4A3MK

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid and soaked with ampcpp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3mK00
4MEYA 4QJVB 3RZOK 4OIPA 3I4NC 4A3MK 1TWFC 1I50K 4QIWD 5C44K 5IYBC 3GTMC 4BXXK 5M5XK 2O5IA 2E2IC 1TWGC 1ZYRA 4A3LC 3GTJC 5FLMK 2NVYK 4LJZA 3K7AC 4A3BK 2VUMC 5TMFA 2NVXK 2JA7C 3S14K 4BBRC 3PO3K 2JA6K 3RZOC 2E2HC 4BY1K 4A3MC 5FJ8K 3S1MK 3S15K 2PMZD 4YFXA 4MEXA 1TWCK 4C2MK 4GZYA 4A3FC 4OIOA 3HKZL 3S2HK 4YG2A 4C3HK 5C4XK 2NVQK 1I6HC 2PPBA 3I4MK 4A93K 2WAQD 4Y7NK 2NVTC 3PO2K 3HOXC 3CQZK 2NVXC 4A3BC 5IP9K 2YU9K 3S14C 2R7ZC 4G7HA 4A3JC 4BBSC 5IP7C 4A3CC 3HOUK 2PA8L 3S17K 5D4DA 1YNNA 3S1QK 4OIQA 3GTLC 3M4OK 3H3VL 4JK1A 4YFNA 3S1RC 3S15C 4A3EC 1TWCC 3GTOC 2A6HA 5C4JC 3FKIC 3M3YC 4Y52C 3EQLA 3HOYK 5IYDK 2BE5A 3HOZC 1Y1WK 1BDFA 3WODA 2Y0SL 5C4XC 2NVQC 4XLNA 1I6VA 4A3KC 4XSZA 2JA5K 3HOVK 4A93C 2R92K 3GTGK 2YU9C 4G7ZA 4XSXA 3GTQK 2CW0A 1WCMK 4KN7A 4QJVA 4ZH4A 1I50C 2A69A 5C3EK 5C44C 3S16K 3S2DK 4BXXC 4A3GK 1I3QK 5FLMC 1TWAK 2NVYC 1R9TK 2JA8K 5IYCK 3RZDK 2WB1L 2JA5C 3HOVC 1SFOK 2R92C 3HOWK 4A3DK 2B63K 3GTPK 4KMUA 3PO3C 2R93K 2JA6C 4BY7K 4KN4A 4BY1C 3HKZD 3S1MC 4AYBD 1K83K 1Y1VK 4MQ9A 5M3FK 2E2JK 3S1NK 3S16C 3S2DC 4G7OA 4A3GC 3S2HC 4Q4ZA 4LK1A 4NOIA 1HQMA 5M5WK 1TWAC 3I4MC 3RZDC 3I4NK 4Y7NC 3PO2C 5M3MK 1TWFK 3CQZC 5IP9C 4LLGA 2B63C 5IYBK 3GTMK 3HOUC 4A3LK 3S17C 4BY7C 1TWGK 3S1QC 4XLPA 3GTJK 4OIRA 3M4OC 4A3IK 4QIWL 3GTKK 1K83C 1Y1VC 3S1NC 5IYDC 3HOYC 2JA7K 4BBRK 1Y1WC 4X6AK 2A6EA 2E2HK 1TWHK 3GTGC 4YFKA 1SMYA 4Q5SA 3GTQC 4A3FK 5TMCA 5M5YK 2PMZL 1WCMC 3H0GK 1XPPA 1I6HK 4A3IC 3GTKC 4C3JK 2NVTK 3HOXK 2WB1D 5C3EC 4BBSK 1IW7A 2R7ZK 4A3JK 1I3QC 4OINA 3DXJA 5IP7K 4A3CK 4X6AC 1YNJA 2JA8C 2WAQL 1R9TC 1TWHC 2PA8D 5IYCC 4C3IK 3GTLK 3S1RK 1SFOC 3HOWC 3H3VD 4A3EK 3GTOK 4A3DC 5C4JK 3GTPC 3FKIK 3M3YK 4Y52K 2R93C 3HOZK 2E2IK 4AYBL 3H0GC 2O5JA 4LK0A 2Y0SD 3K7AK 4A3KK 2E2JC 2VUMK 2A68A
chains in the Genus database with same CATH superfamily
