4A3MK

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid and soaked with ampcpp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3mK00
4OIOA 5C44K 5FJ8K 2E2IC 5TMCA 4BY1C 4OIRA 4A3IC 3S1RK 1TWAC 5M3MK 1K83K 3HOXC 1TWHC 4LK0A 5IYBK 3CQZK 3GTPK 1XPPA 2Y0SL 2JA5K 1YNJA 5C4JC 3GTKC 3HOWC 4LJZA 1I50K 2WB1L 3FKIK 3GTJC 4A3FK 5IP7C 4A3KC 2VUMC 3GTQC 3I4NK 3GTLC 1R9TC 1Y1VK 4A3LC 3S2HC 3H3VL 1I6HK 3S2HK 4YFNA 4XSZA 2A6EA 3M4OC 3PO3C 3S16K 1TWGK 3WODA 1TWFC 4OIPA 4QJVA 4QIWD 5FLMK 4C2MK 4A3EC 1TWHK 1WCMK 2PA8D 4Y7NK 1SMYA 3S17C 3HOVK 4X6AK 4A3JC 5C4JK 4BXXK 4BBSK 2NVXC 3DXJA 5IP7K 5IYCC 3S14C 3I4NC 2E2JC 5C3EC 4A3BC 4XLPA 3S1MC 2PA8L 4A3CC 1K83C 3HOZK 5D4DA 4A93K 1TWCC 3K7AK 4XSXA 3HOYC 4MEXA 4MQ9A 4A3EK 2A6HA 1WCMC 1I3QK 3HOUK 2NVQK 2O5JA 2R93C 2B63C 4QIWL 2E2HC 2PMZL 2JA6K 4AYBL 2E2JK 3S1NK 5IYDC 3S17K 4KN4A 3M3YK 4YFXA 1TWGC 5FLMC 4C3JK 4C3IK 4A3MC 3HOZC 1TWAK 2R7ZC 3S2DK 4ZH4A 1TWCK 4BXXC 2NVYC 4XLNA 4LK1A 2JA7C 5IYCK 3HOUC 4A3FC 2YU9C 2R92K 3HKZD 2B63K 4LLGA 4BY7K 4A3CK 1ZYRA 4BBRC 5M5YK 3S1NC 3S1RC 2O5IA 4A93C 3K7AC 5C44C 4BY1K 3HOYK 3S16C 1HQMA 2JA5C 3GTKK 3GTMC 1I3QC 2NVQC 3I4MK 3FKIC 2A69A 2VUMK 3RZDK 2A68A 5M5XK 3H0GK 5M3FK 2JA7K 3GTGC 3RZOK 5C4XC 1I50C 3GTJK 3M3YC 1Y1WK 1IW7A 3EQLA 1R9TK 2E2IK 2WAQL 3M4OK 5IP9C 2Y0SD 3GTOC 4A3GK 4Y52K 1YNNA 4A3JK 3GTMK 4AYBD 3S15K 1BDFA 4KN7A 4MEYA 3RZDC 4BY7C 5M5WK 3GTLK 5C3EK 1Y1VC 4BBRK 3PO2K 2JA8C 3S1MK 4Q5SA 1I6HC 1Y1WC 4A3BK 3PO3K 2PMZD 1SFOC 2NVTC 3GTOK 4A3DC 2BE5A 4A3IK 4Y52C 3H3VD 3HKZL 2WAQD 2R7ZK 3HOVC 3S2DC 4G7OA 4OIQA 2CW0A 5C4XK 3CQZC 5IYBC 2NVXK 2PPBA 3GTPC 3RZOC 3S1QK 4KMUA 4QJVB 2YU9K 2R93K 4OINA 5IP9K 2JA8K 1I6VA 4A3GC 5IYDK 1SFOK 3HOXK 2NVTK 4YFKA 3S15C 4A3MK 4GZYA 4A3DK 2NVYK 3HOWK 1TWFK 4NOIA 4G7ZA 4YG2A 3I4MC 2R92C 4G7HA 4A3KK 4Y7NC 5TMFA 3GTQK 3PO2C 2E2HK 2JA6C 4X6AC 3H0GC 3GTGK 3S1QC 4C3HK 4BBSC 4Q4ZA 4A3LK 4JK1A 3S14K 2WB1D
chains in the Genus database with same CATH superfamily
