4A3MK

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid and soaked with ampcpp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3mK00
4OIQA 4MQ9A 1ZYRA 4A93K 4XLNA 4C2MK 4BXXC 2VUMK 2E2JK 2YU9C 3HOVC 4A3CK 4QJVA 4YG2A 5IYCK 3S1MK 5C4XK 2NVTK 3RZOK 1SFOK 3I4MK 3GTKK 4A93C 4XSXA 2R7ZK 4X6AC 4Q5SA 2WAQL 2VUMC 4G7OA 2E2JC 4A3CC 2R92K 5IYBK 4LJZA 4OIPA 4A3BK 2BE5A 3GTOK 4LK1A 5C4JK 3S1MC 3S2DK 5C4XC 4A3EK 3EQLA 3S1RK 2NVXK 4BBSC 2NVTC 3RZOC 1SFOC 4C3IK 3I4MC 2WB1D 4A3IK 4Q4ZA 1BDFA 3GTKC 3GTMK 3RZDK 2R7ZC 3I4NC 4BXXK 4YFNA 1K83K 2WB1L 2R92C 4LK0A 2PMZL 5IYBC 3HOXK 4A3BC 1R9TK 4KMUA 1IW7A 5C4JC 3S2DC 4BY7C 4A3EC 2PA8D 3S1RC 2NVXC 2JA6K 3S15K 1TWHK 4A3IC 2A69A 4YFXA 4X6AK 4Y7NK 3GTMC 3RZDC 4KN7A 2PA8L 3S1NK 1K83C 4G7ZA 2A68A 3HOXC 3HKZD 1R9TC 2B63K 2WAQD 4QJVB 4A3DK 4BBSK 4OINA 2JA6C 2Y0SD 3GTPK 3I4NK 3S15C 1TWHC 3HKZL 5TMFA 1Y1WC 4Y7NC 3M3YC 2O5JA 3S1NC 1I3QK 2Y0SL 3S16C 4BY7K 4OIRA 2B63C 5M5WK 4A3DC 1TWFC 3GTPC 2PMZD 5FJ8K 1Y1VK 3K7AK 3S2HC 1I3QC 2JA5C 3HOZK 1I50K 2JA8K 2E2IK 4A3LK 5TMCA 5IP9K 3GTJK 4XSZA 2NVYK 3HOWC 1Y1WK 3CQZK 3M3YK 4YFKA 5D4DA 1Y1VC 3DXJA 3K7AC 4A3JK 4C3HK 3GTQK 4GZYA 3S16K 3HOZC 1I50C 5M5YK 2JA8C 2E2IC 4XLPA 3HOYK 3S14K 4A3GK 4A3LC 3H0GK 5IP9C 1TWFK 2A6HA 3GTJC 2NVYC 4LLGA 3CQZC 3S2HK 1TWGC 4A3JC 4NOIA 2JA5K 3GTLK 1HQMA 3GTQC 3WODA 4A3MK 5FLMK 5C44K 2CW0A 3S14C 4KN4A 3HOYC 4A3GC 1TWAC 5M5XK 3H0GC 3HOWK 4C3JK 3HOUK 4MEYA 2R93K 4BBRK 3GTLC 2E2HK 5IYDK 1WCMK 4JK1A 4A3FK 3HOVK 4A3MC 1XPPA 1YNNA 5FLMC 5C44C 3PO2K 3FKIK 4Y52K 4ZH4A 1TWCK 4AYBD 3M4OK 3HOUC 2R93C 1TWGK 4A3KK 2PPBA 3PO3K 1I6HK 4BBRC 4AYBL 4BY1K 3GTGK 1YNJA 5IYDC 2E2HC 5M3FK 1WCMC 5IP7K 5M3MK 4A3FC 2JA7K 3PO2C 1TWAK 5C3EK 3S17K 2NVQK 3FKIC 1I6VA 4Y52C 5IYCC 3S1QK 1TWCC 3M4OC 4G7HA 4QIWD 4A3KC 1SMYA 3PO3C 1I6HC 2YU9K 4MEXA 4BY1C 2A6EA 2JA7C 4QIWL 2O5IA 3GTGC 5IP7C 3H3VD 5C3EC 3S17C 4OIOA 2NVQC 3GTOC 3S1QC 3H3VL
chains in the Genus database with same CATH superfamily
