4A48A

Crosstalk between cu(i) and zn(ii) homeostasis
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
66
Chain Sequence
AQTINLQLEGMDCTSCASSIERAIAKVPGVQSCQVNFALEQAVVSYHTPQILTDAVERAGYHARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Investigating the Role of Zinc and Copper Binding Motifs of Trafficking Sites in the Cyanobacterium Synechocystis Pcc 6803.
pubmed doi rcsb
source organism Synechocystis
molecule tags Transport protein
molecule keywords PROBABLE COPPER-TRANSPORTING ATPASE PACS
total genus 20
structure length 66
sequence length 69
chains with identical sequence B
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2011-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4a48A00
1FE4A 4A4JA 2QLXA 2OFGX 1FEEA 1OPZA 2PD1A 1IUJA 1FVSA 2ROGA 2VV5A 2FIUA 1WD6A 4NL5A 1KVJA 2AP6A 1Y0HA 2QLWA 3KKFA 4HH0A 3BN7A 5A6WA 1OQ3A 2HFNA 2W4PA 3HHLA 5IXUA 5B0BA 3MZIA 1CC8A 1YJVA 2IYGA 2OFHX 2GGPA 1X8DA 2K7KA 1MWYA 2FB0A 2GCFA 1Q53A 2N7YA 1QUPA 3WDOA 2JDJA 3HFKA 2KYZA 1TZ0A 2HLTA 3BR8A 3E8OA 2FTRA 4YEAA 4DL0C 2GFFA 2XMVA 4A47A 1KQKA 3F44A 4EFAC 2ZDOA 2W4DA 3KG1A 2EW9A 3DXSX 4HL9A 5T7LB 4OJ3A 1GXUA 1SQEA 1TL5A 3HHLC 4ZOSA 5F0UA 1URRA 3CJKA 1FE0A 2K7JA 3T9NA 4Q2MA 3BDEA 3HHLD 4DPOA 1AW0A 2AJ0A 1AFIA 1MWZA 4Y2IA 2ZDPA 2N4CA 2LDIA 2K1RA 3HF5A 1N5QA 1RJJA 2G9OA 1FD8A 2OAUA 3I9ZA 2KT2A 2HIQA 4F67A 2XMUA 3KG0A 1OSDA 1AFJA 4DN9A 2QIFA 5B0EA 1W2IA 3QGPA 2HLUA 1FVQA 4OJ1A 2GV1A 4FNHA 4HI1A 4OJHA 5B0FA 3BGUA 4A46A 1APSA 1CPZA 2LQ9A 2KT3A 2KKHA 2ROPA 3TOQA 2OKQA 2RU9A 5A6PA 2BYCA 2IYIA 2HQIA 2PGCA 3IWLA 2RMLA 3IWXA 2CRLA 3KNGA 2IFXA 2XMTA 5B0DA 1Y3JA 4HI2A 1X0PA 3GZ7A 5F0WA 5B0CA 2BBEA 2HFOA 2LQBA 1N5VA 1S6OA 4YDXA 5K9FA 1VQYA 2BJDA 3HHLB 1V3ZA 1YJRA 2XMKA 3FRYA 3HX9A 2W4CA 2OD6A 3K7RA 3UDCA 1FESA 1SI9A 1P8GA 3DCAA 2XMMA 1P6TA 1Y9OA 2RILA 2LXFA 1TUVA 2BJEA 2GGPB 3HDSA 1R6YA 4Y2MA 3BB5A 1K0VA 4ZA1A 2ACYA 3TRGA 2N4DA 2GA7A 3LO3A 1Q8BA 1Q4RA 2AW0A 2XMWA 4FNIA 3VTIA 1YJTA 3CJKB 1YG0A 1S6UA 1KVIA 1OQ6A 4HH1A 4Y2KA 2OMOA 2Q3PA 2XMJA 1U7LA 2L3MA 1Q8LA 2OP5A 4OJGA 2RSQA 1LQ9A 1N5SA 1CC7A 1SB6A 4OIXA 2K2PA 2AJ1A 1VQSA 1TL4A 2OD4A 2K1RB 2VH7A 4NPOA 1N5TA 2ASYA 4U9RA 1TR0A 1ULRA 3LGMA 3MCSA 5B08A 1XBWA 5B09A 4Q2LA 3BF4A 1X7VA 5B0GA 1JK9B 5KAKA 3LGNA 2ROEA 3BM7A 4A48A 1YRXA 1JWWA 1YJUA 5T7LA 5B0AA 1Y3KA 2QYCA 4QOTA 3TNVA 3FMBA 2GO8A 2FHMA 2BUNA 1GXTA 3FGVA 3QMQA