2Y3PA 3LPXA 5FJ8K 4KB2A 1TWHC 2JA5K 1YNJA 1XZPB 2WB1L 3GEHA 4A3KC 4GTEA 4GTLA 1O2BA 4GTBA 1USMA 4YFNA 3M4OC 3PO3C 3FKIA 1TWFC 4QJVA 1TWHK 2PA8D 5EGHA 4Y7NK 2JA7A 5C4JK 4BXXK 5IP7K 3S14C 2R7ZA 3IPJA 2PA8L 3A8KA 4A3CC 4A93K 4MEXA 4MQ9A 2B63A 2A6HA 2B63C 4QIWL 1IE0A 1TWGC 5FLMC 4A3MC 3HOZC 2R7ZC 1WOPA 4ZH4A 3CAGA 3QX3A 4LK1A 1WIHA 5IYCK 2R92K 2B63K 3GDZA 4PABA 3GTGA 1O27A 2JA5C 1I3QC 1ZXOA 3FKIC 3LAPA 5M5XK 4KMHA 3GTJK 1TWHA 3M3YC 1Y1WK 3M4OK 2Y0SD 2NVYA 5JVOA 1YNNA 3GSIA 3JSTA 5IOQA 4AYBD 2JA6A 1ZQ1C 1BDFA 4KMAA 1UV7A 2P5MA 5C3EK 2JA5A 4BBRK 4Q5SA 2ZUEA 3PO3K 1YX2A 1ZBSA 3AH5A 3S2DC 3CQZA 3GTPA 4KMUA 1JQWA 2R93K 4A3GC 3FOEA 4GTAA 5IYDK 4YFKA 3S15C 4GZYA 2NVYK 3HOWK 1DD5A 4YG2A 2R92C 3AQPA 4FM9A 5CHPA 4Y7NC 3PO2C 1Y1WA 3H0GC 3GTGK 3S1QC 3GEIA 4A3LK 1VGXA 4JK1A 2PHCB 2WB1D 5C44K 3GTOA 4A3IC 3S1RK 3HOXC 4KAWX 4LK0A 3L4KA 2NVXA 3GTKC 3HOWC 1BGWA 3GTJC 1L0WA 2VUMC 3OEPA 1TWFA 1PJ5A 4A3LC 1O24A 4PAAA 4XSZA 1XXAA 3S16K 3OPFA 1R9TA 1TWGK 5FLMK 4QIWD 4OIPA 4A3EC 4X6AK 1HI9A 3DXJA 5IYCC 2D6FC 1K83C 3G4CA 1TWCC 3HXAA 1WCMC 2W7VA 1TWGA 1JOEA 2E2HC 2PMZL 4AYBL 2GAGC 3S1NK 5IYDC 3M3YK 4O2DA 4DDQA 1TWCK 4FZBA 4XLNA 4KASA 2JA7C 3HOUC 4A3FC 2GSOA 3HKZD 3V4GA 4GT9A 4J3NA 4A3CK 1ZYRA 3ERED 4BY1K 2V6UA 1HQMA 1JVIA 3GTMC 3MMLB 3I4MK 2VUMK 5L46A 5M3FK 3T02A 1WOOA 1WQFA 2CFAB 1EQRA 3EQLA 3GTQA 2WAQL 3GTJA 3N3YA 3S0XA 3GTMK 1O29A 4KN7A 2KWAA 1F9NA 1O28A 2E2IA 4BY7C 3GTLK 1Y1VC 3PO2K 2ZUFA 3N0BA 1I6HC 2EBBA 3H0GA 1SFOC 2NVTC 3BUEA 1BJTA 4C45A 4Y52C 5IORA 4OIQA 2NVXK 4WILA 4QJVB 5IP9K 1WOSA 1J98A 1WSRA 3GIRA 1PJ7A 4A3DK 2E2HA 4A3MK 3T01A 1B4BA 4NOIA 4A3KK 2E2HK 4KB4A 3TTGA 4BBSC 4Q4ZA 1K83A 2XCQA 4GTDA 4OIOA 4BY1C 3AD8C 4OIRA 1TWAC 4AH6A 1K83K 5IYBK 3CQZK 3GTPK 4GFQA 5C4JC 3ADAC 4LJZA 1I50K 3FKIK 4A3FK 5IP7C 3I4NK 3GTMA 3H3VL 3S2HK 3SZYA 1O25A 2V6TA 3GTLA 1I3QA 3AD9C 1ISEA 1INNA 3NUHA 4A3JC 3N0CA 2XCOA 4BKWA 4KARA 4M1XA 3I4NC 2E2JC 5C3EC 4XLPA 1DCHA 1VJEA 1AB4A 1B4AA 5CJ9A 3HOZK 2V6SA 5D4DA 3FOFA 1IS1A 2O5JA 2NVQK 1SFOA 3AQOA 4WJ4A 2E2JK 1Y1VA 4C3JK 4C3IK 1J6WA 1X31C 2NVYC 3T00A 2YU9C 4BY7K 4LQYA 5IOTA 5M5YK 1BS2A 1I50A 2O5IA 3K7AC 5C44C 1F7VA 3HOYK 3S16C 3TFJA 2A69A 1J6VA 4GTCA 2A68A 4G0WA 2GAHC 3TFHA 4KATA 1R9TK 5IP9C 3GTOC 4A3JK 4G0VA 5TJ3A 4C2MC 4MEYA 5M5WK 1XZQB 1ZVUA 3Q3QA 1DCPA 1Y1WC 3VA7A 4A3BK 1XXBA 2PMZD 3GTOK 2BE5A 2GSUA 1XXCA 1YCLA 2XCRB 3H3VD 5IYBC 1WQHA 3CQZC 5C4XK 3GTPC 3RZOC 4KMDA 3S1QK 1EK8A 5JFEA 4OINA 1GE9A 2RH6A 3HOXK 1J6XA 1F7UA 2R93A 1TWFK 4G7ZA 3I4MC 1WCMA 2FQOA 3BP8C 3GTQK 4C3HK 