4MEYA 3HXAA 2EBBA 4QIWD 4BXXK 2O5IA 1B4AA 1TWCA 3GTOA 5FLMK 4DDQA 3IPJA 4A3BK 4LOWA 2NVXK 3V4GA 1EK8A 3PO3K 2JA6K 1V5VA 5IORA 2P5MA 4A3MC 4O2DA 1XXBA 4YFXA 4C2MK 4A3FC 3HKZL 3S2HK 4C3HK 5C4XK 2NVQK 4Y7NK 4C3JC 3PO2K 2YU9K 4BBSC 4A3JC 2R92A 1ZVUA 4GTBA 3S1QK 1YNNA 4GTDA 4OIQA 3GTQA 3S15C 4YFNA 1F93A 5IOSA 1WCMA 3FKIC 3LAPA 3EQLA 3HOYK 3OEPA 1I3QA 3HOVK 4A93C 1TWAA 1R9TA 1WQHA 1PJ5A 4QJVA 1I50C 2A69A 3VA7A 2GSOA 2GSUA 4WJ3M 1K83A 3T01A 2JA5C 1SFOK 3HOWK 4A3DK 3GTPK 1WSVA 2R93K 1VH2A 4KN4A 3GTMA 1BGWA 1TWGA 3GEHA 3S1NK 4KMDA 4G7OA 3T02A 4GTEA 1O28A 1HQMA 3SZYA 3I4MC 3RZDC 1L0WA 1VLOA 1O2BA 4BY7C 1B4BA 2R93A 1Y1VC 4XCHA 4X6AK 5JFEA 2R7ZA 1TWHK 3GTQC 3GEEA 4A3FK 4WILA 3G4AA 1WCMC 4A3IC 1EH1A 4C3JK 4BBSK 1IW7A 4A3JK 1I3QC 3DXJA 1YNJA 1R9TC 3H3VD 3FKIK 4KAWX 1WSRA 4GTCA 4LK0A 1G51A 1IE0A 1X31C 3OREA 2V6SA 4LR2A 3I4NC 1I50K 4KM9A 3GTMC 5M5XK 2E2IC 1TWGC 1ZYRA 3FOEA 1BJTA 2RH6A 5EGEA 3K7AC 2VUMC 4FZBA 5TMFA 1IQ0A 3A8KA 3S14K 1XZQA 4BBRC 3L4KA 3RZOC 2PMZD 1TWCK 2RGRA 2Y3PA 1YX2A 4LQYA 4GZYA 4PAAA 4G0WA 1I6HC 2PPBA 3I4MK 1J6XA 1Y1WA 1RU0A 2NVTC 2R7ZC 2JA5A 1USMA 1KQ4A 3BP3A 1JOEA 2PA8L 4C3IC 4JK1A 5C4JC 2BE5A 3GEIA 2Y0SL 1DCOA 1I6VA 2R92K 4GT9A 4BKWA 3GTQK 1WQFA 2V6UA 1WCMK 4ZH4A 1PJ7A 4KATA 4KMAA 1O2AA 4A3GK 1WORA 5TJ3A 1I3QK 1Y1VA 1TWAK 1R9TK 1XZPB 2WB1L 2JH3A 4FM9A 3S0XA 1J98A 1O2FB 3HKZD 2ZUEA 4AYBD 1WOPA 5IOQA 3S1MC 3FOFA 1K83K 5M3FK 3TFIA 1ZBSA 3S16C 3S2DC 4GTFA 4G0VA 4LK1A 4NOIA 1F7VA 3I4NK 1EI6A 4WJ4A 4LLGA 2B63C 3NUHA 3GTMK 3S17C 3CAGA 1TWGK 1J6WA 3TTGA 3A8IA 5IYDC 4C45A 4BBRK 2XCQA 1Y1WC 5JVOA 3GTLA 1SMYA 3JSTA 1ISEA 3AQOA 5M5YK 1XPPA 1I6HK 2E2IA 3GTKC 1AB4A 2NVTK 3LAJA 4PABA 2R7ZK 2VUMA 3GIRA 2PHCB 2WAQL 5IYCC 4C3IK 1JVIA 3AD8C 1EFWA 5C4JK 1F9NA 4RMFA 4KB4A 3H0GC 2O5JA 2E2JC 2NVYA 2ZUFA 3AD9C 4OIPA 4A3MK 1TWFC 2CFAB 5EGHA 3AQPA 4A3LC 4KM8A 1VRQC 4P5BA 1WIHA 3S1MK 3S15K 2D6FC 3GSIA 1UV7A 4A93K 4A3BC 2GSNA 3HOXC 1C0AA 2NVXC 2FQTA 4G7HA 3GTGA 4A3CC 5CJ9A 1O24A 3S17K 1O29A 3GTLC 3T00A 3H3VL 5IYDK 3M3YC 3HOZC 1Y1WK 4C3HC 5C4XC 4AH6A 2NVQC 2JA5K 4P9SA 2YU9C 4G7ZA 2B63A 1O26A 4KN7A 4G0UA 1O25A 5C44C 3ERED 1J6VA 2NVYC 5IYCK 3RZDK 3HOVC 3TFJA 4BY7K 4BY1C 4GTLA 3GTJA 1Y1VK 2E2JK 4P5AA 2XCRB 3GTKA 1DCPA 5E68A 5IOTA 5M5WK 2JA7A 1EQRA 1YCLA 5M3MK 1TWFK 3CQZC 2E2HA 5IP9C 3AH5A 3HOUC 4A3LK 2GAGC 1IS1A 3M4OC 4A3IK 1XXAA 4QIWL 1IL2A 1WOSA 3H0GA 3S1NC 3Q3QA 3FHZA 3GTGC 4YFKA 1TWFA 4Q5SA 5TMCA 1USOA 3HOXK 2WB1D 5C3EC 4X6AC 4A3CK 4J3NA 1VJEA 2JA8C 1TWHC 1ZQ1C 3GTLK 3A8JA 1XZPA 2XCOA 3M3YK 2P8TA 