4A3SA

Crystal structure of pfk from bacillus subtilis
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
319
structure length
319
Chain Sequence
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYAGLISGKIEKLELGSVGDIIHRGGTKLYTARCPEFKTVEGREKGIANLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCVGVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWAGLAGGAESILIPEADYDMHEIIARLKRGHERGKKHSIIIVAEGVGSGVEFGKRIEEETNLETRVSVLGHIQRGGSPSAADRVLASRLGAYAVELLLEGKGGRCVGIQNNKLVDHDIIEILETKHTVEQNMYQLSKELSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-PHOSPHOFRUCTOKINASE
publication title Dissection of the Network of Interactions that Links RNA Processing with Glycolysis in the Bacillus Subtilis Degradosome.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 110
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature ec 2.7.1.11: 6-phosphofructokinase.
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4a3sA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4a3sA02
1PFKA 4LJLA 4A3SA 3EHDA 3QUAA 3O8NA 2Q4DA 4I4IA 4MCJA 4U1RA 1S3FA 1S2IA 3K2QA 4I36A 3O8LA 4NPAA 2PMBA 3O8OA 3PFKA 4P5EA 3GH1A 3SBXA 2F62A 2Q4OA 1S2DA 4FYHA 2KHZA 4PFKA 3IMKA 1MTOA 4FYKA 4I7EA 2A33A 1WEHA 2F2TA 2KLHA 4OHBA 1S2GA 1RCUA 5AJTA 4KXLA 3OPYB 1ZXXA 1F8XA 1WEKA 1S2LA 2F48A 3UQZA 4LJRA 3MAJA 1YDHA 4JELA 3HNOA 4FYIA 4JEMA 5ITSA 3U39A 4KXNA 1KZHA 4RH3A 4HX9A 4WL0A 2A0KA 1T35A 4P5DA 2F67A 4MEJA 2IZ5A 2IZ7A 2HIGA 2NX2A 2IZ6A 3F5MA 3BQ9A 5AJUA 3O8OB 4OHRA 4JENA 3OPYA 1F8YA 4LJKA 2PFKA 6PFKA 4KXMA 2F64A
chains in the Genus database with same CATH superfamily
3B5EA 1VE9A 1Q0TA 5IJZA 4ZOLF 4QNMA 3ZZNA 3EJ6A 3D7RA 2A5LA 1DJOA 2H1WA 2WC1A 3PX3A 5LC1A 1QIJA 1NQAO 2IV7A 1O1YA 3NATA 4R9RA 5LUBA 4F84A 3HR4A 5I7EA 4PO8A 1H4SA 2RMKA 2DCUA 2NXNA 4WCDA 5K20A 1WXFA 4KNWA 1QGAA 4E15A 1VJRA 1ZIXA 4INJA 5IC4A 2R8ZA 4PG4A 4LJ7A 4D25A 4N03A 5EP3A 1QFSA 4DLYA 4DB2A 2QP9X 5AP9A 2AN5A 3E9RA 5AK6A 2O6HA 2F6RA 5AICA 1N57A 1T3HA 4ENTA 2REQA 3EWAA 1XFAA 2C04A 1H3EA 2CMDA 1GHTA 3IEKA 2C3PA 2FE4A 1ZIYA 2XUHA 3L7DA 3L49A 3MRVA 4LOHA 1K6IA 3MBKA 4Y2XA 5F3WB 1KMIY 4MYSA 1FSFA 1T1IA 2I3ZA 1ICEA 3D8TA 3EQZA 4MS4A 5AXAA 2VP0A 4MW5A 2N47A 1ZUNA 5DYWA 2QTCA 3PPIA 2AFHB 3W34A 3U60B 4FOPA 3THXB 4R9UC 3RVPA 3N70A 4EELA 2B25A 3PD1A 3VHXA 3B9QA 4B6QA 1T9GS 1ZK4A 1JEYA 4A8JC 5LN1A 4N1AA 1HZZC 4G4JA 2O2GA 3ZDXB 2ZJ5A 3GJSA 1V45E 3G2KA 2X58A 3MGCA 4M9UA 4PHGA 3CFYA 4XEUA 4ALIA 5KC9A 4DDWA 4PHTA 3UXHA 3VPBA 3HB7A 1DUIA 3F9CA 5AJVB 1LLFA 3AKZA 3EQ8A 1PZXA 3B12A 3F1LA 3UV7A 2OO5C 1BHJA 2CD7A 3BD6A 2C5FA 3AJRA 3AFHA 3PCXA 1V7PC 3MK31 2A58A 3EBPA 4YP5A 2A86A 5TGTA 3RVOA 1Q1AA 2ZJOA 4OQDA 3SEZA 2H31A 4ITRC 4W7SA 4TKVA 1QTNA 2FP4A 4QQ8A 3W90A 4LF8B 1K3FA 4MCHA 2W2PA 5BWNA 1AS2A 2D62A 1X1AA 2WYUA 2FJUA 1E7WA 2PO5A 1RC0A 4GDMA 4FGWA 2FMFA 4R31A 3IPAA 1AVTA 2DSNA 3KSRA 1B6TA 2I4MA 4G09A 3DD1A 3KUDA 3CVVA 4I99A 3WNVA 3HBMA 5MN6A 4DV6B 2Q2OA 1W0CA 4I19A 3KKQA 3F71A 2FK7A 1M34A 3WWEA 2HMWA 2I9PA 2HMTA 3FOAA 3N7UA 4EITA 4ZCIA 5L45A 1G7TA 2RGYA 2G7ZA 1ES9A 2WU3A 1MU0A 4MQ5A 4MDYA 1B1AA 1FFDA 4UNQA 3FFTA 3S8EA 3IA7A 3F4KA 5CM9C 5FORA 2J0QA 4QEZA 1CPYA 1KI6A 1T9HA 4GXNA 5E2BA 2BIFA 1RTTA 2JAUA 1C0LA 1X7YB 4COOA 2X7XA 2VDPB 3LLCA 2NO9A 2RCNA 4HY3A 2FMIA 1XN4A 4M9SA 5G0TA 1Y3CE 1CR1A 3HADA 3USZA 1FZTA 2YY7A 2J0UA 4OQMA 3UMVA 3WRWA 4RTLA 3DV2A 1JKIA 2REQB 4KQIA 3DM9B 3NHYA 4W5NA 3HSKA 1E5DA 1GPLA 4WY5A 2GF0A 5CK5A 3R0VA 4NABA 3DZGA 4MV4A 1K3TA 2WABA 4AJNA 1VRWA 4MS4B 3EEQA 3AM5A 3EW7A 1KVQA 5C7IO 1A9YA 1WB4A 1DJNA 2Q46A 4BFCA 3QLUA 4YP7A 1JEEA 3VHXB 4DLZA 1G6HA 2GKSA 2BGUA 3IP1A 1H8HD 3Q15C 1E18A 2XUAA 3ZIAA 2ZVQX 2WM9B 1J09A 3KSUA 1EUCA 2W0MA 4EVSA 4NOJA 2D0OB 4LZAA 5AW9A 2WDPA 3UAZA 2CJWA 1MX9A 3IAAA 1ZC4A 2AOTA 2GR9A 2CD9A 4JASB 2IP2A 2DHDA 1U5CA 3FDFA 1Z12A 1CY7A 1C41A 2GA9A 1DHRA 3A1EA 1QCDA 3TS1A 2VPXA 3B9RA 4LBYA 1HOXA 2BT4A 1TCBA 4MUJA 4Y2HA 5DTRA 1T15A 3CZMA 4E33A 2Y1KA 2HMAA 5DOVA 5IT4A 4CLRA 3JR3A 2W6CX 4BB6A 4E12A 1EHYA 2DGDA 3WB0A 3FGNA 4L28A 1U9JA 1ZRHA 2IGBA 1TJNA 2BI4A 2HU5A 3L0OA 4I50B 1KRHA 1XQVA 1YSCA 2ZIGA 1TZBA 3CSDA 4UXIA 2C0PA 3PUKA 3UJAA 4CCWA 2FP4B 1JR6A 3LQQA 4CLDA 4DV4B 2X5OA 1C9EA 5CA0A 1MJFA 2P2GA 3A9RA 3H4TA 2BISA 2UUCB 3W6NA 2G6BA 3WHLA 3T5BA 1AZTA 1SIOA 2PHZA 1Y3IA 4O4IA 5D5QA 4FONA 1N1EA 5BQFA 2EEZA 4KVGA 2JAOA 5B1SA 1QX4A 1SCUA 3FYHA 4IIFA 3R5SA 4E1AA 5DULA 5C37A 2P0YA 1V3QE 1NJ6A 3ZW8A 1W1UA 5EC8A 1SR8A 1W6UA 1PAUA 1XRLA 1UK9A 1FUUA 3GNLA 4V39A 3UAYA 1CR0A 4J0JA 5JARA 3VYVA 4Y9DA 3FWYA 1HEYA 1SU8A 3IBSA 2EU8A 4G0NA 6LDHA 3GUVA 2GRAA 2XMGA 3JYLA 1X3SA 4CI0B 2OLJA 1N8KA 4FHDA 1EXDA 3K1AB 4CPDA 1A9SA 1JHPA 3M2PA 1Q15A 4DVJA 5A4MS 1RWKA 3HZZA 3AEXA 2FSPA 3LM8A 3NOQA 1D1PA 3X1MA 1PK7A 4HADA 2J0UB 3TIIA 1WQ1R 1S3SA 1X6VA 2I2XB 1JEOA 4Y6OA 4YEDA 1SO8A 3LX6A 3M6VA 5C1OA 4AQYB 1TQ8A 5KTPA 4PNHA 2NYVA 4ZI5A 5DP1A 5FFFA 3CX8A 2FQXA 1A95A 1E7SA 1JG4A 4GPIB 1MXHA 2ZRKA 4UVEA 3MJDA 5CUQA 2G1AA 4FN5A 1GPNA 2XGSA 1PD1A 1QO0D 1LNQA 2BM0A 1IHYA 1POXA 4DMHA 2QORA 3DLIA 3GRZA 3G0CA 1U98A 4IIEA 4PLGA 2O8BA 1SUAA 5THXA 3WGHA 4DSAA 1KZ9A 4EG1A 1EP2B 3PZBA 3H6HA 