chains in the Genus database with same CATH superfamily
1WKLA 1SUQB 3OFFA 5EHHA 4DV2J 3OFEA 4I2QA 4K4ZA 1TFYA 1WHYA 2HAIA 2FIUA 2XSFA 2HVHA 2BW7A 2QLWA 4C97A 3QSIA 1QTMA 3W5XA 2BE2B 3G9CA 3QAEA 1XJWB 3SQGA 3UVJA 4FPIA 1RT2A 1QE1B 4U96A 1XNRJ 3CJ8A 1ZA1B 3PYDA 3VGUA 2V8VA 4G3IA 2HZAA 1HWKA 2Z30B 1YWXA 4LIWA 3M8RA 2ZM6J 1JLQB 2DGQA 1CULA 3QIPB 4FDFA 2MKKA 2J0XA 4XAKA 3J7ZT 2ZBPA 2KYZA 5IT9Y 2G1DA 4LR7A 2DNGA 1FRMA 3D68A 3KHLA 1R7IA 2J8AA 5LJ5Y 4MK8A 4X4UA 4QZVB 1NH8A 3C15B 4ZP9A 4ECWA 1DBDA 1X5SA 4RW6A 3LA0A 3M6XA 2FJDB 3DRXA 4P2FA 1SH0A 1AB8A 3AOBA 2DNQA 4USTA 3UDEA 2DJWA 4YUDA 3KOAA 2YNGA 4F4KA 1WC6A 4FF3A 4RZRA 1WORA 4Y2IA 1Q7YT 4B9LA 2XO7A 3NAIA 1VRQC 4WCEQ 2LDIA 1IKWA 3ZTOA 3IR5B 2O66A 4KQZA 4QIVA 2HK3A 4KC5A 3OHAA 2QRRA 4WP9A 2HIQA 2YY3A 1VQOS 2A10A 4WXOA 2QIFA 3NCQA 4DU8A 4FF1A 2NREA 5DG7A 2JLGA 3EDQB 3I0SA 3E51A 1B99A 1I1GA 2WTFA 1W7WA 5J2PA 3BGUA 3GQCA 3PFOA 4YDDB 4CLLA 3BBBA 4ED8A 2PMHA 1ICEB 5HI7A 3CCVS 1SXLA 3NCRA 2X51A 4P74A 1G3OA 3ISZA 4GKJJ 2I38A 4L3NA 2P9EA 5F0WA 1VQLS 1Y10A 3RUBL 2DNOA 4LRBA 2BBEA 3JTOA 1S76D 5H9FK 2WB1D 4WKYA 5J2QA 3AD7C 2XTJP 2CWXA 1N5VA 2Q79A 3B4DA 3Q23A 5L1KA 5G4DA 4NE9C 2XMKA 1S9EA 2WSEC 3FRYA 3GYNA 4DR1J 3OUYA 2ZH2A 4P9SA 4B3OA 1BLUA 4TXSA 4C0HA 4GKKJ 4CT9A 1LWFB 4ED4A 1JLQA 4XIUA 3AT1B 4CT8A 2PEHA 3ITHA 1K1SA 1YX2A 2JVOA 3U27A 3I96A 4DV4J 3TAQA 3DRRA 4WFYA 3MOZA 1JKHB 5GADU 2VPZB 1SC4B 2KRRA 1UVIA 2IA6A 2VD3A 2ZBRA 4DV6F 3T9ZA 3K59A 1YJ9S 2FYXA 1YJTA 4TVAB 4C2MA 2Z2MA 1UVNA 1UKUA 3TWZA 1S57A 2D3O1 1CQMA 2KDOA 4JV5J 1D3WA 1R27B 4I2PA 1BWVA 4MYUA 1CLFA 1CC7A 2J6SA 3QWUA 1PBUA 1CSJA 2MZQA 4PWWA 4QPTA 1T7PA 4Q43A 1FJCA 5HQLA 3ADAC 1N5TA 5HN0A 3NOGA 1OY8A 2D74B 2HHHF 3FC9A 4J9PA 3I0SB 2VJVA 5B08A 5B09A 2M7SA 1QY7A 3ENWA 1JK9B 1TVRB 2AT1B 1S1UB 2EKYA 4NCGB 1T11A 2VQEF 1YRUA 5J2MA 3MMCB 2R8KA 4J9QA 2HHVA 3BSNA 3HXMA 4LVNP 2ZH7A 1DQAA 3M30A 1TL3B 3H40A 2RHQB 2PI4A 5FD1A 1ZZFA 3CJSA 2CJ9A 3I0RB 5HP1B 3H5UA 2RJZA 1U1MA 1U6ZA 3BGRB 2HW3A 4FXWA 