4A3MK

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid and soaked with ampcpp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3mK00
5FLMK 2PA8L 4A3BC 4A3LC 4JK1A 3EQLA 2WAQD 5C44K 2WAQL 3HOUK 3CQZK 4LK0A 4A3MC 4LJZA 1IW7A 4C2MK 4C3IK 3RZDK 2B63C 4A93K 2E2IK 5C3EK 2CW0A 4A3FC 3GTLK 4BY7C 4X6AC 2NVQC 3GTOK 1I50C 3I4NC 2Y0SD 5M5XK 3S1NC 3S1RC 3S2DK 3WODA 3S14K 4BBRK 3S1QC 1K83K 1XPPA 4OIPA 3H0GC 4KN7A 4YG2A 2YU9K 3S17K 4A3DK 4A3EC 1TWCK 1Y1VK 1HQMA 2PPBA 1TWHK 3GTGC 2A6EA 3PO2K 3S1MC 4QIWL 1ZYRA 4QIWD 2R7ZC 1TWFK 3GTQC 5IYCC 4BY1C 2VUMK 4OINA 5IYBK 4BXXK 2E2JC 3HOYC 3I4MC 2WB1D 2PA8D 2WB1L 5IYBC 3PO3C 4BXXC 4BY1K 5IP9C 2VUMC 5C4JC 4OIRA 4MQ9A 3GTPC 3GTQK 4Q4ZA 3FKIC 3I4NK 1TWHC 2O5IA 3GTGK 3GTJC 4A3KC 3HOVC 2JA7C 2NVYK 4LLGA 4MEYA 4OIOA 4Q5SA 2R93K 4A3JK 3K7AC 1K83C 2E2HC 3GTKC 4BBSK 1I6HC 2BE5A 4QJVB 3S1RK 3K7AK 4XSXA 1TWGK 3HOWC 4A3GC 2NVYC 4AYBD 4A3FK 4AYBL 3GTLC 3HOVK 2JA5C 2PMZL 4A3IC 1I6HK 4BBSC 2E2HK 3CQZC 3GTKK 3PO3K 5IYDK 3HOUC 3HOYK 2JA7K 3GTJK 4A3KK 4YFNA 2JA8K 3FKIK 4KN4A 4ZH4A 1WCMC 3GTPK 3H3VD 5C4JK 5FJ8K 5IP9K 1WCMK 3M3YC 2JA8C 4NOIA 4C3JK 4A3EK 3S17C 3S2HK 5IYDC 2A69A 4G7ZA 2R92K 3DXJA 5IYCK 1TWFC 4BBRC 4A3IK 3S1QK 2JA5K 1I50K 1Y1VC 2NVQK 3GTOC 4A3DC 4BY7K 2R93C 4X6AK 1TWGC 3HOWK 4A3GK 4YFKA 2O5JA 3HKZL 2NVTC 3RZDC 3S14C 5M3FK 1BDFA 4A3JC 3S1NK 5C3EC 2B63K 2R7ZK 4A93C 1I3QC 5FLMC 4OIQA 4Y52C 3I4MK 5M5YK 2NVXK 2E2JK 4YFXA 1R9TK 3HOZK 3GTMK 4A3BK 3S16C 2A68A 3PO2C 1TWCC 4KMUA 3S1MK 3M4OC 3H0GK 2YU9C 4Y7NC 3S15K 1SFOK 3S16K 2JA6C 3RZOK 4XLPA 4QJVA 3GTMC 1I6VA 3S2DC 3HOZC 1TWAC 1R9TC 3HKZD 4G7OA 2A6HA 4XLNA 5IP7C 2E2IC 5TMCA 5C4XK 1I3QK 4A3CK 5C4XC 5IP7K 2Y0SL 4C3HK 5C44C 4XSZA 4A3LK 2PMZD 5M3MK 5D4DA 4A3CC 1SFOC 2NVTK 5M5WK 4Y7NK 3HOXC 4A3MK 3S15C 3M4OK 4GZYA 1Y1WC 1TWAK 3H3VL 1YNJA 2JA6K 3RZOC 1YNNA 1Y1WK 4LK1A 4G7HA 5TMFA 2R92C 3S2HC 2NVXC 1SMYA 4MEXA 4Y52K 3HOXK 3M3YK
chains in the Genus database with same CATH superfamily