3HOZK 2E2IK 4AYBL 3K7AK 1INNA 2VUMK 1BS2A 4BLBA 2NVXA 3LPXA 4QJVB 3RZOK 2JA6A 4KDDA 3ADAC 5C44K 5IYBC 4KC6A 3GTJC 2FQOA 2NVYK 4LJZA 1F7UA 1VGXA 3L4JA 2JA7C 2YU9A 2ZFZA 2E2HC 4BY1K 5FJ8K 1IBAA 4MEXA 2GAHC 4OIOA 1ZXOA 4YG2A 2WAQD 3CQZK 5IP9K 3S14C 5IP7C 3HOUK 5HL8A 5D4DA 3M4OK 3S1RC 1HI9A 1TWCC 4M1XA 2A6HA 4KARA 4A3EC 3GTOC 4Y52C 1BDFA 3WODA 5CHPA 1WQGA 4XLNA 4A3KC 4XSZA 3GTGK 4XSXA 1SFOA 3CQZA 2CW0A 3GTPA 4ILDA 3N0CA 5C3EK 2CFAA 3S16K 3GDZA 3S2DK 3MMLB 4BXXC 3N0BA 1PJ6A 5FLMC 2JA8K 1XXCA 4KMHA 2R92C 2B63K 1DD5A 4KMUA 4GFQA 3PO3C 2JA6C 4KASA 1O27A 4MQ9A 4C2MC 4A3GC 1GE9A 4GTAA 1JQWA 4Q4ZA 3S2HC 1TWAC 4Y7NC 3PO2C 1TWHA 3SZZA 5IYBK 1WOOA 3S1QC 4XLPA 4BLAA 3GTJK 4OIRA 3GTKK 1K83C 1XZQB 2V6TA 3HOYC 2JA7K 3QX3A 2A6EA 3BP8C 2E2HK 4KB2A 3G4CA 3FKIA 2PMZL 3H0GK 3BUEA 3AD7C 4OINA 5IP7K 2W7VA 2PA8D 3S1RK 1SFOC 3HOWC 3TFHA 4A3EK 3GTOK 4A3DC 3GTPC 2KWAA 4Y52K 3OPFA 2R93C 1I50A 2Y0SD 4A3KK 5L46A 1DCHA 2A68A 3N3YA
chains in the Genus database with same CATH topology
4MEYA 4QJVB 3RZOK 4OIPA 3I4NC 4A3MK 1TWFC 1I50K 4QIWD 5C44K 5IYBC 3GTMC 4BXXK 5M5XK 2O5IA 2E2IC 1TWGC 1ZYRA 4A3LC 3GTJC 5FLMK 2NVYK 4LJZA 3K7AC 4A3BK 2VUMC 5TMFA 2NVXK 2JA7C 3S14K 4BBRC 3PO3K 2JA6K 3RZOC 2E2HC 4BY1K 4A3MC 5FJ8K 3S1MK 3S15K 2PMZD 4YFXA 4MEXA 1TWCK 4C2MK 4GZYA 4A3FC 4OIOA 3HKZL 3S2HK 4YG2A 4C3HK 5C4XK 2NVQK 1I6HC 2PPBA 3I4MK 4A93K 2WAQD 4Y7NK 2NVTC 3PO2K 3HOXC 3CQZK 2NVXC 4A3BC 5IP9K 2YU9K 3S14C 2R7ZC 4G7HA 4A3JC 4BBSC 5IP7C 4A3CC 3HOUK 2PA8L 3S17K 5D4DA 1YNNA 3S1QK 4OIQA 3GTLC 3M4OK 3H3VL 4JK1A 4YFNA 3S1RC 3S15C 4A3EC 1TWCC 3GTOC 2A6HA 5C4JC 3FKIC 3M3YC 4Y52C 3EQLA 3HOYK 5IYDK 2BE5A 3HOZC 1Y1WK 1BDFA 3WODA 2Y0SL 5C4XC 2NVQC 4XLNA 1I6VA 4A3KC 4XSZA 2JA5K 3HOVK 4A93C 2R92K 3GTGK 2YU9C 4G7ZA 4XSXA 3GTQK 2CW0A 1WCMK 4KN7A 4QJVA 4ZH4A 1I50C 2A69A 5C3EK 5C44C 3S16K 3S2DK 4BXXC 4A3GK 1I3QK 5FLMC 1TWAK 2NVYC 1R9TK 2JA8K 5IYCK 3RZDK 2WB1L 2JA5C 3HOVC 1SFOK 2R92C 3HOWK 4A3DK 2B63K 3GTPK 4KMUA 3PO3C 2R93K 2JA6C 4BY7K 4KN4A 4BY1C 3HKZD 3S1MC 4AYBD 1K83K 1Y1VK 4MQ9A 5M3FK 2E2JK 3S1NK 3S16C 3S2DC 4G7OA 4A3GC 3S2HC 4Q4ZA 4LK1A 4NOIA 1HQMA 5M5WK 1TWAC 3I4MC 3RZDC 3I4NK 4Y7NC 3PO2C 5M3MK 1TWFK 3CQZC 5IP9C 4LLGA 2B63C 5IYBK 3GTMK 3HOUC 4A3LK 3S17C 4BY7C 1TWGK 3S1QC 