4OIQA 5E68A 4C2MK 4A3CK 1YCLA 5IYCK 2CFAB 3GTMA 1SFOK 3GTKK 4XSXA 1WQHA 2E2JC 1INNA 2R92K 5IYBK 4OIPA 2JA6A 3GTOK 5C4JK 1IS1A 3S1MC 3LPXA 3S2DK 3OREA 2NVTC 3RZOC 4G0WA 5EGEA 3I4MC 4Q4ZA 3AD9C 5CJ9A 5TJ3A 2WB1L 4KC6A 4A3BC 1TWFA 1R9TK 4BY7C 3S1RC 2NVXC 3QX3A 1TWHK 4C3IC 4Y7NK 3GTMC 3AQOA 4KM9A 4KN7A 1EH1A 4BBSK 4QJVB 4LOWA 4OINA 2FQTA 1BS2A 2Y0SD 3NUHA 2JA6C 3I4NK 3HKZL 3SZYA 3S15C 1PJ7A 4KMDA 3N3YA 1I3QK 4GTAA 1DCPA 1TWFC 2PMZD 5FJ8K 3VA7A 3FOEA 4LR2A 3BP8C 1TWAA 1F7UA 1EFWA 3LAJA 4A3LK 3N0CA 4KATA 3GTJK 3HOWC 3CQZK 3GTLA 5D4DA 1UV7A 3K7AC 3GTQK 2KWAA 3HOZC 4A3GK 3HOYK 2R93A 5IP9C 1WSVA 3TFHA 3T02A 1G51A 2E2HA 1ZQ1C 1XXAA 3FKIA 3BP3A 3A8KA 5FLMK 3S14C 1TWAC 1C0AA 3FHZA 1O28A 2JA7A 4LQYA 3GTLC 1F9NA 1WCMK 4A3FK 2CFAA 1XPPA 1VGXA 4KB4A 3M4OK 4AYBD 2JH3A 4KASA 3HOUC 2R93C 1TWGK 4KMHA 4A3KK 1F7VA 1K83A 1I6HK 4BBRC 3S0XA 3FOFA 2E2HC 5M3MK 3PO2C 3S17K 2NVQK 3FKIC 4Y52C 3L4KA 4G7HA 2W7VA 4QIWD 3Q3QA 3PO3C 2ZUFA 2JA7C 2R7ZA 1B4AA 3H3VL 3T00A 1VLOA 4XLNA 2E2JK 4GTLA 4QJVA 4YG2A 5EGHA 1EQRA 3S1MK 1DD5A 2NVTK 3RZOK 1WIHA 3I4MK 4KARA 4BLBA 4ILDA 4A3BK 4LJZA 1Y1WA 5C4XC 3EQLA 3S1RK 2NVXK 4WILA 4C3IK 1BDFA 4BXXK 3GTMK 2R7ZC 4YFNA 2PMZL 3H0GA 3OEPA 3GIRA 3A8IA 4PAAA 4A3EC 3TFJA 2JA6K 1IQ0A 3S15K 1IBAA 2JA5A 4X6AK 1VRQC 2PA8L 2EBBA 2WAQD 1Y1VA 1B4BA 1J98A 1Y1WC 1I50A 3M3YC 2E2IA 4GT9A 2V6UA 4GTFA 5CHPA 2XCRB 5M5WK 1BJTA 3A8JA 4P5AA 3K7AK 3GEEA 4GTBA 2JA5C 3HOZK 1X31C 5TMCA 5IP9K 3CAGA 3IPJA 4C3JC 1Y1VC 4C3HK 3S16K 1I50C 2JA8C 3S14K 2E2IC 4XLPA 3N0BA 3S2HK 4A3JC 1VH2A 3GTLK 1HQMA 1EI6A 1TWCA 4KN4A 5M5XK 1WOOA 1WSRA 3HOUK 2R93K 1KQ4A 1IL2A 1VJEA 4BBRK 2E2HK 3GTOA 4JK1A 4A3MC 3PO2K 4GFQA 5C44C 3FKIK 4Y52K 1JQWA 3GDZA 3MMLB 3PO3K 4KM8A 4C2MC 2JA7K 3TTGA 5M3FK 4KB2A 5IYCC 4AH6A 1TWCC 1XZQB 2VUMA 4PABA 4BY1C 4KMAA 2GSUA 3AD7C 5C3EC 4OIOA 3GTOC 3SZZA 4MQ9A 1ZYRA 3HOVC 1JVIA 4BLAA 2GSNA 5C4XK 3G4AA 4WJ3M 4A93C 2XCOA 2R7ZK 1DCOA 4Q5SA 2WAQL 2Y3PA 2VUMC 3AD8C 2BE5A 2D6FC 4A3EK 4BBSC 3I4NC 2WB1D 1PJ5A 1XXCA 2B63A 4KDDA 3GTPA 1IW7A 1O29A 4A3IC 2A69A 3ADAC 4YFXA 3RZDC 3AQPA 1K83C 4G7ZA 3HOXC 3HKZD 2GAHC 3G4CA 1O2BA 5TMFA 3S1NC 2Y0SL 4KAWX 2NVYA 5IOSA 5L46A 4BY7K 2P8TA 4OIRA 2B63C 1XZPB 1TWGA 4A3DC 3GTPC 1Y1VK 1ZBSA 1I50K 1IE0A 2JA8K 3GEHA 2E2IK 5IOTA 4A3JK 3DXJA 3JSTA 4G0UA 4GZYA 5M5YK 4XCHA 1J6WA 1XZQA 2GSOA 1TWFK 4GTCA 1O2AA 2NVYC 4LLGA 2XCQA 1TWGC 4BKWA 1L0WA 4A3MK 1ISEA 5C44K 1O24A 3H0GC 3HOWK 2V6TA 4MEYA 4RMFA 3GTGA 1WQGA 4P5BA 4DDQA 2NVXA 1ZXOA 1WORA 4FZBA 1WOPA 4ZH4A 1TWCK 2GAGC 2V6SA 2ZUEA 2YU9A 