3H8JA 2EZUA 2VHTA 4TV8A 5H0IA 4EBFA 3TPCA 4MP8A 1GSOA 5D5PA 4CU5A 4DBVO 1ZD3A 4EM6A 3NUQA 4N7RA 3R7WA 2YJGA 5IJ0A 2ECQA 5KPDA 3IIMA 5CEJA 1R4MA 4ER3A 5KTKA 1JLMA 5H9WA 5EFZA 2RAUA 4CLRB 1PSDA 2PKXA 4GUDA 5CXQA 5EERA 2GLTA 5F76A 4RDCA 4ZVPA 4RFSB 3ZI0A 3AR9A 1Y5RA 4O5OA 3T7AA 1ZKDA 3WRYA 3WGQA 1QPZA 1T5BA 4LXIA 1XEAA 4ZV7A 3NBFA 3W5AA 2AKEA 3O94A 2FEOA 3NXKA 1A9XA 1Z6QA 5LPNA 1AZWA 3SGLA 5EMMA 5CA0B 5KCZA 1CF9A 1GL7A 3T5AA 1G7SA 1PX2A 1TM4E 3D4OA 3T94A 4DNPA 1KZYC 1TTQB 1UDBA 3AKEA 2J7KA 2BMAA 3HR7A 4FDLA 2BW0A 4LRWA 4R2XA 1SCUB 4Q9KA 1I2MA 3U3XA 3FUWA 4OQXA 3L6OO 4GLOA 4YT4A 2Z98A 5KSPA 2HQ1A 2ZJ1A 5IDWA 1CVIA 1OTXA 4DRZA 1PZNA 3TUJC 4G0UA 3E9CA 4DSOA 5IHPA 1GPUA 2R5WA 2J4CA 4JHXA 1XEWY 3Q6NA 1NIPA 2O07A 4J6EA 3FPHA 3E6AA 4XLLA 3L0ZA 3Q9SA 1W5AA 1YV9A 1CQJA 3Q9LA 4HWGA 1RYNA 2B36A 1GZDA 4KO4S 2EJCA 2HEIA 4J16C 3B3QA 2WA1A 2ZRNA 1PFQA 1ZMBA 2O2ZA 1L8LA 4URXR 1J8QA 5K8UA 3RUAA 1OI4A 1YRQA 2I80A 4LRQA 5EWJA 1E9BA 5L40A 4L51A 1TVEA 4UCXA 2CDCA 5IBCA 1NPDA 2Z5VA 3JARA 3M83A 1NMEA 3UIEA 1V1RB 1O58A 5TS3A 2HBZA 3OEWA 4F4FA 1M0WA 1U28A 2QUAA 4KXWA 1R9JA 2DUNA 4V0NA 3IOYA 1HR0B 3DQPA 1GV0A 2G40A 4TV9F 3NGMA 1GARA 2Q45A 2C9YA 5G40A 4A0GA 2G7MC 4RKFA 5IYZA 1Y3FE 1ZN9A 2GFIA 4YAUA 1RADA 2VWQA 3KTOA 4B7AA 4JQZA 1TZKA 5TARA 4F04A 1L5WA 1R00A 2WSLA 9MHTA 2O8BB 3PNYA 1QO9A 1WPQA 1XLWA 4R0NA 2X1MA 3SKYA 4PG7A 4RYDA 1AXEA 4BLVA 3C39A 3OOWA 4XCQA 5FI5A 4DCGA 2VHZA 1R0ZA 3E4DA 4H0NA 5IJ0B 3R7WB 2Q9CA 4P82A 4EUSA 5IAAA 3DCJA 2O7RA 3GLSA 3IAHA 4GE3A 4M0UA 4CMJA 7YASA 4MQ6A 4YY3B 1GFSA 2RD2A 1R4MB 2YFHA 3OPVA 3GLHA 1QB7A 2CNKA 1SXJB 2OK7A 4YALA 5AJYA 5GVRA 5GZ6A 3LP5A 4MWSA 3C7DB 4ANFA 3FF4A 4UHBA 1PGQA 4UTZA 1NLYA 1P8AA 5D86A 4MDFA 4C0AC 2F4NA 2A0XA 1PTKA 5B1EA 4UTVA 1RPNA 5LQJA 2VQFB 2J6CA 3EUEA 2LCFA 2PGOA 4H3KB 3UMMA 3TTTA 1IOWA 1N0WA 1KERA 5TC4A 4NS1A 2QPOA 3AFMA 1BE8A 1LLQA 1TGYA 2E85A 2KPOA 2XNHA 4CTOA 4CM3A 1E2DA 4HBZA 4D4IA 2HH9A 1XNQB 1L4MA 3QVGA 2WSYB 4BQIA 2EG9A 1V3TA 1R64A 2XGGA 3K94A 4MLPA 5BN1A 2CWWA 4HEJA 1X80A 2P6MA 1SPBS 4FX5A 5EHXA 1OZ0A 1IATA 3A6EA 1M2FA 2GK4A 2C4MA 2VNSA 4NCHA 1L5HA 4DA0A 3R7FA 3SBOA 3R6TA 2ZIXB 4Y18A 4B3GA 5J4KA 4PRLA 1CQJB 3NXSA 3O8DA 4HQ6A 1BJRE 5T5QA 4FVTA 5AW1A 1EB9A 3ADKA 4L75A 3FVTA 4C30A 3M9XA 5A9SA 5C8VA 3LYLA 3NHUA 5JCPA 3HO1A 5EWJB 1HEUA 2CFIA 1AKQA 1X7GA 4MX8A 5EE0A 2ZYAA 1VL6A 1QV7A 2YJZA 3GGSA 4JWKA 4WGGA 1J97A 1U0OC 3VJMA 4ENVA 5BN5A 4BWVA 2IQ5A 4ZEOA 1N36B 1XZCA 1I7NA 4E94A 1RZVA 1A2QA 3SC6A 2XYQA 1F9AA 1XZBA 4DR7B 5IYZB 1BEZA 1C30A 4E5VA 4FK8A 4MW9A 3SDZA 4IMPA 4RO0A 4D3YA 3NBUA 4NH0A 3GYBA 1W85B 1DRKA 1WTAA 3AI2A 4XWKA 1YR3A 1OVGA 3AY0A 3KFXA 2YTZA 1B1CA 5A0FA 1G5HA 1WY5A 3MD0A 1HH4A 4X60A 1PR1A 5ALZA 2J33A 3TI9A 1ZJ6A 3NGLA 5JC8A 2V3WA 1QS0A 1QNLA 3S5UA 1YHZA 4XGKA 1U7DA 1TPYA 3VR4A 3GLHB 2PXAA 2C9MA 4BDSA 3CR8A 2VDRB 3D5QA 5AOAA 3WGUA 1YQUA 1KE1A 1X2BA 1ZAYA 3RYHA 3ILXA 3DUFA 1IUKA 3SY8A 1FRQA 3KPYA 1FVFA 4YHBA 2FZ5A 2ATEA 4NBSA 4CGZA 4B6OA 4Z4EA 1A7UA 1ONPA 3IJEB 4KXQA 3V55A 4CXMA 3T7KA 1V4VA 3IB6A 4A15A 2JFUA 4E30A 2OCPA 3H19A 3R6WA 2GN8A 3EMDA 1I30A 1XZQA 3DTNA 2OFFA 1AOXA 1NMXA 3OPXA 3MGGA 3HJUA 2ZRPA 2WWWA 5AVUA 3IJ5A 3FLAA 2VAMA 3VSCA 3AEQA 4GZ3A 1ELOA 1R8YA 2Q1UA 3M4XA 3FYSA 3QVGB 4ICIA 3Q4GA 2TRSB 4TMWA 1XZFA 1ESNA 3PG5A 5CT9A 1FK8A 3CBGA 1QXSA 4H6PA 4ZPXA 3V80A 2IH5A 1DIRA 3AI7A 3RS8A 2HLDD 3MTJA 3NHZA 4LSWA 3WLNA 3ZI7A 1L5HB 2I91A 5HUQA 4DA8A 3QE9Y 1XL0A 1Y1TA 2HDHA 2W2XA 3PUVA 5J43A 5JNVA 4OLBA 3KXPA 1YDGA 4Q82A 2CYBA 4YLGA 5EXXA 4ESHA 5LQAA 4WL0A 1B4DA 1Q1ZA 4S12A 1U0FA 3WLAA 2Z04A 4E07A 5BRJA 1Q2UA 3F49S 2OQIA 3LKDA 4R2WA 2IOHA 5SYMA 1M7BA 2XDQA 2C88A 3C3WA 2P4QA 2WZQA 3KSDO 5IKPA 5LJLA 1HORA 1XXHB 4KVZA 1N8SA 5KVQA 5KYGA 3DO6A 2CLSA 3KTAA 1ZP6A 4RU1A 4QELA 4YRRA 3ESAA 4G1UC 5BN5B 5JVDF 1QF9A 3NETA 1CZHA 3GLTA 4NY1A 2IZ6A 3HFGA 4P8RA 1U8YA 3L41A 3UAWA 2GESA 2ZKLA 2ZB8A 4ZXPA 5LQDA 5FPQA 3ETJA 1C30B 4XWTA 3UJHA 4BV2A 5AJUA 4TLLB 5K6RA 3ESXA 1SD1A 1JI3A 2ORWA 1T1GA 2D1TA 2VOEA 3G5MA 3G79A 3WLHA 1PR6A 4JENA 4IJUA 3MQFA 1S2OA 1W4AA 1JFFA 3VR2A 3JQBA 4G0YA 5AIBA 4KQJA 5K3DA 2MYTA 3X44A 4MVJD 4JUFA 3UVEA 4ZHQB 2BJHA 5ITWA 3BGSA 1A77A 4C5AA 1Z4LA 3I0NA 1SBHA 3RREA 4L5YA 3BSYA 1QGOA 1RMQA 1G60A 3ASUA 3CV3A 5I7SA 2IS6A 5ENZA 2OXCA 3GXOA 5G1NA 1NW8A 2VPWA 3HWX1 3T35A 4ZAYA 4R54A 4S05A 1K97A 3LVQE 3CX7A 2XCUA 1M75A 4P4NA 1IQPA 1GNLA 1NR1A 2XCOA 3LS2A 4RPLA 5EJEA 4LVCA 5A6VA 1U2DA 3DUFB 4KQ2A 5ISMA 2G5PA 3QBJA 2P35A 1QDEA 2QHXA 1FSGA 4JEIA 3TR0A 4NEHB 2DUMA 1YA4A 4L0MA 3Q5DA 5KWVA 2F3QA 1LC0A 2HCTA 5KVCA 2QM0A 4OH7A 4P34A 4CHTA 3VYTB 1UDRA 2ZSKA 4LDRA 4YV7A 2AIRA 3A3KA 3RC9A 3S29A 2UXDB 1ANKA 1YFKA 1SA0A 3AEQB 4U3JA 2C7VA 2JIOA 5FLKA 4D7AA 5L3QA 1XHEA 4RPKA 1EVIA 1ZQ1A 3VV3A 2BEKA 3P9SA 3HDTA 2R7KA 2O48X 1YKFA 2KWIA 3AEUB 4OFWA 1XRNA 1KZ1A 5BNFA 3V2HA 2PJZA 2VZEA 5DNYB 3L1JA 1KZ6A 1UEXC 3CUYA 1XTTA 1Z4QA 3I0MA 4JKIA 4OLFA 4UFOA 5IWAB 2HYDA 1ZXXA 4UW9A 3NC0C 2VTDA 3ZBPA 3NHSA 2DERA 2I2FA 1MJ5A 1HYGA 3UQZA 3GAMA 3DOHA 2IWRA 1J0AA 4ER6A 5CX4A 3VRHA 3IT3A 3BC1A 4OQZA 4TTJA 2C54A 3KTAB 4IOLA 4FI3C 2XT9A 1JT9A 2EBFX 2JHCA 4H1VA 3KTDA 5BYAA 1I1HA 1T6ZA 2JD1A 1F7VA 4JQOA 4UTRA 3MPOA 2M32A 3IV9A 2Q1TA 1MOQA 1PV2A 2YIMA 1V26A 3E84A 4WKGA 5DM2A 5DSXA 1C8VB 2Q2WA 4ZCRA 4KV9A 5TRTA 4FGZA 3ZCTA 3QTBA 5KQSA 3MBIA 4S1OA 3FBWA 1E6CA 4H3HB 1LBSA 1I4DD 3K09C 4B6JA 2VJKA 4Y2QA 1JFFB 1N6KA 2DHRA 4R69A 5C31A 1RLOA 1J33A 1DC7A 1UDXA 3ANLA 4HI0E 3VHLB 4BMOB 2XADA 3DSRA 3JVDA 1MJNA 4D6YA 2NU6A 5FXMA 3M7IA 4DSUA 3C5EA 2PL9A 3D6FA 1Z0JA 4PGMA 2PWBA 1CDZA 3BWCA 3DW1X 3E03A 3H2GA 1PG5A 3OBIA 1CZLA 1TEXA 3IQDB 3UTDA 3CKMA 1ADYA 3ITNA 5BQ3A 3N6VA 2I6FA 3G59A 1C8KA 1MHPA 3I5MA 4E13A 4EPWA 3AJ8A 4U5XA 2VHWA 1PJ3A 3OJXA 1FCJA 3CNQS 3QE3A 4LGYA 1CSEE 1U0EA 3D8SA 3NTLA 4HFJA 1WIWA 2PX8A 4IDOA 3BMNA 5LLTA 1QYIA 1W0KA 2CB9A 4HXEB 5F4ZA 3R8XA 1KAQA 2ECOA 5JJIA 4O1IA 3UXEA 1XNJA 4HFMA 3STXA 4DYVA 1P5ZB 2A9OA 4HDRB 4LWOA 4BCDA 3ZIDA 2CDNA 2FN7A 4J03A 2OKCA 3KJHA 3U9LA 2O3JA 5KSYA 1HFJA 2FZKA 1K06A 1YR6A 2YR0A 3NHLA 1YFLA 1L5MA 1SA0B 1EKXA 3IV7A 1G1MA 4U3JB 5TMDA 1T5TA 2JCSA 4CM9A 2AK3A 3O8BA 5D3MA 3G49A 2MU1A 4N7JA 1H2WA 3NCHA 4W99A 2D6FA 3BXFA 1TK2A 2VLBA 1EFVA 2X77A 2NAFA 3NRJA 3ZVRA 3PGLA 5KUTA 4UZSA 1F9EA 3JCZA 3K32A 3RQSA 4Q47A 4I9GA 2WNIA 2P9YA 3FSGA 5CH3A 4RFLA 5FBQB 1XYYA 3LT5A 3GXBA 1E1DA 4X62B 2Y4NA 2Z6AA 1ADJA 1VZ3A 2IC5A 2LIPA 4LC0A 4TXNA 2OFWA 4ZDKA 4GWLA 1Y8RA 1S2IA 1UP4A 2YNMA 3EH1A 4JCCA 4OHPA 1NFFA 2HI0A 1VXRA 4J2HA 2X19A 4NZ9A 3X1KA 4HNUA 3GRAA 3MSXA 3AYZB 2A0UA 1PJAA 4OJMX 5G4KA 1YTLA 1A2OA 2NO7A 3C7KA 1M2WA 3TNJA 1CUYA 3L8MA 3ONDA 2YFYA 3W1VA 4EQ6B 1JG3A 3LF1A 1AUQA 5B1DA 3P0EA 2C8LA 2Z2YA 2WUWE 2Y0CA 4NAUA 1RE0A 5HWSA 3FOWA 3BVPA 4EH1A 4RSRA 5EESA 1JU3A 2BMDA 4RKRA 4DUGA 1M6HA 4BGEA 2PGAA 3P7MA 3QLVC 4K1LA 1KQGA 1BN6A 2G17A 2XPCA 4GF5A 2ADMA 1SOVA 4KIWA 5FOVA 4HDCA 5EXEA 4MRNA 1Q57A 2AMFA 3DONA 2B7LA 4Q00A 2J7PA 3MRSA 1ILWA 1IE3A 4MR9A 1B3RA 2NU6B 2WTXA 2AH5A 3GF4A 4X9XA 5JALA 4KPEC 4BQPA 2FPMA 3DV0B 1B8UA 4OUKX 2HF7A 3U0BA 3CINA 2D7CA 2Q3EA 4U7DA 3O0TA 2OLKA 4HAOA 1QHFA 2Y1OA 3W5IA 5AI8A 3AI3A 4YO7A 1LVGA 1L2TA 4LJRA 4DCMA 5KWJA 2IZ1A 3JX9A 1CNFA 3B78A 5DYYA 4ER0A 2PMCA 3I5UA 5P21A 2ZB2A 5IJAA 2FVYA 3QFHA 5HVNA 4GYWA 2JFYA 5FWXA 1E3EA 1RHRA 4P1ZA 4R3NA 4EA6A 1KRWA 2A4KA 2FF5A 2JZCA 3G2QA 3I76A 4CRWB 4YJ3F 3LIPA 1GQSA 5F7XA 1SIBE 3HRHA 3H4IA 3PENA 3VOAA 3VYSB 2V3CC 1G8PA 4UHJA 1CVLA 2J46A 3SZRA 2A9PA 4BWYA 5C46F 1N6NA 2IZOA 3E48A 4FNAA 1U0NA 3AVQA 3QUTA 5EPOA 3PRYA 3U09A 5ED4A 1GZ7A 3ADPA 4EHNA 3BAFA 4L6AA 3ANSA 3UAXA 2FUCA 4I1PA 3PC4A 4LE1A 4M6WA 5ILGA 4AMZA 1OLUB 4C0XA 1V2HE 4IMRA 2VLIA 3RBZA 4EJMA 3SQWA 2CJXA 1EFVB 4CFZA 2A9JA 4C5CA 1YJXA 1EVLA 4H3SA 4CIYA 3JQEA 4YT2A 2DFLA 1XZAA 1NKVA 1KMNA 4N76A 5JV5A 3STHA 3VISA 3FJ1A 1QTIA 1MRNA 4FWIB 1KKUA 2X7JA 4PG8A 3EULA 5JD4A 2XRYA 1YO6A 1YQTA 3GY0A 1U6KA 4Y9TA 4EDFA 3RIXA 3FVRA 1Y8RB 4DEXA 3OA0A 4MGZR 1CTQA 5A3QA 1PSWA 1XI2A 1PHPA 1UT6A 2Z2ZA 4FKMA 3GMIA 2FWAA 3VZSA 1NOIA 4BZWA 5A2GA 5H83A 3RU3A 1WUHS 3R5HA 4KAXA 4WY8A 1YJBA 2X9GA 3GFVA 3ZHZA 2F3RA 4BP9A 1OGYA 3ZWBA 4I2NA 2AR9A 4ZC1A 1PL8A 2D5IA 1TEZA 3ZIAD 4H1HA 5F64A 4UQPA 3D6UA 3DMRA 4GS5A 1CY0A 1UOOA 2QI9F 3F8WA 2EKZA 5D6NA 4FTWA 4IQ4A 3LFTA 2C2BA 4EK9A 1N5IA 4BNDB 1N5JA 1UWVA 2QRJA 2CLMB 3DLBA 1FTGA 2IUTA 4MR9B 4DWOA 1EDBA 3MTDA 1UBEA 4Q3LA 3EIFA 2JEZA 1BXKA 1VB5A 3PEVA 2TECE 3LVBA 3QEMB 2IOQA 4PBRA 4ND4A 3E05A 5BRNA 3DKKA 4DEVA 4GX0A 3NEAA 2RHGB 2YFKA 4WDQA 5KNDA 5JCXA 5DLEA 3BCUA 4YUVA 5KOIA 4XIYA 3KJGA 3UTCA 4C7OA 5FWXB 3VSBA 4B87A 4MWTA 1N9ZA 4B2PA 1QGED 3EUFA 2VUHB 2ZBGA 4N7BA 1P1BA 1AS3A 4O2BF 4IIVA 5I9BA 2AD1A 4MKXA 3EEIA 2KHZA 3DJFA 3T06B 1HKHA 3CTPA 2OHOA 1G8AA 2B4TO 2OHHA 1AGYA 5BO5A 2O8CB 3MZ0A 4BGUA 2UUAB 2F90A 2GFQA 3Q5GA 4LW8A 3JQDA 1TE2A 3B5JA 3HU1A 4BO6A 2FZVA 4M6WB 2X0NA 1Z17A 1TEVA 1V39A 1Q6ZA 1FDWA 2C0QA 4PGGA 3BCRA 2GK7A 1H5UA 1OBHA 2I4TA 2O2XA 1T25A 4ZYWA 1UAGA 2W2QA 3STYA 4FJ2A 4MW7A 1DBIA 4J7UA 4KMOA 3KOZA 4X6LA 2G70A 2YWFA 5TB5A 1RPAA 3ZY6A 3BIXA 3D5TA 3N0TA 1XZPA 2B7BA 3ZHCA 1U0BB 1QCZA 5D7BA 3R9XA 2HWWA 4U7JA 4JAVC 4G86A 1T1SA 4JUDX 3OZFA 4W5HA 5F77A 1RCFA 2GD0A 4PE5B 4WK6A 4XPIB 3R4CA 5I8WA 5LFAA 2O14A 4UTPA 3EFHA 1R16A 3GLKA 3AOGA 3OE7A 4G84A 3ABRB 1WD7A 1T9ZA 5ALTA 5E4TA 3WQRA 4C7VA 1ZVJA 2BTQA 3P2IA 3IJPA 4AZSA 2QRPA 4EI7A 4F86A 4DF3A 5EPEA 4O4HB 1AF7A 2H16A 2Q0XA 2A9RA 3O3NB 1FS5A 1ISJA 3WK6A 1BD3A 4R2HA 1GSAA 2XH8A 4TZTA 4YB8A 4O63O 4G63A 1OI2A 1AGPA 2VVTA 4HNHA 5I3ZA 3A6PC 2OCBA 3D2AA 1OXSC 1QFXA 1XRMA 4LSZA 3RC1A 3W04A 1VMEA 1OLXA 5ALGA 4EY6A 1XZLA 4Q4CA 3AMVA 4PNEA 3E8XA 4RPGA 3K05A 5GONF 3KV1A 1NASA 4NQRA 4RQTA 3P9QA 5D6OA 3F6EX 1SXJD 1UEIA 2Q99A 3IVXA 2HK8A 3HLKA 4B32A 4DJDC 5K8IA 5L6MB 1J7KA 2ZS8A 3KZVA 4C20A 4FUQA 4B3DA 5K01A 1NPYA 2FMHA 4Q9NA 4TL9A 4LF5B 3NO4A 4ODIA 1BVUA 4OVKA 1FJXA 3GR6A 4HK4A 1Y8CA 1E92A 4ZYXA 1EAYA 4B3JA 4C7OB 4FSXA 1VYUA 2VF4X 3H75A 2EW8A 4EHAA 1Y81A 1VPVA 3JYHA 2PH1A 3MLEA 1UODA 2CLIB 1Y1PA 2WJJA 1GUYA 1QKKA 4AP6A 2P77A 1GZVA 3S1AB 3PE3A 1RZ3A 4Z0NA 3LG2A 2X6QA 4GSYA 4JZYA 1O08A 3EXG1 1CQZA 3SZGA 2OEPA 1M6VB 3FTPA 4X97A 4JP5A 1P7CA 5LZ9A 4B8ZA 1IBMB 3NT2A 2SHKA 3PQ8A 2ZRCA 4G97A 3ZHSA 4KX5A 1GTRA 4OJNA 1C3XA 4U9IS 3R7SA 5IJWA 2JVKA 5DTEA 3RU9A 2R44A 1AXGA 1DKQA 1N25A 3N39C 