4A3SA

Crystal structure of pfk from bacillus subtilis
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
319
structure length
319
Chain Sequence
b'MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYAGLISGKIEKLELGSVGDIIHRGGTKLYTARCPEFKTVEGREKGIANLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCVGVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWAGLAGGAESILIPEADYDMHEIIARLKRGHERGKKHSIIIVAEGVGSGVEFGKRIEEETNLETRVSVLGHIQRGGSPSAADRVLASRLGAYAVELLLEGKGGRCVGIQNNKLVDHDIIEILETKHTVEQNMYQLSKELSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-PHOSPHOFRUCTOKINASE
publication title Dissection of the Network of Interactions that Links RNA Processing with Glycolysis in the Bacillus Subtilis Degradosome.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 110
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature ec 2.7.1.11: 6-phosphofructokinase.
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4a3sA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4a3sA02
4MEJA 2F62A 2IZ5A 3OPYA 5ITSA 1S2DA 4FYIA 4LJKA 2KHZA 1F8YA 3O8OA 4KXMA 1MTOA 1T35A 2A0KA 4FYKA 2F2TA 1RCUA 2F64A 3HNOA 2KLHA 3MAJA 4HX9A 4RH3A 4KXNA 1ZXXA 3K2QA 1F8XA 4I4IA 4LJLA 3SBXA 4LJRA 2Q4DA 3U39A 3IMKA 1S2LA 3O8OB 1KZHA 4A3SA 2F48A 2NX2A 4OHRA 1S2IA 2F67A 4I7EA 4NPAA 4KXLA 2IZ7A 4OHBA 1WEKA 2PFKA 4WL0A 3OPYB 2IZ6A 1S3FA 5AJUA 4JELA 3GH1A 4I36A 4P5DA 2HIGA 2Q4OA 2PMBA 6PFKA 3PFKA 1WEHA 4FYHA 4MCJA 4P5EA 3O8LA 1YDHA 4PFKA 1S2GA 4JENA 3EHDA 3F5MA 5AJTA 3BQ9A 3UQZA 4U1RA 3QUAA 3O8NA 1PFKA 2A33A 4JEMA
chains in the Genus database with same CATH superfamily
5IVPA 1SB8A 1ZU5A 1GNPA 1KO7A 3EARA 3H7IA 4ZEOA 2JGIA 1IWPB 1Z0FA 2VJAA 4ZALA 4BRZA 4D82A 4E1AA 3AF4A 1FU7A 2NO7A 3L6UA 3NJ4A 5TS3A 4II7A 1A88A 1GA4A 1GKUB 1NMXA 2VXCA 3AR5A 2G4CA 2GBPA 3DLCA 2ECQA 4E5PA 1P3JA 3V2HA 4H2DA 3HO8A 3JS5A 1Y1KE 2GJAA 2XKBA 1SXIA 3E61A 3M89A 1G6OA 4KWEA 5ALIA 1V5GA 1H5UA 4DXHA 4GECA 4Z9AA 1DX9A 4B7CA 3Q3IA 2GARA 3FPJA 1ACLA 4KLZA 4KYUA 4QD3A 2JFHA 1BVHA 3OMWA 1VJDA 4YPFA 4LRUA 4HO1X 1H5QA 4E08A 4YUVA 3CUEF 3QW4B 4BQSA 5ALTA 3O83A 2Q2VA 3NXSA 4TQ9A 1T26A 3H5RA 3MTAA 1PJZA 4Q1AA 2CNBA 1JYEA 2W70A 1S5PA 5FTWA 3COWA 4D4JA 1XRMA 1JB1A 1E2UA 2E21A 2IIVA 2ZBDA 3GWGA 3P0EA 3WQSB 1NVBA 1Z0SA 4IH9A 5CFLA 1W0JA 1TM3E 5EG5A 2C98A 4HN4B 3U44A 4BHTA 2BMFA 5ALKA 3MFQA 1JFRA 4CF4A 1L4GA 4LSMA 5HCIA 1FTGA 2YOGA 3CEJA 5ALJA 2RKWA 3HCDA 2IPMA 2H7VA 3SQXA 5E9QA 1P0PA 3PPIA 4NJMA 4OP3A 3GPCA 4Q1DA 2H4FA 5D8DA 2Q5QA 5CLJA 3KQSA 2C5FA 4OL0A 2NAPA 4OGKA 4NNJA 5BSEA 3VNUA 4HLDA 3GNLA 3DDZX 4H6XA 4D3SA 1NUSA 1RWPA 4H60A 5F98A 2CUTA 3WGNA 1XZDA 1HDRA 1SOMA 2P4SA 3DCJA 1K4MA 1BU5A 3RNOA 2VF7A 4GUAA 2AKYA 4JHLA 4IQ0A 3NHWA 2ATXA 2PR7A 3LUDA 4FIZA 2NT3A 2H59A 3SZMA 4NPAA 3FVTA 2DRIA 4TTAA 2QUIA 4F0JA 3UZUA 3QMVA 1K3UB 3L7AA 5FOQA 3ZCQA 3IUNA 3JPWA 4QLOA 5I7WA 2BSAA 3IL2A 1U3VA 2JAWA 3OE4A 1C3JA 4GYWA 2C61A 1QDUA 1A5ZA 3EFHA 1NVVR 1TTQB 1GPH1 1U7WA 2QMHA 3IDOA 4IIFA 3DHEA 3TQIA 3UKOA 4N6GA 5G4KA 2H4JA 2I1LA 4EJSC 1LB1B 3VR5A 2NQTA 3E3AA 3TPZA 2P75A 5BQOA 2R87A 4ZT5A 1CIPA 3C3JA 2HIGA 1NXVA 1HDEA 3K2IA 5JD6A 1JU4A 4CPDA 3W5AA 4GPIB 5DXJA 4DWWA 3BJIC 3PX7A 1HETA 1W85B 5T4BA 3WHPA 1WQ1R 2O5CA 8LDHA 4P0QB 1QTQA 4BQOA 2O3JA 2RAPA 1ABEA 1RYMA 1CJTC 5ALHA 4BNHA 2YRFA 2W6CX 1A7KA 4B4DA 3UV6A 1V37A 4DM7A 4K05A 3NRJA 2YZGA 3NHKA 1G2QA 4J9VA 1K86A 5L45A 4C01A 4R41A 5IU6A 1UDCA 4AYTA 3KE8A 4KH1A 2J0QA 2VLIA 2CHUA 2G7ZA 1KJJA 1EJ0A 2C00A 2D0DA 1TMKA 2IK8A 3JD1A 1ST3A 2B99A 4O4HA 3DLIA 1J2TA 4QYWA 1R64A 1WB5A 4ZOBA 4BNWA 3FKQA 3KYCA 1ZUNB 1Y48E 3VDMA 5JYEA 1QQBA 1O87A 2WD7B 3S44A 4AF8A 2WF6A 3HP4A 1NMZA 2VTEA 3HDYA 1U0SY 3FSRA 3O38A 4JLJA 5KYGA 3DMDA 4XJTA 2VF4X 1R6UA 5GGYA 1PZNA 4GOJA 3ROMA 1K2VN 2KBEA 1LBTA 1U8UA 3TLMA 4R2LA 4ZAWA 3FMGA 4A0HA 2YJTD 3CLKA 1KI9A 1TZJA 4G5QA 5JBNA 2QX9A 3T1TA 1C30B 3OF5A 1V71A 3HTXA 4DB2A 4J0QA 5K45A 2AF4C 2X76A 1FXWA 1GNRA 1GJRA 2CXNA 4OU5A 4ZZ3A 3KT8A 5KDOA 3JQBC 2DLCX 2NP6A 5BMVB 3QV1A 4GR5A 1GYQA 1VI6A 4KWCA 3BA1A 2O59A 1QR2A 4DY4A 5ELMA 3TG8A 4TV8A 3VTAA 5HF8A 3EPPA 1LY1A 4MA4A 2QTZA 3W1WA 4FN5A 4D0LB 1OXMA 4PICA 4QAQA 5AJZA 4ZREA 3SS9X 1T2FA 2HV9A 1E9SA 1PFGA 5H4HA 4D56A 2BBOA 2PKXA 2QXUA 2WF8A 4MWDA 4NOKA 3RFCA 4C0LA 2W8ZA 3OM9A 1HNNA 4W5OA 2ZG6A 3QFRA 4QXQA 1P1FA 1NJSA 5LYYA 2ZJ6A 1JQ5A 1NI5A 1PGJA 1A5TA 2A5GA 3R6DA 3T5MA 3TD6A 5IJ0A 2WPDD 1H0KA 1ZJ6A 2OEPA 2L69A 2ZAGA 2V3CC 1IXZA 4LHWA 3ZIDA 1EGHA 1FNNA 2A14A 3MVEA 4OKNA 4B3RB 1RZUA 1BOOA 4A8TA 1G9SA 2IHJA 4C20A 3OCCA 1ISIA 4Q05A 2O8VA 4X66B 3WYNA 1PJBA 2WHPA 1TUIA 3D6MA 3H0KA 3AVUA 2I03A 3ROPA 4O2BB 3WIDA 2FLKA 2H9YA 2HSGA 3JQ8B 3FIUA 5CEJA 3PGLA 3AEXA 2IELA 1SXPA 1GSAA 1N5KA 2I91A 1IIRA 2N46A 1PJRA 4HNAA 3BWCA 4UBKA 5A1TA 1SKUA 1TM4E 3CLUD 3MPUA 4F56A 4E88A 4MRRA 2PV0A 4IDCA 2EX0A 2LTAA 2BTQA 3GLKA 3RIGA 1DKMA 1Z5WA 3NBKA 4BO0A 5KJ1A 4M0EA 2WYHA 3N2GA 4M9CA 4IHJA 3SQMA 3FXAA 4LHEA 1X8KA 2HMAA 4FWTA 1RXCA 1MJHA 3EODA 4EUSA 3HJHA 4C76A 3S2IA 1K6MA 1E79D 2R6AA 3PF8A 4UTXA 1E2HA 3E7DA 3M5PA 3KWMA 3AU8A 5SYNA 3TLGA 4Q3BA 1W5SA 4JR0A 4R3WA 3SC2B 4AQDA 2RC6A 3ICOA 3M33A 2J3IA 4DV2B 