2RH6A 2PPBA 4AYBL 4BY1K 1ZVUA 5IYDC 4C45A 1J6XA 1TWAK 5C3EK 1I6VA 4FM9A 1F93A 1V5VA 4J3NA 3ERED 1RU0A 1SMYA 3HOVK 4MEXA 3GTGC 2A6EA 4QIWL 3H3VD 5IP7C 1DCHA 1SFOA 3GTKA 1O25A 3S1QC 1PJ6A 4A93K 2R92A 4BXXC 2VUMK 1HI9A 2YU9C 3HXAA 3OPFA 4M1XA 5JVOA 3AH5A 5IORA 4X6AC 1R9TA 4G7OA 3L4JA 4A3CC 1XZPA 4LK1A 1TWHA 1O27A 1O2FB 1SFOC 4A3IK 3GTKC 3RZDK 5JFEA 3TFIA 1K83K 2R92C 4LK0A 5IYBC 3HOXK 4KMUA 5C4JC 3S2DC 1J6VA 2PA8D 2PHCB 2ZFZA 1I3QA 1GE9A 3S1NK 1JOEA 1WQFA 3GSIA 2A68A 1WOSA 1R9TC 1O26A 1USOA 2B63K 4A3DK 3GTPK 1TWHC 4G0VA 4Y7NC 2O5JA 2FQOA 1XXBA 4C3HC 3GTJA 4GTEA 3S16C 3CQZA 1YX2A 1USMA 3T01A 3GTQA 3S2HC 1I3QC 3BUEA 1AB4A 4XSZA 2NVYK 1Y1WK 2RGRA 3M3YK 4YFKA 3V4GA 4A3LC 2P5MA 3H0GK 2A6HA 3GTJC 1BGWA 3CQZC 1WCMA 3LAPA 4NOIA 2JA5K 3GTQC 3WODA 5HL8A 2CW0A 4A3GC 3HOYC 4P9SA 4C3JK 4WJ4A 5IYDK 1EK8A 1YNNA 5FLMC 3GEIA 4O2DA 3GTGK 1YNJA 5IOQA 1WCMC 5IP7K 4A3FC 4GTDA 3S1QK 3M4OC 4A3KC 1I6HC 2YU9K 2O5IA 3S17C 2NVQC
chains in the Genus database with same CATH topology
4OIQA 4MQ9A 1ZYRA 4A93K 4XLNA 4C2MK 4BXXC 2VUMK 2E2JK 2YU9C 3HOVC 4A3CK 4QJVA 4YG2A 5IYCK 3S1MK 5C4XK 2NVTK 3RZOK 1SFOK 3I4MK 3GTKK 4A93C 4XSXA 2R7ZK 4X6AC 4Q5SA 2WAQL 2VUMC 4G7OA 2E2JC 4A3CC 2R92K 5IYBK 4LJZA 4OIPA 4A3BK 2BE5A 3GTOK 4LK1A 5C4JK 3S1MC 3S2DK 5C4XC 4A3EK 3EQLA 3S1RK 2NVXK 4BBSC 2NVTC 3RZOC 1SFOC 4C3IK 3I4MC 2WB1D 4A3IK 4Q4ZA 1BDFA 3GTKC 3GTMK 3RZDK 2R7ZC 3I4NC 4BXXK 4YFNA 1K83K 2WB1L 2R92C 4LK0A 2PMZL 5IYBC 3HOXK 4A3BC 1R9TK 4KMUA 1IW7A 5C4JC 3S2DC 4BY7C 4A3EC 2PA8D 3S1RC 2NVXC 2JA6K 3S15K 1TWHK 4A3IC 2A69A 4YFXA 4X6AK 4Y7NK 3GTMC 3RZDC 4KN7A 2PA8L 3S1NK 1K83C 4G7ZA 2A68A 3HOXC 3HKZD 1R9TC 2B63K 2WAQD 4QJVB 4A3DK 4BBSK 4OINA 2JA6C 2Y0SD 3GTPK 3I4NK 3S15C 1TWHC 3HKZL 5TMFA 1Y1WC 4Y7NC 3M3YC 2O5JA 3S1NC 1I3QK 2Y0SL 3S16C 4BY7K 4OIRA 2B63C 5M5WK 4A3DC 1TWFC 3GTPC 2PMZD 5FJ8K 1Y1VK 3K7AK 3S2HC 1I3QC 2JA5C 3HOZK 1I50K 2JA8K 2E2IK 4A3LK 5TMCA 5IP9K 3GTJK 4XSZA 2NVYK 3HOWC 1Y1WK 3CQZK 3M3YK 4YFKA 5D4DA 1Y1VC 3DXJA 3K7AC 4A3JK 4C3HK 3GTQK 4GZYA 3S16K 3HOZC 1I50C 5M5YK 2JA8C 2E2IC 4XLPA 3HOYK 3S14K 4A3GK 4A3LC 3H0GK 5IP9C 1TWFK 2A6HA 3GTJC 2NVYC 4LLGA 3CQZC 3S2HK 1TWGC 4A3JC 4NOIA 2JA5K 3GTLK 1HQMA 3GTQC 3WODA 4A3MK 5FLMK 5C44K 2CW0A 3S14C 4KN4A 3HOYC 4A3GC 