4GTFA 3S14K 3AD7C 4LR2A 1WSVA 2E2IC 5TMCA 1PJ6A 2VUMA 5M3MK 4P5BA 1XPPA 2Y0SL 1TWAA 1EI6A 3LAJA 5IOSA 4WJ3M 4KC6A 3GTQC 3GTLC 1O26A 1R9TC 1Y1VK 1I6HK 4G0UA 2A6EA 1WORA 3WODA 3GEEA 4KDDA 4C2MK 1WCMK 2YU9A 1SMYA 3HOVK 4BBSK 2NVXC 4BLBA 4A3BC 3S1MC 1O2FB 1O2AA 3K7AK 4XSXA 3HOYC 4A3EK 3HOUK 2R92A 1I3QK 5E68A 2R93C 2RGRA 2JH3A 2JA6K 1TWCA 3S17K 3G4AA 4KN4A 4YFXA 1F93A 2CFAA 1TWAK 3S2DK 1WQGA 4BXXC 3L4JA 4LLGA 1VRQC 2ZFZA 4BBRC 3S1NC 3S1RC 1IQ0A 4A93C 1EFWA 3A8IA 3GTKK 1RU0A 2NVQC 1EH1A 1KQ4A 2GSNA 1DCOA 3RZDK 5HL8A 4KM9A 3H0GK 2JA7K 3GTGC 3GTKA 3RZOK 5C4XC 3A8JA 1I50C 1IBAA 2P8TA 3OREA 1IW7A 2E2IK 4A3GK 4Y52K 4RMFA 1XZPA 1VLOA 3S15K 3BP3A 1IL2A 1V5VA 4KM8A 3RZDC 4XCHA 1VH2A 3FHZA 2JA8C 3S1MK 5EGEA 4C3HC 4A3DC 1USOA 4A3IK 3HKZL 2WAQD 2R7ZK 3HOVC 4G7OA 4ILDA 2CW0A 2PPBA 1G51A 4BLAA 4LOWA 2YU9K 2JA8K 1I6VA 3SZZA 1XZQA 1SFOK 2NVTK 2FQTA 4C3IC 4C3JC 4G7HA 1C0AA 4X6AC 5TMFA 4P9SA 2JA6C 4P5AA 3TFIA 3S17C 3S2HC
chains in the Genus database with same CATH topology
4OIOA 5C44K 5FJ8K 2E2IC 5TMCA 4BY1C 4OIRA 4A3IC 3S1RK 1TWAC 5M3MK 1K83K 3HOXC 1TWHC 4LK0A 5IYBK 3CQZK 3GTPK 1XPPA 2Y0SL 2JA5K 1YNJA 5C4JC 3GTKC 3HOWC 4LJZA 1I50K 2WB1L 3FKIK 3GTJC 4A3FK 5IP7C 4A3KC 2VUMC 3GTQC 3I4NK 3GTLC 1R9TC 1Y1VK 4A3LC 3S2HC 3H3VL 1I6HK 3S2HK 4YFNA 4XSZA 2A6EA 3M4OC 3PO3C 3S16K 1TWGK 3WODA 1TWFC 4OIPA 4QJVA 4QIWD 5FLMK 4C2MK 4A3EC 1TWHK 1WCMK 2PA8D 4Y7NK 1SMYA 3S17C 3HOVK 4X6AK 4A3JC 5C4JK 4BXXK 4BBSK 2NVXC 3DXJA 5IP7K 5IYCC 3S14C 3I4NC 2E2JC 5C3EC 4A3BC 4XLPA 3S1MC 2PA8L 4A3CC 1K83C 3HOZK 5D4DA 4A93K 1TWCC 3K7AK 4XSXA 3HOYC 4MEXA 4MQ9A 4A3EK 2A6HA 1WCMC 1I3QK 3HOUK 2NVQK 2O5JA 2R93C 2B63C 4QIWL 2E2HC 2PMZL 2JA6K 4AYBL 2E2JK 3S1NK 5IYDC 3S17K 4KN4A 3M3YK 4YFXA 1TWGC 5FLMC 4C3JK 4C3IK 4A3MC 3HOZC 1TWAK 2R7ZC 3S2DK 4ZH4A 1TWCK 4BXXC 2NVYC 4XLNA 4LK1A 2JA7C 5IYCK 3HOUC 4A3FC 2YU9C 2R92K 3HKZD 2B63K 4LLGA 4BY7K 4A3CK 1ZYRA 4BBRC 5M5YK 3S1NC 3S1RC 2O5IA 4A93C 3K7AC 5C44C 4BY1K 3HOYK 3S16C 1HQMA 2JA5C 3GTKK 3GTMC 1I3QC 2NVQC 3I4MK 3FKIC 2A69A 2VUMK 3RZDK 2A68A 5M5XK 3H0GK 5M3FK 2JA7K 3GTGC 3RZOK 5C4XC 1I50C 3GTJK 3M3YC 1Y1WK 1IW7A 3EQLA 1R9TK 2E2IK 2WAQL 3M4OK 5IP9C 2Y0SD 3GTOC 4A3GK 4Y52K 1YNNA 4A3JK 3GTMK 4AYBD 3S15K 1BDFA 4KN7A 4MEYA 3RZDC 4BY7C 