4A3WA

Crystal structure of archaemetzincin (amza) from archaeoglobus fulgidus at 2.16 a resolution complexed with citrate
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
MKIYIQPLSVNSHTVEVLANSLPKIFNAEVFVLPASDVSLKCYNASRRQYNSTCILRMLPPIKVTLGVTGKDIYAKGMNFVFGEAELGGARAVLSVFRLTTADSELYRERVVKEAVHEIGHVLGLKHCSNNCVMRFSNSVQDVDRKPVSFCRECASKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARCHAEMETZINCIN
publication title Crystal Structures of Archaemetzincin Reveal a Moldable Substrate-Binding Site.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 50
structure length 158
sequence length 158
ec nomenclature ec 3.-.-.-:
pdb deposition date 2011-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07998 Peptidase_M54 Peptidase family M54
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4a3wA00
1OM8A 2D1OA 3AIGA 3NX7A 3F19A 2AIGP 3DSLA 4PKVA 1JKYA 1K7GA 1GXDA 4G0DA 1S4BP 2KRJA 3HY7A 1XFXA 4IJOA 5B5PA 3OHLA 1H71P 1Y0VA 4J4MA 3ZVSA 1CK7A 1HFCA 1C3IA 4GWNA 4ILWD 1BQOA 1GKDA 3F17A 2MZIA 1HTDA 2QPJA 1SLNA 3ZUKA 1JK3A 4JP4A 1OS2A 3F16A 1IABA 1ZXVA 1XFUA 1Y8JA 2X3CA 4DPEA 2OXWA 3HB2P 3I7IA 4I03A 1G49A 1QICA 5CZMA 1QUAA 3EWJA 4H3XA 3RTTA 1KBCA 1CGFA 1SRPA 1B3DA 2OW0A 3LE9A 4QKZA 1B8YA 1BM6A 1JIZA 1AF0A 2MZHA 2WO8A 3E8RA 1KUFA 1A86A 1XFZA 1QIBA 1YQYA 2USNA 1PWPA 3B92A 1FLSA 3BA0A 1UMTA 1UTTA 2E2DA 3EDZA 1IACA 2O36A 3P24A 1Z3JA 3KWVC 1GKCA 2ERPA 4AYKA 2CLTA 3O2XA 1SU3A 5I12A 3ZXHA 1XFVA 3U1RA 5L79A 1GE7A 1MMBA 2K2GA 4DF9A 2W0DA 2OY4A 2EROA 4GUYA 2YIGA 1XUCA 1YCMA 2JSDA 2X3AA 1CXVA 2OW2A 1SATA 1ZTQA 1CGLA 1FBLA 4FVLA 830CA 3DNGA 4H82A 4IUWA 2PJTA 2POJA 3LUMA 2A8HA 2X3BA 4PKTA 2X7MA 456CA 2J0TA 3CKIA 4H84A 4JIJA 3KMCA 4HX3A 4L19A 5JMYA 3Q2HA 4GR8A 1PWUA 4GQLA 1OM6A 1O0QA 4Q1LA 1IAGA 2RJPA 3F1AA 4AUOA 1XURA 2CKIA 2JIHA 2HU6A 1BQQM 4A3WA 1OO9A 2Y6DA 3LIRA 2L0RA 4CTHA 2D1NA 4H49A 2K9CA 2AYKA 4HMAA 2O3EA 1BIWA 5D1TA 3HBUP 4XM7A 3AYUA 4WKEA 3K7LA 1O0TA 4AIGA 4H30A 2OVXA 2OZRA 3N2UA 4IN9A 1BKCI 4ON1A 1YOUA 1HFSA 1PWWA 1I1IP 2MZEA 5L7FA 1Y93A 1D5JA 1JAOA 2Z2DA 3KRYA 3LQBA 5D7WA 4I35A 3LKAA 1BSWA 1BUVM 2Y6CA 3HY9A 4EFSA 1OS9A 1EB6A 1UMSA 3WV1A 4XBHA 3LUNA 4R3VA 1YP1A 3EHXA 1D7XA 5D3CA 4PKWA 3KMEA 1BUDA 3TS4A 4DD8A 1JAPA 1PWVA 1KUIA 3I7GA 2I47A 3EHYA 1Q3AA 1SMPA 1KUHA 2OXUA 1R54A 3HYGA 5LABA 3LJTA 2W15A 3UVCA 1ATLA 3ELMA 3G42A 1HY7A 5CXAA 1UEAA 2DW0A 4H2EA 1GO7P 4AXQA 5I43A 4PKRA 1IADA 1MNCA 3LIKA 2JT5A 2DDFA 2DDYA 1UTZA 2MLRA 2WOAA 5I3MA 2OW1A 3LILA 3Q2GA 1G4KA 5D1SA 1GE5A 1XUDA 3DPFA 1EUBA 3KECA 3LQ0A 1IAEA 4G9LA 1R1HA 1C7KA 1BKCE 1RMZA 1OMJA 2SRTA 3TSKA 1G05A 3GBOA 3SHIA 1L6JA 1G9KA 1WNIA 1GE6A 1J7NA 2XS3A 4GWMA 1CAQA 3F15A 3TT4A 1SLMA 2N8RA 1ZXCA 1BZSA 1K7QA 2W13A 3KHIA 1CIZA 4XCTA 2OY2A 1QIAA 4H1QA 2OW9A 2W14A 3DPEA 1KUGA 2XS4A 3WV3A 3AYKA 4JQGA 1OM7A 4DV8A 