  2RHS B;  1OXV A;  4O2D A;  4A75 A;  1VQO A;  1SE8 A;  1EYG A;  3GTK H;  3OYY A;  1K8G A;  4DR3 L;  3CP0 A;  1ASY A;  3AQQ A;  4L5T A;  2ZTE A;  3J7A 5;  1UE5 A;  3F1Z A;  3HOX G;  3CPF A;  1FVI A;  4JOI A;  4P74 A;  5LMN Q;  1A0I A;  4BBS H;  1I50 H;  2UXB L;  3BJU A;  3JC6 6;  4IPC A;  4AYB G;  1AE3 A;  5AJ3 L;  1QZG A;  1HNZ Q;  3I56 A;  3GD7 A;  1IBL Q;  4PMW A;  1K9M C;  2NVY H;  4JI3 L;  3CCV A;  2UU9 L;  2D0P A;  3A5U A;  1ASZ A;  5IYC G;  1SR3 A;  2ZJQ A;  5GAE C;  3RLF A;  1C9O A;  4LFA Q;  1HJP A;  1E1O A;  1MKH A;  5C3E H;  5C0X G;  2NN6 I;  2F4V L;  1SMX A;  1D7Q A;  3CCS A;  1KIX A;  5GAD C;  1S40 A;  2VUM G;  1V1Q A;  2VW9 A;  3W1B A;  1I3Q H;  2ASB A;  1TWG H;  3F2B A;  1Y1V G;  4IPD A;  4JG2 A;  3GTL H;  4A3G G;  4A3L G;  3G4S A;  2E5L L;  4B3M Q;  4P73 A;  3RLO A;  4A3B H;  1CUK A;  4GKK L;  1VQ6 A;  4JBK A;  1B7Y B;  5GAG C;  2YYZ A;  2ES2 A;  1SRO A;  2AWO A;  3NBH B;  3HOU H;  1V9P A;  2UUC L;  4JV5 Q;  2PI2 E;  1JB7 A;  4C3J H;  3ULL A;  1A8V A; 
#chains in the Genus database with same CATH topology
 2M9V A;  4ME5 A;  5IGF A;  1EUC B;  4JV5 L;  1PH9 A;  5CB4 F;  2R93 A;  3TDQ A;  3VA5 A;  1M4V A;  2MCT A;  1VQN A;  3MR2 A;  2R7K A;  5C5J A;  1KDC A;  2L5T A;  3K7U C;  5CBA E;  4DV3 L;  2NU8 B;  3GQC A;  2I5H A;  3GDE A;  1VQJ A;  2B29 A;  2F0S A;  3NQT A;  1QNU A;  3FEW X;  4C2M B;  3GTQ B;  4RNM A;  1MIU A;  3E3X A;  1SNM A;  2K5Q A;  4A3M H;  3UDG A;  3S14 H;  2MPM A;  4X66 L;  4FYD A;  4DAP A;  4WOR A;  1S5B D;  1LT4 D;  4J9K A;  3SK5 A;  3GTG H;  2D2C C;  3K57 A;  4XQQ A;  2R84 A;  3ND9 A;  1DOL A;  2CZG A;  3PW2 A;  3A56 A;  2K05 A;  3GTP A;  4BY1 H;  4Q8E A;  3FDS A;  3BDC A;  2ZXR A;  4XYM B;  4JUZ A;  2EJM A;  3SVM A;  3I12 A;  4DR1 Q;  4IWY A;  3ETJ A;  4ED2 A;  1CZW A;  2XCL A;  2A69 C;  4IOA A;  4HR7 A;  2QF7 A;  4O2A F;  1SXT A;  4GLX A;  3HBL A;  1A3U A;  3NXW A;  1SYX B;  1X3Q A;  1UC8 A;  2ALY B;  4XXE A;  2XGQ A;  1BCP F;  4C3H H;  2FJZ A;  1RJR A;  2F1M A;  2VQF Q;  3K5L A;  2M05 A;  4JI0 L;  4B3R Q;  1Z47 A;  4ED3 A;  3RF2 A;  1H95 A;  1V4Y A;  5IWA H;  4XYQ A;  3E0J A;  1DV1 A;  4GOP A;  2ICI A;  2ZTC A;  4N9P A;  2JEB I;  3EPG A;  4K0K L;  2O03 A;  4A3E G;  3KJP A;  4JV5 H;  1PHJ A;  4DL6 A;  3VR3 A;  2L15 A;  5C4Z A;  4C3H B;  5EZY F;  1S4Z A;  1XNQ Q;  4OEM B;  4LFC L;  2V4R A;  3VR5 A;  3D0F A;  1SNQ A;  4QIW B;  2W71 A;  4UCT A;  5C1P A;  2C35 B;  1I94 H;  2MO1 A;  4MV4 A;  1QB5 D;  2FPI B;  2VUM H;  3HB9 A;  2UUA H;  4U67 3;  5LMN W;  4O3Q A;  4UCU A;  5KG0 A;  4LUO A;  3GTO A;  1JWM D;  4S3S A;  4RG1 A;  1S5E D;  1WCM G;  1K83 H;  1R9T H;  5H1S E;  3GTQ A;  1SYF A;  3PIP 3;  2JA5 A;  4EEY A;  1LTA D;  4K2K A;  5K36 H;  1T5E A;  5DM6 3;  4J6H A;  5G3L F;  3BAB A;  4A93 H;  3DWA A;  4YHH Q;  2YS7 A;  2R7D A;  2RCN A;  3ORR A;  1SJE D;  2J6U A;  1QNK A;  1DOK A;  2JEJ A;  2EYM A;  1SYB A;  2LXK A;  2DJF C;  2K5V A;  3CRK C;  1TS2 A;  3NEN A;  1GUS A;  1GXD C;  4J9P A;  1B53 A;  3TII A;  1N9W A;  1K83 B;  2XRQ D;  5DEH A;  1NY4 A;  3URY A;  2GVB A;  4A3D G;  5IGE A;  2JJQ A;  2F0D A;  3VYR A;  4DNR B;  1O75 A;  2I46 A;  4YY3 L;  4RMF A;  4DPG A;  4QQB X;  4OIK A;  3J7A F;  5KFT A;  1TWH B;  3CME A;  2F4V H;  4C2M H;  2OQK A;  1KJJ A;  1HZC A;  3CQZ H;  2CCZ A;  1GUN A;  2FJ2 A;  2B63 A;  5JAV A;  3TN2 A;  4G7H C;  2K5W A;  4K5X A;  4A3B B;  1L0Y B;  4LF8 H;  2EVB A;  3KF8 B;  1MGS A;  4FF3 A;  4QWD A;  4BY7 G;  3U58 A;  2FLN A;  5IGG A;  3J7A K;  1VF7 A;  4N8F A;  5IOD A;  3R8B A;  2AQ4 A;  4KD3 A;  3J81 L;  4YR2 A;  3VPC A;  1II3 A;  1F77 A;  5EBC A;  2PQA B;  1TWG A;  2R8H A;  4EQ5 A;  2RDJ A;  3JSL A;  3D8G A;  3OTO Q;  4ECT A;  3ONA B;  5C0X I;  3QO2 A;  1BBW A;  1N33 H;  1I3Q B;  4TV9 F;  1HA5 A;  1JWU D;  1JE4 A;  1WCM H;  2EZV A;  5F9L A;  3R3O A;  4GC6 A;  1AEX A;  1SMY C;  2LFN A;  1SFO H;  4KI0 A;  2R92 A;  5IOC A;  1A3V A;  4Y7N H;  1SYC A;  2E74 C;  2W6M A;  3BZC A;  1Q86 C;  3FHW A;  1OO9 B;  3J7Z C;  5JVG 3;  4X66 H;  3PR5 B;  4KHP L;  3DWP A;  3IKJ A;  2UXD Q;  4Q43 A;  2UVU A;  4KHZ A;  3TRZ A;  4CC5 A;  5KNC A;  1SFO A;  3H4B A;  1KBL A;  5C5M A;  2VUM A;  1HHV A;  1VQM A;  4DN4 M;  5KFP A;  3GIL A;  1JKJ B;  3KLW A;  2ZT9 C;  1J5E Q;  4KY6 A;  1KRT A;  4GKJ L;  3H3V I;  4DAY B;  1YHB A;  2KUM A;  3GTJ H;  2UVR A;  5M3M H;  3HOX H;  4LF5 H;  4X62 H;  2X6G A;  3V4S A;  5LL6 X;  3G6Y A;  5LMU H;  4O3O A;  4DV1 H;  3M4O B;  3CW2 C;  4A2B A;  3ND8 A;  4EBC A;  4LF4 H;  1EY0 A;  4DR6 H;  1N36 L;  4I55 F;  4HQ6 A;  1YNJ C;  1IBM H;  4DR5 L;  1PFB A;  3HRZ C;  2Y0S A;  3Q23 A;  1LT5 D;  4DV4 L;  3D3R A;  4GZY C;  1LT6 D;  5HY6 A;  4BY7 B;  2NVQ H;  3ULJ A;  1RTN A;  4P71 A;  1K28 A;  2R3Z A;  1N34 L;  2UUB L;  1IHZ A;  4R4O A;  3PIO A;  2RVL A;  1MD2 D;  3ITP A;  4FVM A;  4B3M L;  3HOW B;  1SEB D;  4ILW A;  1KAB A;  2NTS A;  3DMU A;  3SK4 A;  1XWE A;  3N8D A;  1B2T A;  3AB9 A;  3KHL A;  3MXN B;  4DV7 Q;  1N33 L;  3JRW A;  2I80 A;  2D62 A;  3N40 P;  4YP3 A;  5BR8 Q;  2WB1 G;  3HOV B;  2L4N A;  5JEA G;  3G6E A;  4LF8 Q;  5KFD A;  1B04 A;  4PZ8 A;  2JA6 B;  4EBE A;  1OXU A;  3F2U A;  2IMW P;  1VQD A;  1TS4 A;  3GID A;  4LF9 H;  4J15 A;  1SLJ A;  3CCJ A;  2BA0 A;  3CCL A;  4FF4 A;  2ID0 A;  3GTG A;  4ZUI A;  3PW7 A;  5JQW A;  4ECS A;  4A3M B;  1TY2 A;  1T9H A;  1CK1 A;  5KG3 A;  3S14 B;  4AQY Q;  2VQE L;  4IUQ A;  4X3T A;  1KXL A;  1OXT