1T4CA 2BGMA 3U48A 1U9YA 3SGLA 1WNTA 1P72A 2FH5B 3ZI4A 2IPNA 2XGGA 1PF7E 2PVCA 4B8WA 2D5IA 1AS2A 4HAXA 5DBIA 3QE2A 2D1TA 4HGYA 4L5CA 3RUFA 4YPOA 1XF9A 4US1R 4UM8B 2FB9A 2CE7A 3HSSA 3QUTA 2VSYA 3CXUA 4LOJA 5AP9A 4M1QA 3SXUB 1UJNA 5BQXA 4GI2A 1D6SA 2INGX 4IUDS 3YASA 4A82A 4KCGA 1S96A 4KN8A 2YIVX 1MIHA 4QU5A 3CVWA 1SXJE 2E2WA 4NCJA 4BFXA 3S8EA 2AXQA 4I5GA 2BFAA 3ISJA 3MILA 2NG1A 1Q1EA 2LPMA 2WPNA 4ZTZB 1P5FA 3QU2A 4CTOA 4K46A 1PP4A 3GEDA 1QE0A 3U3RA 4EENA 5FBVB 4ESVA 3EVGA 1NIPA 4MAAA 3GGPA 2B4RO 2P9TA 1TF7A 2ZIFA 4FK8A 3DZBA 3FFTA 1OC2A 4HP8A 4ID9A 1I7PA 2PH3A 5TEVA 2G1KA 1XTKA 2WF7A 3MSXA 4G97A 4MI1A 1YB7A 4FE3A 2XOKD 4RZXA 2DUMA 4KDFA 1Z5GA 4RVDA 1SVLA 3U3XA 4CLOA 1VXOA 1X70A 2RGGA 1WHSA 2O48X 4A5SA 4C5AA 1FDVA 3FIJA 3QXCA 2C99A 4RX1A 4GMGA 3TOXA 4YACA 2UXCB 1MAVA 2P6UA 1N0UA 4E0BA 3O03A 3AIOA 1I2DA 1XC7A 3O4FA 5AJHA 1U1FA 3WXMA 4JGIA 4TTRA 2XXAA 1FRZA 2G9QA 1NMQA 1T8WA 5AM2A 2JLYA 1GD1O 3DVAB 1GA6A 1UPCA 3MCZA 8OHMA 3LX8A 4YASA 1SUFA 3P0JA 1DU4A 4OCZA 4YK7A 1TF5A 2FN3A 3A2MA 1YAJA 2GYWA 2Q50A 4MWEA 3BIWA 1RDFA 3LBYA 4IO1A 2C1EA 1YA6A 4L2IB 3U49A 1HH4A 3FI0A 4XW2A 2XNKA 1S2LA 4TKVB 1O6BA 2CDCA 1DZIA 1G5FA 2QHXA 4J03A 1MJNA 3NEJA 4X8OA 3DHNA 1MA0A 3DVSX 4RF5A 2BZGA 1DS6A 3O74A 3P19A 4YWJA 2FRDC 1FYFA 1XRQA 3QELB 2HU8A 3NDPA 1Z6TA 2HEIA 5G02A 2VBFA 1P91A 4N5DA 4Q16A 3UC5A 2OCYC 1USGA 5JLAA 2EVWX 1XRSB 1JLSA 4ZI5A 2W2KB 4YJHB 3DMTC 2PGIA 2ZOSA 3TLEA 1Z18A 4BYMA 3TQOA 2Q7XA 5HR5A 2GF2A 2J08A 4KR3A 5AM1A 5JEEA 2N75A 1V6CA 5DP2A 4IO0A 2HJRA 4YJDA 2DR3A 4KQJA 4LGMA 1Y8RA 2QL6A 3BWXA 1DRKA 4FCVA 2QTHA 1OYVA 1UL1X 2JCVA 4Q82A 4Z4GA 5GJBA 4MB6A 4FYPA 2C3UA 3O26A 2ZUBA 2ZVDA 3BXOA 1XXLA 5BW6B 3PITA 3G3EA 1ZW1A 3CEAA 1ESDA 2OOKA 3ZDFA 3HDGA 1SUBA 2NXNA 5D3KA 5LZ2A 1K08A 2XA2A 4LGVA 4P35A 2ZRCA 3AH8A 3F2VA 1IRIA 5TGZA 4QJ4A 4KLAA 5KPDA 3CRZA 1P3DA 4F6RB 1SBYA 5HQ3A 1XYGA 1GY8A 1X1BA 2CD7A 3FUUA 3F7TA 4LZJA 4Q21A 4GR4A 5T57A 3ZCUA 1PVVA 1L4UA 3T7JA 5JW6A 1Z4PX 3AEYA 3H1GA 5H1YA 2HU5A 5AW7A 2O50A 3ND5A 3FRHA 5E9JA 2W22A 3JALB 2Z5VA 3WVNA 4RU1A 1E5TA 4XB6B 3TL2A 3IURA 2SKDA 4PQEA 2F59A 2AA3A 1A0OA 4TT3A 1P2UA 1KO4A 3QLUA 3R7NA 1T34A 3F71A 4PBSA 3MJCA 3A9CA 4D1YA 3FRJA 3LT0A 4EG1A 1N32B 2TSYB 3Q3HA 5C8XA 5F1PA 5CFQA 3PXGA 3AY7A 2W93A 4GICA 3RS5A 1CUVA 3KVRA 1ODCA 2PCJA 3P0IA 3MGGA 1RMTA 2GZ3A 2ROQA 3IUQA 5A3QA 5LQMA 1G7TA 3KNZA 4OQYA 1F60A 1XN4A 1ZGZA 3QVTA 1DADA 3QEMB 3ESQA 1X2EA 4IEIA 1QH9A 5ALDA 3NMUF 1DXOA 3C1UA 1D7OA 3L6CA 1PGNA 4M60A 4EFKA 6YASA 4PS0A 2AZDA 5BNWA 4W7IA 1ECBA 1W6RA 2FX5A 2FR0A 4HWPA 2WOOA 4MP6A 4C78A 4Y6PA 3TF5A 2QX6A 3OZBA 1MIOA 1V0JA 4YLYA 2ZUFA 3COJA 4U3JB 3KR0A 2ANCA 3ITKA 2HA2A 5HKAA 1AHPA 1MGPA 1NBEA 2PL1A 2GFHA 2VEOA 3HUUA 3AP2A 4E3WA 3F96A 3GRKA 2ACWA 4OHVA 4X1KB 5CBPB 1NN5A 4B34A 5AM5A 1G0NA 2YRWA 4MINA 1O9GA 4GIBA 2QRUA 2R8OA 4GPAA 1TJ4A 1G17A 5CB8A 4JJ4A 5FOSA 3MT9A 4BGIA 4OX9Y 4WN9A 5CB4F 1D1SA 3OD5A 3CJTA 3KCQA 4M36A 1EDEA 3OWXA 2GZDA 3GLIE 5E0KB 4JK3A 1DWPA 1M1YA 1EHCA 1XD2A 1JR3A 1O96B 2J3QA 3GOQA 4YP5A 2HHLA 1WE2A 3Q8XB 3PGMA 4BE9A 4JI8B 1U6JA 5G1OA 5F64A 4WK2B 1FZTA 5EQTA 4RGQA 3ZBTA 2ZETA 1C9JA 1W47A 4Q3AA 4F1WA 4URHA 3QE0A 3S2YA 4ZI2A 4A0RA 2IVZA 2GKSA 4WZ6A 5HMLA 3MC1A 1H94A 4KIJA 4GRDA 4MW7A 2LKCA 4V0ME 2ORYA 4L9RA 1U2EA 3EIOA 2FPGB 2I2AA 5AXCA 1B76A 3FLBA 3E9QA 2PKQP 1QHFA 4ALJA 1JUDA 1QWOA 2QQ0A 1AGYA 4KL8S 3QVLA 3OQIB 1X1DA 3HDHA 3LP8A 2YYAA 5BQPA 1OI3A 2YV1A 1HNXB 1J09A 1HYQA 3O8RA 2BFFB 1GPNA 1L7OA 2XF2A 1OWLA 1SOAA 2WW8A 5CH3A 3TINA 1WUYA 1KSHA 2WABA 4I50A 1R9GA 3HYCA 3FCUB 1II8A 1AQIA 2AN9A 2PO5A 2VF5X 3H11B 3H2ZA 3H3JA 4LOAA 5E2AA 4ZEXA 5JPDA 4J94A 2C7GA 5AIAA 5FL7D 3U7JA 4DCCA 1LDEA 5KIAA 1W0JD 3T0FA 2GN0A 2CF6A 4LV8B 3KB8A 3MB8A 3OU2A 2YW2A 4J90A 1XAGA 1ZCAA 2C4HA 2WYOA 1C7QA 4J7CA 4W5HA 1GDTA 4CEIA 2C58A 3H3XA 3KELA 4C6RA 4QRIA 3RIHA 4AO7A 1SXJD 3NU1A 4G9BA 4L3WA 4NZ9A 4PAQA 5F21A 5F73A 4FZ3A 3HCBA 3QLEA 1K7CA 2V6IA 3GQBA 2VNIA 5AI8A 4YUAA 3ZDYB 621PA 4PY2A 1NE2A 2QZSA 3BH6A 2EOAA 3EGDA 1Q7EA 1MU0A 4GYYA 4JZKA 3WK9A 1OWNA 2RK6A 4N3GA 3VNBA 5CPBA 1DO0A 1S1MA 1SBCA 1UMBB 3IJ5A 1XRPA 2VPTA 5FWDA 1G8HA 3UK0A 5HUHA 3H9CA 1CY7A 1KS9A 1YVDA 4KUEA 4C2BA 2PSEA 4RD2A 3RS8A 5KX5B 2XMZA 4ZPJA 4W9NA 1OASA 3L1KA 4GQIA 5LP6A 1G5TA 4WLNA 4PTYA 3KPYA 5L7WA 3N0VA 2QOEA 1K98A 4XQ9A 3BGOS 4MI3A 1E61A 3VPDA 2PT5A 4NYMQ 2X0FA 5JAZA 2B34A 3KOOA 2DHDA 1XTBA 2VO1A 3IUSA 3KAKA 3LY7A 4EECA 5FLEX 3LK7A 4A7PA 1GNLA 2R1UA 3WNBA 4BNVA 4XD2A 3K9LA 1J0AA 2X13A 3I6MA 5HTKA 1TK9A 1F8XA 3BMCB 2D5BA 2WFLA 1K9VF 3U80A 1NV8A 3GIDA 2A9VA 3PD7A 1JMYA 3KR2A 2BFDB 2K4MA 5CH5A 5KTKA 4FP9A 3W9SA 2ZIWB 1GTZA 1ZJZA 1X7YB 1YL7A 3H5WA 1E6LA 5FPQA 1KIMA 5K0ZA 3RBVA 4PLCA 1Z3IX 4NYIR 3EYAA 3D8RA 2IYRA 5SICE 4IKOA 3ONFA 2HI0A 3AG6A 3G2OA 3FOWA 3HK2A 2OM2A 3NOVA 1J23A 3RC3A 3WLSA 3DOOA 4P4LA 3WI7A 4TYNA 4OQPA 1ZH4A 4B6QA 1SVMA 5ICEA 3G2JA 2ZAYA 3NI2A 1SXJC 4GPTA 3ELUA 2HDHA 3A4MA 2ZT8A 2ZVPX 4N8SA 5JUWA 4JYPA 1T29A 3OQHA 4NAVA 2H2DA 1OA0A 1WIWA 1G9TA 2W6OA 4G8CA 1CQZA 1BQ4A 2XNDD 3EG9B 3F3SA 3K8YA 2H07A 4FDMA 1DINA 1BD4A 2BR3A 8ABPA 5F76A 2B9EA 3DZJA 4IYJA 4DNXA 2FKAA 4JLMA 1QCDA 2G08A 3TW8A 2ZIUB 