3QYJA 1Z33A 4C89A 5FAKA 4B8YA 3OSUA 1GNQA 1WO8A 3KXKA 4TKVB 5TE9A 1IB6A 4UPEA 1JEJA 3OEHA 4LRUA 1UQRA 3ABZA 3DXXA 4NDAA 4G9EA 5AVOA 4Y2PA 1G64A 2HDOA 3HGTA 2N9UA 3H5IA 4X8LA 5EIWA 3R9XB 1QORA 3HY4A 4R8RA 5JJLA 1GA4A 1UBNA 1YOVA 1PK9A 5DBGA 2H8KA 3I32A 2IU4A 1OZFA 3HDQA 5CFMA 3JD3A 1SCIA 1X7WA 2Q4OA 2PZ8A 4RKYA 3G8DA 4CQMB 4G5RA 4XVRA 3VPSA 4E2YA 2G9UA 4BUCA 1C1YA 2XUGA 3QY9A 4ZQEA 2CK3A 4YH1A 1CUWA 1K89A 3UHAA 5BQ5A 3ZKWA 3GN2A 1JDJA 3HE3A 2PV7A 4JI1B 2CW5A 2VH1A 5AHXA 2IOFA 1E9RA 3O21A 4NJEB 1NI3A 3KYCB 1EDOA 4EYEA 1BS9A 2W4IA 1ZU4A 3QKTA 2NGRA 4PG6A 3V7NA 3RLIA 1MR3F 4HTAA 5IAGA 1QK3A 3CRMA 3GFSA 1V9SA 1WMAA 2EHDA 2EX0A 5IUJC 4LOJA 2OMKA 4M1QA 4S1NA 1IQRA 1VRVA 2YVUA 3R44A 4MMYB 2PQ2A 1RQRA 4C3VA 2BSAA 1I80A 3NHBA 3ONWA 2OORA 4CFYA 1E5LA 3E5MA 1UXOA 1VLVA 2HJWA 2B5WA 2YN0A 3GOQA 4FYIA 1HMYA 2FEMA 1YKGA 3FNIA 4R6XA 3RNOA 2KB0A 3C6YA 3FMIA 3LJKA 1R6BX 2YW2A 1MGOA 1VHDA 3FOZA 3PLRA 3NIBA 4XQEA 4ZJZA 4PFSA 1MRZA 2RHTA 3H1BA 4FILA 1M6WA 3O3OB 5TV2A 3ZGZA 2HU7A 2HZ7A 5DLPA 4RVFA 1NRXA 3ODPA 3TNYA 3I12A 4FMDF 4MWBA 4TS1A 4FB4A 4FPXA 1L7BA 2WKQA 2XHZA 1N2BA 3HV2A 3QLJA 4C0WA 1IFXA 5DHUA 1EWYA 4L50A 4E6EA 3HWRA 2PFSA 5AVYA 5EJ6A 1YGYA 4OP3A 4LUCA 5LZ4A 1SUSA 4Q02A 5DLYA 1JFLA 4PTLA 2FZWA 2QLBA 2IYVA 4FR2A 4GKVA 1ZW1A 4RFVA 3Q8LA 3N1UA 2XUJA 3AEYA 3F5MA 2IY7A 1RYFA 2Z1MA 4I5DA 1DIOB 4M0CA 2QMUA 4DPKA 3IRUA 5SY6A 4ZDIA 3R3UA 2Z09A 4OOFA 2FZLA 3DZIA 4CM5A 2EZ9A 1UPXA 4GRIA 5HXAA 1DBQA 2IYRA 4LE0A 4WJZA 4PPFA 1NWHA 2GPAA 2WJZB 3QU9A 2WT4A 1YOVB 4H7FA 3SBEA 3ONNA 4YPFA 3CRZA 4J90A 3PQDA 3QF4A 3T3HA 4DZTA 1O0CA 4H1WA 3EGVA 1X7WB 2C77A 3RYTC 3TLZA 3OQIA 4P38A 3SZMA 3OC6A 1ZL2A 2Q6OA 1WR8A 3MB8A 4XYLA 4ZGGA 2EWWA 3FHJA 2G28A 3VU0A 3L93A 4MKIA 4R1PA 3PNMA 1UZAA 2DM6A 1BVHA 2DPHA 3EUAA 4V03A 1JV2B 4LQ4A 1W47A 1EZZA 4F97A 5DHRA 4IGFA 4QU8A 3SMVA 3EZXA 2OXRA 3D6AA 2J8ZA 3U4AA 2PUAA 1NMZA 1U3GA 2FHPA 3H9JA 4BKRA 1O6CA 1YQEA 1JIIA 3D6HA 3K2IA 3IQEA 4K6OA 3SNHA 3N53A 3PGA1 1JPNA 2Q5JA 3IAEA 4DRXB 5KYYB 1YQQA 2P5SA 3I2IA 4FYJA 4X7BA 4B2IA 1G16A 1WDMA 3VR4D 5B1HA 1ADBA 1KQPA 1DLJA 4RZUA 3HA7A 5JPCA 2UUOA 5CG1A 4OK5A 3IUQA 4G2NA 3QITA 4OXRA 5DN9A 5AVTA 2PRYA 1CY4A 4RKQA 4CMKA 4II2A 3LCMA 2OPHA 4EI2A 5BW4A 3PXAA 2QVLA 2HF2A 4YJHA 1ZRMA 3RTEA 4CIAA 1WULS 1C9KA 3DEYX 3BCHA 3S81A 1DJLA 2J9FA 1S2GA 2CFSA 1ACLA 3KKEA 1U5BA 2YIJA 3LT0A 4ON9A 4F8YA 1LK7A 3K92A 4TXMA 2QYHA 3I45A 1U6IA 3NTRA 3C8MA 4TLBA 4AULA 2JCVA 2ANCA 3SJAA 4L4XA 4B6SA 3KSZO 4HRAA 1WSWA 4YN3A 5JAUA 5L6LB 5C3UA 1P5RA 1MB3A 2YCLA 3C5VA 3QI2A 4FM9A 4B6RA 1RQXA 4DJJA 2A59A 1HDEA 4LI3X 3CLRD 3L02A 1UFRA 2DPGA 4NC9A 2YW9A 1SM4A 5DNEA 3TQCA 1PGOA 4N82A 3AO0B 2OCDA 2B0CA 1MG5A 2A9FA 1H05A 3MN1A 2QAIA 2BBSA 2O8VA 3T1QA 1ARZA 3E27A 5EZQA 3TFOA 2Q1WA 4M21A 3D3WA 4WCVA 1IZ8A 2X8JA 3PPVA 3SC4A 1ZN8A 3ZWKA 1C0IA 4L4UA 4EG8A 1A96A 2PSFA 4MQ4A 3OZIA 3QF4B 1N5MA 3ZY3A 3FPAA 3PDCA 1KFJB 2BYTA 2HHHB 3JD1A 5BUZA 1CS0A 2PIDA 3OQIB 4BNVA 3HCOA 2VXOA 1P5JA 1XZIA 3A1WA 4QT0A 4F2HA 1UZMA 2OSVA 2BY4A 4GI3A 3TB6A 2HIAA 1Z4JA 1ZH8A 4YT8A 2ZJ8A 4NYJQ 2D7JA 1WZUA 4Q7EA 5LDHA 1ZUIA 1K63A 1NY6A 1P45A 1RRKA 1OROA 1YVDA 4I5GA 4I1VA 3MT9A 2ZWOA 4PZ0A 3ZGLA 4JYMA 2F9MA 4NU8X 5H02A 4TXHA 3CF4A 5JTTA 3BQ9A 4YNBA 1N0HA 1M5RA 2ZUCA 2Z5FA 1DIBA 2OUIA 1RLIA 3K9HA 4FMCB 1R37A 5FNZA 4BU0A 4M1MA 4RACA 4XOIA 1NKSA 4N5IX 2IVZA 4GPZA 4A8PA 2BBWA 4LNUA 1GR0A 3GEGA 5HKAA 2X8AA 3JVVA 5K05A 1A9TA 1X9IA 4CKCA 3BUSA 3KCNA 5AK3A 3D4BA 1FS4A 1VPWA 3A2KA 3HO6A 3BHNA 4HXFB 3O95A 5LCXA 4QQNA 3PCRB 1B6RA 4Y7CA 1OT3A 4NG5A 2GHQA 1NQUA 2AMJA 2YJ3A 1NIJA 2RH8A 3OKAA 2F43A 1XDDA 3KZXA 2HA2A 3C97A 4YJHB 4LN1A 3ZZ0A 4OXKA 2J9FB 3T5CA 3W9BA 3EZ7A 1F48A 1U5BB 2PTGA 4GEKA 2ODPA 4QYMA 3UYKA 1CJBA 2PGLA 4YIKA 5FUVA 4EHBA 4C2UA 3E22A 4TV9A 1SMKA 1SWWA 2PX2A 4XIIA 4ZOBA 3U16A 4TN5A 4EMTA 2O2DA 1W6RA 1PFWA 3LYAA 1ZIDA 2JCBA 2GNOA 3PGXA 4HN4B 4NH4A 5TT1A 2I7VA 3IB3A 4OOEA 3KQPA 4TZ6A 3LY8A 2C03A 3AI1A 3H3XA 3BF7A 1IL0A 1J39A 3DE0X 3FPFA 2V0NA 3ESZA 3IR6A 3THYB 4CM6A 3RJTA 4HBGA 1UBRS 2F1HA 3CH7A 1KSJA 3PI6A 2FZEA 4KRFA 1ZQ9A 1XQ1A 2WAAA 4JT4A 5B3AA 4RA9A 1JXMA 3R9KA 4L5BA 5JU6A 1SFRA 2PUGA 2HO4A 2JASA 3C3KA 3D3WB 3IOEA 3ILVA 2FQYA 2NU8A 4LV6A 4AJHA 4AKIA 3RADC 4XX1A 3OZBA 1KDOA 1T9GR 5BXYA 1YRAA 3NWOA 1CZNA 4IXNA 4UNSA 1V1JA 1CS0B 1IDN1 1GGEA 2XKBA 2ZI7A 3GZJA 1TYAE 2ZIUB 3KR9A 4BFXA 2VH5R 1JS1X 1N2EA 3KQYA 3NNNA 3M1IA 4INOA 3OC0A 2WINI 2VTVA 3OIGA 4B7CA 5CCEA 3PNPA 1MC1A 1HDOA 4F1KA 5J4LA 3EDRA 1PT6A 1L5KA 4IIDA 3WLSA 3T9AA 1F3OA 5COQA 2H17A 2MSDB 4C3OB 2YL2A 4JFRA 1XLTA 1P7PA 4WFJA 3DHEA 3QVOA 2WM8A 3AHIA 1Q3KA 1SUEA 1U2TA 1AN0A 2CHVA 4XB1A 5CVUA 4DABA 3UWMA 4UQLA 4DR6B 1X39A 2Q6KA 3S0JA 2Q50A 3L40A 3VZPA 4DLNA 2IY8A 4LNUB 4CKCB 3IP5A 5IRCD 4E2FA 2ZSBA 3WLPA 2GWRA 2P3OA 3GPBA 4IQGA 5AOCA 3V46A 3ZQUA 1GQYA 1SUCA 2IPNA 2NVBA 5EMLA 2ODAA 3WWPA 1ULZA 1TA4A 2F43B 2WYHA 3GRUA 3L7IA 3G23A 4KN6A 4WNYA 1CZOA 4RTQA 2PUFA 1KJJA 4JQSA 3M6AA 2OUKA 1IXRC 2ZT7A 4OJQA 3SQOA 5IM4F 2QT0A 1N2ZA 3L8YA 4MUHA 1EEXB 3R6DA 2H1OA 2YJNA 1GT91 4Y30A 4B17A 3E22B 2GAAA 4KNVA 4TV9B 1VRCA 2HJVA 2WJ6A 2Q7XA 3E15A 1JLKA 3H1AA 5JXGA 5FTNA 4XWAA 