A;  3WDN A;  5KYL A;  4DUZ Q;  3GTQ H;  2R8I A;  2EYL A;  4JI1 Q;  1L0W A;  2PW7 A;  3I90 A;  2J7Z A;  1Q81 C;  3RJ0 A;  1HFG A;  1I6H H;  1SNC A;  3C0F B;  4HIO A;  1E1T A;  5CV8 A;  5KFF A;  1STH A;  1QUQ B;  4IUU A;  4LF5 L;  3KXY T;  5ELN A;  4YWL A;  2X6L A;  1VDZ A;  1HZ9 A;  1PLF A;  2V58 A;  4ED1 A;  4O4I F;  2A6H D;  3U9S A;  2HQE A;  1C3O A;  5DQG A;  2YTX A;  4JYA Q;  2WKC A;  5FO8 B;  4HIK A;  2HHH H;  3HOX B;  4QY7 A;  3AFQ A;  5ELO A;  1VS0 A;  2EYO A;  2VB3 X;  3KJO A;  3D31 A;  4DV2 L;  2IT1 A;  2XIG A;  2FMC A;  1CM9 A;  1HUN A;  1N34 H;  4GOP B;  2EE1 A;  3PW4 A;  4JI5 L;  3HOY H;  4DV0 H;  1LLR D;  1EIG A;  5LP6 F;  2VA2 A;  4QIW E;  2K5H A;  4JI4 Q;  4X3K A;  4P75 A;  4NP5 A;  3PF4 A;  3PVX A;  3OWE B;  2K01 A;  2WE6 A;  3P7J A;  1DOM A;  4CDE C;  2I8C A;  4AH6 A;  3N41 B;  4FXK C;  5JPM C;  4L63 B;  1GHJ A;  2TMP A;  3BDL A;  4JI2 Q;  4B3S Q;  3RZD B;  1PK8 A;  2JA8 B;  2O5J C;  3HZX A;  4MV1 A;  3KFU A;  2XWJ B;  5KFR A;  2BQ3 A;  4LF9 Q;  4CHT B;  5C44 G;  1N34 Q;  2F0E A;  3X3M A;  1CQJ B;  1S5C D;  4A3J H;  2W7P A;  2WIN B;  3AEV A;  5DLQ E;  4BY1 B;  2CQY A;  4RHR A;  3VYS A;  4A3C G;  3MR5 A;  5J1Z A;  1Q1B A;  1Q7Y C;  2R7M A;  3I4L A;  2F0T A;  1VF5 C;  5EKI A;  1K8A C;  4ECW A;  3F8T A;  3I4O A;  3MAQ A;  1JJG A;  5FLX W;  1NE3 A;  1QJO A;  5DLG A;  3CRL C;  3OSN A;  2A5H A;  2XIW A;  3PUX A;  2JA7 H;  1F9Q A;  4LW1 A;  1B9M A;  5L9X A;  3J81 E;  4ECZ A;  4HNU A;  3HOW H;  3DM1 A;  3UDX A;  1JR0 D;  2K04 A;  4ZUJ A;  4GLV B;  5LL6 S;  1VQH A;  2FLL A;  1B70 B;  2B2U C;  4JI7 Q;  3DLL A;  1J5E L;  5EJW A;  5LMN H;  1P8L A;  2AGP A;  2OTJ A;  4J1M A;  3I7F A;  1I5F A;  5EPJ A;  1LTI D;  2YRW A;  1KD1 C;  5FD6 A;  2RDF A;  4JI7 L;  1SNP A;  2XCP A;  2K50 A;  4MTN A;  2PZT A;  4DV0 L;  3RV4 A;  1EUJ A;  1TKW B;  1MSG A;  4DR6 L;  1NTG A;  3M4O H;  3OUU A;  3JSN A;  2UXD L;  4DV5 Q;  3X3N A;  4ZOL F;  3KF8 A;  4A4I A;  2ZTD A;  4R7R A;  1ESR A;  3RB6 A;  5IYB H;  1EWI A;  2W70 A;  3RB0 A;  2WB1 E;  4TQU S;  1KJ9 A;  2JA8 G;  1O7Y A;  2UVV A;  5GON F;  2E2J H;  1XNR H;  4IPH A;  5KRU A;  1Z7T A;  3MWM A;  1X3E A;  1CSP A;  2F0F A;  3MFI A;  3G6J B;  5IYD G;  2RA4 A;  4DR1 H;  2QW7 A;  2VUG A;  1Q46 A;  4A3K G;  3HKZ A;  1W3S A;  1Q1E A;  2WII B;  1I50 B;  1FJG Q;  2D5D A;  3I72 A;  3HOU G;  2E5L H;  4LF7 Q;  4ZHQ F;  2DNC A;  4TRD A;  5EAY A;  1TWC H;  5ELD A;  1CI3 M;  1O7Z A;  2E2I B;  1MI2 A;  5EWF A;  1CHP D;  1UE7 A;  3P20 A;  1C7Y A;  4EVO A;  4DKA C;  5I2X A;  3CCM A;  4JI2 L;  2F52 A;  4JI6 H;  1RL2 A;  1TS5 A;  1L1O A;  3EN2 A;  4J0M A;  4OO1 H;  4DV1 Q;  1DJR D;  1EFW A;  2R7N A;  3K3V A;  2CW7 A;  1H9S B;  1N36 Q;  4GOP C;  1PRT F;  2BQR A;  1JIC A;  3D4R A;  4DR7 Q;  5JJL A;  1FNU A;  1PMR A;  1EZ8 A;  2YYA A;  2C28 A;  2A68 C;  3PGZ A;  3S2H H;  2F0O A;  4RB0 A;  2FB9 A;  4G57 A;  2CH4 A;  1CFM A;  3JRX A;  4DR3 L;  1ASY A;  1VMP A;  4O3P A;  1ZYR D;  3DXJ C;  4CDF C;  3HOX G;  3CPF A;  2SNS A;  5LMN Q;  3I70 A;  1H9R A;  1A0I A;  3GV6 A;  4RB2 C;  4LSA A;  4DV6 H;  4AYB G;  5AJ3 L;  1AE3 A;  3E6Z X;  2XGP A;  4RAU C;  1K9M C;  1ICW A;  4JI3 L;  4YB8 B;  4DV3 H;  2D0P A;  3DWQ A;  1ASZ A;  3KK7 A;  2UVW A;  3G6X A;  1IW7 C;  1E1O A;  3T1Y H;  4HED A;  1D7Q A;  5C8Y F;  2W7O A;  3S17 B;  2KJX A;  2QIL A;  1CQF A;  1TY0 A;  5GAD C;  2CHB D;  2F0V A;  4I4T F;  5D1O B;  4A3G G;  4U68 A;  1K3B C;  2J0T D;  2E5L L;  1WCM B;  4KD4 A;  2NWG A;  4B3M Q;  4DR2 H;  1GYF A;  1JCK B;  3PO3 B;  3SR1 A;  4JBK A;  5GAG C;  1EU3 A;  5C3W A;  1I4P A;  2W9B B;  3NBH B;  2WAQ A;  2UUC L;  1AZQ A;  3RB4 A;  2F0J A;  3A7L A;  5C1O A;  1JB7 A;  4HJ8 A;  2NVY A;  4BS9 A;  1CE8 A;  2NVT B;  1RKN A;  4DK6 C;  3K81 C;  1GHK A;  1UNN C;  2ZDQ A;  5BN5 A;  3L9A X;  3FVQ A;  3SI8 A;  3MVV A;  4HNV A;  2XSC A;  2LMC B;  2OTL A;  1HCZ A;  5KFE A;  4NDX A;  1NMF A;  2FK1 A;  5HBR B;  4QF4 A;  4A93 G;  1PZI D;  4HSV A;  1IL2 A;  4K0K H;  1AN8 A;  2IJ0 A;  3CPW A;  2BH2 A;  3VA7 A;  3Q0A A;  4R4Q A;  3K5M A;  4KHV A;  1CQI B;  1XDN A;  1E22 A;  4O4L F;  2ZM6 Q;  4HJA A;  3RN5 A;  3VMM A;  2ASJ A;  2VOB A;  1F9S A;  5BR8 H;  1X3F A;  4MIU A;  1BCP D;  1NBW A;  2EIF A;  2MP1 A;  1MJE A;  2KCC A;  1LYL A;  4K6D A;  4O3S A;  4F87 A;  1QVC A;  1VQ4 A;  1PYB A;  3RMH A;  3CC4 A;  3OIP A;  4C3I H;  1FNW A;  3R5H A;  3S1N B;  3V4Z A;  2NVX A;  2NZH A;  3C1E A;  2PZU A;  5J2U F;  3CQZ A;  3M3Y H;  4RHS A;  2H5X A;  2JEF A;  1T5X D;  2WAQ G;  4A3L H;  2B63 B;  2UUA Q;  2VNU D;  1I7L A;  4X3U A;  1ZKO A;  2Z6K C;  2JEI A;  5IIF A;  4LF5 Q;  2R85 A;  3U4V A;  4I7A A;  2KHJ A;  2R7Z H;  5K36 G;  5IGC A;  1WTV A;  4ED7 A;  1RDP D;  3Q24 A;  2LSS A;  3BG5 A;  1EHI A;  4A3K B;  4FS2 A;  4G7O C;  1IL8 A;  2RBM A;  2V9W A;  3W1G A;  5IYZ F;  4A3B G;  4J9Q A;  1I4Q A;  2R7Z A;  4X6A H;  3NTK A;  3P1H A;  5EBD A;  2E2I H;  3JAM W;  4RU9 A;  4YY3 H;  2B2Y A;  2O4X A;  5EPK A;  4H44 C;  5LOV F;  3CHB D;  2HHH Q;  4H0L C;  3BQ1 A;  2WP8 J;  1GUW A;  4C3I B;  4LFB H;  4I7Z C;  2GA4 B;  4K8I A;  2EPB A;  2Q2H A;  5C3X A;  4V19 0;  4MAM A;  2W9A A;  1OTC A;  2CW0 C;  1Q12 A;  5FLM G;  1JE5 A;  2E2J B;  2E2H H;  2AQ3 B;  2W6O A;  3GQB A;  4PG3 A;  5KYI A;  4JV1 A;  4JBJ A;  2GPW A;  5DG7 A;  1F2Z A;  2R6F A;  4IZO A;  2MO0 A;  3S15 H;  4F7X A;  3DM3 A;  1PX2 A;  1S68 A;  2MHV A;  1TWH H;  1NR4 A;  1VQK A;  