4XLPA 3GTJK 4OIRA 3M4OC 4A3IK 4QIWL 3GTKK 1K83C 1Y1VC 3S1NC 5IYDC 3HOYC 2JA7K 4BBRK 1Y1WC 4X6AK 2A6EA 2E2HK 1TWHK 3GTGC 4YFKA 1SMYA 4Q5SA 3GTQC 4A3FK 5TMCA 5M5YK 2PMZL 1WCMC 3H0GK 1XPPA 1I6HK 4A3IC 3GTKC 4C3JK 2NVTK 3HOXK 2WB1D 5C3EC 4BBSK 1IW7A 2R7ZK 4A3JK 1I3QC 4OINA 3DXJA 5IP7K 4A3CK 4X6AC 1YNJA 2JA8C 2WAQL 1R9TC 1TWHC 2PA8D 5IYCC 4C3IK 3GTLK 3S1RK 1SFOC 3HOWC 3H3VD 4A3EK 3GTOK 4A3DC 5C4JK 3GTPC 3FKIK 3M3YK 4Y52K 2R93C 3HOZK 2E2IK 4AYBL 3H0GC 2O5JA 4LK0A 2Y0SD 3K7AK 4A3KK 2E2JC 2VUMK 2A68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MEY A;  4QJV B;  3RZO K;  4OIP A;  3I4N C;  4A3M K;  1TWF C;  1I50 K;  4QIW D;  5C44 K;  5IYB C;  3GTM C;  4BXX K;  5M5X K;  2O5I A;  2E2I C;  1TWG C;  1ZYR A;  4A3L C;  3GTJ C;  5FLM K;  2NVY K;  4LJZ A;  3K7A C;  4A3B K;  2VUM C;  5TMF A;  2NVX K;  2JA7 C;  3S14 K;  4BBR C;  3PO3 K;  2JA6 K;  3RZO C;  2E2H C;  4BY1 K;  4A3M C;  5FJ8 K;  3S1M K;  3S15 K;  2PMZ D;  4YFX A;  4MEX A;  1TWC K;  4C2M K;  4GZY A;  4A3F C;  4OIO A;  3HKZ L;  3S2H K;  4YG2 A;  4C3H K;  5C4X K;  2NVQ K;  1I6H C;  2PPB A;  3I4M K;  4A93 K;  2WAQ D;  4Y7N K;  2NVT C;  3PO2 K;  3HOX C;  3CQZ K;  2NVX C;  4A3B C;  5IP9 K;  2YU9 K;  3S14 C;  2R7Z C;  4G7H A;  4A3J C;  4BBS C;  5IP7 C;  4A3C C;  3HOU K;  2PA8 L;  3S17 K;  5D4D A;  1YNN A;  3S1Q K;  4OIQ A;  3GTL C;  3M4O K;  3H3V L;  4JK1 A;  4YFN A;  3S1R C;  3S15 C;  4A3E C;  1TWC C;  3GTO C;  2A6H A;  5C4J C;  3FKI C;  3M3Y C;  4Y52 C;  3EQL A;  3HOY K;  5IYD K;  2BE5 A;  3HOZ C;  1Y1W K;  1BDF A;  3WOD A;  2Y0S L;  5C4X C;  2NVQ C;  4XLN A;  1I6V A;  4A3K C;  4XSZ A;  2JA5 K;  3HOV K;  4A93 C;  2R92 K;  3GTG K;  2YU9 C;  4G7Z A;  4XSX A;  3GTQ K;  2CW0 A;  1WCM K;  4KN7 A;  4QJV A;  4ZH4 A;  1I50 C;  2A69 A;  5C3E K;  5C44 C;  3S16 K;  3S2D K;  4BXX C;  4A3G K;  1I3Q K;  5FLM C;  1TWA K;  2NVY C;  1R9T K;  2JA8 K;  5IYC K;  3RZD K;  2WB1 L;  2JA5 C;  3HOV C;  1SFO K;  2R92 C;  3HOW K;  4A3D K;  2B63 K;  3GTP K;  4KMU A;  3PO3 C;  2R93 K;  2JA6 C;  4BY7 K;  4KN4 A;  4BY1 C;  3HKZ D;  3S1M C;  4AYB D;  1K83 K;  1Y1V K;  4MQ9 A;  5M3F K;  2E2J K;  3S1N K;  3S16 C;  3S2D C;  4G7O A;  4A3G C;  3S2H C;  4Q4Z A;  4LK1 A;  4NOI A;  1HQM A;  5M5W K;  1TWA C;  