5IKPA 1PQWA 1T8TA 4EJFA 4G0NA 3GLFB 3CPHA 3GO4A 3L3BA 3C5CA 1UJ6A 1RYEA 3ZS8A 1WEHA 1WPRA 3U4IA 4KWHA 4OVKA 3C24A 4EO7A 1T3SA 4BMZA 1TJPB 4KKVA 3ZXUB 5LDHA 1QHIA 2Q1YA 4MDFA 1II0A 4N5MA 3NBZC 3KTFA 1F8GA 4R9UC 3P0FA 4YUZA 5IANA 5JCJA 1BE6A 5LB4A 3Q0IA 1YFZA 3TRFA 4CW7A 4DWVA 5ALOA 5AOBA 4RXUA 3OCWA 2BMJA 4WDQA 3ZWQA 2AG6A 4AUNA 3JYNA 5KVQA 5EVJA 3N8KA 4ENWA 3BFPA 1NAIA 2HHCA 3HUTA 2WT9A 3WGGA 1F6BA 2X2PA 6REQA 2O19A 3QFFA 2Y6UA 2G5TA 3A11A 4DZTA 5B30A 1SBZA 4KSYA 1IY9A 4LDNA 3UFXB 3L0YA 4A1OA 4YR9A 1VPEA 5DCLA 4DPMA 2WWGA 4UU1A 1EWVA 1XA4A 2RG7A 3C3BA 3DEKA 7GPBA 1CQIB 4HQFA 1KYXA 4NHEA 2RHHA 4FSHA 4XA8A 1HL3A 1P60A 2WKWA 3BTVA 3EWAA 2DUUA 3CSSA 3H99A 3HKBB 3L1HA 4ZYUA 4Q1EA 2AIRA 3HB0A 4KFSA 2FMHA 5GP1A 1GUZA 5FADA 5EHNA 3SXJA 3H0CA 5DIFA 5EXSA 1Q21A 1A97A 2W2MA 2BZ0A 3BFKA 2ZJZA 3GD7A 1FJHA 3R3SA 2V7EA 5DBEX 4DDHA 3RVKA 3V9AA 5A02A 3CNOA 2B8WA 5JXIA 2ZJ8A 3QYFA 2YHIA 4R1UA 4XRRA 1MA3A 1P17A 2QG4A 1TIBA 4LYYA 4FR2A 5EJMA 3RG2A 5EJ5A 2ZRBA 3AJ9A 3FUVA 3WIBA 3QX8A 2OHOA 4N49A 3WE7A 4YREA 2W6ID 1ZNXA 1M1NA 1PZGA 5HCUA 3RAPR 2R1TA 1P33A 1QQ5A 2IV3A 4DNPA 3K20A 3DXXA 3W77A 2PX3A 1QS0B 5H9WA 3SHOA 3ZWDA 2VSNA 3I9V1 5IDYA 2DUWA 2XGSA 4NU6A 3TJMA 1X7GA 2FFRA 3ILXA 4QGSA 1RCTE 2X8BA 1PTKA 1FUKA 1K9SA 3CX3A 2OWEA 3C7KA 4NFSA 1E18A 4RJKA 3RREA 3AR3A 2HX1A 2PGNA 1NQUA 3F8SA 3OZ7A 5GQSA 1RBMA 2YW9A 3V8RA 5BT9A 1XR3A 1LWOA 4K9OA 4RSGA 3T4PA 2HB6A 3HJGA 4ENTA 1SPXA 2OVFA 2QRZA 3DNMA 1IPHA 4XTRA 1XCPA 1RJ9A 3Q11A 3PU6A 4UBJA 1OZGA 3MJTA 2PH7A 4Y1GA 1UMDA 1V5IA 2ZI4A 1VDZA 2ZE8A 1XZKA 3O9VA 1SGWA 3OU7A 3RU7A 2NUAA 3ZHOA 3WJ1A 1J2UA 3LUAA 5IYZB 1F7VA 2GVNA 2E49A 2E4AA 3L01A 5F3RA 2YWCA 3KZCA 3TQTA 2M98A 2A94A 3RASA 4Y98A 4B33A 3VKUA 2R68A 3CCCA 4AMUA 5KYUA 1C9EA 1AGNA 1HPLA 4ZVSA 1TEHA 2VWQA 2DFNA 1KZGB 2RHCA 3LXRA 2I6FA 3EY9A 4E70A 3A2KA 1ODFA 1JLMA 1PT7A 2C2OA 3HY4A 4D8UA 2QTRA 1EFPA 4URFA 2WMNB 5AD1A 3SHWA 1RSZA 1JAYA 5CD9A 1PDOA 3AP3A 1A4IA 1C9MA 2PSFA 1M2FA 1HUQA 1W6UA 2H1RA 1A96A 1DARA 4IV8A 1MNAA 4Q0MA 2O2GA 5E2BA 3ZQ6A 1Z4LA 5BXQC 3SDBA 3X3HA 4QASA 5HS6A 3MOIA 3A9TA 4G1UC 3TEMA 4M8IA 2YWXA 3I45A 3DAFA 5TPWA 1DBSA 1M54A 3MLAA 1IM2A 1RWBA 4IGEA 1LEHA 2VP5A 4C7OA 4DMRA 4EAAA 2D2XA 1Z7GA 1CEQA 3W1EA 2GEDA 3PHCA 4XM1A 3EXEB 3IV7A 3ADKA 4PFSA 1JE1A 4PW0A 2DETA 1IBKB 1ZZGA 2FOXA 4FFBB 5DOVA 2FMFA 2W2NA 2J30A 4GGMX 5B7GA 2RI0A 1CQWA 3A1WA 3DEHA 1W44A 1JHRA 4GKVA 5FNVB 2YQ4A 3F2IA 3WNCA 4D8VA 3O8QA 3ITNA 3GUUA 3OKFA 3I9MA 4RE6A 5K0FA 5FOWA 2P27A 3BTSA 4M83A 4G8DA 4XSVA 3H2JA 3T7IA 4OMUA 4D9IA 3R7WB 1P2VA 3KDAA 4ZQEA 3C0KA 3FVQA 3NEYA 2G36A 5E4FA 4C14A 4QSMA 1TMGE 3AUFA 4JSTA 1YDFA 2EERA 4K9PA 4RF3A 4V0OA 5FOXA 1YDMA 3U16A 2FSPA 3I30X 4Y6QA 5K3BA 1AS3A 2A9RA 2IT1A 1HDZA 4OQLA 1SUDA 3MJEA 2BP7A 5K4HA 1QIJA 1NDQA 1JEQA 1KH3A 4P7GA 4A27A 1RM3A 1NW3A 4I4TF 2W2XA 2WJGA 4ZK6A 1E6KA 2OKGA 3IV6A 2FZCA 3VV2A 3CUYA 1O94A 3U37A 2Z30A 4TKZA 1M9NA 1FRQA 4BWVA 2WYUA 5DLEA 3LS2A 5ADHA 5AKYA 3K6SA 3OI7A 5G3YA 3UXMA 1X7ZA 1TCVA 2IEDA 1UM9B 3LJKA 5GJCA 2RI1A 3GBSA 4V02A 2FJ0A 1EE1A 1Y3HA 2CLOB 2XMGA 3QPWA 3TXXA 2QN7A 3F78A 3MT8A 2FE1A 1FSPA 4YDQA 4RV9A 4UNSA 1KYVA 1JHAA 3PHGA 4IGAA 2TMKA 3IH5A 4LPKA 1FU8A 2V58A 1COZA 1L7BA 3JQDA 2O05A 3HVKA 2HRQA 3I37X 3MWLA 1EK6A 1JHVA 1YBMA 2J0UB 3H7AA 4O4LB 5LDGA 2E4ZA 2Z1DA 4D8WA 3W6NA 4LWOA 4NCXA 3U39A 1RWOA 1M7GA 4H3SA 3X1MA 2ZSHA 1FSGA 5JSYA 2OHVA 2W2LA 3CO5A 3KQWA 3TSYA 2WUDA 2FDXA 3VOTA 4QM7A 1M72A 1XDGA 4U6NA 1H1LB 3ER8A 2XRMA 3EMKA 2H00A 1FS6A 3BRWD 2PS1A 3T9EA 1E1RD 1MB4A 3W9BA 1OV6A 2X8AA 4MLPA 3V6MA 4M38A 1F2UB 1BOFA 2M32A 1CQPA 4FGWA 2ZJ2A 2B69A 5CDSA 3NLLA 3W3AA 1NRJB 4BNGA 1DX4A 4FQ5A 1I0LA 1R15A 1E9EA 3GYGA 4GP6A 1CG6A 1N2HA 2A0WA 2CNWA 4KE8A 2C2MA 3A3YA 3DLPX 4ZRMA 1W30A 2G9UA 2JI6A 3IMFA 2V9PA 5BN1A 3N7AA 4IIJF 3D6FA 1Y6FA 1YR8A 3O3OB 5IAEA 1FYDA 4IX9A 1TX4B 4PTZA 1RXIA 2P3SA 3BHNA 4IZIA 3STYA 1U2QA 5D2CA 1X0XA 3OM0A 4R8MA 4MR9B 3SYKA 1E3IA 4PX5A 1S3GA 3PICA 5ALPA 2DY0A 2ZJ0A 3ZXXA 1SOWA 4OJNA 2R8ZA 4AURA 3FFXA 4CCYB 1RJWA 1OT3A 4AROA 2GCNA 2DFKB 3FWYA 3HY3A 3H6KA 3OZXA 1GIAA 3QI2A 2E6UX 2PANA 2R97A 3GZNB 1IAVA 2JCBA 2WWTA 3R5HA 4HTAA 4RS4A 2AX3A 4EYOA 1KY4A 3RPEA 4RELA 3RCBA 4NZMA 2RMKA 4GW3A 3DMHA 1Q15A 2ORWA 3SC3A 1H2AS 1QV7A 3IUMA 1FSZA 2ZEJA 2RGEA 1RI5A 3NTLA 3OBBA 3DLAA 4L5AA 7MDHA 5L6MB 5BV7A 1NG9A 2R8XA 2V7QA 5IDVA 4U0KA 2AXPA 1HE3A 3TPCA 1TUEA 3FYCA 2A5JA 1CVRA 1DXQA 2AOUA 4WASA 1WTAA 3SSNA 1LZKA 4DA0A 1UWVA 2JIZD 3BJRA 1FQWA 3EIEA 2NPIA 3PPWA 2C20A 3V8PA 2AFIB 4JAVC 5JI2E 2CV1A 3JY6A 3AO0B 5JISA 5BY2A 4P4SA 1GU7A 5EKSA 1UPUA 3Q3EA 4ZFNA 2QUJA 3CG4A 1W2WB 5FO1A 4R81A 2QPTA 4IOKA 4KXMA 5IH3A 3DWGA 2GILA 4FLEA 4URXR 1EBBA 3L0OA 1VA5A 2OFFA 5M2QA 2Y93A 4BV2A 1U7PA 1P3Y1 1T5DX 1XTTA 4Z99A 3C8UA 4RV5A 3D81A 4KYTA 3PUIA 4B82A 1YZNA 5ALSA 1CJCA 1YC2A 3V1NA 3N53A 1ULUA 2YV2A 4B76A 3MOGA 3L4SO 4JGGA 4PRLA 4URYR 2ZBUA 1NN1A 4LNHA 1RRCA 3AUKA 1R0WA 4N7BA 1HL7A 3QITA 4A2PA 4WESB 3CVYA 1LDGA 2QTGA 2C2GA 3G8CA 3HDVA 1ADCA 1EZZA 2ZANA 4JQCA 1NUTA 4ARCA 4U2KA 1Z15A 2HZ7A 1UBOS 2WFMA 1V9SA 5TDHA 3THWA 3TTUA 1PO7A 1Q6YA 2WM8A 3PFWO 4Y2YA 1TT5A 2ZIAA 5DHRA 4BVGA 3B6KA 