5M5WK 3GTLK 5C3EK 1Y1VC 4BBRK 3PO2K 2JA8C 3S1MK 4Q5SA 1I6HC 1Y1WC 4A3BK 3PO3K 2PMZD 1SFOC 2NVTC 3GTOK 4A3DC 2BE5A 4A3IK 4Y52C 3H3VD 3HKZL 2WAQD 2R7ZK 3HOVC 3S2DC 4G7OA 4OIQA 2CW0A 5C4XK 3CQZC 5IYBC 2NVXK 2PPBA 3GTPC 3RZOC 3S1QK 4KMUA 4QJVB 2YU9K 2R93K 4OINA 5IP9K 2JA8K 1I6VA 4A3GC 5IYDK 1SFOK 3HOXK 2NVTK 4YFKA 3S15C 4A3MK 4GZYA 4A3DK 2NVYK 3HOWK 1TWFK 4NOIA 4G7ZA 4YG2A 3I4MC 2R92C 4G7HA 4A3KK 4Y7NC 5TMFA 3GTQK 3PO2C 2E2HK 2JA6C 4X6AC 3H0GC 3GTGK 3S1QC 4C3HK 4BBSC 4Q4ZA 4A3LK 4JK1A 3S14K 2WB1D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIO A;  5C44 K;  5FJ8 K;  2E2I C;  5TMC A;  4BY1 C;  4OIR A;  4A3I C;  3S1R K;  1TWA C;  5M3M K;  1K83 K;  3HOX C;  1TWH C;  4LK0 A;  5IYB K;  3CQZ K;  3GTP K;  1XPP A;  2Y0S L;  2JA5 K;  1YNJ A;  5C4J C;  3GTK C;  3HOW C;  4LJZ A;  1I50 K;  2WB1 L;  3FKI K;  3GTJ C;  4A3F K;  5IP7 C;  4A3K C;  2VUM C;  3GTQ C;  3I4N K;  3GTL C;  1R9T C;  1Y1V K;  4A3L C;  3S2H C;  3H3V L;  1I6H K;  3S2H K;  4YFN A;  4XSZ A;  2A6E A;  3M4O C;  3PO3 C;  3S16 K;  1TWG K;  3WOD A;  1TWF C;  4OIP A;  4QJV A;  4QIW D;  5FLM K;  4C2M K;  4A3E C;  1TWH K;  1WCM K;  2PA8 D;  4Y7N K;  1SMY A;  3S17 C;  3HOV K;  4X6A K;  4A3J C;  5C4J K;  4BXX K;  4BBS K;  2NVX C;  3DXJ A;  5IP7 K;  5IYC C;  3S14 C;  3I4N C;  2E2J C;  5C3E C;  4A3B C;  4XLP A;  3S1M C;  2PA8 L;  4A3C C;  1K83 C;  3HOZ K;  5D4D A;  4A93 K;  1TWC C;  3K7A K;  4XSX A;  3HOY C;  4MEX A;  4MQ9 A;  4A3E K;  2A6H A;  1WCM C;  1I3Q K;  3HOU K;  2NVQ K;  2O5J A;  2R93 C;  2B63 C;  4QIW L;  2E2H C;  2PMZ L;  2JA6 K;  4AYB L;  2E2J K;  3S1N K;  5IYD C;  3S17 K;  4KN4 A;  3M3Y K;  4YFX A;  1TWG C;  5FLM C;  4C3J K;  4C3I K;  4A3M C;  3HOZ C;  1TWA K;  2R7Z C;  3S2D K;  4ZH4 A;  1TWC K;  4BXX C;  2NVY C;  4XLN A;  4LK1 A;  2JA7 C;  5IYC K;  3HOU C;  4A3F C;  2YU9 C;  2R92 K;  3HKZ D;  2B63 K;  4LLG A;  4BY7 K;  4A3C K;  1ZYR A;  4BBR C;  5M5Y K;  3S1N C;  3S1R C;  2O5I A;  4A93 C;  3K7A C;  5C44 C;  4BY1 K;  3HOY K;  3S16 C;  1HQM A;  2JA5 C;  3GTK K;  3GTM C;  1I3Q C;  2NVQ C;  3I4M K;  3FKI C;  2A69 A;  2VUM K;  3RZD K;  2A68 A;  5M5X K;  3H0G K;  5M3F K;  2JA7 K;  3GTG C;  3RZO K;  5C4X C;  1I50 C;  3GTJ K;  3M3Y C;  1Y1W K;  1IW7 A;  3EQL A;  