1ROSA 2ERQA 1IAAA 3L0TA 3LGPA 1ND1A 1R55A 2WO9A 5I4OA 1DMTA 1CGEA 1JJ9A 3LJGA 2OXZA 1USNA 4WF6A 5H8XA 3L0VA 1RM8A 1KAPP 5D2BA 2RJQA 1XFWA 1CQRA 1C8TA 5BPAA 4GR0A 3KEJA 3WV2A 2V4BA 1JANA 4XM6A 2OVZA 3USNA 1K7IA 3G5CA 2J83A 2YB9A 1I76A 3LMCA 2JNPA 3OHOA 2W12A 3EDIA 3KEKA 3EDHA 2MLSA 4FXYP 3B8ZA 3MA2A 1ZP5A 3HDAP 1HOVA 5CUHA 4L6TA 3LJZA 4PKSA 1MMPA 4ZR5A 5BOYA 4PKQA 1D8FA 1KUKA 1DTHA 5BOTA 2DW2A 2DW1A 1G12A 1AKLA 4H76A 3HDBA 5I0LA 4GF1A 4FU4A 5D1UA 1BKCA 1JIWP 1QJJA 4PKUA 1JH1A 3RTSA 3N2VA 2FV5A 2E3XA 1PWQA 1GO8P 4GR3A 3HBVP 1JAQA 3EDGA 1A85A 4WK7A 1AYKA 3VI1A 3VTGA 3LK8A 5I2ZA 4WKIA 5B5OA 2OI0A 1D8MA 1XFYA 1EAKA 3TVCA 3P1VA 2JT6A 3O64A 4JPAA 4FXQA 1I73A 2FV9A 1ZS0A 3F18A 1FM1A 4JA1A 966CA 1R1JA 1MMRA 3V96B 4L63A 3DWBA 1QJIA 4WZVA 3LEAA 3K7NA 1HV5A 1R1IA 1ASTA 2TCLA 1MMQA 3DL1A 1ZVXA 4A7BA 4XM8A 3B2ZA
chains in the Genus database with same CATH superfamily
1OM8A 2D1OA 3AIGA 3NX7A 3F19A 2AIGP 3DSLA 4PKVA 1JKYA 1K7GA 1GXDA 4G0DA 1S4BP 2KRJA 3HY7A 1XFXA 4IJOA 5B5PA 3OHLA 1H71P 1Y0VA 4J4MA 3ZVSA 1CK7A 1HFCA 1C3IA 4GWNA 4ILWD 1BQOA 1GKDA 3F17A 2MZIA 1HTDA 2QPJA 1SLNA 3ZUKA 1JK3A 4JP4A 1OS2A 3F16A 1IABA 1ZXVA 1XFUA 1Y8JA 2X3CA 4DPEA 2OXWA 3HB2P 3I7IA 4I03A 1G49A 1QICA 5CZMA 1QUAA 3EWJA 4H3XA 3RTTA 1KBCA 1CGFA 1SRPA 1B3DA 2OW0A 3LE9A 4QKZA 1B8YA 1BM6A 3DTEA 1JIZA 1AF0A 2MZHA 2WO8A 3E8RA 1KUFA 1A86A 1XFZA 1QIBA 1YQYA 2USNA 1PWPA 3B92A 1FLSA 3BA0A 1UMTA 1UTTA 2E2DA 3EDZA 1IACA 2O36A 3P24A 1Z3JA 3KWVC 1GKCA 2ERPA 4AYKA 2CLTA 3O2XA 1SU3A 5I12A 3ZXHA 1XFVA 3U1RA 5L79A 1GE7A 1MMBA 1XAXA 2K2GA 4DF9A 2W0DA 2OY4A 2EROA 4GUYA 2YIGA 1XUCA 1YCMA 2JSDA 2X3AA 1CXVA 2OW2A 1SATA 1ZTQA 1CGLA 1FBLA 4FVLA 830CA 3DNGA 4H82A 4IUWA 2PJTA 2POJA 3LUMA 2A8HA 2X3BA 4PKTA 2X7MA 456CA 2J0TA 3CKIA 4H84A 4JIJA 3KMCA 4HX3A 4L19A 5JMYA 3Q2HA 4GR8A 1PWUA 4GQLA 1OM6A 1O0QA 4Q1LA 1IAGA 2RJPA 3F1AA 4AUOA 1XURA 2CKIA 2JIHA 2HU6A 1BQQM 4A3WA 1OO9A 2Y6DA 3LIRA 2L0RA 4CTHA 2D1NA 4H49A 2K9CA 2AYKA 4HMAA 2O3EA 1BIWA 5D1TA 3HBUP 4XM7A 3AYUA 4WKEA 3K7LA 1O0TA 4AIGA 4H30A 2OVXA 2OZRA 3N2UA 4IN9A 1BKCI 4ON1A 1YOUA 4L7AA 1HFSA 1PWWA 1I1IP 2MZEA 5L7FA 1Y93A 1D5JA 1JAOA 2Z2DA 3KRYA 3LQBA 5D7WA 4I35A 2YUFA 3LKAA 1BSWA 1BUVM 2Y6CA 3HY9A 4EFSA 1OS9A 1EB6A 1UMSA 3WV1A 4XBHA 3LUNA 4R3VA 1YP1A 3EHXA 1D7XA 5D3CA 4PKWA 3KMEA 1BUDA 3TS4A 4DD8A 1JAPA 1PWVA 1KUIA 3I7GA 2I47A 3EHYA 1Q3AA 1SMPA 1KUHA 2OXUA 1R54A 3HYGA 5LABA 3LJTA 2W15A 3UVCA 1ATLA 3ELMA 3G42A 1HY7A 5CXAA 1UEAA 2DW0A 4H2EA 1GO7P 4AXQA 5I43A 4PKRA 1IADA 1MNCA 3LIKA 2JT5A 2DDFA 2DDYA 1UTZA 2MLRA 2WOAA 5I3MA 2OW1A 3LILA 3Q2GA 1G4KA 5D1SA 1GE5A 1XUDA 3DPFA 1EUBA 3KECA 3LQ0A 1IAEA 4G9LA 1R1HA 1C7KA 1BKCE 1RMZA 1OMJA 2SRTA 3TSKA 1G05A 3GBOA 3SHIA 1L6JA 1G9KA 1WNIA 1GE6A 1J7NA 2XS3A 4GWMA 1CAQA 3F15A 3TT4A 1SLMA 2N8RA 1ZXCA 1BZSA 1K7QA 2W13A 3KHIA 1CIZA 4XCTA 