1N34J 1LW2A 5J2QB 2JX2A 4DSLA 2KVQE 2OFGX 1S97A 1HLWA 4NLPA 3ZZ0A 3TAPA 1NK0A 4CLZA 2UXCJ 4NLYA 1XC9A 2EWHA 3OR2A 3BQ0A 1D9FA 4YHHJ 2HGMA 2FZKB 3QT7A 4U8VA 3K57A 1TK5A 1WUUA 4DR6F 1YJVA 2IYGA 2XULA 5M2PA 2D7SA 3CJ3A 2FPHX 2CJKA 4ERDA 3W62A 2MXYA 4A8OA 1S59A 4FZVA 1KQFB 1KLMB 2G2YA 4DFMA 1RT3A 5E2QA 4PXEA 1FO1A 4F02A 4UUWA 3DGVA 1N54B 3KG1A 2GMJA 5ETMA 2BQRA 1VQ9S 3HHEA 3DRSA 1M1GA 1NO8A 1WI6A 4CP5A 4ZIWA 4QWCA 3NG8A 4ZPAA 4TU8A 2IA0A 5F0UA 3KLHA 1HHQA 2O1PA 3PNIA 2HQCA 4I2PB 1NK8A 3NLCA 1S49A 2VUGA 3DOMA 4DV5J 1SJ1A 2PA3A 1D9DA 4OZLA 1YIJS 2E5LF 2G0JA 3OLBA 3OVBA 5IV4A 3TVKA 4DL2A 3RB4A 2ZNYA 3R7SB 4LFAF 2YKNB 4RWWA 4LRCA 1AFJA 2NR0A 2JH3A 1M5VC 4DPWA 3KLIB 1KC8T 2XB2D 2MQNA 1IJFB 1J5OB 2IVYA 3ZZTA 1T9VA 2ZVIA 4RNOA 4N56A 4KRWA 5EWEA 3CC4S 2GV1A 3MMJA 3OVSA 5AXKA 2IVFB 4OJHA 2P9CA 4A46A 3GU0A 4ZIVA 1C0TA 2CG4A 2P5VA 3EVOA 3RBZA 2NLWA 3A3PB 2KKHA 5A6PA 4A8KA 4MKYA 3QJPA 3NGDA 3CC7S 3M2UA 4K0KJ 3IWXA 2IM1A 2XMTA 1VQ4S 3CNQP 2DO4A 1YHQS 2M4MA 2Z8QA 2CQ3A 2Q66A 4DFJA 2X3GA 3JQJA 1UJ6A 2VG7A 2M9KA 3OR2B 1FEHA 3DRPB 4LF6F 1WHXA 2G1HA 3C6UA 4JI0F 5KG5A 2GJIA 4O44A 2BOPA 4KIAA 3FVYA 3MPWA 2DT9A 2FC8A 1N56A 1VIXA 3PYFA 3M8PB 1HNWJ 4EEYA 2E44A 2HQGA 4WYWA 3FDSA 3M2VA 1JJ2R 1QAIA 4GVBA 3TJ8A 3QNWB 5HMYA 3SMZA 2CJBA 1VS3A 2EFOA 3M4XA 5K14A 4BC9A 3IWNC 3IR7B 3RZAA 1LNQA 4XK8C 3HJFA 5KFGA 5E0OA 1BQMB 5AE1A 3IBWA 3PM9A 2RE1A 5IFMA 1VBZA 1SJQA 4A8MP 1NPKA 4IFVB 5C5JA 4G1IA 3WQPA 2RQCA 2BR0A 1NJXA 1U8WA 2M0GB 4K4TA 4H4KA 3W2VB 1LOUA 2OI2A 1U02A 2V4RA 1LWEA 3JSRA 4DSJA 3DOKB 4FF4A 2R7XA 3VZIA 2E1CA 1XBWA 2NPFA 2HRTA 2V69A 3LAMA 1TV6B 2V67A 2H4YB 1RACB 4Q0BA 1RSCA 4XPCA 2QMXA 1C0TB 4NMLA 2Z2LA 3NGKA 3RU0A 3PRVA 3TX8A 2UXBJ 3W9JA 2HPUA 3E3XA 1HBUB 4DEZA 1R6VA 1CQNA 2HHSA 1U2CA 4DPXA 2IDEA 3QLHB 3AXKA 3BKTA 2UUTA 3UFCX 4IRCA 2I6WA 2DXEA 2VG5B 1FEEA 4NL5A 3HM9A 4DV7J 1HARA 2LECA 3DRPA 2AQ4A 4JI3F 3H5XA 2H5IB 3D6HB 4NRUA 1F5CA 2KZMA 1MSWD 1HNXJ 5A6WA 1OQ3A 2MKJA 1MMLA 3EDRB 4RW8B 4ZVTB 1WTFA 1EETB 4PQAA 1P27B 4OZ3A 5ETNA 1FERA 4FVMA 1HYSB 2QJ3A 3CCES 4MYTA 2JDJA 4GVBB 5CZVA 2FVSA 2VQFJ 2EC0A 2SXLA 3BR9A 2VG6B 4MIWA 5IS2A 3F44A 4DV5F 3GFXA 4XDDA 3KLFA 3ET6B 3PX6A 5HLFA 1VFJA 2PO4A 