3PF5 A;  1GUO A;  5IWA L;  2G9D A;  3PUV A;  4KLK A;  1EQQ A;  2IBK A;  2BR0 A;  1HR0 W;  1MSH A;  4DR5 Q;  1YJ9 A;  1RF2 D;  2V4D A;  1LAB A;  3IFT A;  3JAM E;  2FK3 A;  4B3T H;  3CF5 A;  5LXT F;  2PMZ B;  2M2L A;  4IJL A;  3QJY A;  4I50 F;  4QGU A;  2M00 A;  1Z2N X;  4ECR A;  5LA6 F;  1XMQ H;  1GUT A;  2XTI A;  3HOY G;  1G2T A;  1GLV A;  1YBY A;  2CW0 D;  5M5Y B;  3VPD A;  2FXQ A;  3KDF A;  2DPJ A;  2I5M X;  4X64 L;  1DD2 A;  1WJJ A;  3L0O A;  3GO5 A;  1LTB D;  3MR6 A;  4JI6 Q;  3RAX A;  1XPR A;  1QOH A;  4YJ3 F;  1FD7 D;  2NVX H;  3TIG A;  5A2Q E;  3HKZ B;  5E3F A;  2AUJ D;  1G29 1;  2ZM6 L;  2OF1 A;  3A54 A;  2YZG A;  3T16 A;  3MFY A;  4FO2 A;  2R6G A;  3C1F A;  3S17 H;  3M4Y A;  4GLA C;  4POG A;  1UNS A;  4QCL A;  4JI0 Q;  4B3R L;  3GTP H;  3J80 c;  1IBM Q;  5L1J A;  4GKJ H;  1Q90 A;  2G9H D;  5IGB A;  3PO3 H;  4LFB Q;  1SRU A;  4EYH B;  1U4M A;  1QG7 A;  1U0L A;  4RGO S;  1IBM L;  4PWQ A;  3CCU A;  1JXL A;  2A1A A;  5IGD A;  2ATW A;  3TP7 A;  1EIH A;  4ECU A;  1CSQ A;  1M90 C;  4KKS A;  2AWN A;  3MXU A;  4K6L A;  2JP1 A;  2F0W A;  2R7F A;  4BBR H;  5JJK A;  1ZHS A;  2PI2 A;  1LUZ A;  1H9S A;  2JN4 A;  4AIM A;  4L5R C;  1JJC B;  3GP7 A;  5D3I B;  5KFW A;  4FF1 A;  2HQL A;  5KFN A;  1ZQ7 A;  4J9S A;  2N78 A;  2B2T C;  1Y1W A;  2DUD A;  4TQR A;  3GTM B;  1BF4 A;  1SE4 A;  2VB2 X;  1JJ2 A;  3TRE A;  1GM5 A;  2IX1 A;  1WVL A;  4DR7 L;  1WCM A;  2C2E A;  2AKW B;  4HJ7 A;  1NR2 A;  3GTK B;  5KFB A;  4X66 Q;  1VQ8 A;  3UQ8 A;  1V43 A;  3EIV A;  1EEF D;  3KF6 A;  4IPG A;  4RGM A;  1XMQ L;  4FBU A;  5LYJ F;  2YU9 H;  2B8F A;  2FFK B;  5F9N A;  3ORQ A;  2AU0 A;  4NXM L;  2RDI A;  3T1H Q;  3PN1 A;  5KT6 A;  3Q22 A;  3EA6 A;  4BBS G;  3RBD A;  1VQ5 A;  2LY7 A;  4NXN Q;  4AYB A;  1DV2 A;  3C46 A;  1Q8I A;  1VCI A;  1I4R A;  1LT3 D;  1QZH A;  3NGD A;  4NB3 A;  3I3C A;  1S97 A;  1I6U A;  3RFC A;  2MUY A;  5COR A;  4KN4 C;  5ELE A;  2YU9 B;  2EJF C;  4HMI A;  3NWT A;  4NXN H;  1S0N A;  3A8J E;  3M3Y B;  5CAE B;  4O3R A;  5EOY A;  1YJW A;  1EU4 A;  1DM0 B;  1TWA B;  5IYC H;  2PQE A;  2RCF A;  3K7A B;  3N6R A;  5EQ0 A;  3S1M B;  3CU7 A;  2Z4I A;  2DJG C;  1UWV A;  4MV7 A;  3Q8D A;  3A74 A;  4DL5 A;  3H0G G;  2JEA I;  2CKZ B;  3HOV H;  1M0T A;  4FXD A;  4IUT A;  1PFN A;  2ENB A;  1UEA B;  4PDB A;  2F0L A;  1EY8 A;  4DV1 L;  2NZO A;  1RIP A;  2AGO A;  1W6J A;  3IFD A;  5DG9 A;  3FKI G;  1X55 A;  1IZ6 A;  1RCV D;  2FMA A;  1IW7 D;  4QWB A;  1ET6 A;  3K3P A;  3MA2 B;  1MBY A;  3K7A H;  3T53 B;  5LMU L;  4K5W A;  5JJI A;  5DQI A;  1SJH D;  3J81 W;  4X65 H;  2KEC A;  1HA6 A;  1CKO A;  2F0H A;  1TWF A;  4LF4 L;  3HOV G;  4J9R A;  1C0A A;  1MHW C;  1N36 H;  2J6S A;  3I8Z A;  2R92 G;  3GTO H;  4EBD A;  2P5Z X;  4B3M H;  4R8I A;  4KMU C;  4DV4 Q;  1WYD A;  4B08 A;  2W6P A;  1I6H B;  4QB4 A;  1WI5 A;  1N32 L;  3TEH B;  1YIJ A;  2A68 D;  2VPQ A;  1VQI A;  1FYC A;  2PMZ E;  3GIJ A;  5L37 A;  5C44 H;  1PH5 A;  3M4P A;  1I4X A;  4A3D B;  1FL0 A;  1PVO A;  5L1K A;  1X32 A;  4RWS C;  1YI2 A;  3LGJ A;  1I94 Q;  4JI1 H;  1JX4 A;  4ZRZ A;  2YW2 A;  1E3P A;  3HEJ A;  4IAL A;  4QMG A;  5C6A A;  2PO4 A;  4A3D H;  5KFL A;  3QZ8 A;  3IN5 A;  3JZI A;  1IYV A;  2RDG A;  4LF9 L;  4NXM Q;  3CCR A;  3GIP A;  4O3N A;  5COY A;  4APV A;  5KFM A;  1LTS D;  3H6M A;  1Q82 C;  3IRB A;  4A3J B;  1AE2 A;  2RF4 A;  2IWH A;  3RLN A;  3WO1 A;  1D5X C;  4OIJ A;  4A3G B;  4X3S A;  2YCH A;  3H4D A;  1ZET A;  4JBW A;  4A3I G;  4Q8F A;  3TZD A;  2Z9H A;  1J8I A;  2HVR A;  1Y1W H;  3H15 A;  1KJI A;  1IOW A;  1I50 A;  2Y0S E;  3NEM A;  4MV8 A;  3PIP A;  3TQY A;  4M8A A;  4P72 A;  1B6R A;  4DR4 Q;  3M9O B;  1KAA A;  2JA7 A;  1PA6 A;  5LMN L;  3S16 B;  3E0E A;  3S1Q B;  3KF6 B;  4TUY F;  4ME6 A;  2B2U A;  1S0O A;  4APM A;  4QW9 A;  1UUP A;  3PUZ A;  1JMC A;  4DV2 H;  4F4Z A;  1VQE A;  4C1N I;  5H80 A;  1X6O A;  2IX3 A;  3HGB A;  5CA0 F;  3RUP A;  1JOK A;  2VY3 A;  3RD4 A;  2E76 C;  3EBE A;  2JA9 A;  3OTO H;  4DL2 A;  3BVM A;  1N32 H;  2EDG A;  3OSO A;  5C0X H;  1D8L A;  5JPN C;  3OWF A;  5T1G A;  1SEI A;  1WTR A;  5D3D A;  2PBZ A;  4DR1 L;  3KHG A;  4X65 Q;  1EEI D;  5CV9 A;  1A2T A;  2R93 H;  2E75 C;  4RZQ A;  3S2D H;  1LAC A;  1PH6 A;  3H0G A;  1TWA A;  4JVZ A;  3WWV A;  2JXM B;  5DM7 3;  4LH6 A;  2K75 A;  3RV3 A;  2KBN A;  3K59 A;  1I7N A;  1SDF A;  3V05 A;  1F9P A;  2AQ1 B;  3PCO B;  2EXZ A;  3QIA A;  3VYT A;  2JA6 H;  2C00 A;  2FE3 A;  3S2D B;  1A63 A;  3OUZ A;  4RZR A;  1HNW Q;  5EPL A;  1ML0 D;  1FJG L;  3TZU A;  4EQN A;  5C4X H;  2V1C C;  1EL0 A;  2RQX A;  1CS0 A;  2NU6 B;  2R61 A;  3UFX B;  5KFH A;  2R92 B;  2EY5 A;  4LMQ D;  2YTY A;  4HCS A;  1K8O A;  1BCP C;  1CTM A;  1D2B A;  2JA7 G;  1X9N A;  3EVQ A;  1TWH A;  1IYJ B;  4XZ3 B;  4LMY A;  3CAM A;  3J81 i;  2BDO A;  2Q8I B;  4DUY H;  1LTG D;  3BDO A;  4DR3 H;  1ONL A;  1B50 A;  1D5Z C;  3GTM A;  1IBK Q;  2E2H B;  1K8M A;  2WAC A;  1B6S A;  2ASL A;  1Y1V B;  3SGI A;  4C1N K;  3CCE A;  4MV9 A;  4KTA A;  4DV6 L;  3NTI A;  3EPI A;  1K83 A;  4WD3 A;  3M4Q A;  3AMU A;  3OHB A;  3CQZ B;  5BPH A;  4C5B A;  2NB0 A;  4L6T B;  1HR0 L;  3T1Y L;  5KT7 A;  4EFE A;  1BBX C;  2R82 A;  2W8K A;  1A62 A;  5FLX E;  2UUA L;  5KFU A;  3GTL B;  2V4Q A;  4LF6 Q;  3KYH C;  4EX5 A;  4IRK A;  3NQI A;  3DF7 A;  4PV1 C;  3D4W A;  1VQA A;  3G8C A;  4ODG A;  5FD5 A;  3T13 A;  4TKO B;  5JVH 3;  1UEB A;  1G91 A;  1KLU D;  