2OY2A 1QIAA 4H1QA 2OW9A 2W14A 3DPEA 1KUGA 2XS4A 3WV3A 3AYKA 4JQGA 1OM7A 4DV8A 1ROSA 2ERQA 1IAAA 3L0TA 3LGPA 1ND1A 1R55A 1XM5A 2WO9A 5I4OA 1DMTA 1CGEA 1JJ9A 3LJGA 2OXZA 1USNA 4WF6A 5H8XA 3L0VA 1RM8A 1KAPP 5D2BA 2RJQA 1XFWA 1CQRA 1C8TA 5BPAA 4GR0A 3KEJA 3WV2A 2V4BA 1JANA 4XM6A 2OVZA 3USNA 1K7IA 3G5CA 2J83A 2YB9A 1I76A 3LMCA 2JNPA 3OHOA 2W12A 3EDIA 3KEKA 3EDHA 2MLSA 4FXYP 3B8ZA 3MA2A 1ZP5A 3HDAP 1HOVA 5CUHA 4L6TA 3LJZA 4PKSA 1MMPA 4ZR5A 5BOYA 4PKQA 1D8FA 1KUKA 1DTHA 5BOTA 2DW2A 2DW1A 1G12A 1AKLA 4H76A 3HDBA 5I0LA 4GF1A 1TVIA 4FU4A 5D1UA 1BKCA 1JIWP 1QJJA 4PKUA 1JH1A 3RTSA 3N2VA 2FV5A 2E3XA 1PWQA 1GO8P 4GR3A 3HBVP 1JAQA 3EDGA 1A85A 4WK7A 1AYKA 3VI1A 3VTGA 3DTKA 1OZ9A 3LK8A 5I2ZA 4WKIA 5B5OA 3DTIA 2OI0A 1D8MA 1XFYA 1EAKA 3TVCA 3P1VA 2JT6A 3O64A 4JPAA 4FXQA 1I73A 2FV9A 1ZS0A 3F18A 1FM1A 4JA1A 966CA 1R1JA 1MMRA 3V96B 4L63A 3DWBA 1QJIA 4WZVA 3LEAA 3K7NA 1HV5A 1R1IA 1ASTA 2TCLA 1MMQA 3DL1A 1ZVXA 4A7BA 4XM8A 3B2ZA
chains in the Genus database with same CATH topology
1OM8A 2D1OA 3AIGA 3NX7A 3F19A 2AIGP 3DSLA 4PKVA 1JKYA 1K7GA 1GXDA 4G0DA 1S4BP 2KRJA 3HY7A 1XFXA 4IJOA 5B5PA 3OHLA 1H71P 1Y0VA 4J4MA 3ZVSA 1CK7A 1HFCA 1C3IA 4GWNA 4ILWD 1BQOA 1GKDA 3F17A 2MZIA 1HTDA 2QPJA 1SLNA 3ZUKA 1JK3A 4JP4A 1OS2A 3F16A 1IABA 1ZXVA 1XFUA 1Y8JA 2X3CA 4DPEA 2OXWA 3HB2P 3I7IA 4I03A 1G49A 1QICA 5CZMA 1QUAA 3EWJA 4H3XA 3RTTA 1KBCA 1CGFA 1SRPA 1B3DA 2OW0A 3LE9A 4QKZA 1B8YA 1BM6A 3DTEA 1JIZA 1AF0A 2MZHA 2WO8A 3E8RA 1KUFA 1A86A 1XFZA 1QIBA 1YQYA 2USNA 1PWPA 3B92A 1FLSA 3BA0A 1UMTA 1UTTA 2E2DA 3EDZA 1IACA 2O36A 3P24A 1Z3JA 3KWVC 1GKCA 2ERPA 4AYKA 2CLTA 3O2XA 1SU3A 5I12A 3ZXHA 1XFVA 3U1RA 5L79A 1GE7A 1MMBA 2K2GA 4DF9A 2W0DA 2OY4A 2EROA 4GUYA 2YIGA 1XUCA 1YCMA 2JSDA 2X3AA 1CXVA 2OW2A 1SATA 1ZTQA 1CGLA 1FBLA 4FVLA 830CA 3DNGA 4H82A 4IUWA 2PJTA 2POJA 3LUMA 2A8HA 2X3BA 4PKTA 2X7MA 456CA 2J0TA 3CKIA 4H84A 4JIJA 3KMCA 4HX3A 4L19A 5JMYA 3Q2HA 4GR8A 1PWUA 4GQLA 1OM6A 1O0QA 4Q1LA 1IAGA 2RJPA 3F1AA 4AUOA 1XURA 2CKIA 2JIHA 2HU6A 1BQQM 4A3WA 1OO9A 2Y6DA 3LIRA 2L0RA 4CTHA 2D1NA 4H49A 2K9CA 2AYKA 4HMAA 2O3EA 1BIWA 5D1TA 3HBUP 4XM7A 3AYUA 4WKEA 3K7LA 1O0TA 4AIGA 4H30A 2OVXA 2OZRA 3N2UA 4IN9A 1BKCI 4ON1A 1YOUA 4L7AA 1HFSA 1PWWA 1I1IP 2MZEA 5L7FA 1Y93A 1D5JA 1JAOA 2Z2DA 3KRYA 3LQBA 5D7WA 4I35A 2YUFA 3LKAA 1BSWA 1BUVM 2Y6CA 3HY9A 4EFSA 1OS9A 1EB6A 1UMSA 3WV1A 4XBHA 3LUNA 4R3VA 1YP1A 3EHXA 1D7XA 5D3CA 4PKWA 3KMEA 1BUDA 3TS4A 4DD8A 1JAPA 1PWVA 1KUIA 3I7GA 2I47A 3EHYA 1Q3AA 1SMPA 1KUHA 2OXUA 1R54A 3HYGA 5LABA 3LJTA 2W15A 3UVCA 1ATLA 3ELMA 3G42A 1HY7A 5CXAA 1UEAA 2DW0A 4H2EA 1GO7P 4AXQA 5I43A 4PKRA 1IADA 1MNCA 3LIKA 2JT5A 2DDFA 2DDYA 1UTZA 2MLRA 2WOAA 5I3MA 2OW1A 3LILA 3Q2GA 1G4KA 5D1SA 1GE5A 1XUDA 3DPFA 1EUBA 3KECA 3LQ0A 1IAEA 4G9LA 1R1HA 1C7KA 1BKCE 1RMZA 1OMJA 2SRTA 3TSKA 1G05A 3GBOA 3SHIA 1L6JA 1G9KA 