5JS1A 2X6TA 1G4AE 3A3NA 3JD3A 3O9MA 4H3KB 1DC3A 3BHJA 4O1IA 3STTA 5FPKA 3LUGA 5JAIA 4M99A 5KAPA 3MBOA 4ZQGA 1QO9A 2LDBA 1QONA 1ZVKA 4HUQB 3KB6A 4OLHA 3AWIA 4UDOA 5SY4A 3PGVA 4AJ4A 1UEJA 4DRXA 2AKEA 4DV7B 3D3WA 1VCNA 2VA9A 4LZNA 1OPXA 3BDIA 3RVDA 2MYUA 4G5OA 4LTMA 3H8JA 4YP9A 5CUQA 4NQRA 4L6IA 3MINB 5TSDA 2ODAA 2ZYRA 3AERA 1P2TA 2BCGY 4HNQA 1WF6A 4RD4A 5AMXA 1LFAA 4QOSA 1V16A 3H4VA 3NTVA 1P7VA 3PUKA 1O6FA 3QPUA 4L76A 2ECFA 3ZVLA 1U31A 2A8YA 2ZT7A 2A7QA 2P0AA 2XCOA 3GFQA 4KVAA 4JN6B 3B6ZA 4XIYA 3RABA 1NY6A 1T8SA 3PC8A 2EJWA 5AM4A 1Z0KA 5KNBH 3AU9A 3BDVA 2ZJ4A 1HEIA 1FOEB 1U4OA 3SYNA 4ENQA 1V41E 3REQB 1N9GB 3BIFA 4AY3A 2DM6A 2QRVB 1WLSA 3DVRX 3OWHA 3WGKA 3C3MA 5DF1A 1KRWA 3VDRA 4GVPA 5BSGA 5KMGB 3GD5A 2WB4A 1XMPA 3IPAA 4KQ9A 4QQ8A 5B37A 3HWSA 1JTEA 4OLAA 1KSGA 4RPKA 4BCCA 1XJ0A 2P8SA 2Y1FA 3D3EA 2X15A 1DT5A 1ZMOA 4G8JA 4GSYA 2H1LA 1P39A 4QUJA 2HFJA 3A6LA 2WEKA 3BKWA 3VH4A 5KHLB 4J0IA 5CAEB 4C3ZA 4JYZA 3TQRA 3EQ8A 1F8FA 1AKUA 1UPFA 3B12A 3OPQA 4AYXA 4YAKA 3DGEC 4DV0B 3SLGA 3O93A 1CUCA 4S0ZA 2AFHA 8GPBA 1NDHA 1NYQA 3F3YA 1I9CA 3KKZA 2WWWA 1M33A 4MUNA 4IMPA 2DBRA 1J1IA 4LJYA 2UV8A 4MR8A 4CV0A 1GKYA 3G9ZA 4ZJYA 3K3PA 4YJ2F 5EP1A 1B8UA 3PQ4A 3T61A 1GG2A 3OPYA 3SG0A 4JT2A 3VR2D 1N2GA 3WWEA 2G1UA 3IUYA 4IDOA 4LOKA 4BLOA 1FMFA 1EFTA 1TUGA 2A1UB 1ZO8A 2Q5IA 4JR2A 4FNOA 2GFIA 3CISA 4NKRA 1FZQA 5EKUA 3GRFA 4D0NA 3I2GA 5LA6A 3LZDA 3W5IA 5IHXA 4Z0NA 1CUAA 3WLFA 2SKCA 3DEFA 3TM5A 1XLUA 3PCXA 2WSBA 3LT4A 4QUEA 2ID4A 4P7FA 1GFIA 3VVBA 3MW8A 1VIMA 1HE2A 3HXLA 4NECA 4E5UA 3P2IA 3VNVA 4ALNA 3FYTA 4MW4A 4AJ2A 4EB0A 1UMCB 2KLBA 1NQXA 1T91A 4BP3A 1GADO 2R00A 2EFEB 3ESAA 3EXG1 1ZLXA 3KKQA 3PYXA 4HZUB 4MH0R 4U63A 1IK4A 3WLPA 3LAWA 3FX2A 5C18A 2ZTMA 3WHIA 2WAYA 4LAFA 4WADA 3E9DA 1WSBA 3GMDA 2Y2UA 4GBED 2GPWA 5KOYA 5B53A 1NNLA 2WLSA 4DARA 2GKOA 4DA7A 2IYEA 2O3UA 4Z4QA 4JXJA 4HNHA 2YHAA 3GARA 4ZO7A 3AP1A 5BQ3A 1C5KA 3RKRA 1ZXXA 1EUYA 2XA1A 4YMTA 1VB5A 2Y1KA 3WBKA 4RIHA 2OA0A 1I2AA 4WACA 3OCYA 1BCRB 1X1EA 4I9FA 5KZMB 2ZM5A 4E46A 1QUEA 1RM4A 8MHTA 4G4SO 6ABPA 5EC8A 3LL4A 4MWSA 2W42A 2OGSA 2OK8A 5AXAA 3R2JA 1AZWA 4L07A 1FNDA 1W85A 2OB2A 5K8JB 5DI3A 4F60A 1XD8A 2SCUA 1RLIA 1SXQA 1AKMA 4GR9A 1CEXA 3LUFA 1JG4A 1FK8A 2CHFA 3KJEA 5FBWB 7MHTA 3UN1A 1MAWA 1IDOA 2JASA 4WDRA 3HJAA 2DYKA 4BMOB 1YR7A 4IJ5A 3BCHA 3SXPA 2K87A 5ALXA 3ZE6A 3FTPA 4DGQA 1WXIA 3NWOA 1ACMA 4IHKA 4PYMA 1CNMA 1V1JA 4BZQA 4H15A 1R8JA 2H4YA 3ND7A 2WMYA 1P2DA 4LK3A 3ZWYA 3IJPA 4UEQA 4EHAA 4QUIA 1JIXA 1J99A 5JSHA 3DTNA 3CKMA 3R23A 4RK1A 1G5IA 5C46F 1WDKA 1KQOA 3EZ9A 1B2LA 2EGHA 4RGYA 2P5UA 1MFZA 1DQPA 2Q4EA 1KVSA 5CURA 4KBFA 4CKBA 5I7UA 5D1HA 3ZGXA 1IWOA 3S27A 3Q7PA 4N01A 1E1QA 4L72A 1M76A 3ZNOA 3IAAA 4ZYVA 5IJZA 1ZN8A 2C42A 2ZQ5A 1T36A 4MCJA 4BMVA 1TPYA 2R66A 3W9UA 1T0HB 5L3RA 5BMVA 3ZDCA 2JFYA 4KLRA 4UJ5A 1N8KA 1F9AA 2HQBA 3I9NA 3O4IA 3LXUX 1FB5A 2JFNA 2VSQA 2G9NA 4W99A 5AR1A 3VC7A 4BFWA 3DL2A 4WINA 3KCNA 5L3SB 1ZJWA 1FY2A 3PQ5A 3UJAA 3VR5H 3ZBQA 3EGXA 1I3LA 1TQ6A 4S1WA 1DBWA 2Z04A 3TX2A 5JFGA 2ETXA 4QWMA 1T6XA 5IXJA 4K0KB 2JGNA 3BD6A 3GEHA 4GAEA 1E4EB 2FR8A 2BDTA 4RZ3A 2R9VA 4W9RA 3SF8B 1N7HA 3VNRA 1QF6A 1DV2A 5MF6A 1R10A 4NCAA 1K97A 3O7WA 1YU6A 2UZ1A 3MZ0A 3KSDO 3UM9A 3GUVA 1Q6ZA 2R44A 1CPYA 1BXZA 2WP8J 1FNMA 4RPGA 3ZGVA 1XZIA 4ZRDA 4QYIB 3S4YA 2PBFA 3OIUA 4CV2A 1JH8A 1VGVA 2XE8A 3GEIA 3OJWA 1SC9A 5AVVA 1UXOA 1HQCA 3DZIA 1TI7A 4O2BA 4DCUA 3UMJA 2I4IA 5B4VA 1K4YA 1DO8A 1TEXA 1E2EA 3JQ8A 3K30A 3QTLA 4Z7QB 1HI9A 3AESB 521PA 2QLFA 3QBJA 4Q15A 4WLEA 5E7JA 3NTRA 1DOHA 2DY1A 4QXMA 2WOJA 3PX3A 4PU0A 2GLXA 3AUTA 4FFNA 1IHYA 2QPOA 3QWBA 4O0MA 3GUCA 2YH2A 5EZ5A 3R9KA 4MSUA 4KR0A 5IAJA 5ALZA 4I1VA 1KK3A 2B7CA 2B1IA 2HO5A 2XZTA 4OBWA 1CFJA 3UCFA 3ZZTA 3ZDDA 2KWIA 5DCYA 3HDTA 3L4BA 3LTEA 2L2QA 4D74A 4MEBA 4C89A 5DHSA 2C8VA 1CJBA 1LTKA 3WJ2A 2YFQA 1PYGA 1E2LA 4J3NA 1ZH8A 2QAGC 4JKOA 1P81A 3DDOA 5LQSA 4HRXA 1NBOA 4J7XA 1OYOA 2PJUA 3PJDA 3QHQA 4LJRA 1IZ7A 2G5PA 1H6DA 1WXFA 4B3IA 4M1SA 3RADC 3WLMA 3UAZA 1ZRSA 4M76B 2IYUA 4V03A 2W37A 4BATA 5LDDC 4D8XA 3UMVA 1WU7A 1W76A 3ZHYA 4ZC8A 1GAEO 1XRNA 4KTVE 1NR7A 3SBDA 1FVHA 3OCVA 1C8VB 4ETWA 1A98A 4BDTA 2X0RA 2OAP1 1ZJ5A 4RA9B 1A8HA 1BA2A 3EZNA 3ADPA 2F3PA 1BDBA 4WZBA 3MHPA 4D4MA 2YOHA 4D4GA 2ZRLA 4D0RA 4X8LA 5HTOA 4YRDA 1QK4A 1YZVA 3R7AA 4X71A 1JXAA 4EGSA 2K2WA 2YJGA 4WTOA 1XJWA 2J67A 2X8JA 3OX1A 3QXSA 4PINA 1DO2A 1HO3A 1UPXA 1V2GA 4OIFA 3CUVA 3SYRA 4ZDIA 1TVEA 2XT9A 2JFGA 3JATB 3KQQA 4L0CA 5LSAA 5IT0A 1HSOA 4CV1A 1YVEI 3O21A 1V7ZA 3D7LA 2DJIA 5ERYA 2WJ4A 3DZFA 1P1KA 4NZOA 4NVRA 1RHUA 3FSGA 1DXHA 2GYYA 3VZRA 2GJ9A 2V7WA 5E1MA 1X9HA 5IMBA 1ZRMA 3S3TA 1DRUA 1O94D 4RFSB 1CDDA 1BXRB 4IOMA 5AQEA 3USZA 2VHYA 1S1CA 4HXGA 3IIEA 1F4VA 3H6HA 1JFFB 3EPKA 4BNJA 2RKOA 3ZK9A 2ERYA 5L3QB 5DTIA 2JRLA 1PWHA 3BQ9A 4BVLA 5DASA 4HFMA 3K71B 1C50A 2GJSA 3RTCA 4CV3A 5IUNC 4IP0A 4AJKA 2VK4A 3UK7A 4EB3A 5KKNB 5KYXA 1CUBA 3ICPA 2I2WA 1EFHA 1SC3A 3H8VA 4RS3A 1TYEB 3NH9A 3QKIA 4E4YA 5BWLA 2IDZA 3HFGA 2CUKA 1KZ6A 4RCYA 2P3OA 1UQTA 3HUEA 5JZBA 3H3FA 3QG1A 2V98A 3BHIA 4OKSA 2VDJA 3DMFA 1G3RA 3HA3A 3RS0A 3GLGE 3HS3A 1W4ZA 2DECA 2A0UA 3ZD6A 1DOAA 3QJ5A 4C6TB 