1TWAC 5M5XK 3H0GC 3HOWK 4C3JK 3HOUK 4MEYA 2R93K 4BBRK 3GTLC 2E2HK 5IYDK 1WCMK 4JK1A 4A3FK 3HOVK 4A3MC 1XPPA 1YNNA 5FLMC 5C44C 3PO2K 3FKIK 4Y52K 4ZH4A 1TWCK 4AYBD 3M4OK 3HOUC 2R93C 1TWGK 4A3KK 2PPBA 3PO3K 1I6HK 4BBRC 4AYBL 4BY1K 3GTGK 1YNJA 5IYDC 2E2HC 5M3FK 1WCMC 5IP7K 5M3MK 4A3FC 2JA7K 3PO2C 1TWAK 5C3EK 3S17K 2NVQK 3FKIC 1I6VA 4Y52C 5IYCC 3S1QK 1TWCC 3M4OC 4G7HA 4QIWD 4A3KC 1SMYA 3PO3C 1I6HC 2YU9K 4MEXA 4BY1C 2A6EA 2JA7C 4QIWL 2O5IA 3GTGC 5IP7C 3H3VD 5C3EC 3S17C 4OIOA 2NVQC 3GTOC 3S1QC 3H3VL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIQ A;  4MQ9 A;  1ZYR A;  4A93 K;  4XLN A;  4C2M K;  4BXX C;  2VUM K;  2E2J K;  2YU9 C;  3HOV C;  4A3C K;  4QJV A;  4YG2 A;  5IYC K;  3S1M K;  5C4X K;  2NVT K;  3RZO K;  1SFO K;  3I4M K;  3GTK K;  4A93 C;  4XSX A;  2R7Z K;  4X6A C;  4Q5S A;  2WAQ L;  2VUM C;  4G7O A;  2E2J C;  4A3C C;  2R92 K;  5IYB K;  4LJZ A;  4OIP A;  4A3B K;  2BE5 A;  3GTO K;  4LK1 A;  5C4J K;  3S1M C;  3S2D K;  5C4X C;  4A3E K;  3EQL A;  3S1R K;  2NVX K;  4BBS C;  2NVT C;  3RZO C;  1SFO C;  4C3I K;  3I4M C;  2WB1 D;  4A3I K;  4Q4Z A;  1BDF A;  3GTK C;  3GTM K;  3RZD K;  2R7Z C;  3I4N C;  4BXX K;  4YFN A;  1K83 K;  2WB1 L;  2R92 C;  4LK0 A;  2PMZ L;  5IYB C;  3HOX K;  4A3B C;  1R9T K;  4KMU A;  1IW7 A;  5C4J C;  3S2D C;  4BY7 C;  4A3E C;  2PA8 D;  3S1R C;  2NVX C;  2JA6 K;  3S15 K;  1TWH K;  4A3I C;  2A69 A;  4YFX A;  4X6A K;  4Y7N K;  3GTM C;  3RZD C;  4KN7 A;  2PA8 L;  3S1N K;  1K83 C;  4G7Z A;  2A68 A;  3HOX C;  3HKZ D;  1R9T C;  2B63 K;  2WAQ D;  4QJV B;  4A3D K;  4BBS K;  4OIN A;  2JA6 C;  2Y0S D;  3GTP K;  3I4N K;  3S15 C;  1TWH C;  3HKZ L;  5TMF A;  1Y1W C;  4Y7N C;  3M3Y C;  2O5J A;  3S1N C;  1I3Q K;  2Y0S L;  3S16 C;  4BY7 K;  4OIR A;  2B63 C;  5M5W K;  4A3D C;  1TWF C;  3GTP C;  2PMZ D;  5FJ8 K;  1Y1V K;  3K7A K;  3S2H C;  1I3Q C;  2JA5 C;  3HOZ K;  1I50 K;  2JA8 K;  2E2I K;  4A3L K;  5TMC A;  5IP9 K;  3GTJ K;  4XSZ A;  2NVY K;  3HOW C;  1Y1W K;  3CQZ K;  3M3Y K;  4YFK A;  5D4D A;  1Y1V C;  3DXJ A;  3K7A C;  4A3J K;  4C3H K;  3GTQ K;  4GZY A;  3S16 K;  3HOZ C;  1I50 C;  5M5Y K;  2JA8 C;  2E2I C;  4XLP A;  3HOY K;  3S14 K;  4A3G K;  4A3L C;  3H0G K;  5IP9 C;  1TWF K;  2A6H A;  3GTJ C;  2NVY C;  