4ES2A 2C28A 2DYAA 4GMKA 4Q5VA 1S7HA 1TL5A 3D1HA 2BOAA 2I2YA 4P6QA 4ANCA 3V6DB 2CADA 2DKOB 1VRTB 1XTZA 1U8SA 3MMBA 3QQCD 3W8PA 5CA5A 4Y2AA 2J9EA 2PT0A 4KE5A 5D4NA 2KO1A 3OXFA 2HBYB 1FA0A 4KHPJ 5DETA 3GIIA 3K5LA 1XEZA 2VBXA 2FY1A 4N47A 3SBMA 3FBFA 2IC3A 1M1HA 2GQQA 2W24A 4M5DB 3W2VA 2XMUA 4L72B 1OSDA 2RDDA 4HDHA 4DN0A 5F8HA 3W8GA 3PJWA 2DHHA 2QA1A 4CTAB 1L3KA 4IH5A 1LW0B 1LV5A 4RLEA 2RB7A 2C22A 3AJ1A 4C8KA 4HKQA 2H48B 2WCXA 4LQ3A 2R7VA 4MAKA 2G0CA 4LRAA 1HW9A 4IH6A 4MK7A 4N8NA 5HBMB 1PAUB 4O4GB 4EBDA 3D66A 4BS2A 2B7CB 4P7TA 2GJFA 3AQOA 3HVAA 5D6GA 3KLGB 2PGCA 3PR5B 2RMLA 3IS9B 3KNGA 4K0KF 1HWUA 2J9CA 3R5DA 2Y3YA 2I9SA 3M2RB 1L3VA 3R5BA 2KTQA 1JLCA 2MDAA 3PRDA 5FLXY 3GV8B 4PUOA 4A8XA 3MM5B 3I87A 4I6YA 3BEGB 4O0IA 3OW2R 4P75A 5E5NA 4W98A 2AX0A 2UUWA 3DM2B 4PXCA 4QIGA 1Q8KA 4FN5A 1SI9A 1YBAA 3DCAA 1X0FA 1Y9OA 2BJ1A 2QE5A 2R8IA 1UZDA 3D6MB 3MM7A 1M5KC 3PW0A 4KV8A 5KT2A 2DD8S 4ZA1A 5F8IA 4YQWA 3PZPA 3W2WA 1DHMA 2V8DA 2VG6A 3T5JA 1RCXB 2ZBQA 2D41A 2W2MP 1Q78A 2RF2A 3LH2S 4OYIA 5HROA 3MD1A 3M6UA 1JLEA 4L74A 4ILMA 1YG0A 1KVIA 3M8ZA 3MMBB 4OFZA 1RQ0A 4WU2A 3Q8SB 2GVDA 4O3SA 4Z2XA 3CSKA 3PIOQ 3PV8A 2CJQA 4LF4J 4DV6J 4USUA 1R8BA 1HHTP 3EWGA 4OL8A 2CQIA 1FJGJ 4X64F 1TL1A 1NSKL 2DCUB 5LL6d 1IVZA 2KRBA 1WJ9A 2F3JA 1FNMA 2XEXA 1F2HA 4NA1A 3ZXWA 2P2CB 2XBPA 3AD9C 1NJWA 1TMJA 3CMAS 3B54A 1OIAA 2AEFA 2XNQA 2ROEA 3LGNA 4NOHA 3U1NA 1EKSA 2CQBA 4ZHRA 5MAOA 5KT4A 1XNQJ 4C7QA 5D15A 3PW4A 3FQLA 4QOTA 3KLGA 3RJMB 3CCTA 2ABYA 5ITHA 4QWAA 4OHYA 2GO8A 2IM0A 3JSBA 2Y0BB 3PX4A 2FJVA 1N36J 1CEZA 2UVWA 2BM0A 1TFWA 1RWNB 1WC1A 3OSNA 4NI2A 4U8YA 3JSMA 1G4CA 3RB6A 2KHCA 3TUIC 4DQSA 2EFPA 1CG2A 4YOEA 5E3QA 2ZE2A 2FLLA 3H4BA 1PC4A 1H72C 3OTOF 3M9OB 2LMIA 1C4AA 3DC2A 1B7YB 2LKZA 2XY6A 3MM7B 3N9UC 3EVWA 5F8MA 4QR1A 2JWNA 2VB6A 2N7YA 2NXEA 1VHIA 1Y5NB 3I9V9 5DGAA 4JYAF 3DU5A 2FD2A 3KK3A 4EBCA 3KYLA 2HHXA 1F5BA 4EUVA 1HWIA 2IJRA 3TZZA 2YNHB 1FKPB 4DF4A 1VC0A 1HR0F 2XYGB 4JV5F 3HT3A 4BBYA 4PWUA 3KJFB 2WOMB 5T7LB 1FFGB 1T0TV 2IRUA 1SH2A 4ZPBA 2R7RA 3Q22A 4OZNA 1H73A 3HKZD 3G87A 3W3SA 1AW0A 3N6NA 4EK2A 1RA6A 1VLYA 1VMBA 3DNCA 1YVFA 1LWXA 4IRKA 2YBVA 1NDLA 3NGTA 3CJTA 4L75A 4WK3A 1FD8A 1F3VA 2OAUA 3I9ZA 