3I4M C;  3RZD C;  3I4N K;  4Y7N C;  3PO2 C;  5M3M K;  1TWF K;  3CQZ C;  5IP9 C;  4LLG A;  2B63 C;  5IYB K;  3GTM K;  3HOU C;  4A3L K;  3S17 C;  4BY7 C;  1TWG K;  3S1Q C;  4XLP A;  3GTJ K;  4OIR A;  3M4O C;  4A3I K;  4QIW L;  3GTK K;  1K83 C;  1Y1V C;  3S1N C;  5IYD C;  3HOY C;  2JA7 K;  4BBR K;  1Y1W C;  4X6A K;  2A6E A;  2E2H K;  1TWH K;  3GTG C;  4YFK A;  1SMY A;  4Q5S A;  3GTQ C;  4A3F K;  5TMC A;  5M5Y K;  2PMZ L;  1WCM C;  3H0G K;  1XPP A;  1I6H K;  4A3I C;  3GTK C;  4C3J K;  2NVT K;  3HOX K;  2WB1 D;  5C3E C;  4BBS K;  1IW7 A;  2R7Z K;  4A3J K;  1I3Q C;  4OIN A;  3DXJ A;  5IP7 K;  4A3C K;  4X6A C;  1YNJ A;  2JA8 C;  2WAQ L;  1R9T C;  1TWH C;  2PA8 D;  5IYC C;  4C3I K;  3GTL K;  3S1R K;  1SFO C;  3HOW C;  3H3V D;  4A3E K;  3GTO K;  4A3D C;  5C4J K;  3GTP C;  3FKI K;  3M3Y K;  4Y52 K;  2R93 C;  3HOZ K;  2E2I K;  4AYB L;  3H0G C;  2O5J A;  4LK0 A;  2Y0S D;  3K7A K;  4A3K K;  2E2J C;  2VUM K;  2A68 A; 
#chains in the Genus database with same CATH topology
 4MEY A;  3HXA A;  2EBB A;  4QIW D;  4BXX K;  2O5I A;  1B4A A;  1TWC A;  3GTO A;  5FLM K;  4DDQ A;  3IPJ A;  4A3B K;  4LOW A;  2NVX K;  3V4G A;  1EK8 A;  3PO3 K;  2JA6 K;  1V5V A;  5IOR A;  2P5M A;  4A3M C;  4O2D A;  1XXB A;  4YFX A;  4C2M K;  4A3F C;  3HKZ L;  3S2H K;  4C3H K;  5C4X K;  2NVQ K;  4Y7N K;  4C3J C;  3PO2 K;  2YU9 K;  4BBS C;  4A3J C;  2R92 A;  1ZVU A;  4GTB A;  3S1Q K;  1YNN A;  4GTD A;  4OIQ A;  3GTQ A;  3S15 C;  4YFN A;  1F93 A;  5IOS A;  1WCM A;  3FKI C;  3LAP A;  3EQL A;  3HOY K;  3OEP A;  1I3Q A;  3HOV K;  4A93 C;  1TWA A;  1R9T A;  1WQH A;  1PJ5 A;  4QJV A;  1I50 C;  2A69 A;  3VA7 A;  2GSO A;  2GSU A;  4WJ3 M;  1K83 A;  3T01 A;  2JA5 C;  1SFO K;  3HOW K;  4A3D K;  3GTP K;  1WSV A;  2R93 K;  1VH2 A;  4KN4 A;  3GTM A;  1BGW A;  1TWG A;  3GEH A;  3S1N K;  4KMD A;  4G7O A;  3T02 A;  4GTE A;  1O28 A;  1HQM A;  3SZY A;  3I4M C;  3RZD C;  1L0W A;  1VLO A;  1O2B A;  4BY7 C;  1B4B A;  2R93 A;  1Y1V C;  4XCH A;  4X6A K;  5JFE A;  2R7Z A;  1TWH K;  3GTQ C;  3GEE A;  4A3F K;  4WIL A;  3G4A A;  1WCM C;  4A3I C;  1EH1 A;  4C3J K;  4BBS K;  1IW7 A;  4A3J K;  1I3Q C;  3DXJ A;  1YNJ A;  1R9T C;  3H3V D;  3FKI K;  4KAW X;  1WSR A;  4GTC A;  4LK0 A;  1G51 