1WNIA 1GE6A 1J7NA 2XS3A 4GWMA 1CAQA 3F15A 3TT4A 1SLMA 2N8RA 1ZXCA 1BZSA 1K7QA 2W13A 3KHIA 1CIZA 4XCTA 2OY2A 1QIAA 4H1QA 2OW9A 2W14A 3DPEA 1KUGA 2XS4A 3WV3A 3AYKA 4JQGA 1OM7A 4DV8A 1ROSA 2ERQA 1IAAA 3L0TA 3LGPA 1ND1A 1R55A 2WO9A 5I4OA 1DMTA 1CGEA 1JJ9A 3LJGA 2OXZA 1USNA 4WF6A 5H8XA 3L0VA 1RM8A 1KAPP 5D2BA 2RJQA 1XFWA 1CQRA 1C8TA 5BPAA 4GR0A 3KEJA 3WV2A 2V4BA 1JANA 4XM6A 2OVZA 3USNA 1K7IA 3G5CA 2J83A 2YB9A 1I76A 3LMCA 2JNPA 3OHOA 2W12A 3EDIA 3KEKA 3EDHA 2MLSA 4FXYP 3B8ZA 3MA2A 1ZP5A 3HDAP 1HOVA 5CUHA 4L6TA 3LJZA 4PKSA 1MMPA 4ZR5A 5BOYA 4PKQA 1D8FA 1KUKA 1DTHA 5BOTA 2DW2A 2DW1A 1G12A 1AKLA 4H76A 3HDBA 5I0LA 4GF1A 4FU4A 5D1UA 1BKCA 1JIWP 1QJJA 4PKUA 1JH1A 3RTSA 3N2VA 2FV5A 2E3XA 1PWQA 1GO8P 4GR3A 3HBVP 1JAQA 3EDGA 1A85A 4WK7A 1AYKA 3VI1A 3VTGA 3DTKA 3LK8A 5I2ZA 4WKIA 5B5OA 3DTIA 2OI0A 1D8MA 1XFYA 1EAKA 3TVCA 3P1VA 2JT6A 3O64A 4JPAA 4FXQA 1I73A 2FV9A 1ZS0A 3F18A 1FM1A 4JA1A 966CA 1R1JA 1MMRA 3V96B 4L63A 3DWBA 1QJIA 4WZVA 3LEAA 3K7NA 1HV5A 1R1IA 1ASTA 2TCLA 1MMQA 3DL1A 1ZVXA 4A7BA 4XM8A 3B2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OM8 A;  2D1O A;  3AIG A;  3NX7 A;  3F19 A;  2AIG P;  3DSL A;  4PKV A;  1JKY A;  1K7G A;  1GXD A;  4G0D A;  1S4B P;  2KRJ A;  3HY7 A;  1XFX A;  4IJO A;  5B5P A;  3OHL A;  1H71 P;  1Y0V A;  4J4M A;  3ZVS A;  1CK7 A;  1HFC A;  1C3I A;  4GWN A;  4ILW D;  1BQO A;  1GKD A;  3F17 A;  2MZI A;  1HTD A;  2QPJ A;  1SLN A;  3ZUK A;  1JK3 A;  4JP4 A;  1OS2 A;  3F16 A;  1IAB A;  1ZXV A;  1XFU A;  1Y8J A;  2X3C A;  4DPE A;  2OXW A;  3HB2 P;  3I7I A;  4I03 A;  1G49 A;  1QIC A;  5CZM A;  1QUA A;  3EWJ A;  4H3X A;  3RTT A;  1KBC A;  1CGF A;  1SRP A;  1B3D A;  2OW0 A;  3LE9 A;  4QKZ A;  1B8Y A;  1BM6 A;  1JIZ A;  1AF0 A;  2MZH A;  2WO8 A;  3E8R A;  1KUF A;  1A86 A;  1XFZ A;  1QIB A;  1YQY A;  2USN A;  1PWP A;  3B92 A;  1FLS A;  3BA0 A;  1UMT A;  1UTT A;  2E2D A;  3EDZ A;  1IAC A;  2O36 A;  3P24 A;  1Z3J A;  3KWV C;  1GKC A;  2ERP A;  4AYK A;  2CLT A;  3O2X A;  1SU3 A;  5I12 A;  3ZXH A;  1XFV A;  3U1R A;  5L79 A;  1GE7 A;  1MMB A;  2K2G A;  4DF9 A;  2W0D A;  2OY4 A;  2ERO A;  4GUY A;  2YIG A;  1XUC A;  1YCM A;  2JSD A;  2X3A A;  1CXV A;  2OW2 A;  1SAT A;  1ZTQ A;  1CGL A;  1FBL A;  4FVL A;  830C A;  3DNG A;  4H82 A;  4IUW A;  2PJT A;  2POJ A;  3LUM A;  2A8H A;  2X3B A;  4PKT A;  2X7M A;  456C A;  2J0T A;  3CKI A;  4H84 A;  4JIJ A;  3KMC A;  4HX3 A;  4L19 A;  5JMY A;  3Q2H A;  4GR8 A;  1PWU A;  4GQL A;  1OM6 A;  1O0Q A;  4Q1L A;  1IAG A;  2RJP A;  3F1A A;  4AUO A;  1XUR A;  2CKI A;  2JIH A;  2HU6 A;  1BQQ M;  4A3W A;  1OO9 A;  2Y6D A;  3LIR A;  2L0R A;  4CTH A;  2D1N A;  4H49 A;  2K9C A;  2AYK A;  4HMA A;  2O3E A;  1BIW A;  5D1T A;  3HBU P;  4XM7 A;  3AYU A;  4WKE A;  3K7L A;  1O0T A;  4AIG A;  4H30 A;  2OVX A;  2OZR A;  3N2U A;  