5FLMK 1O2AA 1PJ5A 1ZVUA 2WAQD 2WAQL 4LK0A 1WSVA 1IW7A 4C2MK 4C3IK 1Y1VA 5C3EK 4X6AC 3LAPA 2V6TA 2ZUEA 3WODA 1WOPA 4OIPA 1J6XA 4A3EC 2PPBA 1Y1VK 2YU9A 3GTGC 4GZYA 4QIWL 1ZYRA 4QIWD 3GTQC 1WORA 1RU0A 4BXXK 2WB1D 4WJ3M 3GTQA 5C4JC 4MQ9A 3I4NK 3N3YA 3HOVC 3VA7A 1K83C 1I6HC 1TWAA 4AYBL 1JQWA 2XCQA 4C3IC 1I6HK 3GTKK 3BP3A 5IYDK 3GTJK 4ZH4A 1EFWA 1O29A 4BLBA 3M3YC 4C45A 4NOIA 4A3EK 3L4JA 3S2HK 2A69A 1O27A 2R92K 3SZYA 3DXJA 2XCRB 3GDZA 1DD5A 2JA5K 1Y1VC 4A3DC 4A3GK 1IE0A 3HKZL 2Y3PA 3A8KA 4RMFA 3IPJA 1G51A 2D6FC 4YFXA 1ZQ1C 2V6UA 2ZUFA 3ERED 2FQTA 3N0BA 2JA7A 3M4OC 4Y7NC 4GTCA 1K83A 3S16K 2XCOA 1R9TC 3GTLA 1IL2A 1SFOA 3FKIA 1L0WA 5HL8A 1WOOA 4A3CC 1SFOC 1B4BA 4A3MK 1J6WA 2JA5A 5L46A 3H3VL 2JA6K 1YNNA 1Y1WK 4KMHA 4MEXA 3HOXK 1VH2A 4JK1A 3EQLA 5C44K 4C3HC 1EQRA 3CQZK 3GSIA 4LJZA 3RZDK 4A93K 1XXAA 3GTOA 1TWGA 3S1NC 1I50C 3BP8C 2Y0SD 5M5XK 3S1RC 1O28A 4LQYA 2YU9K 3S17K 4A3DK 2R93K 4C3JC 3PO2K 3I4NC 2JA6A 1TWFK 5IYCC 3GTPA 4OINA 1R9TA 2PA8D 2WB1L 4FZBA 4FM9A 3PO3C 2VUMC 4OIRA 3GTPC 2R7ZK 3OREA 3FKIC 1TWHC 4P9SA 4MEYA 3TTGA 4Q5SA 1O2FB 4A3JK 4KATA 3GTKC 3GTMA 2BE5A 5JFEA 4XSXA 1TWGK 2RGRA 2PMZL 2E2HK 3CQZC 1YX2A 4LOWA 4WILA 1F7UA 2JA7K 4A3KK 4YFNA 1WSRA 5C4JK 5IP9K 3CQZA 1WQGA 1B4AA 3S17C 4KAWX 1Y1WA 5IYCK 3S1QK 1TWFC 3FOFA 4A3IK 1BGWA 2R93C 2NVQK 3GTOC 4BY7K 3HOWK 4YFKA 2PHCB 1TWFA 3S14C 1J98A 2FQOA 1BS2A 3I4MK 1O2BA 2E2JK 3AD9C 4GTEA 4A3BK 2GAHC 4KMDA 3S16C 2RH6A 3SZZA 4GTLA 2YU9C 3GTGA 3RZOK 4QJVA 2JH3A 3HOZC 4G7OA 2E2IC 1DCHA 1O25A 1I3QK 4A3CK 5IP7K 1YCLA 3LPXA 5IORA 4A3LK 1KQ4A 5M3MK 5D4DA 3L4KA 1HI9A 5M5WK 4Y7NK 3HOXC 4KM9A 1IS1A 3M4OK 1O24A 1VRQC 1Y1WC 1XZPA 4LK1A 3S2HC 4Y52K 4AH6A 3M3YK 3GIRA 3HXAA 4A3BC 5TJ3A 5JVOA 1WQFA 1I3QA 5CJ9A 2B63C 1PJ6A 4A3FC 3GTLK 2NVQC 3GTOK 3T02A 1VJEA 1WQHA 4KMAA 3FOEA 1XZPB 3S1QC 1XPPA 2B63A 3H0GC 4KN7A 4YG2A 2P8TA 1TWCK 3S1MC 1HQMA 2R7ZC 2VUMK 2E2JC 3HOYC 2E2IA 5IYBC 2E2HA 4BY1K 2R7ZA 1EK8A 3GEIA 3G4AA 3GTGK 2O5IA 3GTJC 2JA7C 4OIOA 4LLGA 4WJ4A 2E2HC 3AQPA 4QJVB 3S1RK 3K7AK 3GTJA 1USMA 4A3GC 4A3FK 3GTLC 5CHPA 3GEHA 4A3IC 3A8IA 2EBBA 4BBSC 3PO3K 3HOUC 1JOEA 1INNA 1WIHA 3FKIK 4KN4A 3MMLB 5FJ8K 2JA8C 4C3JK 4GTBA 1PJ7A 3T01A 4BBRC 3FHZA 3OEPA 1BJTA 4P5AA 4X6AK 2O5JA 4KC6A 2W7VA 3RZDC 1VGXA 5IOQA 5M3FK 1BDFA 4A3JC 3S1NK 1EI6A 1J6VA 5C3EC 4A93C 1XXCA 3T00A 1XXBA 4Y52C 5M5YK 4BLAA 1I50A 1R9TK 3HOZK 1DCOA 2GSNA 2A68A 3TFIA 3PO2C 1VLOA 1TWCC 4KMUA 3S1MK 4LR2A 4GTDA 3H0GK 1AB4A 3S15K 1SFOK 2JA6C 4XLPA 1I6VA 3S2DC 1TWAC 3HKZD 2A6HA 4XLNA 5IP7C 4J3NA 5TMCA 5C4XK 