A;  1IE0 A;  1X31 C;  3ORE A;  2V6S A;  4LR2 A;  3I4N C;  1I50 K;  4KM9 A;  3GTM C;  5M5X K;  2E2I C;  1TWG C;  1ZYR A;  3FOE A;  1BJT A;  2RH6 A;  5EGE A;  3K7A C;  2VUM C;  4FZB A;  5TMF A;  1IQ0 A;  3A8K A;  3S14 K;  1XZQ A;  4BBR C;  3L4K A;  3RZO C;  2PMZ D;  1TWC K;  2RGR A;  2Y3P A;  1YX2 A;  4LQY A;  4GZY A;  4PAA A;  4G0W A;  1I6H C;  2PPB A;  3I4M K;  1J6X A;  1Y1W A;  1RU0 A;  2NVT C;  2R7Z C;  2JA5 A;  1USM A;  1KQ4 A;  3BP3 A;  1JOE A;  2PA8 L;  4C3I C;  4JK1 A;  5C4J C;  2BE5 A;  3GEI A;  2Y0S L;  1DCO A;  1I6V A;  2R92 K;  4GT9 A;  4BKW A;  3GTQ K;  1WQF A;  2V6U A;  1WCM K;  4ZH4 A;  1PJ7 A;  4KAT A;  4KMA A;  1O2A A;  4A3G K;  1WOR A;  5TJ3 A;  1I3Q K;  1Y1V A;  1TWA K;  1R9T K;  1XZP B;  2WB1 L;  2JH3 A;  4FM9 A;  3S0X A;  1J98 A;  1O2F B;  3HKZ D;  2ZUE A;  4AYB D;  1WOP A;  5IOQ A;  3S1M C;  3FOF A;  1K83 K;  5M3F K;  3TFI A;  1ZBS A;  3S16 C;  3S2D C;  4GTF A;  4G0V A;  4LK1 A;  4NOI A;  1F7V A;  3I4N K;  1EI6 A;  4WJ4 A;  4LLG A;  2B63 C;  3NUH A;  3GTM K;  3S17 C;  3CAG A;  1TWG K;  1J6W A;  3TTG A;  3A8I A;  5IYD C;  4C45 A;  4BBR K;  2XCQ A;  1Y1W C;  5JVO A;  3GTL A;  1SMY A;  3JST A;  1ISE A;  3AQO A;  5M5Y K;  1XPP A;  1I6H K;  2E2I A;  3GTK C;  1AB4 A;  2NVT K;  3LAJ A;  4PAB A;  2R7Z K;  2VUM A;  3GIR A;  2PHC B;  2WAQ L;  5IYC C;  4C3I K;  1JVI A;  3AD8 C;  1EFW A;  5C4J K;  1F9N A;  4RMF A;  4KB4 A;  3H0G C;  2O5J A;  2E2J C;  2NVY A;  2ZUF A;  3AD9 C;  4OIP A;  4A3M K;  1TWF C;  2CFA B;  5EGH A;  3AQP A;  4A3L C;  4KM8 A;  1VRQ C;  4P5B A;  1WIH A;  3S1M K;  3S15 K;  2D6F C;  3GSI A;  1UV7 A;  4A93 K;  4A3B C;  2GSN A;  3HOX C;  1C0A A;  2NVX C;  2FQT A;  4G7H A;  3GTG A;  4A3C C;  5CJ9 A;  1O24 A;  3S17 K;  1O29 A;  3GTL C;  3T00 A;  3H3V L;  5IYD K;  3M3Y C;  3HOZ C;  1Y1W K;  4C3H C;  5C4X C;  4AH6 A;  2NVQ C;  2JA5 K;  4P9S A;  2YU9 C;  4G7Z A;  2B63 A;  1O26 A;  4KN7 A;  4G0U A;  1O25 A;  5C44 C;  3ERE D;  1J6V A;  2NVY C;  5IYC K;  3RZD K;  3HOV C;  3TFJ A;  4BY7 K;  4BY1 C;  4GTL A;  3GTJ A;  1Y1V K;  2E2J K;  4P5A A;  2XCR B;  3GTK A;  1DCP A;  5E68 A;  5IOT A;  5M5W K;  2JA7 A;  1EQR A;  1YCL A;  5M3M K;  1TWF K;  3CQZ C;  2E2H A;  5IP9 C;  3AH5 A;  3HOU C;  4A3L K;  2GAG