4IN9 A;  1BKC I;  4ON1 A;  1YOU A;  1HFS A;  1PWW A;  1I1I P;  2MZE A;  5L7F A;  1Y93 A;  1D5J A;  1JAO A;  2Z2D A;  3KRY A;  3LQB A;  5D7W A;  4I35 A;  3LKA A;  1BSW A;  1BUV M;  2Y6C A;  3HY9 A;  4EFS A;  1OS9 A;  1EB6 A;  1UMS A;  3WV1 A;  4XBH A;  3LUN A;  4R3V A;  1YP1 A;  3EHX A;  1D7X A;  5D3C A;  4PKW A;  3KME A;  1BUD A;  3TS4 A;  4DD8 A;  1JAP A;  1PWV A;  1KUI A;  3I7G A;  2I47 A;  3EHY A;  1Q3A A;  1SMP A;  1KUH A;  2OXU A;  1R54 A;  3HYG A;  5LAB A;  3LJT A;  2W15 A;  3UVC A;  1ATL A;  3ELM A;  3G42 A;  1HY7 A;  5CXA A;  1UEA A;  2DW0 A;  4H2E A;  1GO7 P;  4AXQ A;  5I43 A;  4PKR A;  1IAD A;  1MNC A;  3LIK A;  2JT5 A;  2DDF A;  2DDY A;  1UTZ A;  2MLR A;  2WOA A;  5I3M A;  2OW1 A;  3LIL A;  3Q2G A;  1G4K A;  5D1S A;  1GE5 A;  1XUD A;  3DPF A;  1EUB A;  3KEC A;  3LQ0 A;  1IAE A;  4G9L A;  1R1H A;  1C7K A;  1BKC E;  1RMZ A;  1OMJ A;  2SRT A;  3TSK A;  1G05 A;  3GBO A;  3SHI A;  1L6J A;  1G9K A;  1WNI A;  1GE6 A;  1J7N A;  2XS3 A;  4GWM A;  1CAQ A;  3F15 A;  3TT4 A;  1SLM A;  2N8R A;  1ZXC A;  1BZS A;  1K7Q A;  2W13 A;  3KHI A;  1CIZ A;  4XCT A;  2OY2 A;  1QIA A;  4H1Q A;  2OW9 A;  2W14 A;  3DPE A;  1KUG A;  2XS4 A;  3WV3 A;  3AYK A;  4JQG A;  1OM7 A;  4DV8 A;  1ROS A;  2ERQ A;  1IAA A;  3L0T A;  3LGP A;  1ND1 A;  1R55 A;  2WO9 A;  5I4O A;  1DMT A;  1CGE A;  1JJ9 A;  3LJG A;  2OXZ A;  1USN A;  4WF6 A;  5H8X A;  3L0V A;  1RM8 A;  1KAP P;  5D2B A;  2RJQ A;  1XFW A;  1CQR A;  1C8T A;  5BPA A;  4GR0 A;  3KEJ A;  3WV2 A;  2V4B A;  1JAN A;  4XM6 A;  2OVZ A;  3USN A;  1K7I A;  3G5C A;  2J83 A;  2YB9 A;  1I76 A;  3LMC A;  2JNP A;  3OHO A;  2W12 A;  3EDI A;  3KEK A;  3EDH A;  2MLS A;  4FXY P;  3B8Z A;  3MA2 A;  1ZP5 A;  3HDA P;  1HOV A;  5CUH A;  4L6T A;  3LJZ A;  4PKS A;  1MMP A;  4ZR5 A;  5BOY A;  4PKQ A;  1D8F A;  1KUK A;  1DTH A;  5BOT A;  2DW2 A;  2DW1 A;  1G12 A;  1AKL A;  4H76 A;  3HDB A;  5I0L A;  4GF1 A;  4FU4 A;  5D1U A;  1BKC A;  1JIW P;  1QJJ A;  4PKU A;  1JH1 A;  3RTS A;  3N2V A;  2FV5 A;  2E3X A;  1PWQ A;  1GO8 P;  4GR3 A;  3HBV P;  1JAQ A;  3EDG A;  1A85 A;  4WK7 A;  1AYK A;  3VI1 A;  3VTG A;  3LK8 A;  5I2Z A;  4WKI A;  5B5O A;  2OI0 A;  1D8M A;  1XFY A;  1EAK A;  3TVC A;  3P1V A;  2JT6 A;  3O64 A;  4JPA A;  4FXQ A;  1I73 A;  2FV9 A;  1ZS0 A;  3F18 A;  1FM1 A;  4JA1 A;  966C A;  1R1J A;  1MMR A;  3V96 B;  4L63 A;  3DWB A;  1QJI A;  4WZV A;  3LEA A;  3K7N A;  1HV5 A;  1R1I A;  1AST A;  2TCL A;  1MMQ A;  3DL1 A;  1ZVX A;  4A7B A;  4XM8 A;  3B2Z A; 
#chains in the Genus database with same CATH topology