4ZI7 F;  3D6W A;  2CWA A;  2OQ0 A;  2IHE A;  1UAP A;  2A6H C;  5DLF A;  1HZA A;  2UXC Q;  3I2Z A;  5EKL A;  4DAY A;  3IAY A;  2EQS A;  2RHS B;  3BYY B;  3OSP A;  4A75 A;  1F9R A;  1VQO A;  1EYG A;  1JWS D;  1RHP A;  1Z6H A;  2GLT A;  4ZKB B;  1E4E B;  3PIO 3;  2ZTE A;  2B2Y C;  4O4H F;  2EY1 A;  1FVI A;  1I50 H;  1ZYR C;  3RTX A;  4EQP A;  3I56 A;  3GD7 A;  2NVY H;  5F2D A;  3CCV A;  3A5U A;  5IYC G;  5KT2 A;  1ICF B;  2ZJQ A;  3PW5 A;  5GAE C;  2FMM A;  1C9O A;  3GTG B;  1HJP A;  2F4V L;  2NN6 I;  5IT9 L;  1C48 A;  1KIX A;  2IA6 A;  5C4J B;  2VUM G;  4DR6 Q;  2R7L A;  1I3Q H;  4XT3 B;  1TWG H;  3MWD A;  4IPD A;  1A15 A;  2VA3 A;  4BBR B;  1EY5 A;  2OT2 A;  3SHL A;  1GSO A;  2R87 A;  3H94 A;  4GKK L;  2L11 A;  1R4P B;  3PZP A;  4IRD A;  3GTJ A;  4ED0 A;  2YYZ A;  5M3F B;  2F0N A;  4U7C A;  2AWO A;  3HOU H;  1V9P A;  2DY7 A;  3SEB A;  5L1L A;  4PQX A;  4AQY H;  2PI2 E;  1A8V A;  4RA8 A;  3ER0 A;  5FPR A;  5IP9 G;  3MWY W;  4B3S L;  2Q8R E;  2F0M A;  5CV4 A;  1YHQ A;  4OHJ A;  1I4H A;  1HFN A;  1AP0 A;  4YY3 Q;  3KUP A;  3PO2 H;  1K3R A;  1T36 A;  1IKL A;  1DXM A;  4CKC A;  2Y0S G;  3OW2 A;  3FMA A;  3V2T A;  2E2D C;  4LFC H;  1TAE A;  4RFB A;  5C3E G;  3GLK A;  5HUR A;  4A3F B;  3QFF A;  4EFB A;  2TSS A;  1YNJ D;  1LTT D;  3NP8 A;  5BMV F;  2WTF A;  2Q2T A;  4JI4 L;  5JUM A;  4DV7 H;  1L1O B;  5DG8 A;  4KY7 A;  1B1Z A;  1JOR A;  1BGW A;  2NZ1 D;  5JJZ A;  4G7Z C;  1S72 A;  5M5X B;  4IN3 A;  3OMG A;  2DZD A;  3M9B A;  4H02 A;  4CDC C;  1K73 C;  3H3V C;  2IHF A;  4UP7 A;  3TP8 A;  4K14 A;  4XDX A;  1YHA A;  2XVS A;  4JC0 A;  4WJW A;  5D65 A;  5C3E B;  5J22 A;  2WDT A;  1CKN B;  2F0I A;  2XGT A;  3E9H A;  3QWN A;  4DR2 L;  1G51 A;  2E5L Q;  1GJX A;  2GPS A;  5FLM H;  4UFZ A;  3FPU B;  1DCZ A;  1CZG A;  1X65 A;  4DXG A;  2EY6 A;  1MZB A;  5KX5 F;  1KDB A;  2KVM A;  5LMU Q;  2RGR A;  1JC7 A;  4WBN F;  4YAJ B;  1FJG H;  3UDI A;  4C3J G;  1DON A;  4A3C H;  2Q2U A;  3E9I A;  1HNW L;  4ECX A;  4FDB A;  2ASD A;  4DV4 H;  1AFP A;  1ZXT A;  1J9O A;  3GTM H;  3Q2O A;  1PTO F;  4RKB A;  4YIJ A;  4CDD C;  3HOY B;  2GVA A;  4AQY L;  3I4N G;  3EYY A;  2HIX A;  1WOC A;  1D1I A;  4NW2 A;  3A7A B;  2F4V Q;  4B3S H;  3LML A;  4KKT A;  2ALZ A;  3RBE A;  1IXR A;  4LF8 L;  3D6C A;  4OL7 A;  3FRP B;  3M9M B;  4UCR A;  1LTR D;  2HDL A;  1EQV A;  2AHO B;  3HXL A;  4I7H A;  3H09 A;  3HOZ H;  2IX0 A;  4LWC A;  5DAU A;  2JA5 H;  2N88 A;  1QCB D;  3RGX A;  1SYG A;  4MNO A;  3GV5 B;  3L4K A;  1WD1 A;  2W9C A;  1VQF A;  1BQQ T;  3H91 A;  1D1K A;  2GN5 A;  4GS3 A;  2UUB Q;  3TP5 A;  4FXG C;  2ZDG A;  1G8Z D;  4GN4 B;  4UAI A;  1LTL A;  1TII D;  1WFQ A;  1SND A;  2WKD A;  1WTO A;  1BJT A;  3MXN A;  1SN8 A;  1W6K A;  2ZM6 H;  4HSP A;  1BUV T;  1HTP A;  2F0P A;  2Q2I A;  5JVL A;  3WO0 A;  4XIG S;  3JAM L;  5K2M A;  3PUY A;  1T3N A;  5KG7 A;  2HCI A;  3ULP A;  3PO2 B;  2KCT A;  1STG A;  4AYB B;  3SE7 A;  1ULZ A;  1X3P A;  3KLR A;  1XNQ H;  4UDU C;  3BU2 A;  1U4P A;  2SNM A;  3R2T A;  2BA1 A;  1PZK D;  4X62 L;  1RJP A;  4KHP Q;  5KFJ A;  1CKM A;  4JCV E;  4DF7 A;  4QUC A;  3CC2 A;  3KLS A;  3FKI B;  1LM0 A;  4DR7 H;  2B2V A;  2B2V C;  5A2Q L;  4LFB L;  3K58 A;  1X54 A;  1IBL L;  2NVQ B;  4RB3 C;  2KEE A;  4KJO A;  1K1Q A;  4JW0 A;  4DR5 H;  4EEQ A;  2I0Q A;  3PR4 A;  3CMA A;  2NN6 G;  1EY9 A;  3N44 B;  1EOV A;  4O1N A;  1H9M A;  4GKJ Q;  4E6I A;  4HTH A;  2UUB H;  1BKB A;  3M85 A;  2UUC Q;  4IHJ F;  3TBI B;  4JYA H;  1OXX K;  5FO7 B;  1QVG A;  2QDL A;  3HKZ E;  3BS1 A;  1S10 A;  1RJT A;  1NAP A;  2PN1 A;  3T1Y Q;  4CJ2 C;  3L3O C;  2YTV A;  2E8G A;  2B63 G;  1R4Q B;  3K5O A;  1E4F T;  3OHA A;  4RGN A;  5C0X J;  5FOB B;  1PH8 A;  3K5H A;  1XMO H;  1QE6 A;  4DV3 Q;  5NUC A;  2MQH A;  4G3I A;  2L0C A;  2FIN B;  2V59 A;  1PDQ A;  2SCU B;  5KFO A;  4WFN 3;  1BXR A;  4BWG B;  5M9O A;  2A69 D;  5D1O A;  4X64 H;  1HNX L;  5EDW A;  1B9N A;  4ECY A;  4Q0F A;  4B3R H;  4MV3 A;  4LUV A;  2RHQ B;  4OO1 G;  1S03 G;  4U6P A;  1TQO A;  2EOT A;  2ZJT A;  4IWX A;  2E2I A;  3LX0 A;  4OWW B;  1AUX A;  1O7I A;  4LUZ A;  2YRX A;  5C4X G;  4JV0 A;  4LNQ A;  3MXP A;  4IRC A;  3GTL A;  2VQE Q;  4OX9 L;  1JDE A;  1AW7 A;  2DN8 A;  2HD3 A;  1QIL A;  5JOB A;  5FJ8 G;  4O2B F;  4Q45 A;  3J80 L;  1FGU A;  3NPP A;  4JI0 H;  1NUC A;  3KLS X;  2ICE C;  2KCN A;  4R1J A;  3MHB A;  1VKZ A;  4J8Q A;  4B9X A;  4F8M A;  2MFI A;  2VQF L;  3R23 A;  5CV6 A;  3BQ2 A;  3P75 A;  3S1R H;  4CBV A;  2SOB A;  1SMY D;  1E4E A;  3GTP B;  4JI1 L;  3U9O A;  3T4A C;  5KG2 A;  5CA1 F;  4GN5 A;  3RGZ A;  2C9O A;  1HZB A;  1S3O A;  1RTO A;  1LO5 D;  2NVT H;  3LWE A;  3UE0 A;  1RJQ A;  3J81 c;  3RR5 A;  5FLX c;  4MA5 A;  1KEE A;  1EWH A;  4IZ8 A;  4KHP H;  4HN7 A;  4UCO A;  4B9W A;  1M6V A;  4JI8 H;  4NXM H;  3M7N A;  3PUW A;  1E7Z A;  1BDO A;  1UE6 A;  2VR1 A;  5EKK A;  5M5Y H;  3HG9 A;  1XMO Q;  3R93 A;  1HNX H;  1RK6 A;  2BCO A;  4A3F H;  4RAY A;  5KFG A;  3MR3 A;  3OMC A;  2PPB C;  1F2Y A;  3N52 A;  3RZD H;  4ABN A;  3GIQ A;  5AFW A;  3BA8 A;  1E24 A;  4EGQ A;  2HCC A;  1VAJ A;  4XQJ A;  5KKN B;  2W9B A;  5KG5 A;  3S24 A;  3A5Z B;  4P2C B;  5DQH A;  2K7V A;  4KJN A;  5DGA A;  1V1O A;  3GTK A;  1Y1W G;  1E2W A;  5AJ3 Q;  4J9M A;  4OX9 H;  4J9N A;  2HGS A;  2LKV A;  1IBK H;  4PMB A;  3TME A;  1RYR A;  3VR4 A;  5I2Y A;  3PO2 G;  1GVP A;  3W3A A;  1DIK A;  3HOU B;  1BCP B;  4DGZ A;  1ILQ A;  2QEJ C;  1XTC D;  4QL5 A;  2XD4 A;  2FLP A;  1D6E C;  2EXD A;  1VBH A;  1KL9 A;  2KCM A;  1TWG B;  3K8A A;  2FKL A;  3GV8 B;  1GKH A;  4PNY A;  2IL8 A;  4POF A;  1WTX A;  1HH2 P;  1VQG A;  5A2Q W;  2VS1 A;  1I3Q A;  3DHQ A;  2PVP A;  2B2W A;  4FP5 D;  2H1E A;  3MTS A;  3GIK A;  1Q8K A;  1STE A;  5DNF A;  2UXC H;  3OTO L;  3I4N H;  1Y8P B;  2OXP A;  5KFX A;  2K03 A;  1S5D D;  1W93 A;  2W57 A;  1L0X B;  5ELC A;  1RYS A;  1M8A A;  5M3F G;  4JV5 Q;  4R4C A;  4ZYS A;  4Y52 H;  5IP7 G;  4CKB A;  2QYZ A;  4IUP A;  1VMC A;  1STB A;  4ME3 A;  2UXB Q;  3S9W A;  2R92 H;  3OPO A;  4N8X 1;  4HYK A;  1WH2 A;  1VQP A;  4HNT A;  4F50 A;  2Z8L A;  2PMZ A;  1GSH A;  4MTD A;  1VQB A;  1KHI A;  4OGQ C;  4L5Q A;  2A8V A;  4IR1 A;  3RZO H;  1PH1 A;  1NJI C;  2SEB D;  2JA5 B;  5A35 A;  1ENA A;  1N8R C;  5IP7 H;  5FPO A;  3SXH A;  2Z1C A;  4ECQ A;  3BJY A;  2I87 A;  3TS0 A;  4WJ3 M;  4BXX G;  4DV2 Q;  4RB1 A;  3K5N A;  4A3I H;  4DR3 Q;  4A2A A;  3MEH A;  5IE8 A;  4DV6 Q;  2XCA A;  1I6V C;  1IBK L;  4OX9 Q;  4IAJ A;  4F4W A;  4DV5 L;  2B3G A;  2F0U A;  1DYQ A;  1KDA A;  4CJ1 B;  1CA6 A;  3V96 A;  4Q0Y A;  1BR9 A;  1HNZ L;  1HNX Q;  3M9N B;  3FDT A;  1N48 A;  3KAK A;  3NE5 B;  2I07 B;  1EWC A;  4LFA L;  2K5N A;  2YZM A;  3QOL A;  5FJ8 H;  2A6E C;  4DUZ H;  1XMQ Q;  1YNN D;  4FM9 A;  5M3M G;  1TXY A;  1XX8 A;  3FMC A;  2N55 A;  2ZXP A;  4RCN A;  1CHQ D;  4IUN A;  3A8K E;  3T1H L;  4B3T Q;  3S15 B;  2PNH A;  2VL6 A;  1H9J A;  3NTH A;  3QOJ A;  3S16 H;  2DGY A;  5HGT A;  1B8A A;  4DNT B;  3HP3 A;  3M7G A;  2OH2 A;  3AFP A;  5GQO A;  1F2M A;  4GNX B;  4IJH A;  3QG1 A;  2F3V A;  4NPS A;  1E2V A;  1WTH A;  1Y8O B;  1VQ9 A;  3LWB A;  1XPO A;  1QWY A;  2A74 C;  4ZK9 B;  3OIQ A;  4RAZ A;  1Y1W B;  5L1I A;  4YR3 A;  5M5W B;  5JEA J;  4LJZ C;  2R93 G;  1ROD A;  4H7B A;  3I91 A;  3G71 A;  2NVX B;  3LP8 A;  1RD9 D;  4DAM A;  4MZ9 A;  1EY7 A;  4UP8 A;  2D0O A;  1K0S A;  2F3I A;  3B6Y A;  1MJC A;  5T1I A;  1IKM A;  1Y69 U;  4QJF A;  2JA6 G;  5J39 A;  5GAH C;  2F0K A;  2IW3 A;  1XNR Q;  5KG6 A;  4ZQI A;  3OW7 A;  4JK1 C;  3T5J A;  1ESF A;  4UPA A;  4JI8 L;  1TS3 A;  5KGU A;  4IUR A;  1V1P A;  1B44 D;  1DGS A;  3RNU A;  3KTM A;  4GKK H;  1PYS B;  4DK0 A;  5C4H A;  2VQE H;  2QCP X;  1FKA H;  2Y0S B;  4X62 Q;  4F4Y A;  5I47 A;  1STA A;  4X64 Q;  1PRT C;  3EQL C;  1HPC A;  2MGS A;  2OCE A;  1LV9 A;  4DAV A;  4C56 C;  2N49 A;  4GNX C;  5M3M B;  4JI7 H;  1OXV A;  4O2D A;  5FKA C;  3GTK H;  3G6V A;  5KFQ A;  1K8G A;  3S2H B;  3CP0 A;  1DZ1 A;  1UE5 A;  3F1Z A;  1ENC A;  5FO9 B;  3NUC A;  2Z4H A;  4RKL A;  4P74 A;  3L4J A;  3AU7 A;  4UHV A;  3ERO A;  5BN4 A;  4BBS H;  2UXD H;  2KA7 A;  1S9F A;  1TU2 B;  3BJU A;  3JC6 6;  1TA8 A;  1QZG A;  1BOS A;  1IBL Q;  5D8D A;  4PMW A;  2UU9 L;  4ZLT F;  2HVS A;  4RNO A;  4LFA Q;  5C3E H;  1MKH A;  5IT9 W;  3CCS A;  3I73 A;  1V8Q A;  5ISR A;  2NU9 B;  1A9X A;  1V1Q A;  3W1B A;  4A3L G;  3F2B A;  1SFO B;  4JG2 A;  1PZJ D;  3G4S A;  4P73 A;  3RLO A;  5KFC A;  1KC7 A;  1CUK A;  2L1B A;  4CGY B;  2VQD A;  1B7Y B;  2X0S A;  4A93 B;  4EG0 A;  1GSA A;  2K5D A;  2NU7 B;  2J9G A;  4C3J H;  3ERQ A;  3NHH A;  4M9U A;  4IO9 A;  2KED A;  1K0R A;  3H0G H;  2YS6 A;  2B63 H;  4OO1 I;  5LHY 1;  5KT4 A;  3U9T A;  3SE0 A;  1BO0 A;  3R5X A;  1EIF A;  2F0G A;  2UXB H;  1SSO A;  2K32 A;  2AGQ A;  5IYB G;  2JA5 G;  3K0Y A;  5C5L A;  5EWE A;  1GD7 A;  3I4M H;  4IFD H;  4L1K A;  2DPI A;  1XTD A;  2PNR C;  1NMG A;  4ZAI A;  2PZW A;  1AH9 A;  4C3I G;  5I9P A;  2EY2 A;  2L9H A;  4KN7 C;  3DEP A;  4YAK B;  5BPF A;  3KAJ A;  2R8K A;  3A55 A;  2K33 A;  1G6Z A;  5LL6 b;  4V0B A;  5CV5 A;  3J81 j;  3WOE A;  3ICE A;  1JDB B;  5C4J H;  1X3G A;  4ETS A;  4A3E H;  4OXP A;  3OHX C;  4L5S A;  4FF2 A;  5T14 A;  2JA6 A;  2PYK A;  4JI3 H;  1QUQ A;  3VR2 A;  4UY8 C;  2WAQ E;  2FK2 A;  2BE5 C;  1TWA H;  1FNV A;  2YV5 A;  4KKU A;  5D14 A;  3HFZ B;  5CR3 A;  3PW0 A;  1V51 A;  1YEZ A;  4R8N A;  4ZCK A;  3GIM A;  2ATL A;  4C3H G;  4GN3 B;  1KQS A;  2CQA A;  3J80 E;  1ILP A;  3HKS A;  5HGQ A;  1JLL B;  3IG0 A;  3MC0 B;  4M1U B;  4DUY Q;  1S0M A;  4RH6 A;  1B3Q A;  1L2Z A;  1XPU A;  5E4W C;  2HIV A;  5E1F A;  2HUG A;  3WOF A;  3K5I A;  3NK9 A;  1GOZ A;  4YCV A;  4DV7 L;  4JI4 H;  4J9L A;  3K6O A;  4R8U A;  2L55 A;  2F0Q A;  1IOV A;  2XC9 A;  5IT9 c;  4IFD J;  5EWG A;  4ED8 A;  1PRT B;  2Z6B A;  5M5X H;  5IYD H;  3T5L A;  4NMZ A;  4J9O A;  4A3K H;  1U9R A;  3G48 A;  2CVR A;  2NTT A;  3MFG A;  1T94 A;  3MEF A;  1EYC A;  2CQO A;  3AYH B;  3T51 B;  1BBU A;  2QKI C;  1RK5 A;  4DK1 A;  1SBB B;  4XYO A;  3HOZ G;  5JVD F;  1O7L A;  3WNZ A;  4QWE A;  2K28 A;  4NKL A;  1EQR A;  3RN2 A;  3N6X A;  4HMJ A;  4TQS A;  4QUF A;  3MWE A;  4BBS B;  2LS0 1;  4A3E B;  5E7N A;  3KAL A;  3ZYY X;  2KSW A;  1FGB D;  2W6Q A;  4WRD A;  2EYP A;  3BA9 A;  4BBR G;  2C2D A;  3F8N A;  1IYU A;  1TWF H;  4PZ6 A;  5KFY A;  3G7L A;  4YQW A;  3PV0 A;  3VDY A;  2W6N A;  1E4G T;  2EYJ A;  1VBG A;  2IP4 A;  4HAE A;  2IY5 B;  2OWO A;  2RGV A;  5KFV A;  5M3F H;  4XX0 B;  1SNO A;  1NSN S;  3STB C;  3NSW A;  4JYA L;  3E5N A;  4A3G H;  1TT2 A;  2C5C A;  1Z2O X;  1YZ6 A;  3VPB A;  2B2W C;  5KIX A;  4Q44 A;  2JK8 A;  2CH4 W;  5KNB A;  3NBH A;  1SE3 A;  2WAQ B;  3A0J A;  3HKZ G;  1I94 L;  1GO3 E;  1YJN A;  2A73 B;  1PXU A;  2EJG C;  3K80 C;  4HR7 B;  2NVY B;  3H0G B;  3SDZ A;  2HJW