C;  1IS1 A;  3M4O C;  4A3I K;  1XXA A;  4QIW L;  1IL2 A;  1WOS A;  3H0G A;  3S1N C;  3Q3Q A;  3FHZ A;  3GTG C;  4YFK A;  1TWF A;  4Q5S A;  5TMC A;  1USO A;  3HOX K;  2WB1 D;  5C3E C;  4X6A C;  4A3C K;  4J3N A;  1VJE A;  2JA8 C;  1TWH C;  1ZQ1 C;  3GTL K;  3A8J A;  1XZP A;  2XCO A;  3M3Y K;  2P8T A;  3HOZ K;  2E2I K;  4AYB L;  3K7A K;  1INN A;  2VUM K;  1BS2 A;  4BLB A;  2NVX A;  3LPX A;  4QJV B;  3RZO K;  2JA6 A;  4KDD A;  3ADA C;  5C44 K;  5IYB C;  4KC6 A;  3GTJ C;  2FQO A;  2NVY K;  4LJZ A;  1F7U A;  1VGX A;  3L4J A;  2JA7 C;  2YU9 A;  2ZFZ A;  2E2H C;  4BY1 K;  5FJ8 K;  1IBA A;  4MEX A;  2GAH C;  4OIO A;  1ZXO A;  4YG2 A;  2WAQ D;  3CQZ K;  5IP9 K;  3S14 C;  5IP7 C;  3HOU K;  5HL8 A;  5D4D A;  3M4O K;  3S1R C;  1HI9 A;  1TWC C;  4M1X A;  2A6H A;  4KAR A;  4A3E C;  3GTO C;  4Y52 C;  1BDF A;  3WOD A;  5CHP A;  1WQG A;  4XLN A;  4A3K C;  4XSZ A;  3GTG K;  4XSX A;  1SFO A;  3CQZ A;  2CW0 A;  3GTP A;  4ILD A;  3N0C A;  5C3E K;  2CFA A;  3S16 K;  3GDZ A;  3S2D K;  3MML B;  4BXX C;  3N0B A;  1PJ6 A;  5FLM C;  2JA8 K;  1XXC A;  4KMH A;  2R92 C;  2B63 K;  1DD5 A;  4KMU A;  4GFQ A;  3PO3 C;  2JA6 C;  4KAS A;  1O27 A;  4MQ9 A;  4C2M C;  4A3G C;  1GE9 A;  4GTA A;  1JQW A;  4Q4Z A;  3S2H C;  1TWA C;  4Y7N C;  3PO2 C;  1TWH A;  3SZZ A;  5IYB K;  1WOO A;  3S1Q C;  4XLP A;  4BLA A;  3GTJ K;  4OIR A;  3GTK K;  1K83 C;  1XZQ B;  2V6T A;  3HOY C;  2JA7 K;  3QX3 A;  2A6E A;  3BP8 C;  2E2H K;  4KB2 A;  3G4C A;  3FKI A;  2PMZ L;  3H0G K;  3BUE A;  3AD7 C;  4OIN A;  5IP7 K;  2W7V A;  2PA8 D;  3S1R K;  1SFO C;  3HOW C;  3TFH A;  4A3E K;  3GTO K;  4A3D C;  3GTP C;  2KWA A;  4Y52 K;  3OPF A;  2R93 C;  1I50 A;  2Y0S D;  4A3K K;  5L46 A;  1DCH A;  2A68 A;  3N3Y A; 
#chains in the Genus database with same CATH homology
 4MEY A;  4QJV B;  3RZO K;  4OIP A;  3I4N C;  4A3M K;  1TWF C;  1I50 K;  4QIW D;  5C44 K;  5IYB C;  3GTM C;  4BXX K;  5M5X K;  2O5I A;  2E2I C;  1TWG C;  1ZYR A;  4A3L C;  3GTJ C;  5FLM K;  2NVY K;  4LJZ A;  3K7A C;  4A3B K;  2VUM C;  5TMF A;  2NVX K;  2JA7 C;  3S14 K;  4BBR C;  3PO3 K;  2JA6 K;  3RZO C;  2E2H C;  4BY1 K;  4A3M C;  5FJ8 K;  3S1M K;  3S15 K;  2PMZ D;  4YFX A;  4MEX A;  1TWC K;  4C2M K;  4GZY A;  4A3F C;  