 1OM8 A;  2D1O A;  3AIG A;  3NX7 A;  3F19 A;  2AIG P;  3DSL A;  4PKV A;  1JKY A;  1K7G A;  1GXD A;  4G0D A;  1S4B P;  2KRJ A;  3HY7 A;  1XFX A;  4IJO A;  5B5P A;  3OHL A;  1H71 P;  1Y0V A;  4J4M A;  3ZVS A;  1CK7 A;  1HFC A;  1C3I A;  4GWN A;  4ILW D;  1BQO A;  1GKD A;  3F17 A;  2MZI A;  1HTD A;  2QPJ A;  1SLN A;  3ZUK A;  1JK3 A;  4JP4 A;  1OS2 A;  3F16 A;  1IAB A;  1ZXV A;  1XFU A;  1Y8J A;  2X3C A;  4DPE A;  2OXW A;  3HB2 P;  3I7I A;  4I03 A;  1G49 A;  1QIC A;  5CZM A;  1QUA A;  3EWJ A;  4H3X A;  3RTT A;  1KBC A;  1CGF A;  1SRP A;  1B3D A;  2OW0 A;  3LE9 A;  4QKZ A;  1B8Y A;  1BM6 A;  3DTE A;  1JIZ A;  1AF0 A;  2MZH A;  2WO8 A;  3E8R A;  1KUF A;  1A86 A;  1XFZ A;  1QIB A;  1YQY A;  2USN A;  1PWP A;  3B92 A;  1FLS A;  3BA0 A;  1UMT A;  1UTT A;  2E2D A;  3EDZ A;  1IAC A;  2O36 A;  3P24 A;  1Z3J A;  3KWV C;  1GKC A;  2ERP A;  4AYK A;  2CLT A;  3O2X A;  1SU3 A;  5I12 A;  3ZXH A;  1XFV A;  3U1R A;  5L79 A;  1GE7 A;  1MMB A;  1XAX A;  2K2G A;  4DF9 A;  2W0D A;  2OY4 A;  2ERO A;  4GUY A;  2YIG A;  1XUC A;  1YCM A;  2JSD A;  2X3A A;  1CXV A;  2OW2 A;  1SAT A;  1ZTQ A;  1CGL A;  1FBL A;  4FVL A;  830C A;  3DNG A;  4H82 A;  4IUW A;  2PJT A;  2POJ A;  3LUM A;  2A8H A;  2X3B A;  4PKT A;  2X7M A;  456C A;  2J0T A;  3CKI A;  4H84 A;  4JIJ A;  3KMC A;  4HX3 A;  4L19 A;  5JMY A;  3Q2H A;  4GR8 A;  1PWU A;  4GQL A;  1OM6 A;  1O0Q A;  4Q1L A;  1IAG A;  2RJP A;  3F1A A;  4AUO A;  1XUR A;  2CKI A;  2JIH A;  2HU6 A;  1BQQ M;  4A3W A;  1OO9 A;  2Y6D A;  3LIR A;  2L0R A;  4CTH A;  2D1N A;  4H49 A;  2K9C A;  2AYK A;  4HMA A;  2O3E A;  1BIW A;  5D1T A;  3HBU P;  4XM7 A;  3AYU A;  4WKE A;  3K7L A;  1O0T A;  4AIG A;  4H30 A;  2OVX A;  2OZR A;  3N2U A;  4IN9 A;  1BKC I;  4ON1 A;  1YOU A;  4L7A A;  1HFS A;  1PWW A;  1I1I P;  2MZE A;  5L7F A;  1Y93 A;  1D5J A;  1JAO A;  2Z2D A;  3KRY A;  3LQB A;  5D7W A;  4I35 A;  2YUF A;  3LKA A;  1BSW A;  1BUV M;  2Y6C A;  3HY9 A;  4EFS A;  1OS9 A;  1EB6 A;  1UMS A;  3WV1 A;  4XBH A;  3LUN A;  4R3V A;  1YP1 A;  3EHX A;  1D7X A;  5D3C A;  4PKW A;  3KME A;  1BUD A;  3TS4 A;  4DD8 A;  1JAP A;  1PWV A;  1KUI A;  3I7G A;  2I47 A;  3EHY A;  1Q3A A;  1SMP A;  1KUH A;  2OXU A;  1R54 A;  3HYG A;  5LAB A;  3LJT A;  2W15 A;  3UVC A;  1ATL A;  3ELM A;  3G42 A;  1HY7 A;  5CXA A;  1UEA A;  2DW0 A;  4H2E A;  1GO7 P;  4AXQ A;  5I43 A;  4PKR A;  1IAD A;  1MNC A;  3LIK A;  2JT5 A;  2DDF A;  2DDY A;  1UTZ A;  2MLR A;  2WOA A;  5I3M A;  2OW1 A;  3LIL A;  3Q2G A;  1G4K A;  5D1S A;  1GE5 A;  1XUD A;  3DPF A;  1EUB A;  3KEC A;  3LQ0 A;  1IAE A;  4G9L A;  1R1H A;  1C7K A;  1BKC E;  1RMZ A;  1OMJ A;  2SRT A;  3TSK A;  1G05 A;  3GBO A;  3SHI A;  1L6J A;  1G9K A;  1WNI A;  1GE6 A;  1J7N A;  2XS3 A;  4GWM A;  1CAQ A;  3F15 A;  3TT4 A;  1SLM A;  2N8R A;  1ZXC A;  1BZS A;  1K7Q A;  2W13 A;  3KHI A;  1CIZ A;  4XCT A;  2OY2 A;  1QIA A;  4H1Q A;  2OW9 A;  2W14 A;  3DPE A;  1KUG A;  2XS4 A;  3WV3 A;  3AYK A;  4JQG A;  1OM7 A;  4DV8 A;  1ROS A;  2ERQ A;  1IAA A;  3L0T A;  3LGP A;  1ND1 A;  1R55 A;  1XM5 