1R9T K;  2E2I K;  2WAQ L;  3M4O K;  5IP9 C;  2Y0S D;  3GTO C;  4A3G K;  4Y52 K;  1YNN A;  4A3J K;  3GTM K;  4AYB D;  3S15 K;  1BDF A;  4KN7 A;  4MEY A;  3RZD C;  4BY7 C;  5M5W K;  3GTL K;  5C3E K;  1Y1V C;  4BBR K;  3PO2 K;  2JA8 C;  3S1M K;  4Q5S A;  1I6H C;  1Y1W C;  4A3B K;  3PO3 K;  2PMZ D;  1SFO C;  2NVT C;  3GTO K;  4A3D C;  2BE5 A;  4A3I K;  4Y52 C;  3H3V D;  3HKZ L;  2WAQ D;  2R7Z K;  3HOV C;  3S2D C;  4G7O A;  4OIQ A;  2CW0 A;  5C4X K;  3CQZ C;  5IYB C;  2NVX K;  2PPB A;  3GTP C;  3RZO C;  3S1Q K;  4KMU A;  4QJV B;  2YU9 K;  2R93 K;  4OIN A;  5IP9 K;  2JA8 K;  1I6V A;  4A3G C;  5IYD K;  1SFO K;  3HOX K;  2NVT K;  4YFK A;  3S15 C;  4A3M K;  4GZY A;  4A3D K;  2NVY K;  3HOW K;  1TWF K;  4NOI A;  4G7Z A;  4YG2 A;  3I4M C;  2R92 C;  4G7H A;  4A3K K;  4Y7N C;  5TMF A;  3GTQ K;  3PO2 C;  2E2H K;  2JA6 C;  4X6A C;  3H0G C;  3GTG K;  3S1Q C;  4C3H K;  4BBS C;  4Q4Z A;  4A3L K;  4JK1 A;  3S14 K;  2WB1 D; 
#chains in the Genus database with same CATH topology
 2Y3P A;  3LPX A;  5FJ8 K;  4KB2 A;  1TWH C;  2JA5 K;  1YNJ A;  1XZP B;  2WB1 L;  3GEH A;  4A3K C;  4GTE A;  4GTL A;  1O2B A;  4GTB A;  1USM A;  4YFN A;  3M4O C;  3PO3 C;  3FKI A;  1TWF C;  4QJV A;  1TWH K;  2PA8 D;  5EGH A;  4Y7N K;  2JA7 A;  5C4J K;  4BXX K;  5IP7 K;  3S14 C;  2R7Z A;  3IPJ A;  2PA8 L;  3A8K A;  4A3C C;  4A93 K;  4MEX A;  4MQ9 A;  2B63 A;  2A6H A;  2B63 C;  4QIW L;  1IE0 A;  1TWG C;  5FLM C;  4A3M C;  3HOZ C;  2R7Z C;  1WOP A;  4ZH4 A;  3CAG A;  3QX3 A;  4LK1 A;  1WIH A;  5IYC K;  2R92 K;  2B63 K;  3GDZ A;  4PAB A;  3GTG A;  1O27 A;  2JA5 C;  1I3Q C;  1ZXO A;  3FKI C;  3LAP A;  5M5X K;  4KMH A;  3GTJ K;  1TWH A;  3M3Y C;  1Y1W K;  3M4O K;  2Y0S D;  2NVY A;  5JVO A;  1YNN A;  3GSI A;  3JST A;  5IOQ A;  4AYB D;  2JA6 A;  1ZQ1 C;  1BDF A;  4KMA A;  1UV7 A;  2P5M A;  5C3E K;  2JA5 A;  4BBR K;  4Q5S A;  2ZUE A;  3PO3 K;  1YX2 A;  1ZBS A;  3AH5 A;  3S2D C;  3CQZ A;  3GTP A;  4KMU A;  1JQW A;  2R93 K;  4A3G C;  3FOE A;  4GTA A;  5IYD K;  4YFK A;  3S15 C;  4GZY A;  2NVY K;  3HOW K;  1DD5 A;  4YG2 A;  2R92 C;  3AQP A;  4FM9 A;  5CHP A;  4Y7N C;  3PO2 C;  1Y1W A;  3H0G C;  3GTG K;  3S1Q C;  3GEI A;  4A3L K;  1VGX A;  4JK1 A;  2PHC B;  2WB1 D;  5C44 