1EX6A 4CM9D 4TUYF 4CI9A 5J4YA 2CMFA 3MFQA 1N0UA 4LRSB 3IUJA 4HRVA 1NUAA 4ZQGA 3M9WA 3OPYA 3CJTA 2JG3A 1KO5A 1LI7A 4LDJA 1O3YA 1PJ8A 1DAEA 3OQNA 4HVAA 1BMFA 1YRBA 3QUQA 4FYWA 3FSGD 3MWLA 2WFMA 2OAGA 4RA9B 1II8A 1SVLA 1UBOS 2YNMD 1LPAB 4O8ZA 1OXUA 1TLLA 3AVXA 4M0PA 3HQ4O 2NU8B 3R3YA 5ICEA 3TPFA 1MN6A 2Q2VA 2XXBA 1ZICA 3LH5A 3EOAI 3MINB 4NBVA 3RRMA 2QR3A 4EHKA 1KSHA 5ESRA 1EJ0A 4KG7A 4X91A 2PX3A 2RARA 1P73A 2ZJ0A 1W19A 3A06A 3KHTA 4EF5A 3U56A 4IKEA 1R3DA 2H2DA 4N4AA 4WXEA 1TW2A 2FF7A 4BFSA 2F1IA 3J81A 3C16C 1PNVA 4YI5A 4JU9A 1Y5NA 4DUGD 1MRSA 3VOBA 2I65A 2OC9A 4YDRA 2RIPA 3TOXA 2BKAA 1SURA 2HA7A 2OHGA 2OLEA 1AZLA 3Q3IA 2WIKA 4WK4B 3KOMA 1C7IA 3COWA 2HA0A 1FSSA 1A7AA 1TC2A 3HN2A 4URYR 4BP1A 5IASA 1K7XB 1VMKA 2J7PD 4KQXA 4E14A 4M46A 2YVLA 5KJCA 1S3GA 4OGLA 3STUA 1GTMA 4HC4A 5DIFA 3BHJA 3NIGB 1J0DA 1IIBA 2VAPA 3LPLA 4QE3A 2RC6A 3S2FA 3DOIA 1IY2A 1E6UA 2ZKIA 4O33A 1OX4A 4QUAA 3HZHA 3WLRA 1ECGA 4GZ5A 3TXAA 3ZDCA 2ICAA 3E8MA 1N3BA 3KZCA 1E79A 2HPAA 2QRMA 3N74A 5ALEA 5FUBA 1JSRA 1YUMA 1PVDA 4TMZA 3QVSA 4PWZA 3INRA 3IKJA 4BVKA 1UC8A 1RZRA 4RH0A 3S44A 1N77A 2YUIA 2CXHA 3RUIA 2WAOA 3DFUA 5D3MB 4IEEA 5DCWA 1GNRA 4M83A 4H59A 2JIZD 1HLPA 3LBNA 3ZGYA 5JVDA 3BQNB 2VWHA 2VJNA 2Q07A 3M82A 3BE4A 1DMRA 2JI9A 3GQVA 4FFMA 1DB3A 2GSWA 1YR8A 2CCKA 3CO5A 3MMPA 4HYYA 4C0KA 2QBYA 3KQKA 5JWHA 3ESQA 2NG1A 1KY4A 1W5TA 2ET6A 3U2QA 5HRAA 2O23A 4K5QA 1PYGA 3BMOB 3TL3A 4E2ZA 4L2IA 5B55A 3WGIA 1XTPA 3PEEA 4IHJA 3T6KA 1UZNA 3FJOA 2C4TA 4WKBA 2FWIA 4O0MA 3B1VA 2QX8A 3B20A 1VPDA 3HVRA 1OAKA 4EHLA 3L8HA 4GT1A 4LX8A 1Q7CA 5JC1A 5JMTA 4LE2A 3S28A 2Y68A 4BV8A 4LMAA 2PMKA 3RI3A 2GASA 1II8B 4Z4GA 1UKVY 2H9YA 1FB5A 1OI3A 2PAFA 3PQ2A 1Q16A 2ZSEA 4C7BA 2CV0A 3GIWA 3TTXA 5B2EA 5C8YF 1YBFA 3PFBA 2RBKA 1AH2A 1A72A 5D1HA 2IYAA 4LVNA 5ITZA 3EQ9A 5EMKA 3CLSD 3Q3GE 4B6GA 2EF1A 4KZKA 3PTLA 2FUNB 4PRZA 4ZQIA 4J4BA 3KETA 2ZR7A 3EW9A 4IGEA 1PU2A 3GLQA 4MIKA 2YHIA 2V6IA 2QN2A 2PMDA 4HJRA 3WIBA 1DPFA 1NRWA 2EATA 2FMXA 2VP4A 5BUCA 4M1WA 3RFFA 3BULA 4WLVA 1P6QA 3QI7A 1YQWA 4OLAA 3ODGA 4UU1A 1TVKB 3W6UA 3EPPA 3X2EA 1EHIA 3H7AA 3L84A 3O4FA 1XPUA 3IHWA 1VE5A 5DGIA 1KH2A 2ZTHA 5H8WA 3FDXA 3U3OA 4X7MA 1Y1LA 1RWVA 1C0EA 1S96A 1R4ZA 2XNDA 2R84A 4YIHA 4YFVA 3SLGA 2PLNA 3H99A 3ETDA 4RGVA 4X41A 4E6PA 3A9CA 1E4OA 1PQYA 4GM1A 4JY7A 1U9IA 4O5AA 4EJ0A 3GPLA 1PJ4A 5JUWA 1OFHA 4YX9A 1VBNA 4RGBA 2Q7DA 4B2LA 3ROKA 5DYTA 3RS3A 3S1LA 1Q84A 4FLMA 2UVDA 1ZN2A 4MGKR 1RWQA 4JLVA 5JVDB 4RF5A 1MOPA 4DW8A 1T34A 4N5NA 1QUEA 4EKEA 5IDVA 3AP3A 2QBYB 2I33A 3D0KA 3GVCA 2ZSUA 3RBXA 4G0WA 3PF8A 3OQVA 2Q4RA 1RXYA 3CUVA 1AU9A 1KP2A 3GDGA 4L2IB 3SPXA 4WA8A 2IW3A 2WOOA 1SG0A 1YQGA 3FOBA 3PKJA 3KSAC 4JP2A 1YZUA 1RQNA 4RD3A 2R7MA 4JI5B 1B0UA 1OF1A 2W8ZA 3SD7A 2MYUA 3DS8A 4IPTA 5AW8A 2VATA 2BGWA 3I8XA 1KIFA 3NEYA 2IEDA 2M98A 4ROSA 1CRQA 1ODLA 1XUOA 4KE7A 3TH5A 3NOVA 5JS8A 1MOZA 4OHXA 2VTBB 3VR6A 2CHUA 5HRUA 5I48A 2VSNA 1H4TA 3RBAA 4MW4A 5F35A 3OE7D 3CB4A 5DISB 5B57C 1BXGB 2ONYA 4RTMA 4K9PA 2FRVA 4BS9A 2UVPA 2XWJI 1FL9A 3Q0EA 5GMOA 1DDIA 2EV9A 1XVIA 2HUPA 1SRQA 3AGQA 2QMHA 3CISA 3FSRA 3L8GA 4LCJA 4FS3A 5EZSA 1RYYA 2IUEA 2ZYDA 4Q03A 5JZMA 4XDYA 2HSJA 2IK8A 3DB2A 3DO5A 3GGJA 4G8DA 4R0VA 5SZHB 1C14A 3OZ7A 2MTBA 1RJGA 3VX4A 5GGXA 1NVUQ 1VIDA 2G82A 2YHIB 2RGWA 1E98A 3OF2A 4IJ6A 1SUIA 2IIVA 3FRJA 3IESA 1ZZEA 4NIMA 5F7ZA 1VSTA 1X13A 2PU5A 3FBTA 3LQRA 1G2IA 2GCIA 1XZNA 2GZ1A 3GQBA 4KUEA 5EEGA 3CX4A 1ZRSA 3LRXA 1C8BA 1OV4A 1LNZA 3QEJA 4HO1X 1UT8A 5F12A 2CHQA 3RS5A 2WYVA 4OB7A 4ENRA 2ZETA 4FDVA 1OY1A 4KPFC 5CFZA 5D84A 1OXXK 3RPEA 3GFGA 4U9HS 5HQ3B 5LP6F 3TM5A 2VS1A 4ZOEA 1ECBA 3B82A 1C8LA 4N18A 3TJZA 1DKRA 1JE0A 3DAHA 2EBWA 3B9BA 1LBTA 2W5UA 3T1TA 4HZGA 3LNCA 3BRCA 5HGXA 3MSCA 2ETVA 4UVDA 4RVNA 4YYZA 3GA0A 5KWEA 3MJTA 4PLYA 5AKKA 5C4IA 3VPAA 2GARA 4MPPA 4XJXA 4UCWA 2BAGA 1Q1QA 4AMBA 4DKJA 3WJ7A 1RU3A 2AD5A 2LRHA 2O3UA 1NYLA 3FLBA 1GFWA 1OFUX 4MGYR 2UVQA 4IOJA 1HGXA 2QR2A 3PFNA 1MB0A 1NVGA 1QYVA 1KAMA 3GO4A 4EATA 4ADSG 3H2JA 3IAS6 1IPFA 1I2CA 3EWSA 5B12A 4IKOA 2TMDA 4J76A 2FETA 4R9SA 1ZITA 3DBRB 1N5RA 1GG5A 2VPYA 5DXAA 4PNPA 2MYNA 5AI6A 5A5DA 5I4IA 5I9LA 3I1FA 2PBFA 1Y5LA 1RRGA 4H08A 5DM1A 4DMCA 3SHTA 3L7YA 5J3JA 1XPRA 3KV3O 1LDNA 2AMYA 1DRUA 4DVGA 1ZVVA 3FCXA 4F5EA 1XMXA 2J4DA 2WUVA 4PAQA 1UADA 1CUHA 4W8HA 1X1CA 1WCXA 2EGGA 2PMWB 1PE0A 1DEKA 2YOFA 1X15A 3ED1A 3JQAA 3PFKA 4JWTA 2CK3D 2WMYA 3CPJB 4JB3A 4NNPA 4MI6A 3CRNA 5ECGC 4QO7A 1N7GA 3KYDB 4OSPA 2XBUA 4MJLA 2IPMA 1PNQA 3IHKA 3G17A 4YJ3A 1GAEO 3S7ZA 3AR3A 2F62A 2XTZA 2Y0DA 3QEBZ 1EHCA 4D8YA 1MB4A 3U17A 3PC8A 5EJ9A 4TKZA 4XWWA 2P4UA 2H4FA 1UDAA 2WM3A 3V1MA 4F5ZA 2GPWA 3RRZA 1TM5E 3W6PA 1QIHA 1GEGA 5A06A 5BWOA 1ZOOA 2J48A 2G88A 1ZM4A 4YPVA 3ICQB 5EJ4A 2Q3BA 2QROA 4J94A 2YXLA 2R6JA 1N6OA 3GFTA 3GQBB 3PQFA 4KR0A 4XM1A 3PJDA 5H59A 1SUDA 1YJ8A 3V9PA 4IJQA 3VR6H 3SAJA 3CUKA 1J0XO 2XCSB 2GRJA 4HDSB 4HDMB 3BORA 1SHLA 1YU6A 1LY1A 1TQ4A 1UMBA 3CZCA 4Q34A 3BSSA 1ISIA 4Z9YA 3PDIB 1MVLA 5CX1A 2ZZNA 2W70A 3SHFA 4QAJA 2VWPA 3TIGA 2YHUA 3S68A 2X3YA 4EG0A 5HPYB 5HUJA 3V4RA 1JHZA 3Q85A 3OOEA 3QLUC 5ULLA 4TN1A 2C5BA 2OWDA 3A70A 2QN6A 1ICIA 3KAPA 3QVUA 4LY9A 4PRYA 