A;  2P0A A;  3GII A;  1VQC A;  4ECV A;  3V6H A;  3C3L A;  4BA2 I;  3N43 B;  4YCU A;  5KT3 A;  2C2R A;  1XMO L;  4ZQ3 A;  1SCU B;  1HR0 Q;  1VQ7 A;  5C4X B;  4OON A;  4K2L A;  4QWC A;  3CXC A;  3NWS A;  5KEE A;  3Q8S B;  1YNX A;  4C2M A;  2ZDH A;  2RSO A;  3DUZ A;  1PH7 A;  1HRJ A;  5TSS A;  4CKE A;  1R9T B;  2WB1 A;  3NEL A;  1CQV A;  2CW8 A;  3J7A V;  3RZO B;  4HIM A;  4FU0 A;  2JEG A;  1X56 A;  2EYF A;  2UUC H;  2K52 A;  3EFX D;  1KC8 C;  3CD6 A;  3O13 A;  3JAM i;  2OLS A;  1JIH A;  1Y14 B;  3HS0 C;  2FPG B;  1KNA A;  2JE6 I;  1C30 A;  3H40 A;  1PFS A;  4DU9 A;  1Y1V A;  4XYL B;  4DK3 C;  4CJ0 B;  4OEL B;  3H3V H;  4QIW A;  3TS2 A;  1XNQ L;  4MA0 A;  2QK4 A;  1JB3 A;  3V6J A;  1HTL D;  4DL7 A;  2NBF A;  1QVF A;  1OXS C;  3I4N B;  2XNA C;  1H9K A;  3T56 B;  1SYE A;  2LXJ A;  3PMF A;  3U50 C;  3LNN A;  1V1P B;  1KAW A;  1HXY D;  4TV8 F;  4ZKC B;  2BE5 D;  3ERS X;  4EGV A;  3MJF A;  5BR8 L;  4H13 C;  5CV7 A;  2K6A A;  4C5C A;  4X65 L;  1GGO A;  5KFA A;  3RUZ A;  4KV6 A;  4LK1 C;  4BA1 I;  4RCO A;  4K8J A;  4HCE A;  3Q8P B;  3Q1K A;  3BYT B;  2A19 A;  4YHH L;  1PH4 A;  4LH7 A;  2ZJR A;  3W5O A;  2NYZ D;  1E2Z A;  1G6P A;  4ALP A;  2D9U A;  2N8N A;  2NN6 H;  1PH2 A;  2PCF B;  3C2P A;  1PTO D;  1PTO C;  4DR2 Q;  4IFD I;  2H4O A;  5C44 B;  1S5F D;  2DWC A;  4UP9 A;  3MFH A;  2Z6K A;  4YBZ B;  4GC7 A;  1TWC B;  1EYA A;  1BNC A;  4IUV A;  4YWM A;  5FK9 C;  4O42 A;  1NCV A;  2KHS A;  4XTC S;  2UU9 Q;  2AUK A;  1Z2P X;  5KG4 A;  5KFS A;  3QZ7 A;  2QA4 A;  4FBT A;  2K14 A;  3KDF B;  1TR5 A;  1KJ8 A;  4RNN A;  1D5M C;  3FKI A;  4ULL A;  4EQO A;  4PMC A;  3LWU A;  4DUY L;  1AZP A;  5ELF A;  2JSO A;  4XT1 B;  3U4Z A;  5KFI A;  3RB3 A;  3BZD B;  1KLG D;  2VXW A;  3S1N H;  2J4X A;  4L8J A;  4K0K Q;  2AMC B;  1N56 A;  2BOS A;  4YJ2 F;  4DA2 A;  2DY8 A;  3PQI A;  1WR2 A;  4M7E A;  2WV6 D;  1W96 A;  5HV6 A;  1U4R A;  1GUG A;  3W2D A;  5CBE E;  3N42 B;  1KTK A;  4YR0 A;  1B33 N;  3UI2 A;  2F03 A;  2RKS A;  1ENF A;  1UE1 A;  5I6Y A;  1Y8N B;  2SDF A;  3J80 W;  1BVS A;  1SE2 A;  4GNX A;  4F88 A;  1NNX A;  1Z9F A;  1UC9 A;  3T5K A;  3QB3 A;  4IQZ A;  2PW5 A;  3SK8 A;  4GKK Q;  1EZ1 A;  1B4O A;  3OOC A;  4JOI C;  3I4M B;  4MV6 A;  4IR9 A;  3D4D A;  4O0A A;  1JQY D;  2F4I A;  1EYD A;  1FR3 A;  2RSN A;  2UXC L;  2I5L X;  5D1P A;  5KT5 A;  3DEO A;  4YHH H;  4ID6 A;  1W2B A;  2ZXO A;  3IL8 A;  1N32 Q;  1B3A A;  2VQF H;  3KBX A;  1CT1 D;  1EY6 A;  2BDN A;  2FP4 B;  4R8U B;  4AYB E;  4LF7 H;  3R5F A;  4JI5 Q;  2VZA A;  2MJ8 A;  4BWS C;  2R93 B;  4B3T L;  2BQU A;  4LF4 Q;  5ELB A;  1PRT D;  4Z9C B;  5J2T F;  1K1S A;  4A3I B;  2DNE A;  5I9O A;  2R7Z G;  4WJ4 A;  1EQT A;  1OWT A;  2PQA A;  2C22 A;  1I4G A;  4Y8V B;  5BN3 A;  1WTP A;  1PTO B;  3HOW G;  2WFW A;  4K5V A;  5KND A;  3STB D;  5CYU A;  3T5H A;  1XXG A;  1F2L A;  4C5A A;  3CKI B;  2N3S A;  3GV7 B;  4MN3 A;  4HJ9 A;  2B2T A;  1C8C A;  1L2F A;  2E2H A;  1J5E H;  1ET9 A;  2K4K A;  3CC7 A;  1PH3 A;  3PO3 G;  3TIN A;  4DV5 H;  3MZ5 A;  4DUZ L;  4DL4 A;  3RIZ A;  4PZ7 A;  2CFM A;  2B8G A;  4LFC Q;  4KY5 A;  2MNA A;  3NBI A;  3ZJY C;  1U4L A;  2XWB B;  1WSC A;  5EGT A;  2YZN A;  1BNZ A;  4KK7 A;  1O80 A;  1J6Q A;  2HHH L;  4JBM A;  5GRO A;  4A3J G;  4DLK A;  1N33 Q;  4ED6 A;  3TQT A;  4E4T A;  4DXF A;  3TQ1 A;  2B39 A;  1KNE A;  1P16 A;  5JEA H;  1Y1V H;  1L1O C;  1JOQ A;  4DNI A;  4N9T A;  4LF6 H;  1STY A;  2K1B A;  3GTJ B;  2R8G A;  1YVC A;  5FLX L;  4A76 A;  4R4I A;  4BXX H;  1PTO H;  4QW8 A;  1O78 A;  2XN9 C;  3RAQ A;  1YNN C;  3S1M H;  4DFA A;  2JYO A;  4LF7 L;  1JOO A;  2A6E D;  3TSS A;  3CCQ A;  3KHR A;  3K0X A;  4TVA B;  4JI5 H;  3SK6 A;  5IP9 H;  4BY1 G;  2WB1 B;  1R9T A;  1WTQ A;  4RGT A;  2FHT A;  2R7Z B;  1PFM A;  4RUC A;  3F2C A;  2NUA B;  4NLG A;  3BVZ A;  4JI2 H;  1PV4 A;  3QR8 A;  1U5K A;  2V5A A;  1KRS A;  2XRS D;  5IY0 A;  4Y7N B;  4IOC A;  1AN7 A;  1E0B A;  2QEX A;  2KHI A;  2KOL A;  1G2S A;  3F2D A;  2ZJP A;  1EIY B;  4A3M G;  5M5W H;  5E4X A;  4QWA A;  3GTO B;  1YIT A;  1XJV A;  2HDM A;  4YCW A;  3Q6S A;  2YL2 A;  4JV2 A;  4Q5V A;  5KG1 A;  4DV0 Q;  5JH7 F;  3J7Y W;  1HNW H;  4TSS A;  2QGQ A;  3KOJ A;  2O5I C;  2BH8 A;  1WD0 A;  3ETH A;  4HID A;  4NXN L;  2JA8 H;  3BZK A;  1KJQ A;  2J6T A;  1EFI D;  3L7Z C;  5CGK A;  4XQN A;  4HJ5 A;  3A8I E;  3BAA A;  1VQL A;  5IT9 E;  4EYI B;  1TWF B;  3UE1 A;  3I55 A;  4BY7 H;  4DL3 A;  3J80 i;  2VUM B;  5CC4 A;  1ZHQ A;  3BG3 A;  5J3B A;  1WTW A;  2HVQ A;  1M0W A;  2JQO A;  2OEO A;  3FP9 A;  3E5S A;  3H20 A;  2KEN A;  3FKI H;  3L2P A;  3S1Q H;  3JAM c;  3VR6 A;  4LF6 L;  1HNZ H;  2JA7 B;  1AUV A;  1EYZ A;  4JI3 Q;  4DR4 L;  2DIK A;  1SYD A;  3PSI A;  1ZEQ X;  2F3W A;  2Z0S A;  3KHH A;  2DLN A;  2FPP B;  4MTK A;  2HT1 A;  1EY4 A;  1EUD B;  4LFA H;  2UU9 H;  1HQM C;  4R9W A;  2WYO A;  1C4Q A;  4I65 A;  3VYU A;  3V6K A;  3I4M G;  4IFD G;  1JT8 A;  4YWK A;  2R86 A;  2CWP A;  4OWX B;  4RUA A;  4FS1 A;  4JI8 Q;  1Q3L A;  2RDH A;  4R4T A;  4C3J B;  5I4D A;  3T1H H;  3GV3 A;  3UDF A;  3MXG A;  2NUC A;  5G3L D;  4A3F G;  1SAP A;  1A3T A;  1M1K C;  1XNR L;  1EOT A;  5IWA Q;  4OWT B;  5DGB A;  4LAA A;  2G5D A;  1CKN A;  2Q8T A;  1A2U A;  5CMD A;  4UCS A;  4MTE A;  1SE8 A;  4JPB W;  3OYY A;  1EZ6 A;  1A6X A;  3AQQ A;  4L5T A;  1TWC A;  3CVZ A;  3J7A 5;  3KBG A;  2X69 A;  3R2I A;  4JOI A;  2O2L D;  1CA5 A;  3M4I A;  3BVG A;  2W9C B;  4G4K A;  2UXB L;  1TVX A;  2KQ3 A;  4IPC A;  1HNZ Q;  4JI6 L;  5K5P A;  2AQ2 B;  3EJI A;  1PYW D;  1SR3 A;  3HOZ B;  1BXT A;  3RLF A;  4FNF A;  3Q8Q B;  3TP6 A;  5C0X G;  4EGJ A;  2R8J A;  1SMX A;  2IPK D;  5KFZ A;  2EYH A;  5KFK A;  2QDB A;  1S40 A;  1HQR D;  2VW9 A;  2ASB A;  3GTL H;  1XYI A;  4UCV A;  1Y1V G;  5I6W A;  1IBL H;  3S1R B;  4A3B H;  2W8L A;  4F4X A;  2W6Z A;  3FPP A;  1VQ6 A;  4CC6 A;  2YU9 A;  1M7J A;  2ES2 A;  1SRO A;  1HUM A;  3BQ0 A;  1STN A;  4MHE A;  3Q8R B;  4LSX A;  1HR0 H;  2VPS A;  4DR4 H;  2L12 A;  3ULL A; 