1ZXOA 2ZFZA 5C4XC 4C3HK 3A8JA 4XSZA 2CFAB 4GFQA 1XZQB 4GTAA 2KWAA 2NVYA 4BKWA 1ZBSA 1F93A 1YNJA 3GEEA 2R92C 5TMFA 4PABA 1SMYA 4KARA 5EGEA 1C0AA 2PA8L 2R92A 4A3LC 2CFAA 3HOUK 3TFHA 4GTFA 4KB2A 3CAGA 2E2IK 1USOA 2CW0A 2R93A 4BY7C 3NUHA 3OPFA 1IBAA 5E68A 3S2DK 3S14K 4BBRK 1K83K 1TWCA 4G0WA 1TWHK 2A6EA 2VUMA 3QX3A 3ADAC 4BY1C 1ISEA 5IYBK 3I4MC 1UV7A 4BXXC 1IQ0A 3GTKA 5IP9C 3GTQK 4Q4ZA 1JVIA 4A3KC 2NVYK 4DDQA 3AQOA 3K7AC 3BUEA 4BBSK 2GSUA 4XCHA 1XZQA 1F9NA 1DCPA 1GE9A 3S0XA 3HOWC 2NVYC 4AYBD 3HOVK 2JA5C 1WCMA 3HOYK 1WOSA 2JA8K 1WCMC 3H3VD 3GTPK 1WCMK 4KDDA 5IYDC 4G7ZA 3LAJA 1V5VA 1I50K 4KM8A 1TWGC 2NVTC 3AD8C 4O2DA 2B63K 1O26A 1I3QC 1X31C 5FLMC 4OIQA 2V6SA 4M1XA 2NVXK 4ILDA 4KB4A 3GTMK 1TWHA 3H0GA 3AH5A 4GT9A 2P5MA 3GTMC 4C2MC 5IOTA 4G0UA 2GAGC 2GSOA 5EGHA 2Y0SL 5C44C 3TFJA 2PMZD 5IOSA 3N0CA 4G0VA 2NVTK 3S15C 3V4GA 2NVXA 3JSTA 3G4CA 1TWAK 3RZOC 3AD7C 4G7HA 1F7VA 3Q3QA 1EH1A 4P5BA 2NVXC 4A3MC 4PAAA 4KASA
chains in the Genus database with same CATH topology
5FLMK 2PA8L 4A3BC 4A3LC 4JK1A 3EQLA 2WAQD 5C44K 2WAQL 3HOUK 3CQZK 4LK0A 4A3MC 4LJZA 1IW7A 4C2MK 4C3IK 3RZDK 2B63C 4A93K 2E2IK 5C3EK 2CW0A 4A3FC 3GTLK 4BY7C 4X6AC 2NVQC 3GTOK 1I50C 3I4NC 2Y0SD 5M5XK 3S1NC 3S1RC 3S2DK 3WODA 3S14K 4BBRK 3S1QC 1K83K 1XPPA 4OIPA 3H0GC 4KN7A 4YG2A 2YU9K 3S17K 4A3DK 4A3EC 1TWCK 1Y1VK 1HQMA 2PPBA 1TWHK 3GTGC 2A6EA 3PO2K 3S1MC 4QIWL 1ZYRA 4QIWD 2R7ZC 1TWFK 3GTQC 5IYCC 4BY1C 2VUMK 4OINA 5IYBK 4BXXK 2E2JC 3HOYC 3I4MC 2WB1D 2PA8D 2WB1L 5IYBC 3PO3C 4BXXC 4BY1K 5IP9C 2VUMC 5C4JC 4OIRA 4MQ9A 3GTPC 3GTQK 4Q4ZA 3FKIC 3I4NK 1TWHC 2O5IA 3GTGK 3GTJC 4A3KC 3HOVC 2JA7C 2NVYK 4LLGA 4MEYA 4OIOA 4Q5SA 2R93K 4A3JK 3K7AC 1K83C 2E2HC 3GTKC 4BBSK 1I6HC 2BE5A 4QJVB 3S1RK 3K7AK 4XSXA 1TWGK 3HOWC 4A3GC 2NVYC 4AYBD 4A3FK 4AYBL 3GTLC 3HOVK 2JA5C 2PMZL 4A3IC 1I6HK 4BBSC 2E2HK 3CQZC 3GTKK 3PO3K 5IYDK 3HOUC 3HOYK 2JA7K 3GTJK 4A3KK 4YFNA 2JA8K 3FKIK 4KN4A 4ZH4A 1WCMC 3GTPK 3H3VD 5C4JK 5FJ8K 5IP9K 1WCMK 3M3YC 2JA8C 4NOIA 4C3JK 4A3EK 3S17C 3S2HK 5IYDC 2A69A 4G7ZA 2R92K 3DXJA 5IYCK 1TWFC 4BBRC 4A3IK 3S1QK 2JA5K 1I50K 1Y1VC 2NVQK 3GTOC 4A3DC 4BY7K 2R93C 4X6AK 1TWGC 3HOWK 4A3GK 4YFKA 2O5JA 3HKZL 2NVTC 3RZDC 3S14C 5M3FK 1BDFA 4A3JC 3S1NK 5C3EC 2B63K 2R7ZK 4A93C 1I3QC 5FLMC 