4LLG A;  3CQZ C;  3S2H K;  1TWG C;  4A3J C;  4NOI A;  2JA5 K;  3GTL K;  1HQM A;  3GTQ C;  3WOD A;  4A3M K;  5FLM K;  5C44 K;  2CW0 A;  3S14 C;  4KN4 A;  3HOY C;  4A3G C;  1TWA C;  5M5X K;  3H0G C;  3HOW K;  4C3J K;  3HOU K;  4MEY A;  2R93 K;  4BBR K;  3GTL C;  2E2H K;  5IYD K;  1WCM K;  4JK1 A;  4A3F K;  3HOV K;  4A3M C;  1XPP A;  1YNN A;  5FLM C;  5C44 C;  3PO2 K;  3FKI K;  4Y52 K;  4ZH4 A;  1TWC K;  4AYB D;  3M4O K;  3HOU C;  2R93 C;  1TWG K;  4A3K K;  2PPB A;  3PO3 K;  1I6H K;  4BBR C;  4AYB L;  4BY1 K;  3GTG K;  1YNJ A;  5IYD C;  2E2H C;  5M3F K;  1WCM C;  5IP7 K;  5M3M K;  4A3F C;  2JA7 K;  3PO2 C;  1TWA K;  5C3E K;  3S17 K;  2NVQ K;  3FKI C;  1I6V A;  4Y52 C;  5IYC C;  3S1Q K;  1TWC C;  3M4O C;  4G7H A;  4QIW D;  4A3K C;  1SMY A;  3PO3 C;  1I6H C;  2YU9 K;  4MEX A;  4BY1 C;  2A6E A;  2JA7 C;  4QIW L;  2O5I A;  3GTG C;  5IP7 C;  3H3V D;  5C3E C;  3S17 C;  4OIO A;  2NVQ C;  3GTO C;  3S1Q C;  3H3V L; 
#chains in the Genus database with same CATH topology
 4OIQ A;  5E68 A;  4C2M K;  4A3C K;  1YCL A;  5IYC K;  2CFA B;  3GTM A;  1SFO K;  3GTK K;  4XSX A;  1WQH A;  2E2J C;  1INN A;  2R92 K;  5IYB K;  4OIP A;  2JA6 A;  3GTO K;  5C4J K;  1IS1 A;  3S1M C;  3LPX A;  3S2D K;  3ORE A;  2NVT C;  3RZO C;  4G0W A;  5EGE A;  3I4M C;  4Q4Z A;  3AD9 C;  5CJ9 A;  5TJ3 A;  2WB1 L;  4KC6 A;  4A3B C;  1TWF A;  1R9T K;  4BY7 C;  3S1R C;  2NVX C;  3QX3 A;  1TWH K;  4C3I C;  4Y7N K;  3GTM C;  3AQO A;  4KM9 A;  4KN7 A;  1EH1 A;  4BBS K;  4QJV B;  4LOW A;  4OIN A;  2FQT A;  1BS2 A;  2Y0S D;  3NUH A;  2JA6 C;  3I4N K;  3HKZ L;  3SZY A;  3S15 C;  1PJ7 A;  4KMD A;  3N3Y A;  1I3Q K;  4GTA A;  1DCP A;  1TWF C;  2PMZ D;  5FJ8 K;  3VA7 A;  3FOE A;  4LR2 A;  3BP8 C;  1TWA A;  1F7U A;  1EFW A;  3LAJ A;  4A3L K;  3N0C A;  4KAT A;  3GTJ K;  3HOW C;  3CQZ K;  3GTL A;  5D4D A;  1UV7 A;  3K7A C;  3GTQ K;  2KWA A;  3HOZ C;  4A3G K;  3HOY K;  2R93 A;  5IP9 C;  1WSV A;  3TFH A;  3T02 A;  1G51 A;  2E2H A;  1ZQ1 C;  1XXA A;  3FKI A;  3BP3 A;  3A8K A;  5FLM K;  3S14 C;  1TWA C;  1C0A A;  3FHZ A;  1O28 A;  2JA7 A;  4LQY A;  3GTL C;  1F9N A;  1WCM K;  4A3F K;  2CFA A;  1XPP A;  1VGX A;  4KB4 A;  3M4O K;  4AYB D;  2JH3 A;  4KAS A;  3HOU C;  2R93 C;  1TWG