1FNCA 3C16C 4WXRA 5JVDF 3BPSA 2D54A 2HBRA 4FYIA 1DUIA 3I9LA 2B92A 1N5RA 4XX1A 4KXYA 5HRAA 5I9NA 1JG3A 1IOVA 1EB8A 2ORIA 2ZWAA 4L2IA 4V3CA 3TPFA 4BTLA 5A4DA 1U9IC 1YCFA 4RO0A 1UBNA 3UOGA 5LOVF 5C8YA 2XVXA 3GLHE 1KMIY 3F1KA 5CYPA 1PW7A 1WVGA 3AHDA 3FPBA 2HMVA 3IP5A 4N3AA 4PG5A 4R2JA 5AK5A 4CM9A 3ZVNA 4OMDA 1PJ4A 3L46A 2Z1NA 4R4JA 4XLLA 4JJ8A 5DISB 5E6SA 4W9MC 4CLRB 1NBMA 3HCWA 1Z2CA 3KDSE 2EYQA 4PGMA 2ZYTX 5J5CA 2Y0CA 2CBZA 1KO8A 1PZEA 3K35A 3G02A 5A3JA 3QQPA 1BKDR 4GRIA 1S7GA 4RMHA 4UQOA 1E6CA 5KJCA 5DNCA 1YTUA 4UQPA 2C8KA 1QE5A 4PRKA 5CEEA 1KI4A 4GNKA 2FNAA 2CKMA 2JAHA 1EQUA 2WJYA 2B3TA 2XAAA 1GZSA 2ZSBA 1VE5A 3CRRA 3JQCA 4K9RA 4N03A 5B1HA 5M7EA 1T8RA 3W2GA 1KJ9A 3GFFA 4GE0A 1I3MA 4X0EA 2GKGA 1W5EA 1RPNA 1OXSC 3ACBA 2CB9A 4RKQA 3PPXA 4BQQA 5GZ1A 1W59A 3PHBE 2ANBA 4NDNE 3PR3A 3JZAA 3OE5A 3U81A 3WBJA 1IUNA 1DQZA 3U9TA 3EIXA 2JFPA 4QDOA 4C4XA 4XARA 2G0AA 3CG0A 4HGOA 4WERA 2VDQB 1G59A 2QRJA 4F6RA 3F7NA 1Y82A 5B6IA 3TVTA 3T12A 2VJDA 1F0PA 3EQZA 3I28A 2C78A 3OZFA 2OYSA 2O2CA 2CFSA 1XNGA 4G0YA 4EB6A 2UU9B 2W11A 1AMUA 2Q2WA 4I55B 4CWAA 1G4HA 3MBKA 5CB6A 1K7EB 1XZGA 3NQ41 1EFAA 1D6NA 3U4MA 4HR7A 4P4TA 3VNSA 4B2YA 4DNQA 2VJMB 4KO1S 3WG9A 4OXKA 1CUJA 1RQXA 3TZBA 4B3SB 1JQLB 1FC0A 2ERXA 3I2YX 2WR8A 4PYRA 4C6SA 3ZY5A 3QWFA 2QSYA 1QKKA 3G5MA 1T1RA 2BIFA 4G25A 3UWMA 4Q4HB 5D7NA 1X3SA 1C4KA 3D2AA 1KK2A 2B1GA 1XZLA 4ZD6A 4JI2B 4LF4B 4MWCA 4ASUA 1Z39A 1QRUA 1THMA 3W7AA 4BVJA 3EHEA 2RIPA 1OW3B 1SPBS 1ZVQA 4RTLA 5KYKA 1UKYA 1DMRA 3TTTA 4EHLA 2HC9A 2YIDA 2ZYDA 4MV8A 2VOJA 3D54D 3MGAA 5FIUA 5K6AA 2ASVA 5AJXA 2A0FA 5BORA 1LWNA 4JH0A 3AOEC 4N0PA 2H92A 4H77A 4O33A 4XI9A 4UM9B 3RJTA 2FJPA 4QT4A 2FMTA 2GXAA 5FL3A 3WDMA 1BN6A 2WKRA 4GPEA 1CQJB 1PYOA 2WFAA 5K20A 2WJVA 4DIDA 4MQ6A 1G8JA 4CIAA 1R0YA 2B5WA 3K15A 3CV3A 3UHFA 4CM9D 3IOMA 4BWGA 4ZEWA 5LC1A 1FJ2A 1OILA 5CBPA 2YOFA 4YQFA 3GG2A 3VSCA 2ACVA 5AO9A 3T3OA 4JV5B 2Q4BA 2VHCA 1E64A 3Q6NA 1NC1A 3WA6A 4CFSA 4BNLA 3TL6A 4E6EA 5J43A 3ZJVA 1Q14A 2LV8A 2MHCA 2YV4A 5FFMA 5CDHA 3EF1A 4FE7A 4C0JA 4AY2A 4M1ZA 1NYRA 1POXA 4U9HS 1O96A 2H57A 4R98A 5TQVA 3R1IA 3LP6A 3FBTA 4MS3B 2P91A 1JDVA 5TXGA 5LD2C 4CMAA 2Z5FA 2CFRA 2WJ6A 4N39A 1X38A 3A28A 1F51E 1L5SA 4IHAA 4TSFA 2ZRMA 4GPZA 4DLPA 3E7XA 2H31A 1F2VA 1L5YA 3HGTA 1MW8X 4JZYA 4OA8A 2CW5A 5K4GA 1IJKA 4JJ6A 4JR1A 3L0IB 5DW0A 2WY2D 3SPXA 1RWXA 2H08A 2XDYA 1EVIA 1CU1A 2ARKA 4C0AC 4DJTA 1B6GA 1Y5LA 3RHTA 4D6YA 3SEAA 5J2TF 1HV8A 2OO5A 1Y5MA 2J3KA 4H1VA 2P7HA 2FPGA 3AXTA 2X0JA 3VYUB 5INTA 5JZ9A 4BO3A 3FNEA 1CP2A 3GT7A 4PIMA 2AEJA 2J1LA 1YMQA 1R4ZA 2VDWB 2B35A 2PXCA 4RLQA 4OHYA 4QU8A 3M4JA 1W73A 3THYB 4HYEA 3WLRA 3P20A 4D81A 5MN6A 1OSNA 3OQIA 5B3LA 3RRMA 3NBYC 1LPMA 1IN1A 1XEFA 3TLAA 2BFFA 1XEXB 3DBOB 4CN9A 5ITVA 1QMGA 1J1UA 5K0EA 1SD5A 4CQLA 5C3MA 1ZKDA 1Q91A 3T1YB 4IXWA 1MAUA 1Y9AA 5ICGA 3H11A 3L1JA 4WK4B 3CGGA 3OCZA 3HO1A 2H06A 3G7SA 1LK7A 3CSDA 4ZVUA 4A0GA 2CY0A 2WZCA 1PFVA 4LX8A 1BFKA 4QDKA 5CM8B 2QTBA 3O82A 1EX6A 1S3FA 3P9XA 3CKKA 4KC0A 4EG4A 1QK5A 2JLQA 4XOIA 1AIPA 3E2MA 4D6PA 3NV9A 4PPQA 3O95A 1FTWA 1Z4KA 2PPVA 3DV2A 4RK6A 1PTJC 4HDOB 4QNMA 4BCDA 2JFOA 2V0GA 5KYVA 1A4UA 3UWDA 5LUAA 4H7HA 5KWJA 3GGDA 2Q5EA 4I1UA 3TR6A 4LDQA 4BFTA 4AIRA 4WT7A 2IX3A 2O0JA 4AT1A 3M1AA 5JV5A 3FFWA 2OBBA 3G8BA 3KJQA 3AV3A 3NP9A 4TN5A 5DKFA 3ZJ4A 3ZE2B 5G3ZA 4S1NA 2BHRA 1M2GA 3GPLA 2B0CA 1ZYUA 4IG9A 1CUUA 2NT4A 4ACAA 2PUCA 4EYQA 1U2GA 4Q4AB 1U7TA 4P38A 4XRGA 3IKJA 2D7CA 1X7HA 1W9MA 3BUSA 3JD4A 5IK2A 5KX5A 2NU7B 3LBAA 1Y1QA 1QSGA 4YA6A 3N9IA 4V38A 2WIAA 2IXBA 3MMZA 1FFEA 1T1SA 3B70A 5ERGB 3T94A 1PS8A 4WBXC 2H11A 2B4TO 4J3FA 2GD6A 1E5QA 3HB4X 1TFRA 5D51S 2FK7A 4DC1A 2YJ3A 3KJFA 4CGYA 4L7QA 3L02A 2XDAA 4B2IA 5LYJF 2JJ2D 2XKAA 3F8WA 4DDUA 2D06A 5JCZA 3C3CA 1WXEA 3V1KA 4F1KA 2C97A 1UAYA 1AV7A 2H63A 2GPBA 2N0SA 3OQBA 5F7ZA 3H5OA 2OENG 5I7RA 5I7FA 1RWMA 3NDBB 2FPLA 3KLPX 1KWGA 4MYRA 2BH2A 1KIAA 1Y3AA 1P1RA 3UJPA 2E89A 1LJ8A 1WMEA 2J9GA 4ZXFA 3OLWA 1N4DA 4M7RA 3O1HB 3L6BA 1O4VA 4RFLA 1LUAA 1X7YA 4TLDA 4DOMA 1ISPA 1VDMA 1WB6A 1YQQA 1MG5A 4NBUA 3WLKX 3RJ9A 3O8BA 1OTHA 3E0QA 4JJKA 4E5MA 1NI4B 2NQ8A 4UE2A 4WCVA 4ER5A 1KMMA 3MRSA 4LECA 4CF3A 4MQFB 3UUGA 6Q21A 4GG1A 4C7MA 1AGRA 5T8KC 3WL6A 1O77A 1NATA 3B8HA 4FJ0A 5CVUA 5DSXA 3WTCA 3NVAA 4DILA 4Z7OB 2E4UA 1EVJA 3IULA 5IC5A 4FZJA 4DQKA 3JX9A 1KKUA 2AOTA 1QU2A 2OORC 1CCWA 3K2QA 4K0RA 2Z9CA 3OE1A 4ZK2A 4MUFA 5E3IA 1GDHA 1NVFA 2PYZA 4YFYA 3N3AC 4XIIA 4MGHA 4Z9YA 4B4OA 2PUBA 4Q01A 4HFNA 3STHA 3VU0A 3CXRA 4OQEA 1NRIA 1S2NA 2P69A 2PRJA 3NFYA 4HDRB 5M29A 2NP7A 1J0EA 1A4RA 2BONA 3TXAA 1FVOA 1P9OA 3B89A 2MJLA 4TMVA 1G4UR 2XUQA 4RWEA 1B0UA 5F3DA 4OJTA 1SZDA 1YOBA 4NZYA 3T3PB 3CRQA 2AJTA 3SEZA 4BQPA 1H1DA 1NFQA 2ST1A 3PDHA 3V7YA 5BVHB 4M9UA 4RLHA 2NVBA 2VQSA 4OQZA 2CZCA 1RWWA 4TM7A 1VRWA 5TLSA 2P2DA 4X7MA 1DRJA 1KO5A 2OQRA 5J4KA 2A0XA 2FSGA 4EARA 1QUFA 3M6AA 4CQJA 1JEJA 4K6CA 4Y0NA 2ZUWA 2UZIR 5LNK1 2YIJA 4KN5A 4IICA 5CX4A 3GB9A 2MWMA 3NBUA 2IHZA 3LUJA 1CQIA 5BR4A 4W7SA 1Z17A 4N0QA 5CW2A 2A88A 4DUGA 5CNJA 5AK0A 5ILOA 4XLTA 3SKXA 3DEAA 4OHFA 4FOOA 3HSKA 4XGNA 1N2CB 4XTCS 3D4PA 2VPWA 2BAGA 2IHBA 3D64A 4BRUA 3AWDA 4UVEA 