4OIQA 4Y52C 3I4MK 5M5YK 2NVXK 2E2JK 4YFXA 1R9TK 3HOZK 3GTMK 4A3BK 3S16C 2A68A 3PO2C 1TWCC 4KMUA 3S1MK 3M4OC 3H0GK 2YU9C 4Y7NC 3S15K 1SFOK 3S16K 2JA6C 3RZOK 4XLPA 4QJVA 3GTMC 1I6VA 3S2DC 3HOZC 1TWAC 1R9TC 3HKZD 4G7OA 2A6HA 4XLNA 5IP7C 2E2IC 5TMCA 5C4XK 1I3QK 4A3CK 5C4XC 5IP7K 2Y0SL 4C3HK 5C44C 4XSZA 4A3LK 2PMZD 5M3MK 5D4DA 4A3CC 1SFOC 2NVTK 5M5WK 4Y7NK 3HOXC 4A3MK 3S15C 3M4OK 4GZYA 1Y1WC 1TWAK 3H3VL 1YNJA 2JA6K 3RZOC 1YNNA 1Y1WK 4LK1A 4G7HA 5TMFA 2R92C 3S2HC 2NVXC 1SMYA 4MEXA 4Y52K 3HOXK 3M3YK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLM K;  2PA8 L;  4A3B C;  4A3L C;  4JK1 A;  3EQL A;  2WAQ D;  5C44 K;  2WAQ L;  3HOU K;  3CQZ K;  4LK0 A;  4A3M C;  4LJZ A;  1IW7 A;  4C2M K;  4C3I K;  3RZD K;  2B63 C;  4A93 K;  2E2I K;  5C3E K;  2CW0 A;  4A3F C;  3GTL K;  4BY7 C;  4X6A C;  2NVQ C;  3GTO K;  1I50 C;  3I4N C;  2Y0S D;  5M5X K;  3S1N C;  3S1R C;  3S2D K;  3WOD A;  3S14 K;  4BBR K;  3S1Q C;  1K83 K;  1XPP A;  4OIP A;  3H0G C;  4KN7 A;  4YG2 A;  2YU9 K;  3S17 K;  4A3D K;  4A3E C;  1TWC K;  1Y1V K;  1HQM A;  2PPB A;  1TWH K;  3GTG C;  2A6E A;  3PO2 K;  3S1M C;  4QIW L;  1ZYR A;  4QIW D;  2R7Z C;  1TWF K;  3GTQ C;  5IYC C;  4BY1 C;  2VUM K;  4OIN A;  5IYB K;  4BXX K;  2E2J C;  3HOY C;  3I4M C;  2WB1 D;  2PA8 D;  2WB1 L;  5IYB C;  3PO3 C;  4BXX C;  4BY1 K;  5IP9 C;  2VUM C;  5C4J C;  4OIR A;  4MQ9 A;  3GTP C;  3GTQ K;  4Q4Z A;  3FKI C;  3I4N K;  1TWH C;  2O5I A;  3GTG K;  3GTJ C;  4A3K C;  3HOV C;  2JA7 C;  2NVY K;  4LLG A;  4MEY A;  4OIO A;  4Q5S A;  2R93 K;  4A3J K;  3K7A C;  1K83 C;  2E2H C;  3GTK C;  4BBS K;  1I6H C;  2BE5 A;  4QJV B;  3S1R K;  3K7A K;  4XSX A;  1TWG K;  3HOW C;  4A3G C;  2NVY C;  4AYB D;  4A3F K;  4AYB L;  3GTL C;  3HOV K;  2JA5 C;  2PMZ L;  4A3I C;  1I6H K;  4BBS C;  2E2H K;  3CQZ C;  3GTK K;  3PO3 K;  5IYD K;  3HOU C;  3HOY K;  2JA7 K;  3GTJ K;  4A3K K;  4YFN A;  2JA8 K;  3FKI K;  4KN4 A;  4ZH4 A;  1WCM C;  3GTP K;  3H3V D;  5C4J K;  5FJ8 K;  5IP9 K;  1WCM K;  3M3Y C;  2JA8 C;  4NOI A;  4C3J K;  4A3E K;  3S17 C;  3S2H K;  5IYD C;  2A69 A;  4G7Z A;  2R92 K;  3DXJ A;  5IYC K;  1TWF C;  4BBR C;  4A3I K;  3S1Q K;  2JA5 K;  1I50 K;  1Y1V C;  2NVQ K;  3GTO C;  4A3D C;  4BY7 K;  2R93 C;  4X6A K;  