#chains in the Genus database with same CATH homology
 4IO9 A;  3ER0 A;  1K0R A;  3H0G H;  4DK6 C;  3K81 C;  5IP9 G;  4B3S L;  1PH9 A;  2B63 H;  4JV5 L;  1YHQ A;  4OO1 I;  4YY3 Q;  1EIF A;  3PO2 H;  1K3R A;  3OW2 A;  2Y0S G;  1VQN A;  3K7U C;  5IYB G;  4DV3 L;  2JA5 G;  2OTL A;  2I5H A;  3GDE A;  5C3E G;  1GD7 A;  1NMF A;  1VQJ A;  2B29 A;  3I4M H;  1MIU A;  4A93 G;  1IL2 A;  2Q2T A;  4JI4 L;  4A3M H;  1L1O B;  1XTD A;  1NMG A;  3UDG A;  3S14 H;  4X66 L;  3CPW A;  2BH2 A;  1AH9 A;  4R4Q A;  1S72 A;  1E22 A;  2ZM6 Q;  4HJA A;  3M9B A;  4H02 A;  3RN5 A;  3GTG H;  1K73 C;  1X3F A;  3J81 j;  3ICE A;  1NBW A;  2IHF A;  4UP7 A;  4BXX H;  2EIF A;  5C4J H;  1MJE A;  1X3G A;  1YHA A;  4JI6 L;  4JC0 A;  1LYL A;  4BY1 H;  1QVC A;  1VQ4 A;  1PYB A;  4A3E H;  1CKN B;  2XGT A;  3E9H A;  4OXP A;  2E5L Q;  4DR2 L;  1G51 A;  4L5S A;  3CC4 A;  5FLM H;  4DR1 Q;  4C3I H;  1QUQ A;  4UY8 C;  2WAQ E;  4IOA A;  1X65 A;  2NZH A;  1TWA H;  4GLX A;  2YV5 A;  5LMU Q;  3HFZ B;  1YEZ A;  3M3Y H;  2H5X A;  3UDI A;  2ALY B;  4C3H H;  4GN3 B;  1KQS A;  2WAQ G;  4A3C H;  2Q2U A;  4A3L H;  3E9I A;  1HNW L;  4FDB A;  2UUA Q;  2VNU D;  2VQF Q;  3HKS A;  5HGQ A;  4DR6 Q;  4JI0 L;  4B3R Q;  3GTM H;  1Z47 A;  4DUY Q;  2Z6K C;  1H95 A;  4LF5 Q;  1XPU A;  2HIV A;  3U4V A;  2GVA A;  4AQY L;  4GOP A;  2KHJ A;  2ZTC A;  2R7Z H;  3I4N G;  2HIX A;  2JEB I;  4YCV A;  1WOC A;  4DV7 L;  4K0K L;  5K36 G;  2LSS A;  5IT9 c;  2F4V Q;  4A3E G;  3KJP A;  1PHJ A;  4IFD J;  3W1G A;  2L15 A;  5M5X H;  1IXR A;  4LF8 L;  4A3B G;  5IYD H;  4A3K H;  1XNQ Q;  3G48 A;  4LFC L;  4X6A H;  2E2I H;  3D0F A;  3MEF A;  2CQO A;  2AHO B;  3AYH B;  1BBU A;  2C35 B;  2MO1 A;  3HOZ H;  2IX0 A;  4LWC A;  3HOZ G;  2JA5 H;  2HHH Q;  2WP8 J;  2VUM H;  1EQR A;  3RN2 A;  4MNO A;  5LMN W;  2Q2H A;  1OTC A;  4LUO A;  1Q12 A;  5E7N A;  1VQF A;  1JE5 A;  5FLM G;  2E2H H;  4RG1 A;  2UUB Q;  2GN5 A;  1WCM G;  4GS3 A;  1K83 H;  4PG3 A;  4BBR G;  1R9T H;  1TWF H;  4GN4 B;  4PZ6 A;  1LTL A;  5H1S E;  4JBJ A;  3PV0 A;  3VDY A;  1WFQ A;  4A93 H;  4YHH Q;  2IY5 B;  1SN8 A;  2R7D A;  2RCN A;  2OWO A;  2MO0 A;  5M3F H;  3S15 H;  2LXK A;  3DM3 A;  3STB C;  2K5V A;  1TWH H;  1VQK A;  4JYA L;  3PF5 A;  2Q2I A;  3NEN A;  4A3G H;  5IWA L;  3PUV A;  4KLK A;  1EQQ A;  4XIG S;  1YZ6 A;  1N9W A;  1HR0 W;  2JK8 A;  3PUY A;  4DR5 Q;  1YJ9 A;  3A0J A;  3ULP A;  3CF5 A;  3HKZ G;  1I94 L;  1GO3 E;  4IJL A;  1YJN A;  3K80 C;  2KCT A;  4QGU A;  1NY4 A;  2GVB A;  4A3D G;  2XTI A;  2JJQ A;  1VQC A;  3BU2 A;  3HOY G;  4YY3 L;  4BA2 I;  4RMF A;  4DPG A;  4YCU A;  4QQB X;  2BA1 A;  4X62 L;  1YBY A;  3CME A;  1XMO L;  4C2M H;  2OQK A;  4KHP Q;  1CKM A;  2FXQ A;  3KDF A;  4JCV E;  2I5M X;  4X64 L;  1HZC A;  4OON A;  3CQZ H;  1HR0 Q;  1LM0 A;  1VQ7 A;  2CCZ A;  3CC2 A;  1WJJ A;  3L0O A;  3GO5 A;  3CXC A;  4LFB L;  1YNX A;  1IBL L;  1X54 A;  4JI6 Q;  1XPR A;  1PH7 A;  2NVX H;  3KF8 B;  1G29 1;  2ZM6 L;  2I0Q A;  3CMA A;  2NN6 G;  3NEL A;  2R6G A;  3S17 H;  1EOV A;  4GLA C;  4HIM A;  3U58 A;  4BY7 G;  4POG A;  1X56 A;  4GKJ Q;  4JI0 Q;  4B3R L;  2K52 A;  3GTP H;  1KC8 C;  1BKB A;  3CD6 A;  3JAM i;  3J80 c;  1IBM Q;  3M85 A;  1Y14 B;  2UUC Q;  2JE6 I;  2PQA B;  3PO3 H;  4EQ5 A;  4LFB Q;  1SRU A;  1PFS A;  1OXX K;  3OTO Q;  4DK3 C;  1U0L A;  1QVG A;  5C0X I;  3HKZ E;  3CCU A;  1IBM L;  3H3V H;  1BBW A;  2A1A A;  2ATW A;  3TS2 A;  1XNQ L;  1CSQ A;  3T1Y Q;  2YTV A;  2E8G A;  1M90 C;  2B63 G;  2AWN A;  2R7F A;  5JJK A;  1WCM H;  4BBR H;  2PI2 A;  5C0X J;  1PH8 A;  1LUZ A;  1SFO H;  4KI0 A;  4AIM A;  4L5R C;  4WJ4 A;  4DV3 Q;  1QVF A;  1JJC B;  1OXS C;  4Y7N H;  2MQH A;  3BZC A;  1Q86 C;  3FHW A;  3J7Z C;  2LXJ A;  4KHP L;  3U50 C;  2UXD Q;  2HQL A;  1KAW A;  4KHZ A;  3TRZ A;  2N78 A;  3ERS X;  2DUD A;  5BR8 L;  1JJ2 A;  4X65 L;  3TRE A;  1GM5 A;  1HNX L;  2IX1 A;  1VQM A;  4DR7 L;  2AKW B;  4HJ7 A;  4X66 Q;  4BA1 I;  1VQ8 A;  3KLW A;  4LUV A;  1V43 A;  3EIV A;  2A19 A;  3KF6 A;  2RHQ B;  4IPG A;  4YHH L;  1XMQ L;  1KRT A;  1PH4 A;  4OO1 G;  2YU9 H;  4GKJ L;  2ZJR A;  3W5O A;  4OWW B;  3H3V I;  4DAY B;  1YHB A;  3GTJ H;  1G6P A;  1O7I A;  4ALP A;  4LUZ A;  2N8N A;  5M3M H;  3HOX H;  1PH2 A;  4NXM L;  3T1H Q;  5C4X G;  4DR2 Q;  4IFD I;  4BBS G;  4LNQ A;  4UP9 A;  2VQE Q;  2Z6K A;  4OX9 L;  1VQ5 A;  3CW2 C;  4NXN Q;  4YWM A;  1N36 L;  5FJ8 G;  4XTC S;  1VCI A;  2UU9 Q;  4DR5 L;  1QZH A;  4NB3 A;  1FGU A;  4DV4 L;  5HY6 A;  2QA4 A;  2NVQ H;  3ULJ A;  2K14 A;  3KDF B;  4R1J A;  4P71 A;  1JJG A;  1N34 L;  2UUB L;  4R4O A;  3PIO A;  4DUY L;  2MFI A;  4B3M L;  2VQF L;  1YJW A;  3U4Z A;  5IYC H;  3S1N H;  3S1R H;  3MXN B;  4DV7 Q;  1N33 L;  4K0K Q;  2D62 A;  2AMC B;  1UWV A;  3Q8D A;  4JI1 L;  3A74 A;  2WB1 G;  5BR8 Q;  5JEA G;  3H0G G;  3G6E A;  4LF8 Q;  2JEA I;  2CKZ B;  