2I2BA 3PEUA 3TO5A 4BZZA 4RK5A 1YRBA 2DP4E 4F3YA 1XZNA 2DFDA 5JANA 4BN0A 3DS8A 3IA2A 4Z4HA 1AQJA 3OY7A 2D5AA 2VNJA 4WOPA 4I8IA 2QROA 1W2HA 4ZXPA 3WYGA 3KSAC 5GJVC 5HK9A 2PL9A 2PYIA 4RF2A 1PW5A 1KDVA 1T9BA 3AI2A 3N8HA 4RQTA 1DZ3A 4TYQA 1P80A 3FNRA 4OM7A 5B36A 2FN7A 1MRNA 1N6NA 4G1CA 1WBBA 2PSDA 4KMRA 4P80A 2QN2A 4BLRA 1YHYA 5A2GA 1QS0A 1KH2A 2OV1A 3SIWA 5IVIA 4GMFA 2JDIA 4I0WB 2B1JA 3V8MA 3T9CA 1USIA 2WIBA 4KVFA 2J5RA 1BE1A 2VDRB 2P3QA 2CLFB 2PXAA 1B1AA 4F93B 1EINA 1RPTA 2HTFA 4NS4A 4OMCA 5FYDA 4N76A 3DONA 2G6BA 1YB4A 2YUIA 4KI0A 1HOXA 2HLDA 4KXXA 4EK9A 3JD0A 5C1DA 5DCUA 4D8TA 4R0VA 3WP0A 3A70A 5LLTA 1UT6A 1ETUA 4QOGA 4H1HA 1QIHA 3K32A 2GN1A 2VH5R 1O5TA 3CYFA 4KAXA 3ZD9A 5HZGA 2JI8A 3DL0A 2II6A 5DW3A 2CSUA 4DMUB 2WFZA 2CDBA 4RAOA 4J29A 1L9KA 1OZAA 3K0BA 3T3EA 3CBGA 5AHOA 1JWBB 2Q8PA 3GVIA 4R7ZA 3W04A 1WVMA 5F52A 4DR6B 4DSUA 3CU5A 3TRHA 5ENZA 3HU3A 1FFCA 5JMTA 4MGYR 3Q0TA 3OKPA 3VJKA 4R84A 3ZW8A 2BZ1A 2ZDQA 3V1LA 4A6PA 3A4TA 4Q34A 3KL4A 4XOUA 3UANA 3OQOA 2P4UA 1NT2A 4R69A 3WGOA 3FSGD 1R16A 4KQWA 4B5KA 3TMYA 1UEXC 2P30A 2OSBA 1TQHA 4XQEA 3I09A 2D2EA 2NUBA 4ZRNA 5IJXA 5BSHA 1C8LA 3FZGA 5AXBA 4GLJA 1HEYA 3P4XA 1DPFA 3KT0A 3RVOA 4JB8A 3M4NA 2CYCA 4IIXA 3DBHB 1VMEA 1MH1A 3PL1A 3TNFA 3LOQA 4BMCA 3ZLTA 1U9JA 2V7VA 1SBIA 3NYRA 3WNVA 2ZIZA 5KNBD 4TQGA 2ZJ7A 1M83A 4YBRA 4BNFA 2IIPA 3LVQE 4CL3A 2DSTA 3UJBA 2YFYA 3DJFA 4LZPA 3IAUA 2NPFA 1GGVA 5JT1A 1RS0A 3QVKA 2XUGA 1KI6B 4JVLA 2VN8A 4N4AA 3TKAA 1OAOC 2VNKA 2F1IA 3ZH9B 1DJOA 2J7PD 1KAEA 4G0QA 2Z5LA 3CHYA 4YJFB 3VC1A 1H85A 2E4YA 2YRXA 2R6ZA 3M82A 2JKYA 5I4CA 5CIWA 5TF0A 1E58A 1H4TA 1IE3A 1PUIA 1QYRA 4Q9AA 4EDHA 1TTHA 1UP7A 2PJZA 5J4HA 4KPEC 3LUCA 3S81A 2PXXA 1WPXA 2DT5A 2OZVA 4Z3DA 1P9NA 2WYVA 2FZVA 5FKJA 2ZI5A 1GPDG 1Z6PA 5CCDA 4C06A 1MABB 1ZGAA 3WZMA 5FTLA 3SQLA 2YINC 1JAXA 2Q0SA 2Q3FA 5DN6A 4I2VA 3P9KA 2VUSA 2BE7A 2RC5A 3MBIA 4PPNA 1CF9A 3MGCA 4TVSA 1CR1A 2QD3A 4MYHA 3S29A 1Y34E 3IQIX 3ONWA 4J6FA 4ITUA 5AOAA 3C39A 5HWSA 2FZGA 3G82C 3RODA 4LJAA 4YMIA 3JYOA 5B1YA 3AETB 4ZCPA 3C3YA 5H16A 3WK6A 1OAKA 1RADA 1KGSA 3UGQA 4CM6A 4RA6A 2QI9C 3Q9SA 1UFOA 3LCJA 3GP5A 2EC5A 5AKHA 2R6GA 3P9PA 1CXZA 3NHPA 3WP1B 5AKLA 4BKRA 1Q11A 1JB9A 2J0UA 3ONEA 4QPPA 5G0VA 4AW9A 2JB9A 3TECE 1P9WA 4IHQA 4LF8B 4OIMA 2ICAA 3FRIA 4MZXA 3NW9A 4NLLA 3RC1A 4QKQA 2FQYA 2PCLA 4B3JA 5FI1B 4CKWB 3WGYA 1OROA 3S2EA 2PJDA 5K9ZA 3HJBA 4QLAA 1E0KA 4KWTA 4CF7A 1IQPA 4MYUA 2DOKA 5IM4F 1CBUA 1J39A 3I42A 4RTJA 4NWIA 2NLOA 4L16A 1WW8A 1CUWA 2IP2A 4OREX 4EAQA 4HEA6 4UVGA 4Z4FA 4F92B 1YC5A 5FJJA 1DUVG 1E77A 1XT6A 2ZWMA 1XMIA 1H8ED 1G8YA 1QZXA 3OEED 4S24A 4X6UA 4QUHA 2CLDX 4MQUA 3A58B 4CHGA 1GTJ1 1P0QA 3WADA 4ENVA 2ZI6A 2GS9A 1GLGA 1VL1A 3A0RB 2Q41A 5CRIA 1NGSA 4EF4A 1H4QA 2X1LA 1MQ9A 5IXYA 1KP3A 1GPUA 4NV0A 5GINE 4AO8A 1FPQA 4YXWA 1T3LA 2VPYA 3GJXC 3N6RA 4K9LA 5JH7B 4YUWA 5KSZA 3WHLA 4KQXA 5DLDA 3N5KA 1D2HA 1YZKA 2IYQA 4R8LA 2OP0A 3F47A 3GXBA 1IOWA 1NWHA 1TMYA 3RYCB 4A6EA 2FQWA 3R5FA 2BRUA 3GIWA 4Z3KA 1RCFA 2ATEA 2IZ0A 3A1TA 1M6HA 4XWKA 5KOIA 1TECE 1NJ8A 1KAGA 4MK4A 1NVTA 3BL5A 3GZNA 4WKCA 4PZ9A 3UHOA 4BMXA 5CCBA 4PLGA 1W7AA 1Q1ZA 1SCDA 2IZ7A 2QV0A 5CFMA 4PM4A 4UE3S 3CH7A 1KI2A 3BXXA 4X24A 1O8CA 4PXAA 5JO0A 3VUEA 2PX5A 1QCYA 2F3QA 4XDYA 3MQ2A 1TUBB 3QXXA 4FYVA 1U1DA 1AKNA 1KNQA 4B7ZA 1BWSA 1MX5A 1ODLA 5JYBA 1XHFA 3THXB 1KTVA 3CZ9A 5EMJA 1QIGA 2IZOA 1NU8A 1OC4A 1UK9A 2R4QA 1DJLA 2FEPA 2Q3DA 1QORA 2Y92A 1KZ4A 2EZTA 1QIFA 1K88A 1VL8A 2GCOB 2I7VA 2XTMA 2BUCA 2AFIA 3KKOA 4KOEC 3ZJ5A 3FUWA 5FI3A 1N78A 3QLVA 2EZ9A 5DPMA 5JXWA 1C7EA 1D2NA 1MO3A 5HYVA 3EH1A 2AN3A 3DE5X 3R0XA 2AD5A 2PZBA 3G5LA 1TFUA 3IAS1 4G1BA 4PAWA 3V33A 4TLMB 1XEAA 3KEQA 1GSHA 1K1EA 3I2JA 3I12A 4HVTA 3O8LA 3QEJA 4BNKA 2WF9A 2TMGA 1A27A 3S1AA 4TSFD 4ROSA 1D5WA 2Z95A 3W3AH 5IVDA 2I8AA 4MAMA 3ZZ0A 3ID6C 3NTQA 1RC8A 5IHPA 1NSFA 4PC3A 4F7DA 1PWZA 2FMKA 2XB2A 3PFBA 3N70A 1KYIA 1QOZA 2HCRA 4RH0A 3KLOA 3OPVA 3ONNA 1Z3CA 2BKVA 3F6EX 3GFRA 9GPBA 1QKIA 2FJUA 4GX0A 5F7XA 1KAMA 1QVAA 4PZCA 1UBRS 2B98A 4OQ4A 3CC8A 1VPLA 1DAIA 4L85A 4O1HA 1CTQA 5K8VA 4Z9FA 1YE5A 4EX6A 1TQDA 5CA0A 2PM8A 2HT6A 3ZYCA 3BS4A 2C07A 3VHXB 1W2GA 3PDUA 5F77A 1UKAA 2NWQA 2QD4A 4G81A 4WAUA 5CG2A 1XD9A 4HUQA 1BDIA 1LLDA 2NSLA 2ODNA 4BX0A 3HN2A 1FP4A 2O1WA 5I45A 3FF4A 3MT7A 3L4EA 3OFSA 1FYVA 3VH3A 2Q4RA 3SJZA 2MSKA 2HM7A 4Q1FA 3ADDA 5AUPB 1VE9A 3B7GA 2QP4A 3B8EA 3R6LA 3N0TA 1CRQA 3M6WA 4FYKA 3FPHA 4LSWA 4RC9A 4YHBA 2VYND 1DQNA 1Z88A 2B2NA 2EFYA 2VP0A 3C7CB 1US8B 3L7LA 3LGXA 3BL8A 3OKCA 2ZJYA 2IHNA 4ALKA 1TU4A 2ZWVA 2EL9A 2PRZA 1U0EA 3H4TA 4QXAA 1P74A 3TOZA 1JDBC 5FULA 1SD1A 2E4VA 4JL8A 1W4RA 1QB7A 3L1UA 3TZKA 2X9LA 3OOYA 4W8HA 5E7MA 1W8DA 4V39A 3X2FA 5BR7A 5KS2A 2FEXA 1NQOA 3M34A 2CXXA 3ROFA 3PGA1 3BXHA 3SBXA 4OHPA 2XCSB 1N9GA 2QYOA 3BL6A 3D3QA 1T5LA 2QRVA 4BGVA 2CFTA 4L02A 2BBTA 1EEXB 2JHCA 3HY6A 1DKPA 3HA5A 3O1IC 4BKUA 2PY6A 3B3JA 1J1ZA 4JEHA 1VM6A 1YS2X 2P9BA 4DG8A 2YY7A 5KYWB 1D2CA 3JYHA 3RLFA 1BHJA 1FFSA 4HFJA 1JR3E 4MIYA 1L7DA 1QCZA 1WD5A 1YR6A 5HF6A 3T4UA 3UT5B 1I2CA 3QVWA 4I4TB 5B3JA 1XZQA 3ILVA 1ZK4A 5IXSA 3ZKAA 2EFGA 3UQYS 5FBQB 2RJNA 4NFLA 2RH5A 2YV3A 3SYTA 3ZZ1A 5B7NA 