1TWG C;  3HOW K;  4A3G K;  4YFK A;  2O5J A;  3HKZ L;  2NVT C;  3RZD C;  3S14 C;  5M3F K;  1BDF A;  4A3J C;  3S1N K;  5C3E C;  2B63 K;  2R7Z K;  4A93 C;  1I3Q C;  5FLM C;  4OIQ A;  4Y52 C;  3I4M K;  5M5Y K;  2NVX K;  2E2J K;  4YFX A;  1R9T K;  3HOZ K;  3GTM K;  4A3B K;  3S16 C;  2A68 A;  3PO2 C;  1TWC C;  4KMU A;  3S1M K;  3M4O C;  3H0G K;  2YU9 C;  4Y7N C;  3S15 K;  1SFO K;  3S16 K;  2JA6 C;  3RZO K;  4XLP A;  4QJV A;  3GTM C;  1I6V A;  3S2D C;  3HOZ C;  1TWA C;  1R9T C;  3HKZ D;  4G7O A;  2A6H A;  4XLN A;  5IP7 C;  2E2I C;  5TMC A;  5C4X K;  1I3Q K;  4A3C K;  5C4X C;  5IP7 K;  2Y0S L;  4C3H K;  5C44 C;  4XSZ A;  4A3L K;  2PMZ D;  5M3M K;  5D4D A;  4A3C C;  1SFO C;  2NVT K;  5M5W K;  4Y7N K;  3HOX C;  4A3M K;  3S15 C;  3M4O K;  4GZY A;  1Y1W C;  1TWA K;  3H3V L;  1YNJ A;  2JA6 K;  3RZO C;  1YNN A;  1Y1W K;  4LK1 A;  4G7H A;  5TMF A;  2R92 C;  3S2H C;  2NVX C;  1SMY A;  4MEX A;  4Y52 K;  3HOX K;  3M3Y K; 
#chains in the Genus database with same CATH topology
 5FLM K;  1O2A A;  1PJ5 A;  1ZVU A;  2WAQ D;  2WAQ L;  4LK0 A;  1WSV A;  1IW7 A;  4C2M K;  4C3I K;  1Y1V A;  5C3E K;  4X6A C;  3LAP A;  2V6T A;  2ZUE A;  3WOD A;  1WOP A;  4OIP A;  1J6X A;  4A3E C;  2PPB A;  1Y1V K;  2YU9 A;  3GTG C;  4GZY A;  4QIW L;  1ZYR A;  4QIW D;  3GTQ C;  1WOR A;  1RU0 A;  4BXX K;  2WB1 D;  4WJ3 M;  3GTQ A;  5C4J C;  4MQ9 A;  3I4N K;  3N3Y A;  3HOV C;  3VA7 A;  1K83 C;  1I6H C;  1TWA A;  4AYB L;  1JQW A;  2XCQ A;  4C3I C;  1I6H K;  3GTK K;  3BP3 A;  5IYD K;  3GTJ K;  4ZH4 A;  1EFW A;  1O29 A;  4BLB A;  3M3Y C;  4C45 A;  4NOI A;  4A3E K;  3L4J A;  3S2H K;  2A69 A;  1O27 A;  2R92 K;  3SZY A;  3DXJ A;  2XCR B;  3GDZ A;  1DD5 A;  2JA5 K;  1Y1V C;  4A3D C;  4A3G K;  1IE0 A;  3HKZ L;  2Y3P A;  3A8K A;  4RMF A;  3IPJ A;  1G51 A;  2D6F C;  4YFX A;  1ZQ1 C;  2V6U A;  2ZUF A;  3ERE D;  2FQT A;  3N0B A;  2JA7 A;  3M4O C;  4Y7N C;  4GTC A;  1K83 A;  3S16 K;  2XCO A;  1R9T C;  3GTL A;  1IL2 A;  1SFO A;  3FKI A;  1L0W A;  5HL8 A;  1WOO A;  4A3C C;  1SFO C;  1B4B A;  4A3M K;  1J6W A;  2JA5 A;  5L46 A;  3H3V L;  2JA6 K;  1YNN A;  1Y1W K;  4KMH A;  4MEX A;  3HOX K;  1VH2 A;  4JK1 A;  3EQL A;  5C44 K;  4C3H C;  1EQR A;  3CQZ K;  3GSI A;  4LJZ A;  3RZD