1QHSA 4MUGA 5ICCA 4TZ0A 1MNQA 3AXTA 4LJ4A 4QARA 3LQ4A 3OLWA 4M55A 1XK7A 3ABSB 3RSSA 1PFGA 2NQ2C 3NOXA 4EIWA 2VRCD 4OAQA 2V1UA 2WEKA 3S3TA 2EWMA 4AZ0A 5IN4A 4XM2A 3WWDA 1T5OA 1U90A 3IP8A 2Y9PB 1CUCA 4CN8A 5ADHA 1KORA 4R2KA 3TSZA 1SWVA 2Z6QA 5IMBA 4X71A 1VCOA 1JHQA 4DJEC 5MFPA 2H11A 1CUVA 4HRYA 1QIEA 2H4XA 1TL7C 3AT1A 4QNNA 3SHVA 5KTOA 1MF7A 5BR4A 4HUJA 4Q3AA 4B81A 4J1NA 1X38A 1H9CA 1M1XB 2P6PA 3L43A 4F8JA 1GITA 1FTWA 2V4UA 4BP3A 5BNZA 1CP3A 2BFDA 3SF8A 1FRZA 1FX0A 3ZBTA 5JADA 3DFFA 2JRCA 4HTFB 1ID8A 1JTEA 1MFPA 3FUUA 1WBJB 1ZGBA 1C1HA 3ZD8A 1YZTA 2JAWA 3K53A 3P71T 3FZYA 4ASUA 2JBAA 1EJBA 3AUSA 3OF3A 3PC2A 4IM7A 4JSYA 4EG6A 3KVOA 3KEFA 4G07A 4LHVA 3TR6A 1U2RA 4RD1A 5CD1A 4YJ3B 2E6UX 2E5WA 2QU7A 2DCMA 3IUSA 1PL6A 3ZDRA 4B47A 2MSLA 3L5KA 1IJEA 2JL1A 3PHHA 4D9EA 6GPBA 5IULC 4X6UA 3TIVA 3B85A 2DQKA 3KCQA 3F4BA 4AF7A 2VG8A 4F06A 1OH5A 5IM5A 2BUBA 1MAHA 2C94A 2Y6UA 4RL4A 3NDRA 3A6GA 5I9MA 5JJ5A 2CBXA 2L42A 2YQ5A 1RMYA 2D2IA 2GVDC 3E0XA 3KPUA 3T7SA 2Q5OA 1Q0LA 3BXXA 4G5FA 5TMEA 5K0NA 4KO8A 4MAMA 2WD9A 2PIAA 4FI3F 1QQTA 5KU1A 5FB3A 5J5AA 3NTXA 1B15A 1VCIA 3EFBA 5GOZA 3V3KA 2RGNA 1UQTA 3QWHA 1MJGM 1Z6GA 4ZTBA 4YUZA 1IVYA 2CXNA 4XSHA 1CE8B 2LV8A 4W5WA 5JYBA 2OBMA 1D7AA 1DFIA 2EZ4A 2ZCVA 5CX1B 5CNJA 1JA9A 4IXMA 4WINA 2RJOA 4HDQB 1W30A 1N1GA 2DBYA 4L5AA 4QPZA 4ZMRA 3B36A 4HXYA 3R0XA 1ZIPA 2PD6A 1QM5A 4JI6B 1A4XA 3IKLA 1XEXB 4Q7QA 3QOYA 3DXFA 4BNIA 1IN5A 1YI1A 4HD8A 4ALNA 1X1BA 5DHTA 4IG4A 4Z8XA 4GR4A 1NULA 2ORVA 5BNWA 1QIDA 1U1GA 3IQZA 1LA2A 4D41A 1PJCA 4EW3A 3VR3A 2A33A 3USES 1Y89A 3LQ1A 5EN4A 4AZ0B 3C2QA 2A5YB 4XA8A 3A9SA 5K1ZA 1RI5A 5CBKA 4PM4A 4JI7B 1V8OA 1WV1A 4HCJA 3GA5A 4JSTA 4JA0A 4TTQA 5E95A 3I58A 4PSVA 1GZ6A 5EFOA 4YMGA 1YUBA 1UBUS 1BDBA 3ONVA 3QWBA 4NV3A 1VKJA 3W3AA 5GONA 2NYAA 5IFLA 2L17A 4YROA 4WSOA 2Z57A 3WGMA 1UINA 4R68A 1XEWX 3KK0A 1NVEA 3AF3A 2B4RO 1OFGA 1XVAA 3L0IB 2BFDB 4REQB 3SF8B 1C7ZA 1FX0B 1YGPA 3HBLA 1KJ8A 1RTKA 3KJFA 2EKBA 1HX7A 1A50B 2IELA 2VJBA 3DKVA 5K99A 1Z2CA 2BCEA 2BEWA 4U7WA 3KKMA 3WAGA 1J9EA 4M8NE 3ZR4B 4UPVA 3WGLA 1XB2A 1TO6A 3EDCA 2R8XA 3OWHA 4O2BB 1IU9A 1M83A 1QHYA 1U7ZA 1FE8A 1Z3CA 2Z4SA 1E2HA 3NWBA 5AD1A 5CDHA 4TQ9A 2VI5A 2PKQO 2B0JA 3C3JA 4GKJB 2C00A 2JFWA 5L4LA 2I6TA 1SVSA 2RGEA 4K0RA 3FCSB 4FMPA 3QKRA 2PZKA 1IZ7A 1I9GA 2DFDA 2D1FA 1C9NA 3N2NA 4FFNA 4KPGA 4NE7A 3DO8A 3DMYA 3LBAA 4QYIB 5DMXA 4EZIA 4A8HA 1T6BY 3FGZA 3BGIA 1JGTA 1J4AA 3NWPA 4NYJR 1QG0A 3CW9A 5CGZA 3VX3A 4GL2A 4KQEA 5G4LA 3RC3A 1H6AA 5KOJA 3N76A 4PHFA 2OCGA 2GJ8A 4QDTA 1AHPA 1M76A 1QOQB 5TPWA 3L4KA 3FRHA 1NJFA 1WLSA 4I8DA 5DSTA 1QIMA 1JQ3A 4JZKA 1VDMA 5DFAA 4ZIRB 1KK3A 4BN4A 1NFRA 2QW1A 1P1FA 1L5OA 4B80A 3HI6A 1EFTA 5EE1A 1P31A 2WWXA 2W00A 1KXJA 3OESA 1VLMA 2O0JA 2XRFA 3A7DA 5AT1A 1GYPA 3T7TA 2R751 3ILSA 2A67A 4TTAA 4TS9A 1TAQA 2LZ0A 1U2QA 4DMKA 4ZYZA 5A02A 3QUAA 2X5NA 1NURA 3OZRA 2V6BA 3UOGA 5BOSB 1NQOA 5ICGA 2BGIA 1NJ5A 2Q62A 4FNGA 5DJ5A 4ZEVA 721PA 5TX7A 1EVZA 5ITZB 3N05A 3ROFA 1QKJA 5FO1A 2GYYA 4CG0A 3GUHA 4GQBA 3WQSB 3B2NA 4NE2A 2O20A 3ETNA 4YRLA 5DTJA 1NKTA 2BGMA 4I36A 2C7GA 4CUJA 3BT7A 4KDCA 3HYSA 3PJGA 4P80A 5G41A 4QSMA 5GONB 5EMJA 1RXUA 2XCTB 4OAPA 1TK9A 3AL3A 4QYTA 5AHRA 4DBLC 3LCJA 4P4UA 5C52B 3Q7SA 1X1TA 1O6BA 4H6VA 1B76A 5EIFA 5LUAA 1F1JA 4ZT4A 1US8A 1NXSA 1KZGB 1EX1A 2W6ZA 2QXUA 2FUEA 1C1XA 2GPJA 3NKLA 3W8EA 5JJCA 1YQDA 3GHYA 4TS3A 4TT3D 3LUAA 1NVKA 1TIBA 2NTNA 5M29A 1BFKA 2YWJA 3AY3A 1ZESA 4OUDA 4I08A 1PTJA 2OG1A 2ZBPA 1ULTA 3SXUA 3RUEA 4DHEA 1WBDA 2VT7A 3IUNA 3NM6B 5AKHA 2WT9A 4P33A 1LV7A 1M74A 2B82A 2PZFA 3C41J 1CY6A 2VHEA 4J3JA 1PSZA 2INGX 4O3FA 1MNAA 2JFZA 1BU8A 2H48A 2HCRA 3R1IA 1LV8A 3L06A 4LMBA 3W3AH 2YHSA 1V8BA 3L7LA 4UEJA 1MMFB 3GJ7A 3ZV4A 2DT5A 2ZVPX 5HDBB 3SVLA 2UXBB 3QKRB 4F71A 4KKXB 4IILA 3PICA 3N28A 4WXPA 3TD9A 3GT3A 4UTNA 5F5NA 4PV7A 3OLZA 1JBEA 1G4UR 3HLYA 1U2GA 1Z0SA 2PS0A 3K20A 3ZWMA 3MS7A 2WE8A 1Y3DE 4JLNA 3VZDA 4MAAA 1KFCB 5IMSA 2YVKA 4YCNA 4K3UA 1CF4A 5G0UA 2F8MA 4Q4DA 2D59A 5LLSA 5TPWB 4B5LA 5ICSA 3AXSA 4RY2A 1EWKA 3C15C 3IIEA 2LPMA 3OPNA 3DKIA 3T3EA 3G7SA 4F9GA 3CTMA 1Y3BE 2DLNA 1A7JA 4R9VA 4QATA 1JWBB 1LVHA 2PXHA 4GG1A 3RAPR 4ZALA 2HK6A 2BFPA 2JGJA 4YRZA 1Q2XA 3HL4A 4WFQA 4RSMA 4DR4B 2EW1A 3ZVLA 4BMZA 2IH2A 2GPYA 1QU2A 2JJYA 2OQ2A 4A92A 4KYUA 2P2NA 3E1SA 3S55A 2JJMA 5LM3A 3CNOA 1YOBA 2JA1A 1ZI6A 1EG2A 4J1TA 4Q3DA 1IMOA 4ZI2A 3HKEA 3CRQA 4BJ1A 4YCDA 5DBIA 3D6JA 3MERA 1BMFD 3WB2A 3H17A 1Y8ZA 4CVNA 2YXEA 2Z8ZA 4IJWA 1G6Q1 1SHUX 2AUMA 2HHAA 5PGMA 4LYGA 4PSAA 5U4QA 1M6EX 1Y4ZA 4JI3B 1BDHA 4NONA 2YHAA 1EFHA 2XYVA 4AMVA 1V5WA 4NICA 1P9OA 3IOMA 3RSHA 3DA8A 3FPBA 4A6EA 4YJDA 4ZT5A 3KX2A 4YMLA 5BSVA 1C1XB 1GTL1 2UYOA 1GLVA 2AYXA 3IT2A 2H4YA 3R5FA 4WXRA 4S3MA 3A1SA 3GMTA 1DLIA 1MX5A 4BBJA 4OCZA 5AJXA 4UVIA 5AXBA 1T5DX 2J85A 3BH6A 2EDCA 3GGOA 3ZCSA 1R1DA 1P2TA 1WCWA 1Z34A 2OR3A 3SXUB 2DR2A 2VRBA 4XWYA 2IYUA 2NXCA 3E9QA 5I9IA 2VQ6A 1XMSA 1REQB 1EUDA 4P31A 4X8MA 1QIKA 1CUIA 1IEWA 1MX1A 1TJ3A 1WXDA 3ZGVA 3WFJA 4DMMA 2IHNA 3HS3A 1Q19A 4BNJA 4C01A 1H22A 2VIIA 4HGYA 221PA 2VPQA 4EW1A 4U2GA 3RJZA 3TOSA 2A3NA 4DLVA 2V03A 1B8NA 4PIMA 3FMPB 4DG5A 2C9BA 2NYUA 3IVMA 4NZZA 