4M5KA 2RD5C 2JJ4D 3PEJA 3GIKA 4DLGA 4AL7A 1NDPA 2J76E 2VOPA 4LF4F 1OPIA 5KFNA 1SL1A 5J2NB 1Q5VA 5B0EA 1X4DA 5KG2A 2N3OA 1BC6A 3R7NB 2QL7B 3T5HA 1FX2A 1KHWA 1HBOA 4C11B 5HL7Q 4DPTA 3BPDA 1APSA 3IP0A 2QLBB 4NMXA 3T1YJ 1FNOA 3NS7B 3MM9A 2ZHBA 4ICLA 5LM7E 4DR7J 2VZ9A 4ALZA 4DUYJ 2W9BA 2Y1RI 4RNNA 3HSZA 1DTQA 3GZ7A 4LRDA 1RT1B 3LALA 3SXLA 1N36F 2J7WA 2W01A 3SZ2A 4I69A 2F7VA 3VV2B 2IRYA 4R0JA 2EEYA 4DOZA 5KFMA 1N4LA 3OV7A 3MFHA 1HNIB 4E98A 2X3DA 3KLEA 5J1EB 2HRYA 1U1LA 2WONA 3MEDB 5CYQB 1HD1A 2L48A 3V4IA 2V68A 2E29A 2Z4PA 2CZ4A 3KK3B 2QL9B 2VBWA 1XK8A 1UMJA 2DIVA 2KJVA 1VK3A 3K58A 1FKPA 5HAOA 2OPQB 4KH1B 8RUCA 3PJXA 2UXDF 3IRWP 1G7CB 4HTIA 2IPOB 3DOLA 3SCLE 4OYPA 3OQ2A 4CH0S 2F63A 3ELHA 2HRUA 3QRRA 2XMJA 2IRXA 3POTB 2IBKA 4WZMA 4B9UA 3DLHA 2IIHA 2XLKA 1FK9B 2CZ9A 1BQNB 3FCHA 2MQMA 4DV1F 3H4DA 4J9MA 2C2DA 2CIMA 3OSPA 2QG9B 3M1VB 2HBQB 5MLCV 4X4OA 5G0RA 4FYXB 1KLNA 1TL7A 4P73A 5KFEA 2CQHA 2J5AA 4B3RJ 1K47A 4H4OB 1IWGA 1HPZA 3TARA 1JLGA 3PW2A 3X3UA 1REVB 2GC8A 2WZ1A 1DJ0A 2QYCA 2B4OA 3W9HA 3TNVA 2MKSA 3VAHA 1SJ4P 1G2EA 1YQHA 4OX9J 2RHSB 2Q6BA 2HNDB 2ZFHA 1UWAA 5KFTA 3AQPA 2FZGB 2XYHB 1Q16B 4DCOB 2W7PA 3FFIA 3FEXB 2LEAA 1KHVA 1IUJA 3D3BJ 1NBEB 4WJBA 2CNOB 4ZVUB 3DU6A 4KGZB 3OL8A 4TQRA 1KKHA 2J7UA 4MKBA 5KFCA 1HNIA 2CVEA 4KGMA 1UVMA 2B7BB 2CNKB 2YXLA 1B4SA 1VQMS 1FF2A 3QSYB 5B0BA 2WONB 2P6TA 3MEDA 2HEKA 5CYQA 2N3LA 1AXQA 3V4IB 1WEYA 1ACMB 1IKYA 2CPEA 2MTLA 3C16B 3ITHB 1J5EJ 4KHRA 1JJ4A 2OPQA 2E1AA 5ETKA 4LF8J 1JNZB 4ECYA 3W61A 4HTJA 4ZVGA 2MJNA 5LOQA 5DDPC 2AEMA 1WG4A 3V81A 1ZETA 2W4DA 1HA1A 4YY3F 4EO8A 5CYMA 5L46A 2J9DE 4OJ3A 4F67A 2B5JA 1HWJA 2FUG9 3BSAA 4CM0A 3UPFA 1NSPA 4DQIA 5IWAF 4UY8T 5E7OB 2RDIA 1UW9A 3IG1B 3FSYA 1AZSB 2MJUA 4KGVB 4QYRA 3KLVA 2KN4A 1IQZA 1LFWA 2EBEA 3LP0A 3OPKA 3G8SA 4DV3F 2UV8A 2WBMA 2VDIA 1FWPA 1REGX 2VL1A 1X31C 1XR6A 1XN9A 3MAQA 2P8IA 3P4UB 3JAMU 1KDNA 3C6TA 1U47A 2OIHA 4NYZA 3CCJS 2C3UA 4ILRA 5B0FA 1DARA 2UVUA 4I4BA 2AHOB 2KT3A 4I68A 2XMAA 2CUYA 2ROPA 3IRXB 3E01B 3NY0A 2EC2A 4KO0A 1I3OB 2E5JA 2GQ2A 2HQIA 3M30B 1RHMB 3HFZB 5HATA 3P3DA 4UZCA 2O01C 4C0BA 1S9GA 1RXOB 2P6SA 1N34F 3CCSS 1L3TA 2HFOA 2FGOA 3A3NB 4ZN3A 3RGIA 1FWLA 5DDOC 2A6MA 5H1SV 