K;  4A93 K;  1XXA A;  3GTO A;  1TWG A;  3S1N C;  1I50 C;  3BP8 C;  2Y0S D;  5M5X K;  3S1R C;  1O28 A;  4LQY A;  2YU9 K;  3S17 K;  4A3D K;  2R93 K;  4C3J C;  3PO2 K;  3I4N C;  2JA6 A;  1TWF K;  5IYC C;  3GTP A;  4OIN A;  1R9T A;  2PA8 D;  2WB1 L;  4FZB A;  4FM9 A;  3PO3 C;  2VUM C;  4OIR A;  3GTP C;  2R7Z K;  3ORE A;  3FKI C;  1TWH C;  4P9S A;  4MEY A;  3TTG A;  4Q5S A;  1O2F B;  4A3J K;  4KAT A;  3GTK C;  3GTM A;  2BE5 A;  5JFE A;  4XSX A;  1TWG K;  2RGR A;  2PMZ L;  2E2H K;  3CQZ C;  1YX2 A;  4LOW A;  4WIL A;  1F7U A;  2JA7 K;  4A3K K;  4YFN A;  1WSR A;  5C4J K;  5IP9 K;  3CQZ A;  1WQG A;  1B4A A;  3S17 C;  4KAW X;  1Y1W A;  5IYC K;  3S1Q K;  1TWF C;  3FOF A;  4A3I K;  1BGW A;  2R93 C;  2NVQ K;  3GTO C;  4BY7 K;  3HOW K;  4YFK A;  2PHC B;  1TWF A;  3S14 C;  1J98 A;  2FQO A;  1BS2 A;  3I4M K;  1O2B A;  2E2J K;  3AD9 C;  4GTE A;  4A3B K;  2GAH C;  4KMD A;  3S16 C;  2RH6 A;  3SZZ A;  4GTL A;  2YU9 C;  3GTG A;  3RZO K;  4QJV A;  2JH3 A;  3HOZ C;  4G7O A;  2E2I C;  1DCH A;  1O25 A;  1I3Q K;  4A3C K;  5IP7 K;  1YCL A;  3LPX A;  5IOR A;  4A3L K;  1KQ4 A;  5M3M K;  5D4D A;  3L4K A;  1HI9 A;  5M5W K;  4Y7N K;  3HOX C;  4KM9 A;  1IS1 A;  3M4O K;  1O24 A;  1VRQ C;  1Y1W C;  1XZP A;  4LK1 A;  3S2H C;  4Y52 K;  4AH6 A;  3M3Y K;  3GIR A;  3HXA A;  4A3B C;  5TJ3 A;  5JVO A;  1WQF A;  1I3Q A;  5CJ9 A;  2B63 C;  1PJ6 A;  4A3F C;  3GTL K;  2NVQ C;  3GTO K;  3T02 A;  1VJE A;  1WQH A;  4KMA A;  3FOE A;  1XZP B;  3S1Q C;  1XPP A;  2B63 A;  3H0G C;  4KN7 A;  4YG2 A;  2P8T A;  1TWC K;  3S1M C;  1HQM A;  2R7Z C;  2VUM K;  2E2J C;  3HOY C;  2E2I A;  5IYB C;  2E2H A;  4BY1 K;  2R7Z A;  1EK8 A;  3GEI A;  3G4A A;  3GTG K;  2O5I A;  3GTJ C;  2JA7 C;  4OIO A;  4LLG A;  4WJ4 A;  2E2H C;  3AQP A;  4QJV B;  3S1R K;  3K7A K;  3GTJ A;  1USM A;  4A3G C;  4A3F K;  3GTL C;  5CHP A;  3GEH A;  4A3I C;  3A8I A;  2EBB A;  4BBS C;  3PO3 K;  3HOU C;  1JOE A;  1INN A;  1WIH A;  3FKI K;  4KN4 A;  3MML B;  5FJ8 K;  2JA8 C;  4C3J K;  4GTB A;  1PJ7 A;  3T01 A;  4BBR C;  3FHZ A;  3OEP A;  1BJT A;  4P5A A;  4X6A K;  2O5J A;  4KC6 A;  2W7V A;  3RZD C;  1VGX A;  5IOQ A;  5M3F K;  1BDF A;  4A3J C;  3S1N K;  1EI6 A;  1J6V A;  5C3E C;  4A93 C;  1XXC A;  3T00 A;  1XXB