1XTUA 4I8XA 2IHUA 2UDPA 3EIWA 3PV0A 2HN9A 4F9FA 2ILTA 2BFWA 1EZ4A 3RWOA 4QWMA 4JA2A 3VJKA 1CFZA 1N1MA 1E79D 1R8QA 3MWDA 2H0AA 1W7AA 4RZ2A 1AXRA 1UBLS 1TZ2A 4AICA 4XFJA 4TVOA 1GUDA 4XAQA 2Z4RA 4QOIA 1NW4A 1HETA 5E2AA 3WMEA 3BWBA 5LQNA 2Q7OE 3PDWA 5KYWA 2AX4A 2ZLBA 4Q3NA 1W25A 4X45A 3NM4A 3OX3A 5ECDA 3ZQ4A 1DC3A 3BFXA 4B46A 1SOWA 4CTNA 4HH3C 3SC2B 4Y7DA 2OHJA 1YMQA 1HE3A 1GZ4A 3VC7A 4LAFA 1BH2A 1IXKA 1J0EA 2D74A 3NTUA 3QXXA 1M2NA 3WJ2A 4CQMA 3WVNA 5BSWA 3W77A 4QPCA 1J1ZA 3GJ4A 4DIDA 2OZEA 1L7PA 2QS9A 3LY5A 5DX1A 1P80A 3T54A 1L5FA 2GXQA 2COUA 2JK0A 2V7PA 1LI5A 3H65A 3IAUA 3MD9A 1DJMA 4LISA 4XXHA 1R6VA 1M8FA 1P62B 2CHEA 3CR7A 3UB3A 1CZRA 1FTYA 4QJIA 4WX2B 1U2DC 1EX9A 2G04A 3P4YA 2R1ZA 1EWTA 1P61B 1U8ZA 4UM9B 1GNTA 3EPJA 5DB4A 2YRWA 1V5IA 1YR1A 2X1HA 5IU6A 1Z22A 3AF4A 3QEOA 2QMEA 4A8JA 3HNRA 5C8XA 4ARIA 4R2JA 5E7QA 2O19A 4RGYA 1IOVA 2YWGA 3L07A 4WBNF 2A0KA 4J1QA 3T9CA 4BEBA 1IHOA 1ISGA 4KE9A 1FUIA 1ZMOA 2COKA 1KI4A 4RXUA 3NWJA 2KMLA 3E9MA 4UNIA 1FU7A 1YJCA 2OO5A 5CAEA 2J5XA 1P6UA 1Q3TA 2J41A 2Q3JA 3KT0A 2PUTA 4M1TA 1ESZA 3I4CA 4P7FA 4M36A 4QFDA 4KR6A 1EUDB 2IYXA 5CURA 5TS2A 1PJZA 3OZEA 1CZUA 2B2NA 1SBTA 3KQWA 1SXHA 3S2IA 3WKCA 5I9TA 1E2FA 3B6JA 3GVXA 4PYNA 3LAWA 4W7IA 1ZY2A 1FVOA 3BEDA 1TFRA 4NE9A 4ZAWA 3V8MA 1P0CA 2WILA 3PC3A 1S4QA 1FP6A 3NVAA 5G3YA 4IGAA 5SZIA 2FSVC 1UJ6A 3EIHA 3RT7A 3DF9A 5JH7F 5D1NA 2XNDD 1WPGA 2EAUA 4XUEA 3V2GA 3VVMA 1TQ2A 4CMBA 2QTWB 2YASA 3ECAA 3CA8A 3TDMA 3SKXA 4EGJA 3DVLA 3E58A 5AM3A 1NI5A 1XTVA 1G8FA 3BBPA 4KN9S 3O8NA 4OFZA 1J6UA 2XQVA 3N0WA 5KYWB 1H0HA 3R4VA 4WE3A 4X3OA 3ZVMA 1C4XA 2BDUA 2IF0A 3HRKA 3A1UA 1CT9A 2IYYA 1XF1A 4JBHA 1GZUA 2DOKA 2M6RA 3E4CA 4UMFA 1GZHB 5B58C 4TYQA 1RI3A 1U1IA 3Q98A 2B8EA 2K4MA 2ZBUA 1QH9A 1GGNA 2Z2XA 3N8GA 2XWSA 2C1EA 4FZVA 4JLPA 5JD3A 3A4LA 3A58B 2LTAA 5DNVA 5FT9A 3TTVA 3VNBA 2XRZA 1PVOA 4S04A 1KA9H 4Y2RA 1ABFA 4NARA 4JYAB 3IVCA 4CODB 3EISA 4YAOA 3PNVA 3CIOA 5CVCA 2JZOA 2YQ4A 3WX0A 4Y6RA 1AGNA 4I4NA 4EHFA 5MHTA 2DHCA 3GELA 5B58T 4KLNA 5H4GA 4ZZ0A 3QUBA 1O4WA 3DP9A 2H4HA 2WV7A 3GEDA 1F0PA 1HZJA 1UPCA 3QXGA 5IZCA 4RKEA 3TECE 3HJFA 1PP4A 3M2TA 2QLNA 1DRWA 3GEBA 3P9ZA 4DC0A 4ZVMA 4C1BA 4JKYA 1A8PA 1XCLA 3NV7A 4IIUA 1V6AA 4FYMA 4IIBA 2J9GA 4TOIA 5AUOB 1P9NA 1JMKC 2CXOA 4A8JB 4RAQA 3EVGA 5JBIA 3ZI4A 2Q8PA 1ONBA 3AKYA 3TSWA 4GFDA 4G0MA 4BFVA 2LDBA 4ZO9A 1NHWA 4LTDA 3V00A 3O03A 1UF9A 2HHLA 5AOVA 5LIRA 1OV6A 4KODA 2O1EA 3NDPA 2XD9A 1RFLA 5IM4A 4M7OA 5DGCA 5L8VA 5CAEB 3K1JA 3W5CA 3M3PA 3PWSA 1KYTA 3PE6A 4P81A 2QYTA 1OZAA 4HR7A 3LHFA 4HAUA 4JBXA 4OLHA 4CKBA 4YRGA 4FDMA 1PWYE 1VKHA 1ORWA 2DC1A 1ZI9A 5AW0A 4BXOA 4KTTE 2XXAA 1JQBA 1PZGA 1A9QA 5F52A 4RDXA 2VRNA 2P2DA 4QXMA 4QDKA 2DBZA 4JBGA 1G291 4G5HA 1ZJJA 4XTCS 2YNMC 5K0FA 2WIDA 2I9KA 4FD3A 2AZMA 1E32A 3OOHA 1SB8A 4DCSA 2HRBA 2CZQA 4ZOCA 3SJZA 3FTDA 2X9VA 4OQEA 3JSAA 3G8BA 5E1MA 3SCZA 1FP1D 4G81A 4W1PA 1KBOA 2IDJA 5LMZA 2W43A 3N0RA 1XMPA 5EPUA 4KQMA 1DFGA 2H4WA 3R8FA 1RQPA 1VKOA 2NU7A 1KEUA 3G0HA 3IYLW 4HNTA 1ATZA 3R20A 4I5EA 2WVAA 1T2FA 3D0QA 3NIDB 4FQ7A 1BQ3A 3N8KA 3H04A 2OESA 4NBLA 2HADA 4N49A 2PNFA 1PLJA 1EDDA 3U6KA 3UJ9A 3KQNA 3VDNB 4EI8A 2ZAIA 3JTEA 5JR3A 3M0EA 2DQYA 4IO0A 3D7SA 1JHAA 1IWOA 2B92A 4PGFA 4GVPA 4YP9A 4EL0A 3EJWA 4KOAA 3ZBUA 3LE8A 5IT5A 1FYWA 1VMIA 4J1SA 2FV8A 1KYQA 4MV1A 1JHOA 3DOOA 3WK9A 2O2SA 1R5OA 1F3LA 5DI3B 4CTKA 1PDWA 1JFVA 1WHTA 3K9BA 3AKCA 1WV0A 4WOJA 2GWHA 1G20A 3LNTA 4PLHA 3QX9A 1T4CB 2XHEA 3H1TA 3SHWA 5KIAA 1FFXA 3UAOA 3OOYA 3PQ7A 3S70A 3WL4A 2FOIA 5CDGA 4FW8A 2AW5A 4ZV4A 5SICE 4HLNA 3RC8A 5FA5A 4RGQA 1SXQA 3AR2A 3UW3A 1XQWA 2WKWA 3SX2A 2NSJA 4K05A 4U8GA 2BMVA 2Y3IA 3PFIA 4GLBA 3B3FA 3U26A 1AD2A 3VR5H 1QSGA 3C85A 1ZWKA 3TLGA 4BEWA 1AV7A 3TRJA 5HE9A 4LC1A 2EERA 3GVPA 5BN4B 2NVWA 2Q3MA 4YRQA 1TCVA 3EA5A 3HDHA 4ZT3A 4HVCA 2NUTA 2HHCA 4RADA 3RASA 3M89A 2FK8A 4GOMD 3EGDB 3JASA 4GMHA 4HWTA 4PS1A 4V0LA 3FE2A 2QPLA 1ZJYA 4QRHA 4ZT6A 4R2LA 1Y1QA 2DWUA 4YJKA 3VKFA 4WAUA 1IZ9A 2W71A 4RCVA 4O29A 1KE2A 4CKBB 4BXOB 3BL6A 1QF6A 1BE0A 1RCTE 2Y77A 5F5LA 3PUIA 4TUYB 5CFOA 2BM1A 1QJ4A 2H1LA 1ZJWA 2XXAB 3AW8A 5IFKA 1SJ9A 3ICCA 1N9GA 2HSDA 1ZA1A 1T13A 3DEHA 3HUFA 3T38A 4L3WA 2QT9A 3NUGA 4XQCA 4YRTA 2R2GA 3DHWC 1O8CA 3FDJA 5CK4A 5FBZA 3UAGA 1CQPA 2P6UA 5HF5A 1UOQA 4LY0A 1YTUA 2REBA 1YU9A 1ZH6A 2ID8A 3IIIA 2VQEB 2J3QA 1RW4A 3B7PA 1HSOA 3CLSC 1WEKA 3TQFA 5HCUA 2VP5A 1YAJA 2BFFA 3HB4X 3NTOA 1JYFA 4TS4A 4FEGA 4TWZA 2R60A 4L22A 4E2WA 4DFDA 4QUGA 3TQQA 5JATA 4WERA 1MJGA 1OU0A 4R8KA 1EESA 1KC1A 1RAAA 1U94A 4Q9HA 3AHGA 3QRWA 3H6GA 1LPOA 3JVUA 2E4VA 2PKRA 4JLKA 1LZLA 4TPKA 5BYBA 2PSDA 3T5GA 3CMCO 5JAHA 3LC7O 2XCIA 1S9DA 3C70A 3SLRA 4X7RA 3CKYA 1ZN7A 2QJOA 1AC5A 2ZROA 3OZAA 2CVQA 3UUFA 2XVYA 2ZCUA 4JEMA 2P65A 2DQZA 3KEMA 4KSCA 3AK4A 1KIAA 3A11A 4TWAA 3IEPA 3PS9A 2RHHA 4XSVA 4CWAA 5LOVA 2GBCA 5AQEA 2FG5A 1WHTB 1PEYA 4KXVA 3LYUA 3LBHA 1G20B 1OIWA 2X5KO 4X1IB 1XRPA 2XJ4A 3TLBA 3WL8A 1FFXB 3PQCA 3AHHA 1YL6A 2NQTA 3PXUA 4TKMA 3VKVA 3VNRA 4YVFA 3ADOA 1SHTX 2GH1A 3U44B 4ASUD 2OE2A 2VO1A 3IP9A 3WBBA 4BQRA 3RVLA 4F5YA 4F92B 4HS9A 2EFJA 1NY5A 3OTIA 4UE2A 2G9RA 4RA6A 3TLGB 1HE4A 1E6WA 4IVQA 4LSMA 