K;  4KMH A;  4A3K K;  1F7V A;  1K83 A;  1I6H K;  4BBR C;  3S0X A;  3FOF A;  2E2H C;  5M3M K;  3PO2 C;  3S17 K;  2NVQ K;  3FKI C;  4Y52 C;  3L4K A;  4G7H A;  2W7V A;  4QIW D;  3Q3Q A;  3PO3 C;  2ZUF A;  2JA7 C;  2R7Z A;  1B4A A;  3H3V L;  3T00 A;  1VLO A;  4XLN A;  2E2J K;  4GTL A;  4QJV A;  4YG2 A;  5EGH A;  1EQR A;  3S1M K;  1DD5 A;  2NVT K;  3RZO K;  1WIH A;  3I4M K;  4KAR A;  4BLB A;  4ILD A;  4A3B K;  4LJZ A;  1Y1W A;  5C4X C;  3EQL A;  3S1R K;  2NVX K;  4WIL A;  4C3I K;  1BDF A;  4BXX K;  3GTM K;  2R7Z C;  4YFN A;  2PMZ L;  3H0G A;  3OEP A;  3GIR A;  3A8I A;  4PAA A;  4A3E C;  3TFJ A;  2JA6 K;  1IQ0 A;  3S15 K;  1IBA A;  2JA5 A;  4X6A K;  1VRQ C;  2PA8 L;  2EBB A;  2WAQ D;  1Y1V A;  1B4B A;  1J98 A;  1Y1W C;  1I50 A;  3M3Y C;  2E2I A;  4GT9 A;  2V6U A;  4GTF A;  5CHP A;  2XCR B;  5M5W K;  1BJT A;  3A8J A;  4P5A A;  3K7A K;  3GEE A;  4GTB A;  2JA5 C;  3HOZ K;  1X31 C;  5TMC A;  5IP9 K;  3CAG A;  3IPJ A;  4C3J C;  1Y1V C;  4C3H K;  3S16 K;  1I50 C;  2JA8 C;  3S14 K;  2E2I C;  4XLP A;  3N0B A;  3S2H K;  4A3J C;  1VH2 A;  3GTL K;  1HQM A;  1EI6 A;  1TWC A;  4KN4 A;  5M5X K;  1WOO A;  1WSR A;  3HOU K;  2R93 K;  1KQ4 A;  1IL2 A;  1VJE A;  4BBR K;  2E2H K;  3GTO A;  4JK1 A;  4A3M C;  3PO2 K;  4GFQ A;  5C44 C;  3FKI K;  4Y52 K;  1JQW A;  3GDZ A;  3MML B;  3PO3 K;  4KM8 A;  4C2M C;  2JA7 K;  3TTG A;  5M3F K;  4KB2 A;  5IYC C;  4AH6 A;  1TWC C;  1XZQ B;  2VUM A;  4PAB A;  4BY1 C;  4KMA A;  2GSU A;  3AD7 C;  5C3E C;  4OIO A;  3GTO C;  3SZZ A;  4MQ9 A;  1ZYR A;  3HOV C;  1JVI A;  4BLA A;  2GSN A;  5C4X K;  3G4A A;  4WJ3 M;  4A93 C;  2XCO A;  2R7Z K;  1DCO A;  4Q5S A;  2WAQ L;  2Y3P A;  2VUM C;  3AD8 C;  2BE5 A;  2D6F C;  4A3E K;  4BBS C;  3I4N C;  2WB1 D;  1PJ5 A;  1XXC A;  2B63 A;  4KDD A;  3GTP A;  1IW7 A;  1O29 A;  4A3I C;  2A69 A;  3ADA C;  4YFX A;  3RZD C;  3AQP A;  1K83 C;  4G7Z A;  3HOX C;  3HKZ D;  2GAH C;  3G4C A;  1O2B A;  5TMF A;  3S1N C;  2Y0S L;  4KAW X;  2NVY A;  5IOS A;  5L46 A;  4BY7 K;  2P8T A;  4OIR A;  2B63 C;  1XZP B;  1TWG A;  4A3D C;  3GTP C;  1Y1V K;  1ZBS A;  1I50 K;  1IE0 A;  2JA8 K;  3GEH A;  2E2I K;  5IOT A;  4A3J K;  3DXJ A;  3JST A;  4G0U A;  4GZY A;  5M5Y K;  4XCH A;  1J6W A;  1XZQ A;  2GSO