A;  2WO9 A;  5I4O A;  1DMT A;  1CGE A;  1JJ9 A;  3LJG A;  2OXZ A;  1USN A;  4WF6 A;  5H8X A;  3L0V A;  1RM8 A;  1KAP P;  5D2B A;  2RJQ A;  1XFW A;  1CQR A;  1C8T A;  5BPA A;  4GR0 A;  3KEJ A;  3WV2 A;  2V4B A;  1JAN A;  4XM6 A;  2OVZ A;  3USN A;  1K7I A;  3G5C A;  2J83 A;  2YB9 A;  1I76 A;  3LMC A;  2JNP A;  3OHO A;  2W12 A;  3EDI A;  3KEK A;  3EDH A;  2MLS A;  4FXY P;  3B8Z A;  3MA2 A;  1ZP5 A;  3HDA P;  1HOV A;  5CUH A;  4L6T A;  3LJZ A;  4PKS A;  1MMP A;  4ZR5 A;  5BOY A;  4PKQ A;  1D8F A;  1KUK A;  1DTH A;  5BOT A;  2DW2 A;  2DW1 A;  1G12 A;  1AKL A;  4H76 A;  3HDB A;  5I0L A;  4GF1 A;  1TVI A;  4FU4 A;  5D1U A;  1BKC A;  1JIW P;  1QJJ A;  4PKU A;  1JH1 A;  3RTS A;  3N2V A;  2FV5 A;  2E3X A;  1PWQ A;  1GO8 P;  4GR3 A;  3HBV P;  1JAQ A;  3EDG A;  1A85 A;  4WK7 A;  1AYK A;  3VI1 A;  3VTG A;  3DTK A;  1OZ9 A;  3LK8 A;  5I2Z A;  4WKI A;  5B5O A;  3DTI A;  2OI0 A;  1D8M A;  1XFY A;  1EAK A;  3TVC A;  3P1V A;  2JT6 A;  3O64 A;  4JPA A;  4FXQ A;  1I73 A;  2FV9 A;  1ZS0 A;  3F18 A;  1FM1 A;  4JA1 A;  966C A;  1R1J A;  1MMR A;  3V96 B;  4L63 A;  3DWB A;  1QJI A;  4WZV A;  3LEA A;  3K7N A;  1HV5 A;  1R1I A;  1AST A;  2TCL A;  1MMQ A;  3DL1 A;  1ZVX A;  4A7B A;  4XM8 A;  3B2Z A; 
#chains in the Genus database with same CATH homology
 1OM8 A;  2D1O A;  3AIG A;  3NX7 A;  3F19 A;  2AIG P;  3DSL A;  4PKV A;  1JKY A;  1K7G A;  1GXD A;  4G0D A;  1S4B P;  2KRJ A;  3HY7 A;  1XFX A;  4IJO A;  5B5P A;  3OHL A;  1H71 P;  1Y0V A;  4J4M A;  3ZVS A;  1CK7 A;  1HFC A;  1C3I A;  4GWN A;  4ILW D;  1BQO A;  1GKD A;  3F17 A;  2MZI A;  1HTD A;  2QPJ A;  1SLN A;  3ZUK A;  1JK3 A;  4JP4 A;  1OS2 A;  3F16 A;  1IAB A;  1ZXV A;  1XFU A;  1Y8J A;  2X3C A;  4DPE A;  2OXW A;  3HB2 P;  3I7I A;  4I03 A;  1G49 A;  1QIC A;  5CZM A;  1QUA A;  3EWJ A;  4H3X A;  3RTT A;  1KBC A;  1CGF A;  1SRP A;  1B3D A;  2OW0 A;  3LE9 A;  4QKZ A;  1B8Y A;  1BM6 A;  3DTE A;  1JIZ A;  1AF0 A;  2MZH A;  2WO8 A;  3E8R A;  1KUF A;  1A86 A;  1XFZ A;  1QIB A;  1YQY A;  2USN A;  1PWP A;  3B92 A;  1FLS A;  3BA0 A;  1UMT A;  1UTT A;  2E2D A;  3EDZ A;  1IAC A;  2O36 A;  3P24 A;  1Z3J A;  3KWV C;  1GKC A;  2ERP A;  4AYK A;  2CLT A;  3O2X A;  1SU3 A;  5I12 A;  3ZXH A;  1XFV A;  3U1R A;  5L79 A;  1GE7 A;  1MMB A;  2K2G A;  4DF9 A;  2W0D A;  2OY4 A;  2ERO A;  4GUY A;  2YIG A;  1XUC A;  1YCM A;  2JSD A;  2X3A A;  1CXV A;  2OW2 A;  1SAT A;  1ZTQ A;  1CGL A;  1FBL A;  4FVL A;  830C A;  3DNG A;  4H82 A;  4IUW A;  2PJT A;  2POJ A;  3LUM A;  2A8H A;  2X3B A;  4PKT A;  2X7M A;  456C A;  2J0T A;  3CKI A;  4H84 A;  4JIJ A;  3KMC A;  4HX3 A;  4L19 A;  5JMY A;  3Q2H A;  4GR8 A;  1PWU A;  4GQL A;  1OM6 A;  1O0Q A;  4Q1L A;  1IAG A;  2RJP A;  3F1A A;  4AUO A;  1XUR A;  2CKI A;  2JIH A;  2HU6 A;  1BQQ M;  4A3W A;  1OO9 A;  2Y6D