1MOZA 3STVA 4RTQA 4ZVVA 3FJYA 4Z4IA 5LQDA 1OLUA 1MT0A 4H7KA 2ONKA 4RESA 3V46A 4ZT3A 5IKEA 1JEEA 2WJIA 3NRCA 5C53B 2IFTA 4JOCA 2O2IA 1LV8A 3GN1A 3ZOZA 3IQWA 3B1ZA 4P32A 5IEBA 4BU1A 2IDKA 2XCIA 4L6AA 4BUCA 4C7KA 2BMWA 1ENOA 2DVMA 3K1JA 3VR6H 2ZB7A 1LW7A 5DGTA 5TMBA 4M7OA 5EJGA 5JLJA 4DAOA 3FTEA 4MXDA 1JALA 2C3MA 3QUQA 4WKNA 2B21A 3EB9A 3OX4A 2DUNA 3WZLA 1E7QA 5IT4A 2CJWA 5LMCA 5ARBA 2PUDA 1PG5A 5CM2Z 5HJEA 5F9HA 1UJ5A 3GLVA 4E15A 2XQFA 3NBAA 2IXTA 4GZ3A 2E9SA 4JI7B 2QMZA 3EVZA 1UMCA 1A9YA 4GPD1 4KQHA 1QAMA 3IEUA 3HZOA 3LFTA 2BGWA 5SYMA 1R6VA 2VYVD 3GLUA 3RBAA 3VYRB 3MS4A 4OHXA 1OTXA 2O23A 5G40A 4E5VA 1NHWA 1X8JA 3A7DA 5ESRA 1Z74A 4R2HA 1FVXA 4QFMA 3A37A 1QQTA 3PNLA 3AVXA 5I9TA 1R6AA 3U7RA 3OEYA 4WBSA 1C9YA 3AZPA 2HA6A 1T9HA 5JRJA 4HQNA 2MYNA 4GMHA 3NYIA 3RLIA 2FA9A 3E9ZA 4N82A 1I0IA 3OPYI 3UNXA 1Y98A 4IIJB 2ZIXA 5B4UA 2PGAA 3TRJA 1BCRA 3VR4A 3A9WA 1ZVMA 4JT9A 4JJEA 2FSFA 2GJ4A 3S2UA 1RYHA 3WRYC 5DU2A 1W87A 1RQGA 1ADGA 3AONB 1TCCA 2CK3D 3DFMA 4HN2A 2BDEA 2ZR7A 3I1YA 4D6XA 3OA0A 2QMYA 1KJIA 3F6PA 3E84A 3UB4A 4F3KA 2B4AA 2VUHB 4QICA 2CVHA 3M9LA 2AHRA 2ZSFA 4U9UA 3M3HA 5HRCA 3JCZA 1SUSA 2C04A 3K70D 5LR6A 2C2YA 2IYWA 4OI4A 7ABPA 1JJAA 1L1QA 5EMLA 3SX4A 1OI7A 2ZUEA 1VLZA 2XUDA 5CXQA 1MBZA 1WSWA 4P58A 4PZYA 5FO0A 4CM3A 2HCFA 4O2LA 5DV9A 5A0FA 1H5NA 1NTRA 4DLYA 1KI7A 4O8CA 4DA9A 3BMNB 2X1VA 3K72B 2PX0A 3WGTA 2DBVO 2XT0A 3GNQA 3BAZA 3BB4A 3KHKA 4FXPA 1YZ3A 4X1OA 4BLQA 1UWCA 4LJLA 4FFSA 3LHDA 1UBGA 2ZRQA 3SQDA 3C5HA 3PD1A 4MGZR 1WWKA 3UATA 4DUGD 3CB2A 1UDAA 1E69A 2JW5A 2WM9B 4Z2AA 1Q3KA 3EDQA 4PSKA 4PNZA 4LZWA 4PCLA 3AY6A 3UA3A 2WE8A 4MVJA 1NXPA 1Z68A 2AQ8A 2IE0A 2RHTA 3OC0A 3ZW7A 1O95D 1W5TA 1L4YA 4Q4CA 5KTNA 2AKAB 4E2YA 5K09A 1EQ2A 2WWHA 1X7DA 4EY7A 5TVKA 1Y4UA 2GF9A 4WLUA 3DW3X 1J8VA 3TI7A 1SWVA 3I6QA 5EHQA 1L7VC 4YUXA 2EIXA 1DIOB 1K7YA 4JP2A 2QUHA 3G6KA 1UANA 1TJ3A 1TJ5A 1C3OB 1XZCA 3AYZB 4BAUA 4P7KA 5L3SA 2H16A 3RSFA 1NVVQ 4M0MA 4U6QA 3DFFA 3QE4A 2JL1A 3ZHZA 5K8UA 3FOZA 1QHSA 2NTNA 1ZRHA 4MDEA 1XNRB 3FY4A 3JRXA 1M5UA 1W19A 2WYIA 3FZEA 4F38A 3JSXA 3PIDA 4YC7A 1E1NA 3VSEA 2ZFUA 4ZJUA 3NNNA 1FLVA 4RDXA 2F1OA 1AO0A 3VHLB 4MWBA 1ISSA 3UJNA 4ACBA 2J85A 1IBSA 2NXCA 1FJXA 1M2HA 2B83A 4BXOB 1Z5OA 2VL7A 3AV0B 2H0AA 1VFNA 3ZV4A 3D1VA 3BJEA 4KJZA 2FPIB 3B6IA 4QYIA 3WTBA 1KDOA 2CNOA 2NVWA 2XYVA 1MQSA 1QHNA 1V1RB 1YE3A 2FPPB 4HLUA 1ISHA 3AGPA 1OGIA 3TX6A 3EXHA 4H35A 4JASB 4LYFA 3T4XA 4C4SA 4EJ6A 5EHZA 3C3AA 1U1GA 3O1JC 4ZYYA 3K70C 3R9XB 2QKYA 3AESA 5DE3A 3DQQA 5FWXB 1POWA 1CJKC 1U0FA 1JRLA 2R8EA 3AW8A 5A5VA 4J4BA 2HJWA 1GSOA 1QYVA 1C0PA 3PC6A 5JNRA 3HN6A 3PE3A 3R3VA 4Q9DA 4AJLA 5L3VA 3Q1KA 2QSUA 5ENVA 4YX9A 1O1YA 2V5VA 4HYTA 4CHTA 3ES9A 4GI5A 5K3FB 1Z5PA 2JBAB 3WDLA 4RY0A 1DGQA 3GAFA 3QVOA 3Q8LA 2HADA 1E96A 5DHQA 4M9SA 4PRYA 4IDQA 1IVSA 1N4AA 4YAGA 1O9BA 3NYWA 2Y71A 4LYEA 1OZHA 5FOTA 1HBJA 1LW6E 4WKGA 2N1MA 3O6VA 4E11A 1SVUA 3B36A 3EXFA 3B9RA 3P5BA 2FRVA 2KW5A 5CYOA 3R6GA 1O95C 1GNVA 1XLTA 5E8JA 4UZFA 1GV1A 2W0MA 4ZAXA 4ETNA 4L4YA 5KO2A 1PGPA 3E9NA 4TS4A 2VDKB 3WKAA 1C7ZA 3KM0A 4I6EA 3OQ6A 4PZDA 1N57A 1S4MA 3CF4G 1F48A 1FPMA 1YCHA 1GXSB 3ANSA 1FFGA 1GNSA 4JX9A 5I7OA 3WO1A 3VVMA 4B6JA 2WUWE 4LRQA 2OV2A 3C5EA 5E1OA 4KQGA 2GYUA 2RH4A 5FUMA 1XJQA 4ZVPA 5I9BA 3TJRA 4N3NA 3RAEC 4AF6A 4BVKA 4QECA 4KREA 1I6LA 5JNWA 2ZZKA 3DQPA 1PK9A 3LDUA 2O8CA 1HMPA 1UF9A 1DCFA 2CJYA 1XNQB 5EGSA 3LF2A 1K8ZB 3BT7A 1DIGA 2AI1A 3IVCA 4KLNA 2YZKA 3Q9LA 4YJ2B 1UKBA 3ILYA 3EIQA 1GGHA 1JJVA 3JATA 4A1FA 1VPTA 5JASA 1P6XA 1Q83A 1U98A 2WNSA 2ZWOA 1N0IA 5AM0A 1N3BA 4YB8A 1CF4A 3IESA 2HIAA 1HWYA 2GN8A 1ZP6A 3ZN2A 4H9GA 1ONBA 2VK2A 4V0SA 5CU7A 4N47A 1NJ2A 2HNAA 4AD8A 4BN5A 1DEOA 3WAKA 4XCQA 4KV9A 5DN6D 2X0NA 2XECA 2Q99A 3QKRA 4HNSA 5ECDA 1PFQA 1W4LA 2D0IA 1NDUA 4FDAA 4HBZA 1P75A 2FZ4A 4GX2A 1EIZA 5AI5A 421PA 3IVXA 4FNMA 5JRZA 1CD5A 1B26A 2ZSJA 4I46A 3BRQA 5HFAA 2QTLA 5LBUA 3MGKA 1NW9B 1MUUA 1AHIA 1NASA 1RNLA 1DHRA 1RQRA 5EJ2A 1W5BA 1BDMA 3SNKA 1V1MB 1NW6A 2WWXA 3IIIA 4HY3A 1RBQA 4G89A 3ESRA 3UJ9A 4CQMD 4RVGA 4JP1A 1QG4A 3W90A 2IYLD 2SICE 1PE0A 3H75A 3EZLA 3JQ9C 4Q9IA 4WPGA 5F12A 4BU0A 4C6TA 1V4NA 2WDPA 3WMEA 4FHGA 1JBQA 2OFWA 2FW6A 1ISJA 3DE4X 4LE0A 4YJ3B 1FLAA 5CX1A 1PGOA 3EFOB 2PYDA 4L5JA 3TIIA 4Q7KA 3MWDB 3D1LA 1GPMA 3RSOA 3PK0A 1Q17A 1Z5ZA 3OFJA 1PT8A 1EBFA 2EEZA 1FRNA 2XTJA 2QU7A 2VJQA 4AS1A 4PFKA 1ZMRA 4EI8A 3QFCA 1O03A 4K8RB 2VTBA 3DKPA 2GRJA 3ZWVA 4WA8A 2M6KA 2KPOA 4IG4A 3OOHA 4EG3A 5GIOE 1I3CA 5IVHA 1ARZA 3FHOA 2BGNA 3EVFA 4DMKA 3RUPA 1X1CA 3HO6A 4HVAA 2EW1A 4XYEA 2WK1A 3ECCA 1T6YA 1JDUA 4JP3A 5D01A 4C08A 5BOVA 1I7QB 2PBLA 1TZ2A 5DXAA 1VHDA 4ZO4A 3C8HA 2GN9A 4IKEA 2AI2A 1RPJA 5E6RB 3EX7C 4C4YA 1EK2A 3ROZA 1GTVA 3N3BC 2OV3A 3LOPA 3F3KA 3INRA 3FYHA 2CV0A 1UWLA 1JHMA 2JGKA 2XEXA 5DEOA 3EIWA 3F4BA 1Z06A 3LI2A 3D0QA 2X9NA 3F5SA 5DTQA 4MMYB 2OBMA 5NLLA 1VLQA 3UK2A 4ER7A 3OESA 4UEJA 1ZSNA 4P2BA 1VMDA 2JCXA 1AK9A 4UFOA 2JGRA 2ODEA 2QLLA 3TIGA 3TG2A 3C3EA 3WLNA 5BWMA 3EMVA 4TRMA 1Z62A 2IH5A 4E94A 3BG5A 4O02B 4YDRA 3U1BA 4F06A 3ASZA 1A8PA 3T38A 1USWA 2VCYA 3AUXA 3DMRA 3FPSA 5DNEA 4BN4A 2Q62A 4E12A 2ACEA 4D43A 1T6ZA 4MB2A 1GUFA 3AIIA 