4OIO A;  3HKZ L;  3S2H K;  4YG2 A;  4C3H K;  5C4X K;  2NVQ K;  1I6H C;  2PPB A;  3I4M K;  4A93 K;  2WAQ D;  4Y7N K;  2NVT C;  3PO2 K;  3HOX C;  3CQZ K;  2NVX C;  4A3B C;  5IP9 K;  2YU9 K;  3S14 C;  2R7Z C;  4G7H A;  4A3J C;  4BBS C;  5IP7 C;  4A3C C;  3HOU K;  2PA8 L;  3S17 K;  5D4D A;  1YNN A;  3S1Q K;  4OIQ A;  3GTL C;  3M4O K;  3H3V L;  4JK1 A;  4YFN A;  3S1R C;  3S15 C;  4A3E C;  1TWC C;  3GTO C;  2A6H A;  5C4J C;  3FKI C;  3M3Y C;  4Y52 C;  3EQL A;  3HOY K;  5IYD K;  2BE5 A;  3HOZ C;  1Y1W K;  1BDF A;  3WOD A;  2Y0S L;  5C4X C;  2NVQ C;  4XLN A;  1I6V A;  4A3K C;  4XSZ A;  2JA5 K;  3HOV K;  4A93 C;  2R92 K;  3GTG K;  2YU9 C;  4G7Z A;  4XSX A;  3GTQ K;  2CW0 A;  1WCM K;  4KN7 A;  4QJV A;  4ZH4 A;  1I50 C;  2A69 A;  5C3E K;  5C44 C;  3S16 K;  3S2D K;  4BXX C;  4A3G K;  1I3Q K;  5FLM C;  1TWA K;  2NVY C;  1R9T K;  2JA8 K;  5IYC K;  3RZD K;  2WB1 L;  2JA5 C;  3HOV C;  1SFO K;  2R92 C;  3HOW K;  4A3D K;  2B63 K;  3GTP K;  4KMU A;  3PO3 C;  2R93 K;  2JA6 C;  4BY7 K;  4KN4 A;  4BY1 C;  3HKZ D;  3S1M C;  4AYB D;  1K83 K;  1Y1V K;  4MQ9 A;  5M3F K;  2E2J K;  3S1N K;  3S16 C;  3S2D C;  4G7O A;  4A3G C;  3S2H C;  4Q4Z A;  4LK1 A;  4NOI A;  1HQM A;  5M5W K;  1TWA C;  3I4M C;  3RZD C;  3I4N K;  4Y7N C;  3PO2 C;  5M3M K;  1TWF K;  3CQZ C;  5IP9 C;  4LLG A;  2B63 C;  5IYB K;  3GTM K;  3HOU C;  4A3L K;  3S17 C;  4BY7 C;  1TWG K;  3S1Q C;  4XLP A;  3GTJ K;  4OIR A;  3M4O C;  4A3I K;  4QIW L;  3GTK K;  1K83 C;  1Y1V C;  3S1N C;  5IYD C;  3HOY C;  2JA7 K;  4BBR K;  1Y1W C;  4X6A K;  2A6E A;  2E2H K;  1TWH K;  3GTG C;  4YFK A;  1SMY A;  4Q5S A;  3GTQ C;  4A3F K;  5TMC A;  5M5Y K;  2PMZ L;  1WCM C;  3H0G K;  1XPP A;  1I6H K;  4A3I C;  3GTK C;  4C3J K;  2NVT K;  3HOX K;  2WB1 D;  5C3E C;  4BBS K;  1IW7 A;  2R7Z K;  4A3J K;  1I3Q C;  4OIN A;  3DXJ A;  5IP7 K;  4A3C K;  4X6A C;  1YNJ A;  2JA8 C;  2WAQ L;  1R9T C;  1TWH C;  2PA8 D;  5IYC C;  4C3I K;  3GTL K;  3S1R K;  1SFO C;  3HOW C;  3H3V D;  4A3E K;  3GTO K;  4A3D C;  5C4J K;  3GTP C;  3FKI K;  3M3Y K;  4Y52 K;  2R93 C;  3HOZ K;  2E2I K;  4AYB L;  3H0G C;  2O5J A;  4LK0 A;  2Y0S D;  3K7A K;  4A3K K;  2E2J C;  2VUM K;  2A68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...