A;  3LIR A;  2L0R A;  4CTH A;  2D1N A;  4H49 A;  2K9C A;  2AYK A;  4HMA A;  2O3E A;  1BIW A;  5D1T A;  3HBU P;  4XM7 A;  3AYU A;  4WKE A;  3K7L A;  1O0T A;  4AIG A;  4H30 A;  2OVX A;  2OZR A;  3N2U A;  4IN9 A;  1BKC I;  4ON1 A;  1YOU A;  4L7A A;  1HFS A;  1PWW A;  1I1I P;  2MZE A;  5L7F A;  1Y93 A;  1D5J A;  1JAO A;  2Z2D A;  3KRY A;  3LQB A;  5D7W A;  4I35 A;  2YUF A;  3LKA A;  1BSW A;  1BUV M;  2Y6C A;  3HY9 A;  4EFS A;  1OS9 A;  1EB6 A;  1UMS A;  3WV1 A;  4XBH A;  3LUN A;  4R3V A;  1YP1 A;  3EHX A;  1D7X A;  5D3C A;  4PKW A;  3KME A;  1BUD A;  3TS4 A;  4DD8 A;  1JAP A;  1PWV A;  1KUI A;  3I7G A;  2I47 A;  3EHY A;  1Q3A A;  1SMP A;  1KUH A;  2OXU A;  1R54 A;  3HYG A;  5LAB A;  3LJT A;  2W15 A;  3UVC A;  1ATL A;  3ELM A;  3G42 A;  1HY7 A;  5CXA A;  1UEA A;  2DW0 A;  4H2E A;  1GO7 P;  4AXQ A;  5I43 A;  4PKR A;  1IAD A;  1MNC A;  3LIK A;  2JT5 A;  2DDF A;  2DDY A;  1UTZ A;  2MLR A;  2WOA A;  5I3M A;  2OW1 A;  3LIL A;  3Q2G A;  1G4K A;  5D1S A;  1GE5 A;  1XUD A;  3DPF A;  1EUB A;  3KEC A;  3LQ0 A;  1IAE A;  4G9L A;  1R1H A;  1C7K A;  1BKC E;  1RMZ A;  1OMJ A;  2SRT A;  3TSK A;  1G05 A;  3GBO A;  3SHI A;  1L6J A;  1G9K A;  1WNI A;  1GE6 A;  1J7N A;  2XS3 A;  4GWM A;  1CAQ A;  3F15 A;  3TT4 A;  1SLM A;  2N8R A;  1ZXC A;  1BZS A;  1K7Q A;  2W13 A;  3KHI A;  1CIZ A;  4XCT A;  2OY2 A;  1QIA A;  4H1Q A;  2OW9 A;  2W14 A;  3DPE A;  1KUG A;  2XS4 A;  3WV3 A;  3AYK A;  4JQG A;  1OM7 A;  4DV8 A;  1ROS A;  2ERQ A;  1IAA A;  3L0T A;  3LGP A;  1ND1 A;  1R55 A;  2WO9 A;  5I4O A;  1DMT A;  1CGE A;  1JJ9 A;  3LJG A;  2OXZ A;  1USN A;  4WF6 A;  5H8X A;  3L0V A;  1RM8 A;  1KAP P;  5D2B A;  2RJQ A;  1XFW A;  1CQR A;  1C8T A;  5BPA A;  4GR0 A;  3KEJ A;  3WV2 A;  2V4B A;  1JAN A;  4XM6 A;  2OVZ A;  3USN A;  1K7I A;  3G5C A;  2J83 A;  2YB9 A;  1I76 A;  3LMC A;  2JNP A;  3OHO A;  2W12 A;  3EDI A;  3KEK A;  3EDH A;  2MLS A;  4FXY P;  3B8Z A;  3MA2 A;  1ZP5 A;  3HDA P;  1HOV A;  5CUH A;  4L6T A;  3LJZ A;  4PKS A;  1MMP A;  4ZR5 A;  5BOY A;  4PKQ A;  1D8F A;  1KUK A;  1DTH A;  5BOT A;  2DW2 A;  2DW1 A;  1G12 A;  1AKL A;  4H76 A;  3HDB A;  5I0L A;  4GF1 A;  4FU4 A;  5D1U A;  1BKC A;  1JIW P;  1QJJ A;  4PKU A;  1JH1 A;  3RTS A;  3N2V A;  2FV5 A;  2E3X A;  1PWQ A;  1GO8 P;  4GR3 A;  3HBV P;  1JAQ A;  3EDG A;  1A85 A;  4WK7 A;  1AYK A;  3VI1 A;  3VTG A;  3DTK A;  3LK8 A;  5I2Z A;  4WKI A;  5B5O A;  3DTI A;  2OI0 A;  1D8M A;  1XFY A;  1EAK A;  3TVC A;  3P1V A;  2JT6 A;  3O64 A;  4JPA A;  4FXQ A;  1I73 A;  2FV9 A;  1ZS0 A;  3F18 A;  1FM1 A;  4JA1 A;  966C A;  1R1J A;  1MMR A;  3V96 B;  4L63 A;  3DWB A;  1QJI A;  4WZV A;  3LEA A;  3K7N A;  1HV5 A;  1R1I A;  1AST A;  2TCL A;  1MMQ A;  3DL1 A;  1ZVX A;  4A7B A;  4XM8 A;  3B2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...