A;  4Y52 C;  5M5Y K;  4BLA A;  1I50 A;  1R9T K;  3HOZ K;  1DCO A;  2GSN A;  2A68 A;  3TFI A;  3PO2 C;  1VLO A;  1TWC C;  4KMU A;  3S1M K;  4LR2 A;  4GTD A;  3H0G K;  1AB4 A;  3S15 K;  1SFO K;  2JA6 C;  4XLP A;  1I6V A;  3S2D C;  1TWA C;  3HKZ D;  2A6H A;  4XLN A;  5IP7 C;  4J3N A;  5TMC A;  5C4X K;  1ZXO A;  2ZFZ A;  5C4X C;  4C3H K;  3A8J A;  4XSZ A;  2CFA B;  4GFQ A;  1XZQ B;  4GTA A;  2KWA A;  2NVY A;  4BKW A;  1ZBS A;  1F93 A;  1YNJ A;  3GEE A;  2R92 C;  5TMF A;  4PAB A;  1SMY A;  4KAR A;  5EGE A;  1C0A A;  2PA8 L;  2R92 A;  4A3L C;  2CFA A;  3HOU K;  3TFH A;  4GTF A;  4KB2 A;  3CAG A;  2E2I K;  1USO A;  2CW0 A;  2R93 A;  4BY7 C;  3NUH A;  3OPF A;  1IBA A;  5E68 A;  3S2D K;  3S14 K;  4BBR K;  1K83 K;  1TWC A;  4G0W A;  1TWH K;  2A6E A;  2VUM A;  3QX3 A;  3ADA C;  4BY1 C;  1ISE A;  5IYB K;  3I4M C;  1UV7 A;  4BXX C;  1IQ0 A;  3GTK A;  5IP9 C;  3GTQ K;  4Q4Z A;  1JVI A;  4A3K C;  2NVY K;  4DDQ A;  3AQO A;  3K7A C;  3BUE A;  4BBS K;  2GSU A;  4XCH A;  1XZQ A;  1F9N A;  1DCP A;  1GE9 A;  3S0X A;  3HOW C;  2NVY C;  4AYB D;  3HOV K;  2JA5 C;  1WCM A;  3HOY K;  1WOS A;  2JA8 K;  1WCM C;  3H3V D;  3GTP K;  1WCM K;  4KDD A;  5IYD C;  4G7Z A;  3LAJ A;  1V5V A;  1I50 K;  4KM8 A;  1TWG C;  2NVT C;  3AD8 C;  4O2D A;  2B63 K;  1O26 A;  1I3Q C;  1X31 C;  5FLM C;  4OIQ A;  2V6S A;  4M1X A;  2NVX K;  4ILD A;  4KB4 A;  3GTM K;  1TWH A;  3H0G A;  3AH5 A;  4GT9 A;  2P5M A;  3GTM C;  4C2M C;  5IOT A;  4G0U A;  2GAG C;  2GSO A;  5EGH A;  2Y0S L;  5C44 C;  3TFJ A;  2PMZ D;  5IOS A;  3N0C A;  4G0V A;  2NVT K;  3S15 C;  3V4G A;  2NVX A;  3JST A;  3G4C A;  1TWA K;  3RZO C;  3AD7 C;  4G7H A;  1F7V A;  3Q3Q A;  1EH1 A;  4P5B A;  2NVX C;  4A3M C;  4PAA A;  4KAS A; 
#chains in the Genus database with same CATH homology
 5FLM K;  2PA8 L;  4A3B C;  4A3L C;  4JK1 A;  3EQL A;  2WAQ D;  5C44 K;  2WAQ L;  3HOU K;  3CQZ K;  4LK0 A;  4A3M C;  4LJZ A;  1IW7 A;  4C2M K;  4C3I K;  3RZD K;  2B63 C;  4A93 K;  2E2I K;  5C3E K;  2CW0 A;  4A3F C;  3GTL K;  4BY7 C;  4X6A C;  2NVQ C;  3GTO K;  1I50 C;  3I4N C;  2Y0S D;  5M5X K;  3S1N C;  3S1R C;  3S2D K;  3WOD A;  3S14 K;  4BBR K;  3S1Q C;  1K83 K;  1XPP A;  4OIP A;  3H0G C;  4KN7 A;  4YG2 A;  2YU9 K;  