1Q82T 3MMAA 3PYEA 5IQ6A 2KYXA 3N4WA 2H1YA 3FCWA 1AUSL 1FRKA 2OD6A 1W25A 2XHCA 4IG0A 4QQBA 1P8GA 1VCTA 2ZJQQ 1S6PA 2KI2A 5HVFA 2ZH4A 3O1LA 3BV8A 4IQMA 5EWGA 4QPXA 3TEGA 1HHSA 3T19A 2A6OA 1RGVA 4QR2A 5F9LA 1S1XB 3O3LA 4XDCA 3V81B 1NMEB 1TP7A 4NLQA 1Q4RA 4X4RA 1N33F 5CYMB 5H9EJ 1VC6A 1URNA 1Q7LB 4CDIA 4JI2J 1JLFA 1D8ZA 2OLWA 3AH6A 1OQ6A 3KUHA 3QO9B 4I1TA 4JV0A 1RADB 4MJKA 9RUBA 4O0NA 3H8YA 1U7LA 2JOQA 2OPPB 2DRBA 3C2PA 1VQ8S 1WDTA 2OP5A 3PW5A 2RSQA 4Y34A 1NKCA 4QIEA 4V19X 1HBNB 4CLUA 3BYRA 1U24A 6FD1A 4AQYF 1HQ2A 1TKZB 2Z2YB 3BKFA 2B56A 2MZJA 3MEKA 2ZNZA 3WX4A 1FFWB 2BKPA 1RTJA 1RWVB 2DGUA 3UW1A 4ZKAA 2HMIB 4B3SJ 5EN1A 2GO9A 3IAM9 3C6TB 3D2WA 3KJVA 4Q2LA 3RB0A 3R2DJ 5SUHA 5L9XA 3EVMA 5KAKA 5DGBA 1X9SA 5I42B 4ELUA 2WVBA 2GAGC 2HNZA 1F2GA 1YRXA 4Q44A 3IRXA 4KO0B 4F0MA 3HPOA 3CE8A 2YWGA 3MEEA 4BDPA 4DR3F 4A8YA 2GMLA 2LU1A 1KRPA 4C9DA 3KDOA 4RW9B 3P5BP 4PCQA 1KOHA 1XMQJ 3WIUA 1VRUA 4F8RA 1RU2A 1UEKA 2HZCA 3CUNA 4OMFG 4JV2A 2CJYB 1PJ7A 2HVDA 1OSCA 1R8AA 2PD1A 2Z57B 4O3PA 4DHVA 5F3ZA 3VAJA 2Y9HA 2EI5A 2I5JA 3KKFA 3SCIE 5D4LA 5DZ6A 4IG0B 2XSJA 4OZJA 2W4PA 2PI5A 3VGVA 3OL6A 3MZIA 1T3NA 1ZPWX 1RAAB 4PG7A 2AMCB 1EARA 2VA2A 3PHTA 4JI5F 2DR6A 2GCFA 2IM2A 4K50A 1H38A 5CHCB 2Y8YA 2HFVA 1NPRA 2NSBA 2BANB 3P8BB 4JI4F 1JXEA 2QLFB 3DYAA 4KT0C 4TY8B 4YEAA 3QZ7A 4DL0C 3OJUA 3MR2A 1VK8A 5E3RA 2YNIA 4I7FB 3Q8QB 2AU0A 5U47A 4EFAC 2PEBA 5KFIA 1S1WA 3T1AA 2IAJA 4ER8A 4NZ6A 3JAMY 1GXUA 2AJFE 2OPPA 4LFCJ 3CJKA 3J7YU 4DFPA 2HFSA 4UZBA 1RLCL 1ZS6A 3BDEA 3ZO7A 2G4BA 2GNKA 2CAJA 3K5MA 3PY8A 3LWLA 4KY3A 4G65A 2AGPA 3QPIA 4DL4A 2CZVC 4MIAA 4AQYJ 1SJRA 3NS5A 5IC6B 2MY8A 4BC7A 4EO6A 4DV3J 4JI1F 1T95A 3N79A 4JI6F 2APOA 4J37A 1LWEB 1VOMA 2AZ3A 4OX7A 3GV5B 3A8KA 1SKSA 1ZM3A 4X84A 2QV6A 3ZZRA 4CYUB 1CS4B 4ZVHA 3PR4A 2KFYA 1UVLA 1VQ5S 3CD7A 4USJC 4CH1A 3TP2A 1OY6A 3CTRA 5LSRA 5K8MA 1RABB 1UJ5A 3OTCA 3OFHA 3HMJG 1VC5A 4R8UB 2BRLA 1SQGA 3VVTA 1BY9A 5B0DA 1Y3JA 3SDEA 3RG6A 4M5MA 2MYFA 3MF5A 4CQ1A 4BHQA 4J9OA 5D3GA 1RT6A 1B0TA 4LREA 4AE5A 3OJSA 1UFLA 2AF6A 4CNYA 1S6OA 4DR1F 1MROA 3GYXB 5K9FA 3G6XA 4GKJF 2OEKA 2EXUA 1R0AB 4HHJA 3VHQA 1O8BA 2R7SA 4QJVA 1UETA 2IM3A 4NLXA 1ZM4A 4OX6A 4P10A 2QA4S 1DY3A 1P6TA 