A;  1TWF K;  4GTC A;  1O2A A;  2NVY C;  4LLG A;  2XCQ A;  1TWG C;  4BKW A;  1L0W A;  4A3M K;  1ISE A;  5C44 K;  1O24 A;  3H0G C;  3HOW K;  2V6T A;  4MEY A;  4RMF A;  3GTG A;  1WQG A;  4P5B A;  4DDQ A;  2NVX A;  1ZXO A;  1WOR A;  4FZB A;  1WOP A;  4ZH4 A;  1TWC K;  2GAG C;  2V6S A;  2ZUE A;  2YU9 A;  2RH6 A;  2PPB A;  4AYB L;  4BY1 K;  1ZVU A;  5IYD C;  4C45 A;  1J6X A;  1TWA K;  5C3E K;  1I6V A;  4FM9 A;  1F93 A;  1V5V A;  4J3N A;  3ERE D;  1RU0 A;  1SMY A;  3HOV K;  4MEX A;  3GTG C;  2A6E A;  4QIW L;  3H3V D;  5IP7 C;  1DCH A;  1SFO A;  3GTK A;  1O25 A;  3S1Q C;  1PJ6 A;  4A93 K;  2R92 A;  4BXX C;  2VUM K;  1HI9 A;  2YU9 C;  3HXA A;  3OPF A;  4M1X A;  5JVO A;  3AH5 A;  5IOR A;  4X6A C;  1R9T A;  4G7O A;  3L4J A;  4A3C C;  1XZP A;  4LK1 A;  1TWH A;  1O27 A;  1O2F B;  1SFO C;  4A3I K;  3GTK C;  3RZD K;  5JFE A;  3TFI A;  1K83 K;  2R92 C;  4LK0 A;  5IYB C;  3HOX K;  4KMU A;  5C4J C;  3S2D C;  1J6V A;  2PA8 D;  2PHC B;  2ZFZ A;  1I3Q A;  1GE9 A;  3S1N K;  1JOE A;  1WQF A;  3GSI A;  2A68 A;  1WOS A;  1R9T C;  1O26 A;  1USO A;  2B63 K;  4A3D K;  3GTP K;  1TWH C;  4G0V A;  4Y7N C;  2O5J A;  2FQO A;  1XXB A;  4C3H C;  3GTJ A;  4GTE A;  3S16 C;  3CQZ A;  1YX2 A;  1USM A;  3T01 A;  3GTQ A;  3S2H C;  1I3Q C;  3BUE A;  1AB4 A;  4XSZ A;  2NVY K;  1Y1W K;  2RGR A;  3M3Y K;  4YFK A;  3V4G A;  4A3L C;  2P5M A;  3H0G K;  2A6H A;  3GTJ C;  1BGW A;  3CQZ C;  1WCM A;  3LAP A;  4NOI A;  2JA5 K;  3GTQ C;  3WOD A;  5HL8 A;  2CW0 A;  4A3G C;  3HOY C;  4P9S A;  4C3J K;  4WJ4 A;  5IYD K;  1EK8 A;  1YNN A;  5FLM C;  3GEI A;  4O2D A;  3GTG K;  1YNJ A;  5IOQ A;  1WCM C;  5IP7 K;  4A3F C;  4GTD A;  3S1Q K;  3M4O C;  4A3K C;  1I6H C;  2YU9 K;  2O5I A;  3S17 C;  2NVQ C; 
#chains in the Genus database with same CATH homology
 4OIQ A;  4MQ9 A;  1ZYR A;  4A93 K;  4XLN A;  4C2M K;  4BXX C;  2VUM K;  2E2J K;  2YU9 C;  3HOV C;  4A3C K;  4QJV A;  4YG2 A;  5IYC K;  3S1M K;  5C4X K;  2NVT K;  3RZO K;  1SFO K;  3I4M K;  3GTK K;  4A93 C;  4XSX A;  2R7Z K;  4X6A C;  4Q5S A;  2WAQ L;  2VUM C;  4G7O A;  2E2J C;  4A3C C;  2R92 K;  5IYB K;  4LJZ A;  4OIP A;  4A3B K;  2BE5 A;  3GTO K;  4LK1 A;  5C4J K;  3S1M C;  3S2D K;  5C4X C;  4A3E K;  3EQL A;  3S1R K;  