3S17 K;  4A3D K;  4A3E C;  1TWC K;  1Y1V K;  1HQM A;  2PPB A;  1TWH K;  3GTG C;  2A6E A;  3PO2 K;  3S1M C;  4QIW L;  1ZYR A;  4QIW D;  2R7Z C;  1TWF K;  3GTQ C;  5IYC C;  4BY1 C;  2VUM K;  4OIN A;  5IYB K;  4BXX K;  2E2J C;  3HOY C;  3I4M C;  2WB1 D;  2PA8 D;  2WB1 L;  5IYB C;  3PO3 C;  4BXX C;  4BY1 K;  5IP9 C;  2VUM C;  5C4J C;  4OIR A;  4MQ9 A;  3GTP C;  3GTQ K;  4Q4Z A;  3FKI C;  3I4N K;  1TWH C;  2O5I A;  3GTG K;  3GTJ C;  4A3K C;  3HOV C;  2JA7 C;  2NVY K;  4LLG A;  4MEY A;  4OIO A;  4Q5S A;  2R93 K;  4A3J K;  3K7A C;  1K83 C;  2E2H C;  3GTK C;  4BBS K;  1I6H C;  2BE5 A;  4QJV B;  3S1R K;  3K7A K;  4XSX A;  1TWG K;  3HOW C;  4A3G C;  2NVY C;  4AYB D;  4A3F K;  4AYB L;  3GTL C;  3HOV K;  2JA5 C;  2PMZ L;  4A3I C;  1I6H K;  4BBS C;  2E2H K;  3CQZ C;  3GTK K;  3PO3 K;  5IYD K;  3HOU C;  3HOY K;  2JA7 K;  3GTJ K;  4A3K K;  4YFN A;  2JA8 K;  3FKI K;  4KN4 A;  4ZH4 A;  1WCM C;  3GTP K;  3H3V D;  5C4J K;  5FJ8 K;  5IP9 K;  1WCM K;  3M3Y C;  2JA8 C;  4NOI A;  4C3J K;  4A3E K;  3S17 C;  3S2H K;  5IYD C;  2A69 A;  4G7Z A;  2R92 K;  3DXJ A;  5IYC K;  1TWF C;  4BBR C;  4A3I K;  3S1Q K;  2JA5 K;  1I50 K;  1Y1V C;  2NVQ K;  3GTO C;  4A3D C;  4BY7 K;  2R93 C;  4X6A K;  1TWG C;  3HOW K;  4A3G K;  4YFK A;  2O5J A;  3HKZ L;  2NVT C;  3RZD C;  3S14 C;  5M3F K;  1BDF A;  4A3J C;  3S1N K;  5C3E C;  2B63 K;  2R7Z K;  4A93 C;  1I3Q C;  5FLM C;  4OIQ A;  4Y52 C;  3I4M K;  5M5Y K;  2NVX K;  2E2J K;  4YFX A;  1R9T K;  3HOZ K;  3GTM K;  4A3B K;  3S16 C;  2A68 A;  3PO2 C;  1TWC C;  4KMU A;  3S1M K;  3M4O C;  3H0G K;  2YU9 C;  4Y7N C;  3S15 K;  1SFO K;  3S16 K;  2JA6 C;  3RZO K;  4XLP A;  4QJV A;  3GTM C;  1I6V A;  3S2D C;  3HOZ C;  1TWA C;  1R9T C;  3HKZ D;  4G7O A;  2A6H A;  4XLN A;  5IP7 C;  2E2I C;  5TMC A;  5C4X K;  1I3Q K;  4A3C K;  5C4X C;  5IP7 K;  2Y0S L;  4C3H K;  5C44 C;  4XSZ A;  4A3L K;  2PMZ D;  5M3M K;  5D4D A;  4A3C C;  1SFO C;  2NVT K;  5M5W K;  4Y7N K;  3HOX C;  4A3M K;  3S15 C;  3M4O K;  4GZY A;  1Y1W C;  1TWA K;  3H3V L;  1YNJ A;  2JA6 K;  3RZO C;  1YNN A;  1Y1W K;  4LK1 A;  4G7H A;  5TMF A;  2R92 C;  3S2H C;  2NVX C;  1SMY A;  4MEX A;  4Y52 K;  3HOX K;  3M3Y K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...