1EETA 3GTYX 4QIFA 1RBOB 2RILA 3S6EA 1RHRB 4NRTA 1X4AA 4M95A 4ZLPA 1RT5B 1N88A 5E3CA 1ROFA 3TJ9A 2U2FA 3L3CA 4K2JA 3ILOA 1TAUA 3R5JB 4JI8F 2R7OA 2C3MA 2IAJB 4Y65A 3M6WA 4NCBA 2VPXB 4YR3A 1SUQA 3Q8VA 3CJKB 2K3IA 5L1JA 1S6UA 2OUGA 2ZH5A 3R5AA 3BN4A 3CD6S 5KT7A 1Q8LA 2AV5A 1U1NA 3GCXP 4EU0A 5GADI 1VRTA 1PC5A 2BRKA 3MR5A 4FYVB 4NX9A 4IR9A 4X2BA 5I3UA 3CJQA 5ETLA 2LA4A 3HT0A 3CIZA 4XPEA 4TNOA 4GO7X 5K8OA 2POKA 4CO4A 4NEYA 5KFOA 4M5DA 4IQXA 2AIRB 2ATCB 4C3KA 4EWTA 2ZC4A 3LAKA 3QT5A 5IOLA 5HMWA 5A8WA 4CYUA 3BF4A 1X4EA 1LW0A 3THPA 2BJ8A 2WVCA 4JI1J 2DRAA 2M8DB 2ZOMA 1NXIA 4RW6B 3D1OA 5A2QU 4OYAA 2F65A 1YJUA 4WXWA 4ETXA 2RIJA 2G13A 2ZBIA 1GQEA 3DN9A 4OLPA 4P72A 2YWHA 3SEOA 4LF7J 2RNEA 1C1CA 2QN6B 2WAQD 3MEGB 1KQSR 1CVJA 1IM4A 4FS1A 5LXYA 3NKYA 1RWXB 4YHHF 4OI6A 4U7UK 3CCZA 2C2EA 1XNRF 3M2RA 2OPSA 2ROGA 4O3QA 2YWFA 4F4WA 3V6KA 2C2ZB 2IMOA 2VU5A 2UV8G 4OX8A 3U02A 4DL5A 3RTVA 2RH3A 5D4OA 1GX6A 4C48A 3KHHA 5IXUA 3GLJA 2YKOA 2GVZB 1FX4A 2XGPA 4NYPA 4ED6A 2NSCA 4NA2A 2NXJA 2BKOA 1BHNA 4NXMF 2VC1A 4F25A 2J6TA 3DGPA 3H2UB 4AL5A 2D3UA 1U26A 3IXQA 4ZPDA 3FKBA 1X4HA 1FXLA 3R6LB 3FSXA 1FRJA 1BD6A 1EIYB 3IGVA 3H5SA 3O5TB 5HROB 2HVIA 4LF2A 2M52A 4ETZA 3LGHA 4YB5A 3L7OA 2YTCA 4Q2MA 1EZZB 2RT3A 2BW2A 2W2OP 5E33A 3NMRA 4X64J 1UA0A 1KEKA 3D9BA 5I3UB 3F41A 2K1RA 3LUYA 2OJ3A 5HMXA 4I2QB 4RUAA 3BPSP 2HYIB 3H7HB 3LTOA 4J9LA 3G6YA 4MK9A 1RTZA 5KOXA 3C14A 3ZC4A 1Q0NA 1I51B 3UQSA 3VAFA 3DRRB 2EG1A 2VDHA 2YQ1A 4K7QA 4G1PA 4WIQA 8AT1B 1RAGB 1EKRA 4X4TA 4AT1B 2WVEA 4CI0B 4TKTA 3G86A 5DZ7A 4DCJB 3FMWA 4OYMA 1H0HB 4K5RA 7AT1B 3QIPA 3ULHA 4K2XA 3GPAA 4URSA 5KFPA 3TYTA 4ZVSB 2AEJA 3V4MA 1RTHA 2JC1A 3V6HA 2A0FB 2HSEB 1RYRA 3M8QA 2W2QP 4FBTA 4DFKA 4LFBF 2JEIA 2WSCC 1HMVA 1RLDA 1C0UB 1YZ7A 3L7PA 5LMNF 1HIYA 4EBEA 4WFNQ 1VQYA 2XS2A 2AJQA 2EFGA 4TQSA 1NLKL 2ZWPA 2OSQA 3J7Z5 2W4CA 4ECTA 2DR8A 4W90B 2Z2ZA 2MB0B 3BO4A 4JI5J 2AJ2A 1X5PA 2ILYA 5DQHA 3MECB 5BYRA 2XCPA 2X1GA 3C66A 3Q83A 4J9RA 1AT1B 2UUCJ 1RWUA 4C8LA 2BMBA 1FXDA 3UN5A 2GQCA 3PXGa 5KFLA 3PDNA 2VIHA 2X1FA 5J2PB 2LEPA 3PIPQ 2YNHA 3M32A 3J7AN 3VWSA 3TQEA 1GMWD 1GFWB 4R5PB 2WOMA 3U7JA 3ZNJ1 4WP8A 5AXLA 3O44A 3OHBA 5DDRC 1N5SA 3ONQA 3SFUA 3TUPA 2HHQA 