K;  3GTO A;  4A3I C;  3S1R K;  3HOX C;  4KAW X;  4LK0 A;  3L4K A;  2NVX A;  3GTK C;  3HOW C;  1BGW A;  3GTJ C;  1L0W A;  2VUM C;  3OEP A;  1TWF A;  1PJ5 A;  4A3L C;  1O24 A;  4PAA A;  4XSZ A;  1XXA A;  3S16 K;  3OPF A;  1R9T A;  1TWG K;  5FLM K;  4QIW D;  4OIP A;  4A3E C;  4X6A K;  1HI9 A;  3DXJ A;  5IYC C;  2D6F C;  1K83 C;  3G4C A;  1TWC C;  3HXA A;  1WCM C;  2W7V A;  1TWG A;  1JOE A;  2E2H C;  2PMZ L;  4AYB L;  2GAG C;  3S1N K;  5IYD C;  3M3Y K;  4O2D A;  4DDQ A;  1TWC K;  4FZB A;  4XLN A;  4KAS A;  2JA7 C;  3HOU C;  4A3F C;  2GSO A;  3HKZ D;  3V4G A;  4GT9 A;  4J3N A;  4A3C K;  1ZYR A;  3ERE D;  4BY1 K;  2V6U A;  1HQM A;  1JVI A;  3GTM C;  3MML B;  3I4M K;  2VUM K;  5L46 A;  5M3F K;  3T02 A;  1WOO A;  1WQF A;  2CFA B;  1EQR A;  3EQL A;  3GTQ A;  2WAQ L;  3GTJ A;  3N3Y A;  3S0X A;  3GTM K;  1O29 A;  4KN7 A;  2KWA A;  1F9N A;  1O28 A;  2E2I A;  4BY7 C;  3GTL K;  1Y1V C;  3PO2 K;  2ZUF A;  3N0B A;  1I6H C;  2EBB A;  3H0G A;  1SFO C;  2NVT C;  3BUE A;  1BJT A;  4C45 A;  4Y52 C;  5IOR A;  4OIQ A;  2NVX K;  4WIL A;  4QJV B;  5IP9 K;  1WOS A;  1J98 A;  1WSR A;  3GIR A;  1PJ7 A;  4A3D K;  2E2H A;  4A3M K;  3T01 A;  1B4B A;  4NOI A;  4A3K K;  2E2H K;  4KB4 A;  3TTG A;  4BBS C;  4Q4Z A;  1K83 A;  2XCQ A;  4GTD A;  4OIO A;  4BY1 C;  3AD8 C;  4OIR A;  1TWA C;  4AH6 A;  1K83 K;  5IYB K;  3CQZ K;  3GTP K;  4GFQ A;  5C4J C;  3ADA C;  4LJZ A;  1I50 K;  3FKI K;  4A3F K;  5IP7 C;  3I4N K;  3GTM A;  3H3V L;  3S2H K;  3SZY A;  1O25 A;  2V6T A;  3GTL A;  1I3Q A;  3AD9 C;  1ISE A;  1INN A;  3NUH A;  4A3J C;  3N0C A;  2XCO A;  4BKW A;  4KAR A;  4M1X A;  3I4N C;  2E2J C;  5C3E C;  4XLP A;  1DCH A;  1VJE A;  1AB4 A;  1B4A A;  5CJ9 A;  3HOZ K;  2V6S A;  5D4D A;  3FOF A;  1IS1 A;  2O5J A;  2NVQ K;  1SFO A;  3AQO A;  4WJ4 A;  2E2J K;  1Y1V A;  4C3J K;  4C3I K;  1J6W A;  1X31 C;  2NVY C;  3T00 A;  2YU9 C;  4BY7 K;  4LQY A;  5IOT A;  5M5Y K;  1BS2 A;  1I50 A;  2O5I A;  3K7A C;  5C44 C;  1F7V A;  3HOY K;  3S16 C;  3TFJ A;  2A69 A;  1J6V A;  4GTC A;  2A68 A;  4G0W A;  2GAH C;  3TFH A;  4KAT A;  1R9T K;  5IP9 C;  3GTO C;  4A3J K;  4G0V A;  5TJ3 A;  4C2M C;  4MEY A;  5M5W K;  1XZQ B;  1ZVU A;  3Q3Q A;  1DCP A;  1Y1W C;  3VA7 A;  4A3B K;  1XXB