1V9LA 2BELA 3BRSA 3I2FA 4ND8B 3UAWA 1GFZA 1ZJYA 2FW9A 10MHA 2KYRA 3PYLA 4PC7A 5T64A 3WB0A 1PV1A 3QUBA 2E7ZA 1MEOA 2K2QB 4EEZA 2HZBA 3K2BA 4MUYA 5BYKA 3A1FA 2QZ4A 2K5UA 3K0CC 4LA4A 4MW0A 4ZAVA 4OFBA 2IHVA 4QTZA 3RS2A 2R62A 3C87A 1Z38A 3DMPA 4HKTA 5AXDA 3W78A 2FMUA 2XMDA 4CG1A 5KTMA 3CIFA 4GD3Q 1TO1E 4JWTA 1MF7A 4KDEA 4Q4HA 3D5QA 4Y2PA 3SZOA 3PIRA 4DUYB 1QG2A 4OP2A 3TKYA 1IPEA 3UMMA 1XTJA 3TQSA 1ZIDA 4KPUB 3HLKA 4BQRA 4BVHA 2Q1WA 1E7SA 2HNBA 3CNEA 2GM9A 4UARA 1MNQA 2PVSA 2W2QA 3I9OA 3Q85A 1TYCA 4B84A 1JS1X 3HJFA 3HCOA 3H2HA 1Z4MA 1IDN1 2O4CA 2R5NA 2ZBFA 2NZUG 2EJTA 2PFKA 3OE7A 4W1RA 1QM5A 2YMMA 2OCKA 2ZBRA 4DCVA 4EQ6B 4PGFA 4YYZA 1FUIA 4CMJA 1C8BA 3Q8MA 4ITRC 1E7RA 1R5NA 4JYBA 4EELA 4JLPA 4MV1A 1CQJA 2QTTA 4LMBA 4Q3DA 2I6XA 4AP5A 2BKXA 1EX1A 1OJ7A 2C4VA 4ER0A 3LYUA 1Z2OX 2A2ZA 1XTPA 1H3FA 1JG6A 2VYCA 3BIOA 4ZOLA 2V55B 4BV3A 1BWQA 2BFOA 1ZGGA 5HA5A 1NJGA 3QKUA 3QMPA 1DAFA 1CUGA 1MN6A 1PR4A 3A31A 3FBWA 3PL5A 2J45A 4JQOA 4U8HA 1TTPB 1IB6A 1ODJA 1ST2A 2P8JA 2D8AA 2UZ3A 2VBCA 4I5FA 1XMQB 2ZUVA 4WIAA 1C7JA 4DNFA 2DR2A 3BH0A 3BA6A 3WQQA 1L5QA 2CDAA 3CJQA 2HF9A 5I9MA 4NK4A 4HRAA 3DFUA 3LT1A 1Y5NA 2X7JA 4MS3A 5EOVA 3ZLVA 5KTPA 5JBIA 5B1EA 3L18A 5KNDH 3W9YA 1XTRA 2OWDA 5FAXA 2EX4A 3JVDA 1JZQA 1E62A 1FVFA 3E0XA 2XY4A 2H7CA 3CX8A 4WXYB 5JO9A 5C4MA 3TJZA 1EGQA 3BGSA 2ZSUA 5JDIC 1AUVA 3LE8A 1Z6GA 3JQGB 1VGQA 3AHIA 3L8EA 4BP9A 1VKOA 1SUCA 4E33A 4MJ3A 3PGKA 2JANA 5HX7A 3DE3X 2C5GA 4X84A 1D6MA 4F4DA 4DSAA 5K2OA 1N75A 2R2AA 2R84A 4W6QA 3KYJB 1AA9A 4QELA 2DWUA 2NU9B 3RR2A 1Q1NA 1AKTA 5A03A 1QIIA 5BR8B 4G63A 4I5IA 4P4GA 4ZVNA 5KNCA 1C7FA 2ISCA 1SBNE 2VZ0A 1A9XB 5FXMA 3P2MA 1ZG3A 1YZGA 4YONB 1XIVA 5TQ2B 1AXGA 3AUUA 2UYGA 1CETA 3OCUA 1Y9EA 1OKKD 3SSOA 5I9LA 3ET4A 1ESEA 4ZVMA 1CIJA 1NX6A 4P3KA 3T5BA 3VZCA 1TM7E 3DEJA 4XWGA 1T2EA 2C9ZA 1KTIA 1XEXA 2IYSA 2OZKA 2VJBA 1L7RA 4MJXA 1EPUA 2PUEA 1QYDA 4G5XA 3LWDA 1V4BA 2F43A 1AUQA 1Q0UA 5HILA 1SUIA 1NF9A 5H3LA 4MW9A 3E35A 3H2GA 3ODGA 4AJ9A 1H2XA 4FPXA 4IWNA 2NTEA 2YWRA 3ZDQA 2O3TA 1IFXA 1U90A 3LMKA 1EAMA 1I6WA 4CETA 1ZS9A 3M81A 4IXMA 4MMZB 4NG5A 4L75A 2RFLA 3B9QA 2PLRA 2VDMB 4ARUA 1F5NA 2AE1A 4F5EA 4NE9A 2Z8ZA 2DH6A 2XBLA 1CRLA 1L9XA 2Z6AA 1F8UA 2HA3A 2QI9F 3EOZA 3IMKA 3LM8A 3KZMA 4KX5A 5EXTA 4EPWA 3WHKA 5LPNA 2WJ3A 3R5KA 2XV1A 3NC4A 4JBWA 5JVDB 4BP1A 1IMOA 4UHJA 3LT5A 2IBTA 4PE5B 5JSZB 3G0IA 5J5AA 3WGVA 3UMRA 5A9RA 1EQAA 1XAIA 2NTYC 2PVPA 3FYUB 3GJTA 4IDFA 4MPPA 1Y6GA 4ZVLA 4YY3B 3GFGA 1TB4A 2R7NA 3HB5X 5LOVB 2GF0A 4LV5B 1CT9A 4P08A 4Y6RA 1F9EA 5EZ6B 2XCTB 4XAQA 1WEKA 4WOKA 4F85A 1YJXA 2NU7A 1SQ5A 3D1JA 4X3PA 5KQGA 2R11A 1FP6A 2Y4OA 4CL8A 3SHFA 3L1VA 2OYRA 4WEQA 1WSDA 5D86A 3RFFA 5IF3A 2YKGA 4BNMA 2JCGA 4JSRA 2I33A 1EGAA 3WGUA 2FP4A 2ISSD 3B1VA 3O2SB 5EXPA 2C2XA 1ULZA 4KUHA 4EUKA 2PUFA 3W2IA 5KQRA 5LKRA 2J5XA 4AZ0B 1DDOA 4DLZA 1WVIA 2PLAA 4OLJA 4UEOA 5DSZA 3WNQA 2FN8A 3RVSA 3Q7SA 2ZB2A 2GR9A 4MVJM 4R3UC 1JAHA 5BUSA 4MNTA 4AJ1A 1YMUA 1RVDA 3H9UA 4POOA 3Q7RA 4KFTA 4PYOA 3UBMA 1BMFA 2UYQA 2D0PB 4EY4A 3RIEA 6PFKA 3KP1A 1YRYE 3PENA 3GMTA 4XD7A 4C5CA 1G6Q1 2QMQA 4F46A 3SCZA 4CRWB 1JYFA 3CEMA 2E5WA 4HZGA 4IUYA 4NFYA 4TLAA 2HW8A 2A86A 1ABFA 2JFFA 3OZEA 3PDIA 1OH8A 5CFPA 2YVKA 3N8DA 3SD7A 4C7BA 3K1TA 1G7RA 3R3HA 5HIMA 1J22A 3IR7A 4HN9A 3V1UA 2VKTA 4OFXA 4I6GA 4FGLA 4XIFA 4U9IS 1M2OB 4NCIA 4HLQB 3ZU2A 1V47A 4R1SA 1NPYA 4MQFA 5KVSA 2A6PA 1T5TA 2PRYA 3KV3O 4DPLA 3KWFA 3R5SA 4II2A 1QZUA 2HIHA 1Z2AA 2IGTA 3CBQA 3QWHA 4EKEA 2AFHE 4RPLA 3GRCA 3JZIA 1SHTX 3KPUA 1LH0A 3LSTA 3LWZA 1JI3A 2F3TA 2J5KA 3D8NA 1VECA 5C1BA 1AQLA 2PZFA 3D4IA 2KI5A 3ORSA 3GGGA 4EF6A 3OX2A 1O7JA 1Y8QB 2BF7A 2OESA 2ZRGA 1T9DA 2A30A 2WICA 3KVOA 4L8WB 4Q7MB 5H3HA 1EGVB 1T3HA 4IDGA 3ZWKA 5KU7A 3KZNA 1IY1A 2MINB 5BYBA 3WK4A 3JTMA 5L7TA 2VJCA 4Q1CA 1DEXA 4WVFA 2E37A 1DAGA 1RRMA 1LVHA 2EU8A 4QBIA 1U11A 2IL1A 4IYRA 5LWHA 4BMDA 4OFWA 1B00A 3GDOA 1BCSA 4U2BA 2AFRA 2IP4A 1OX6A 4N18A 2CXSA 4M7PA 3CVOA 2NO1A 4HTFA 2QNRA 3OZSA 3Q5EA 2B94A 2WV9A 4LRSB 4Q19A 1G21E 3TIFA 1Z0IA 1FYEA 1U4SA 4L5BA 1B15A 1I3OA 5BVHA 1M6EX 2MSNA 5G2OA 2HUNA 3TKLA 1YR1A 4L1KA 4Y2TA 1HT1E 1F17A 2UVPA 1TVMA 2B4QA 3ZLUA 1Z29A 3C5WP 5BT8A 1ZGBA 1L8QA 2BPOA 4DZZA 2CC2A 3CINA 1JWLA 3UENA 4FBGA 4M54A 2F7SA 5KWEA 2OFPA 2AG5A 2V7PA 3PQ8A 1ZMTA 4REQB 4JI5B 4PYJA 1FX0A 2PUAA 3R77A 2ZROA 4XPIA 4JYMA 4M0KA 2IU0A 1D2MA 3DLBA 3TLJA 1JR2A 2VUIB 4QYSA 3JVEA 5IJWA 3PXXA 2GZAA 3WLTA 2VSOA 4R71A 3EXIB 4Q7EA 2ZSIA 5B6JA 1AKVA 1WOMA 2O2XA 4BB0A 4ZYTA 3PCTA 4N5IX 4R6WA 2JJ1D 4A6DA 5LLDA 1GGEA 2XUIA 5CB4A 2FSHA 1DKLA 2VK8A 3IIJA 4FB5A 3AHCA 3PGXA 5THQA 3CW2A 4LQLA 4WOBA 3CTMA 3UOWA 3NS7A 5KYNA 2XCRB 3KR1A 2IUUA 2HHHB 4ZMSA 4PCUA 2ID7A 2V03A 1NUPA 2V1XA 4R2MA 1T2UA 2BKUA 1KAQA 4TTTS 2NZYA 2JAOA 1K7XB 1M2WA 2JIMA 1D07A 4FKMA 2HH9A 1R88A 2H2GA 3L6RA 2HF7A 4GI1A 4M22A 4I2NA 2YL2A 1YQDA 1GEEA 3ZGYA 4DLRA 5I4KA 2PZKA 4FYWA 3AM4A 1H2RS 4IUCS 5J2TB 1OX4B 2Z9DA 5WRFA 2O8FB 5BSKA 1EZ4A 5ALUA 2L82A 1VG8A 5FOVA 4BE7B 2ZB4A 4HX2A 4XVCA 5BURA 3E2PA 1TLFA 5CVDA 4A9AA 2GAAA 3KJHA 1IL0A 1JU3A 4IF6A 4XJXA 1OIXA 3L5OA 4XDHA 221PA 4TV9F 4GL2A 5CDFA 3VPAA 3VR3D 1ECCA 2IU3A 1WUTA 2XMQA 2OC9A