4GN5 A;  3HOV H;  4PZ8 A;  1HZB A;  1OXU A;  1S3O A;  1VQD A;  2NVT H;  3UE0 A;  4DV1 L;  2NZO A;  4J15 A;  1RIP A;  1SLJ A;  3RR5 A;  1UE1 A;  5FLX c;  3J81 c;  3CCJ A;  2BA0 A;  3FKI G;  3CCL A;  1X55 A;  1BVS A;  1IZ6 A;  2ID0 A;  4GNX A;  1Z9F A;  4HJ8 A;  3M7N A;  1E7Z A;  1T9H A;  1UE6 A;  3PUW A;  3K7A H;  4GKK Q;  5JJI A;  5LMU L;  5M5Y H;  4AQY Q;  1XMO Q;  4JOI C;  4A3F H;  2VQE L;  1CKO A;  1KXL A;  4O0A A;  1OXT A;  4LF4 L;  4DUZ Q;  3GTQ H;  3HOV G;  1C0A A;  2UXC L;  2I5L X;  4JI1 Q;  1L0W A;  3RZD H;  1E24 A;  1Q81 C;  2R92 G;  1W2B A;  3GTO H;  1I6H H;  1N32 Q;  4DV4 Q;  1WYD A;  4HIO A;  1E1T A;  3S24 A;  3A5Z B;  1QUQ B;  4LF5 L;  1WI5 A;  4AYB E;  1N32 L;  5ELN A;  3TEH B;  4YWL A;  1YIJ A;  1Y1W G;  5AJ3 Q;  1VQI A;  1HZ9 A;  2PMZ E;  2VZA A;  4JI5 Q;  4B3T L;  3PO2 G;  4LF4 Q;  1GVP A;  2YTX A;  5C44 H;  1PH5 A;  4JYA Q;  3M4P A;  1FL0 A;  4HIK A;  1PVO A;  2R7Z G;  4QL5 A;  3AFQ A;  4QY7 A;  1VS0 A;  2EXD A;  5ELO A;  3LGJ A;  3KJO A;  1YI2 A;  1I94 Q;  1KL9 A;  3D31 A;  2KCM A;  2PQA A;  3K8A A;  4DV2 L;  2IT1 A;  1E3P A;  1GKH A;  4POF A;  4A3D H;  1HH2 P;  1VQG A;  4GOP B;  2VS1 A;  2WFW A;  3HOW G;  4JI5 L;  3STB D;  4LF9 L;  4NXM Q;  3CCR A;  3HOY H;  4APV A;  1Q8K A;  2N3S A;  3IRB A;  4QIW E;  1Q82 C;  2RF4 A;  1AE2 A;  3RLN A;  2K5H A;  3OTO L;  4HJ9 A;  4JI4 Q;  4P75 A;  3I4N H;  3PF4 A;  1L2F A;  4JBW A;  4A3I G;  4AH6 A;  2K4K A;  3CC7 A;  1Y1W H;  3H15 A;  1PH3 A;  3PO3 G;  4WJ3 M;  5M3F G;  4DUZ L;  2Y0S E;  4JI2 Q;  3NEM A;  4B3S Q;  3PIP A;  4PZ7 A;  4P72 A;  4R4C A;  3TQY A;  2CFM A;  5IP7 G;  4LFC Q;  3KFU A;  4DR4 Q;  4Y52 H;  2MNA A;  5C44 G;  4LF9 Q;  1N34 Q;  3ZJY C;  4ME3 A;  2UXB Q;  2R92 H;  1PA6 A;  5LMN L;  1J6Q A;  3E0E A;  3KF6 B;  5GRO A;  4A3J G;  4A3J H;  1VQP A;  2HHH L;  4JBM A;  1N33 Q;  3AEV A;  1J5E Q;  5DLQ E;  1VQB A;  1KHI A;  3PUZ A;  1P16 A;  1JMC A;  4A3C G;  4L5Q A;  2A8V A;  1Y1V H;  3RZO H;  1PH1 A;  1Q1B A;  1NJI C;  1L1O C;  1VQE A;  4DNI A;  1Q7Y C;  1X6O A;  1N8R C;  5IP7 H;  1K8A C;  1YVC A;  2VY3 A;  3F8T A;  3I4O A;  3EBE A;  2JA9 A;  4R4I A;  4DV2 Q;  1NE3 A;  4A76 A;  3TS0 A;  4A3I H;  4BXX G;  4DR3 Q;  3S1M H;  5IE8 A;  4DV6 Q;  4LF7 L;  3PUX A;  3CCQ A;  2JA7 H;  3K0X A;  4LW1 A;  1D8L A;  4TVA B;  1IBK L;  4OX9 Q;  5IP9 H;  2B3G A;  4BY1 G;  3UDX A;  4DV5 L;  3HOW H;  4DR1 L;  1HNZ L;  4GLV B;  4X65 Q;  1HNX Q;  1VQH A;  3F2C A;  2R93 H;  1B70 B;  4JI7 Q;  3S2D H;  1PV4 A;  3DLL A;  1PH6 A;  1U5K A;  4LFA L;  3WWV A;  1J5E L;  1KRS A;  2K5N A;  1P8L A;  2K75 A;  5IY0 A;  2KBN A;  3I7F A;  4IOC A;  1I5F A;  5FJ8 H;  2OTJ A;  1KD1 C;  1XMQ Q;  2QEX A;  2KHI A;  3PCO B;  4JI7 L;  2JA6 H;  3F2D A;  5M3M G;  2K50 A;  4MTN A;  5M5W H;  2ZJP A;  4DV0 L;  4A3M G;  1TXY A;  1EIY B;  1EUJ A;  1A63 A;  1HNW Q;  4DR6 L;  1YIT A;  1NTG A;  3T1H L;  5C4X H;  1XJV A;  4B3T Q;  4YCW A;  2PNH A;  2VL6 A;  1FJG L;  3M4O H;  4DV0 Q;  2UXD L;  2V1C C;  4DV5 Q;  3S16 H;  2DGY A;  1B8A A;  4A4I A;  2ZTD A;  2QGQ A;  3KOJ A;  2YTY A;  2BH8 A;  3AFP A;  5GQO A;  1EWI A;  5IYB H;  4GNX B;  4IJH A;  4HID A;  4NXN L;  2WB1 E;  1X9N A;  4TQU S;  4NPS A;  2JA7 G;  2JA8 G;  1IYJ B;  1VQ9 A;  3BZK A;  2JA8 H;  1XPO A;  3CAM A;  3J81 i;  3L7Z C;  2E2J H;  4IPH A;  4HJ5 A;  1VQL A;  5JEA J;  1X3E A;  1CSP A;  3UE1 A;  3I55 A;  4BY7 H;  3J80 i;  5IYD G;  2R93 G;  1IBK Q;  1Q46 A;  3G71 A;  4A3K G;  1W3S A;  1Q1E A;  3SGI A;  4DAM A;  3CCE A;  1FJG Q;  3HOU G;  4MZ9 A;  4UP8 A;  5J3B A;  2D0O A;  4DV6 L;  2F3I A;  3B6Y A;  1MJC A;  4LF7 Q;  2JQO A;  3M4Q A;  4QJF A;  3FP9 A;  5EAY A;  1TWC H;  2KEN A;  3FKI H;  2JA6 G;  3L2P A;  3S1Q H;  3JAM c;  1UE7 A;  4LF6 L;  5GAH C;  1C7Y A;  4JI3 Q;  1XNR Q;  1HR0 L;  3T1Y L;  4DKA C;  4DR4 L;  3PSI A;  2Z0S A;  3CCM A;  4JI2 L;  2F52 A;  1A62 A;  2UUA L;  2HT1 A;  1RL2 A;  4LF6 Q;  4UPA A;  4JI8 L;  3KYH C;  4EX5 A;  1L1O A;  1DGS A;  3EN2 A;  3RNU A;  3I4M G;  4IFD G;  1JT8 A;  1PYS B;  4YWK A;  1VQA A;  2CWP A;  4OWX B;  4DV1 Q;  4JI8 Q;  4R4T A;  1EFW A;  1UEB A;  4X62 Q;  3UDF A;  1N36 Q;  4GOP C;  2CWA A;  4X64 Q;  2OQ0 A;  4A3F G;  2IHE A;  1M1K C;  2OCE A;  1XNR L;  4DR7 Q;  5JJL A;  5IWA Q;  4OWT B;  1HZA A;  2UXC Q;  2N49 A;  3I2Z A;  4GNX C;  1CKN A;  3PGZ A;  3S2H H;  2EQS A;  2RHS B;  1OXV A;  4O2D A;  4A75 A;  1VQO A;  1SE8 A;  1EYG A;  3GTK H;  3OYY A;  1K8G A;  4DR3 L;  3CP0 A;  1ASY A;  3AQQ A;  4L5T A;  2ZTE A;  3J7A 5;  1UE5 A;  3F1Z A;  3HOX G;  3CPF A;  1FVI A;  4JOI A;  4P74 A;  5LMN Q;  1A0I A;  4BBS H;  1I50 H;  2UXB L;  3BJU A;  3JC6 6;  4IPC A;  4AYB G;  1AE3 A;  5AJ3 L;  1QZG A;  1HNZ Q;  3I56 A;  3GD7 A;  1IBL Q;  4PMW A;  1K9M C;  2NVY H;  4JI3 L;  3CCV A;  2UU9 L;  2D0P A;  3A5U A;  1ASZ A;  5IYC G;  1SR3 A;  2ZJQ A;  5GAE C;  3RLF A;  1C9O A;  4LFA Q;  1HJP A;  1E1O A;  1MKH A;  5C3E H;  5C0X G;  2NN6 I;  2F4V L;  1SMX A;  1D7Q A;  3CCS A;  1KIX A;  5GAD C;  1S40 A;  2VUM G;  1V1Q A;  2VW9 A;  3W1B A;  1I3Q H;  2ASB A;  1TWG H;  3F2B A;  1Y1V G;  4IPD A;  4JG2 A;  3GTL H;  4A3G G;  4A3L G;  3G4S A;  2E5L L;  4B3M Q;  4P73 A;  3RLO A;  4A3B H;  1CUK A;  4GKK L;  1VQ6 A;  4JBK A;  1B7Y B;  5GAG C;  2YYZ A;  2ES2 A;  1SRO A;  2AWO A;  3NBH B;  3HOU H;  1V9P A;  2UUC L;  4JV5 Q;  2PI2 E;  1JB7 A;  4C3J H;  3ULL A;  1A8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...