A;  2PMZ D;  3GTO K;  2BE5 A;  2GSU A;  1XXC A;  1YCL A;  2XCR B;  3H3V D;  5IYB C;  1WQH A;  3CQZ C;  5C4X K;  3GTP C;  3RZO C;  4KMD A;  3S1Q K;  1EK8 A;  5JFE A;  4OIN A;  1GE9 A;  2RH6 A;  3HOX K;  1J6X A;  1F7U A;  2R93 A;  1TWF K;  4G7Z A;  3I4M C;  1WCM A;  2FQO A;  3BP8 C;  3GTQ K;  4C3H K;  4GTF A;  3S14 K;  3AD7 C;  4LR2 A;  1WSV A;  2E2I C;  5TMC A;  1PJ6 A;  2VUM A;  5M3M K;  4P5B A;  1XPP A;  2Y0S L;  1TWA A;  1EI6 A;  3LAJ A;  5IOS A;  4WJ3 M;  4KC6 A;  3GTQ C;  3GTL C;  1O26 A;  1R9T C;  1Y1V K;  1I6H K;  4G0U A;  2A6E A;  1WOR A;  3WOD A;  3GEE A;  4KDD A;  4C2M K;  1WCM K;  2YU9 A;  1SMY A;  3HOV K;  4BBS K;  2NVX C;  4BLB A;  4A3B C;  3S1M C;  1O2F B;  1O2A A;  3K7A K;  4XSX A;  3HOY C;  4A3E K;  3HOU K;  2R92 A;  1I3Q K;  5E68 A;  2R93 C;  2RGR A;  2JH3 A;  2JA6 K;  1TWC A;  3S17 K;  3G4A A;  4KN4 A;  4YFX A;  1F93 A;  2CFA A;  1TWA K;  3S2D K;  1WQG A;  4BXX C;  3L4J A;  4LLG A;  1VRQ C;  2ZFZ A;  4BBR C;  3S1N C;  3S1R C;  1IQ0 A;  4A93 C;  1EFW A;  3A8I A;  3GTK K;  1RU0 A;  2NVQ C;  1EH1 A;  1KQ4 A;  2GSN A;  1DCO A;  3RZD K;  5HL8 A;  4KM9 A;  3H0G K;  2JA7 K;  3GTG C;  3GTK A;  3RZO K;  5C4X C;  3A8J A;  1I50 C;  1IBA A;  2P8T A;  3ORE A;  1IW7 A;  2E2I K;  4A3G K;  4Y52 K;  4RMF A;  1XZP A;  1VLO A;  3S15 K;  3BP3 A;  1IL2 A;  1V5V A;  4KM8 A;  3RZD C;  4XCH A;  1VH2 A;  3FHZ A;  2JA8 C;  3S1M K;  5EGE A;  4C3H C;  4A3D C;  1USO A;  4A3I K;  3HKZ L;  2WAQ D;  2R7Z K;  3HOV C;  4G7O A;  4ILD A;  2CW0 A;  2PPB A;  1G51 A;  4BLA A;  4LOW A;  2YU9 K;  2JA8 K;  1I6V A;  3SZZ A;  1XZQ A;  1SFO K;  2NVT K;  2FQT A;  4C3I C;  4C3J C;  4G7H A;  1C0A A;  4X6A C;  5TMF A;  4P9S A;  2JA6 C;  4P5A A;  3TFI A;  3S17 C;  3S2H C; 
#chains in the Genus database with same CATH homology
 4OIO A;  5C44 K;  5FJ8 K;  2E2I C;  5TMC A;  4BY1 C;  4OIR A;  4A3I C;  3S1R K;  1TWA C;  5M3M K;  1K83 K;  3HOX C;  1TWH C;  4LK0 A;  5IYB K;  3CQZ K;  3GTP K;  1XPP A;  2Y0S L;  2JA5 K;  1YNJ A;  5C4J C;  3GTK C;  3HOW C;  4LJZ A;  1I50 K;  2WB1 L;  3FKI K;  3GTJ C;  4A3F K;  5IP7 C;  4A3K C;  2VUM C;  3GTQ C;  3I4N K;  3GTL C;  1R9T C;  1Y1V K;  4A3L C;  3S2H C;  3H3V L;  1I6H K;  3S2H K;  4YFN A;  4XSZ A;  2A6E A;  