2NVX K;  4BBS C;  2NVT C;  3RZO C;  1SFO C;  4C3I K;  3I4M C;  2WB1 D;  4A3I K;  4Q4Z A;  1BDF A;  3GTK C;  3GTM K;  3RZD K;  2R7Z C;  3I4N C;  4BXX K;  4YFN A;  1K83 K;  2WB1 L;  2R92 C;  4LK0 A;  2PMZ L;  5IYB C;  3HOX K;  4A3B C;  1R9T K;  4KMU A;  1IW7 A;  5C4J C;  3S2D C;  4BY7 C;  4A3E C;  2PA8 D;  3S1R C;  2NVX C;  2JA6 K;  3S15 K;  1TWH K;  4A3I C;  2A69 A;  4YFX A;  4X6A K;  4Y7N K;  3GTM C;  3RZD C;  4KN7 A;  2PA8 L;  3S1N K;  1K83 C;  4G7Z A;  2A68 A;  3HOX C;  3HKZ D;  1R9T C;  2B63 K;  2WAQ D;  4QJV B;  4A3D K;  4BBS K;  4OIN A;  2JA6 C;  2Y0S D;  3GTP K;  3I4N K;  3S15 C;  1TWH C;  3HKZ L;  5TMF A;  1Y1W C;  4Y7N C;  3M3Y C;  2O5J A;  3S1N C;  1I3Q K;  2Y0S L;  3S16 C;  4BY7 K;  4OIR A;  2B63 C;  5M5W K;  4A3D C;  1TWF C;  3GTP C;  2PMZ D;  5FJ8 K;  1Y1V K;  3K7A K;  3S2H C;  1I3Q C;  2JA5 C;  3HOZ K;  1I50 K;  2JA8 K;  2E2I K;  4A3L K;  5TMC A;  5IP9 K;  3GTJ K;  4XSZ A;  2NVY K;  3HOW C;  1Y1W K;  3CQZ K;  3M3Y K;  4YFK A;  5D4D A;  1Y1V C;  3DXJ A;  3K7A C;  4A3J K;  4C3H K;  3GTQ K;  4GZY A;  3S16 K;  3HOZ C;  1I50 C;  5M5Y K;  2JA8 C;  2E2I C;  4XLP A;  3HOY K;  3S14 K;  4A3G K;  4A3L C;  3H0G K;  5IP9 C;  1TWF K;  2A6H A;  3GTJ C;  2NVY C;  4LLG A;  3CQZ C;  3S2H K;  1TWG C;  4A3J C;  4NOI A;  2JA5 K;  3GTL K;  1HQM A;  3GTQ C;  3WOD A;  4A3M K;  5FLM K;  5C44 K;  2CW0 A;  3S14 C;  4KN4 A;  3HOY C;  4A3G C;  1TWA C;  5M5X K;  3H0G C;  3HOW K;  4C3J K;  3HOU K;  4MEY A;  2R93 K;  4BBR K;  3GTL C;  2E2H K;  5IYD K;  1WCM K;  4JK1 A;  4A3F K;  3HOV K;  4A3M C;  1XPP A;  1YNN A;  5FLM C;  5C44 C;  3PO2 K;  3FKI K;  4Y52 K;  4ZH4 A;  1TWC K;  4AYB D;  3M4O K;  3HOU C;  2R93 C;  1TWG K;  4A3K K;  2PPB A;  3PO3 K;  1I6H K;  4BBR C;  4AYB L;  4BY1 K;  3GTG K;  1YNJ A;  5IYD C;  2E2H C;  5M3F K;  1WCM C;  5IP7 K;  5M3M K;  4A3F C;  2JA7 K;  3PO2 C;  1TWA K;  5C3E K;  3S17 K;  2NVQ K;  3FKI C;  1I6V A;  4Y52 C;  5IYC C;  3S1Q K;  1TWC C;  3M4O C;  4G7H A;  4QIW D;  4A3K C;  1SMY A;  3PO3 C;  1I6H C;  2YU9 K;  4MEX A;  4BY1 C;  2A6E A;  2JA7 C;  4QIW L;  2O5I A;  3GTG C;  5IP7 C;  3H3V D;  5C3E C;  3S17 C;  4OIO A;  2NVQ C;  3GTO C;  3S1Q C;  3H3V L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...