2ZJAA 5REQA 1E4VA 1LW7A 3ETCA 2Y0PA 3FAZA 3N3BC 3JASB 1UBGA 2QAJA 4MMZB 5EE5B 1NW3A 1K75A 3BJEA 1L0BA 3D7KA 4KK4A 5EE3A 2QVCA 2TMKA 3KB1A 4UMEA 5JMOA 4KQCA 3BFJA 4RQBA 4K6MA 3EZ9A 5BSUA 1ML3A 2VYQA 1F5NA 2YWDA 3KKPA 2H4ZA 2X5XA 3NG1A 4JNCA 2XA2A 1QNFA 2G1KA 1NDQA 3ZNNA 2AWNA 3KPVA 4DV2B 1MO5A 3Q2OA 1IJKA 3I6ZA 4MWZA 4QWWA 4EENA 1T4BA 3ZDBA 2W2NA 3RVNA 5JSYA 2W6MA 1MZVA 3BE5A 4GPEA 2I87A 4PAWA 2HEGA 3OZVA 4EA8A 4EUKA 4AKGA 1A9RA 1N8NA 4P36A 2GCPA 2WD7A 2CFCA 3ENKA 4EMBA 8MHTA 2Z95A 2BFFB 2Z56A 2JHGA 3G2JA 1PV1A 4B6FA 3GEMA 2CKDA 3ZHUA 2BGJA 4JR1A 5C8YB 4O2AA 5J4HA 1TW3A 1ZK3A 1Z3IX 4RANA 2PWZA 3O91A 4ZI7F 1Y80A 3P32A 3WYGA 2C5AA 1S1CA 2WIJA 2QMYA 3VR3D 4P0TA 2REXB 4Q48A 2OZLB 2XKKA 1SB9A 2IYFA 1IEXA 1WF3A 4OGGA 3ZNPA 4CT4B 4EMUA 3P5SA 4F2DA 3PHBE 2FWJA 2EQBA 4Z4FA 2B2XA 4KUHA 1H65A 1NN0A 4X61A 1JG7A 4YLYA 1FNNA 2VFAA 4BHTA 5ALUA 2R9VA 3NCTA 4G0PA 3A2NA 3MRTA 4KWHA 4RHUA 5HG0A 3KBOA 3SS9X 3SWWA 2BFMA 4ABTA 1Q12A 3N8IA 1YONA 3PL5A 1KO8A 3GVHA 5CA1F 2C3OA 3UH0A 4M9ZA 3FI0A 1BE6A 2QQFA 4ARSA 2WF9A 1G5PA 2GM9A 1CYEA 1IC6A 4BO5A 1D2HA 1DWOA 2KLBA 2WIFA 3DEIA 3P8ZA 2FCRA 3JQ6A 2QL7A 1JPJA 1YHYA 2QRQA 3TJMA 1QU3A 5CVEA 4U0KA 4GZ6A 4AB1A 5HZKA 1OH6A 3SC3A 1D5CA 2XOKA 1H2YA 4V2IA 1CD5A 2A94A 4QOFA 1CRZA 4DCUA 1SVOA 4PYIA 1E9AA 3HXQA 2IF2A 4NBKA 4MS1A 4PYQA 4PZAA 4CF5A 3EAFA 3H5WA 3ABOB 5KKAA 3O2JA 3K6RA 1HQKA 3CF6R 3FCAA 3ORSA 4K8OA 1WDTA 4NATA 4A7PA 3MWKA 3DQQA 1JAIA 5JFOA 1TMOA 3IKTA 2B69A 1R0CA 2QG4A 5CITA 1WMFA 1PBTA 3F6BX 4IJMA 3A4IA 1IBCA 3IULA 3LKBA 4Q7MB 1IM8A 4ZT2A 1RI1A 5D5HA 4PYJA 5A7HA 3OM9A 2ONCA 4U02A 4D3DA 2AXNA 2G5CA 4AU1A 4LZJA 4G4SO 4MWEA 3MUOA 2WW8A 2ODWA 4UDOA 1FXWA 3EOZA 1OH8A 2EW2A 3GA7A 5GADl 2PMFA 3SU8A 1P44A 2I4IA 3DFKA 2DP4E 3T0GA 4EBBA 1X70A 1SQSA 3FETA 3O83A 2WD7B 5HKLA 3B1YA 3AUXA 4RH1A 5AR1A 3V7FA 2FVXA 3C1TA 4OD0A 1ZONA 1AKUA 4R1UA 3BK1A 4J29A 1OXKB 2VF8A 3CWCA 2PX0A 5GP1A 2O7QA 4H18A 3PKZA 1Z75A 2O05A 3QMWA 2PZMA 3GLIE 4FNMA 2VSFA 3W6ZA 5HNKA 4RTJA 1XZEA 621PA 1DEAA 4TMXA 3RVQA 4PZDA 2Q1SA 3OMXA 2JAQA 3LVFO 1LLDA 1JQKA 2DUUA 4LG1A 1Q44A 1P0IA 2JW5A 2O1SA 2OORC 2ZWMA 3D3NA 3G2MA 3I72A 3K73O 1P1JA 4F3YA 1EQAA 3EHDA 4UFNA 3GAFA 1OIVA 2B8NA 4P98A 2QTZA 3V6MA 1EA5A 1W52X 2A92A 1BTOA 3IALA 2IPAB 4B3RB 4EJ6A 4UZEA 1JFSA 2G9ZA 4MWGA 3KEGA 1IY0A 1NGSA 3OHPA 1CLUA 1I2ZA 1KEWA 4MVJF 4ZGWA 1G59A 4CM4A 1E66A 3GJ5A 3OCJA 4V0KA 1UKBA 2ZS7A 2RHOA 4FIDA 2AFIB 1FXUA 4B4KA 2GKOA 3BHIA 4F21A 3R75A 1VI6A 1D0SA 2XLBA 4WZ6A 4KH1A 3TQIA 3KXIA 5EYPA 3PHJA 2QSUA 3B70A 1OYWA 4MS1B 5E3IA 2M1XA 4UXJA 3ZEIA 4F9EA 1Y9DA 3WLLA 3KAQA 5ANRB 3HJCA 4ZAFA 1K4YA 3T3MB 5B6JA 3BIJA 5EXDA 2IYWA 1L5GB 5FWNA 2OSBA 4UU0A 2DR3A 4ALMA 1IPHA 1LQTA 1UJ2A 3KWLA 4PW0A 1EEHA 3REFA 3LK6A 5KNBA 5GIOE 1KU6A 1YCGA 3O1LA 1PQUA 1GNVA 3NFYA 4JXJA 3EMKA 3JQ7B 4GNKA 4UUOA 3WDLA 5CVTA 1ZSNA 1UWCA 1M2GA 3B6EA 3K0SA 3ORHA 1L8OA 4YRJA 1DQPA 5DDIP 4KSBA 2V7QA 3VU3A 1BGWA 7MDHA 1NI4A 2ZJ6A 3I05A 3H1GA 4EJSC 1SKYE 2R2AA 4DWVA 3LOUA 1XWFA 4GP6A 3MQ2A 3RFXA 2SKEA 1ONNA 3HYTA 1T6NA 2WM2A 3ND8A 3IEXA 3BJRA 3R5TA 2PZLA 2RDMA 4B8WA 5HP4A 4BE4A 1UBFA 1YNOA 4D9GA 1YS9A 1MEOA 3CEPB 3WB9A 3ONEA 1SKQA 3WNCA 3DMDA 4KVFA 1C3EA 1F0KA 4RHFA 7REQA 1PS0A 4LV5B 3IBGA 3U39A 5A0VA 1RM5A 1S0UA 1M9NA 3HK2A 1CZKA 1RABA 1FFCA 2I1VB 2OCAA 3BF8A 4MAFA 5AUQA 3UFXA 2X2OA 3MJEA 3LF2A 3FYTA 1JBQA 1J99A 1WCYA 2JLRA 3ZWOA 5K0SA 1GL9B 4KGVA 3SF0A 2ZUBA 1SCNE 3DAFA 1FU4A 4HEA1 4Q66C 1G9TA 4BUZA 3CLTD 1U3UA 1TU4A 1JP7A 2P40A 3IBYA 2EXXA 4WN9A 3UAVA 3TG2A 4WK2B 2Y1EA 4JBLA 1JUDA 3D5EA 2O8FA 4QOEA 1LX7A 3P19A 1H66A 1L5QA 2P2LA 3H7IA 4UM9D 4Y1FA 3OU6A 4A0RA 2I8CA 3H11B 4RYLA 3WO1A 1UFOA 1P39A 2TMYA 1XCBA 1Q0ZA 4ATNA 5ER6A 1L1QA 1MB9A 1B8PA 2C96A 1EI9A 3Q87B 1SHZA 4RPCA 2W7TA 4W9MC 4QRIA 1VJCA 2OOKA 3OA2A 4CM4B 1WRBA 2QMZA 2ZAOA 3H1PA 4ZO4A 2GEUA 2VA9A 3RAGA 1N75A 2AJTA 3TIXB 2Y1CA 5TDHA 3VVLA 1DAFA 3QKUA 1NLFA 4AY3A 1INLA 4JGBA 2OVFA 1A98A 2ODTX 1DU4A 5EYPB 4BEVA 2HV9A 1POWA 1UKEA 1EVJA 3GBSA 1B2RA 1XKTA 3AF0A 1F2UA 4Q4AA 4H0CA 3ZLVA 4LJLA 3H0CA 1I7QB 3NORA 2FOXA 4DLBA 4LHSA 5FUYA 1NVXQ 1KK1A 1GRCA 4N8DA 3EDQA 5DHQA 1J8YF 5T4EA 3U7HB 1KEVA 4E09A 1V5GA 2AHRA 1MV8A 2G67A 2K5UA 4WMLA 4TRJA 1U3CA 1BS2A 1W2HA 3P2MA 1EGQA 4AN1A 2IUUA 3QVLA 421PA 3ZHVA 1ULAA 1XF9A 3L7OA 4DYDA 1QHGA 1XAJA 4YR9A 1NI4B 3I39X 3HHPA 1O97C 3MCTA 3UGTA 1WCIA 2Q5QA 2H7CA 3D3QA 5TNXA 5AM1A 4CZ2A 1FRNA 2P9EA 3BMXA 2EJVA 4G5QA 1PW7A 3WR5A 2Q8QA 3TLCA 5BMOA 5TF4A 2YYYA 4LY3A 3UCEA 2VQSA 3MTIA 1QP8A 4YUYA 1XA0A 2HCBA 1T5HX 4YYEA 4B2YA 1Z0DA 2WUFA 3BJZA 1NATA 4URZR 1GOTA 3T1YB 5KNBH 5IT9A 1EXVA 1VSVA 5LJIA 1KMQA 4CQMD 2VCHA 1EP9A 2FPGA 5AI5A 1QGYA 3W7BA 3WKBA 1NUUA 3UFXB 1YB6A 3OZCA 1Z36A 2IRWA 4YAIA 3EGEA 1N78A 3LL4A 1LEHA 1RQ7A 1KO1A 1GY8A 2QRUA 2HHJA 3BZWA 3DE1X 3F2IA 3IEUA 3KM0A 4YQEA 3A0RB 2D8MA 3TVYA 2ZIVB 2F4VB 1VP9A 1NF8A 3K9GA 2QU8A 1OPRA 3RROA 2O8FB 5JEDA 2AJCA 4DQDA 4CG3A 2HC9A 3BZBA 1MC4A 2AJDA 3CSSA 1KFBB 5THKA 4EG3A 1QPGA 3O1HB 2ON6A 4EVIA 3TUIC 1V43A 1FFBA 1M2HA 3SEQA 5B7GA 3WMFA 3KKLA 1B0PA 1NVAA 3WXBA 2FR0A 1ZC3A 3P97A 1Y1KE 1FS6A 1CY1A 1FNMA 2Q5FA 3H9QA 3QLVA 4X3PA 2PZGA 4RKWA 2GD2A