3M4O C;  3PO3 C;  3S16 K;  1TWG K;  3WOD A;  1TWF C;  4OIP A;  4QJV A;  4QIW D;  5FLM K;  4C2M K;  4A3E C;  1TWH K;  1WCM K;  2PA8 D;  4Y7N K;  1SMY A;  3S17 C;  3HOV K;  4X6A K;  4A3J C;  5C4J K;  4BXX K;  4BBS K;  2NVX C;  3DXJ A;  5IP7 K;  5IYC C;  3S14 C;  3I4N C;  2E2J C;  5C3E C;  4A3B C;  4XLP A;  3S1M C;  2PA8 L;  4A3C C;  1K83 C;  3HOZ K;  5D4D A;  4A93 K;  1TWC C;  3K7A K;  4XSX A;  3HOY C;  4MEX A;  4MQ9 A;  4A3E K;  2A6H A;  1WCM C;  1I3Q K;  3HOU K;  2NVQ K;  2O5J A;  2R93 C;  2B63 C;  4QIW L;  2E2H C;  2PMZ L;  2JA6 K;  4AYB L;  2E2J K;  3S1N K;  5IYD C;  3S17 K;  4KN4 A;  3M3Y K;  4YFX A;  1TWG C;  5FLM C;  4C3J K;  4C3I K;  4A3M C;  3HOZ C;  1TWA K;  2R7Z C;  3S2D K;  4ZH4 A;  1TWC K;  4BXX C;  2NVY C;  4XLN A;  4LK1 A;  2JA7 C;  5IYC K;  3HOU C;  4A3F C;  2YU9 C;  2R92 K;  3HKZ D;  2B63 K;  4LLG A;  4BY7 K;  4A3C K;  1ZYR A;  4BBR C;  5M5Y K;  3S1N C;  3S1R C;  2O5I A;  4A93 C;  3K7A C;  5C44 C;  4BY1 K;  3HOY K;  3S16 C;  1HQM A;  2JA5 C;  3GTK K;  3GTM C;  1I3Q C;  2NVQ C;  3I4M K;  3FKI C;  2A69 A;  2VUM K;  3RZD K;  2A68 A;  5M5X K;  3H0G K;  5M3F K;  2JA7 K;  3GTG C;  3RZO K;  5C4X C;  1I50 C;  3GTJ K;  3M3Y C;  1Y1W K;  1IW7 A;  3EQL A;  1R9T K;  2E2I K;  2WAQ L;  3M4O K;  5IP9 C;  2Y0S D;  3GTO C;  4A3G K;  4Y52 K;  1YNN A;  4A3J K;  3GTM K;  4AYB D;  3S15 K;  1BDF A;  4KN7 A;  4MEY A;  3RZD C;  4BY7 C;  5M5W K;  3GTL K;  5C3E K;  1Y1V C;  4BBR K;  3PO2 K;  2JA8 C;  3S1M K;  4Q5S A;  1I6H C;  1Y1W C;  4A3B K;  3PO3 K;  2PMZ D;  1SFO C;  2NVT C;  3GTO K;  4A3D C;  2BE5 A;  4A3I K;  4Y52 C;  3H3V D;  3HKZ L;  2WAQ D;  2R7Z K;  3HOV C;  3S2D C;  4G7O A;  4OIQ A;  2CW0 A;  5C4X K;  3CQZ C;  5IYB C;  2NVX K;  2PPB A;  3GTP C;  3RZO C;  3S1Q K;  4KMU A;  4QJV B;  2YU9 K;  2R93 K;  4OIN A;  5IP9 K;  2JA8 K;  1I6V A;  4A3G C;  5IYD K;  1SFO K;  3HOX K;  2NVT K;  4YFK A;  3S15 C;  4A3M K;  4GZY A;  4A3D K;  2NVY K;  3HOW K;  1TWF K;  4NOI A;  4G7Z A;  4YG2 A;  3I4M C;  2R92 C;  4G7H A;  4A3K K;  4Y7N C;  5TMF A;  3GTQ K;  3PO2 C;  2E2H K;  2JA6 C;  4X6A C;  3H0G C;  3GTG K;  3S1Q C;  4C3H K;  4BBS C;  4Q4Z A;  4A3L K;  4JK1 A;  3S14 K;  2WB1 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...