2EK6A 3IAS9 3ZZYA 1TL4A 3FBEA 1NK9A 1KN6A 4NPOA 2W2NP 3C14B 4DV1J 3LP2A 1NSQA 2HBZB 3RR8A 4U9RA 1MG7A 3TAMB 3MCSA 1FJGF 2VKRA 2ZD1A 1IR2A 4AD6A 4AXJA 3VAMA 2JEGA 2E1MC 4B3OB 1LFPA 1U2FA 3GV7B 4Q8FA 2LVWA 2IBOA 2OTLS 1T3OA 1KONA 1Z4UA 2JC0A 5GAEU 4IOAQ 3P96A 4F50A 1IBMF 5D0RA 2DBBA 2Y1LB 2Q6CA 3QFWA 4RBVA 3UE2A 5LMUF 1CBKA 3QGGA 2LYVA 3KLHB 3HD2A 4ED3A 3RAMA 1H3DA 2BUNA 3FCVA 3MM9B 3HO1A 4M5JA 4H4KC 1PIEA 1Z2ZA 1HMVB 1SC6A 3WC0A 5K8NA 3F0NA 2VF3A 2ZITA 2VC0A 1XMBA 5F41A 4A4JA 1WEXA 5L9NA 2UU9J 5H9EK 5B7WA 1CJVA 2HQFA 3CVKA 1IR0A 1Q1KA 3UD5A 3KLIA 3NP5A 3UD3P 4B9SA 2H5JB 2HGNA 4WFXA 3KHGA 5FLXU 2B6AB 5HVGA 1JX4A 2GHPA 4AXIA 2KXHA 2GGPA 1X8DA 1S0VA 1S7IA 1FRLA 4M63A 2B0GA 5KFRA 3TANA 4RU2A 1ITPA 2FQQB 1TZ0A 3AD8C 4OHVA 1WDDA 2FJAB 1HI1A 2H4WB 3BR8A 3HI9A 4S0MA 4QWDA 2M3DA 4RKUC 1YJNS 1M5OC 3G8QA 5J2MB 1Y4ZB 2LXIA 3AJDA 4R5PA 4ECUA 2ERRA 4KH0B 1BMQB 3T9NA 4RUHA 3BQ2A 4JI7F 2IY5B 4ES1A 3I32A 5KG1A 1SC3B 2E1PA 3I0RA 3BREA 4OHWA 2J9DA 2J0WA 1LXNA 1NK4A 3RR7A 5RUBA 2ZKTA 2ASLA 4NLDA 2DHGA 3LP2B 3CEDA 5KFAA 3GIRA 4JOUA 1JB0C 4HT5A 4YB6A 3M8PA 4U6PA 3H2LA 1B0PA 3M1VA 5K5MA 2YWWA 1F1BB 3M2VB 3TVZA 2HLUA 3DI6A 1RAOA 3GG1A 3UR3C 4OJ1A 2J0QD 5FJ4A 1F60B 1NUEA 1RWPB 2YKQA 2X1BA 4C6AA 5KFDA 3MFIA 1UVJA 5FDLB 1PG5B 2OKQA 1KLMA 2WW8A 2ZZTA 4RPFA 4UT4A 3J81Y 1KTVA 2WB4A 2D3ZA 3IWLA 1FRIA 4UUXA 1PO6A 2KJWA 1S10A 1Y11A 2KXNB 3NOCA 5B0CA 3BSOA 2RRBA 3DLGA 1HQEB 1RWMB 1MW7A 3GJTB 4RJVA 3H90A 4DX8H 3QBCA 1F5AA 3MWBA 5DG8A 3C46A 2HNYB 2CQ1A 4RL1A 3CJ5A 3K2YA 3P6YC 5DLGA 4LBIA 5ETQA 4WP3A 3UDCA 6FDRA 1TV6A 2PSZA 1ZBTA 2YPZA 1O5JA 3I5CA 2R2RA 3T6JA 2PFDA 4JI3J 2UXCF 1U49A 2UUCF 1N33J 2HS4A 1NH7A 4DR4F 3G4SS 4NZ0A 1GX5A 2UVVA 1OYEA 1HQUB 2DNKA 2N4DA 3IM9A 3W65A 1SL2A 3QLHA 4AYBD 3G6ES 2XI2A 5A0YA 1NB2A 2W1BA 3HSJA 2XMWA 4NLRA 3HVRA 2ZH8A 1FNXH 1OWXA 3CJ2A 5IC4B 4WF9Q 3Q2SC 5DLFA 1S1TA 2BV3A 2GMHA 4IDKB 4LFAJ 2BXJA 2DNPA 3JXOA 2DGVA 4MT1A 4PXBA 2XQCA 1GMUA 1H98A 1Y5IB 3MTKA 1SB6A 3RRKA 5KFHA 2KM8C 4RW8A 3PG9A 5A76A 5KFSA 3D6FB 1RP5A 2YWEA 2ALZA 1TQLA 2R7WA 4M5HA 2HHHJ 4UQTA 4X4PA 4B3RF 1NPPA 2AYMA 1V5VA 2DH8A 4ZPCA 3DI6B 6AT1B 4DXLA 4F36A 3V2UC 4BCAA 4J9KA 3TR5A 2ZC3A 4C8MA 1FI4A 4A48A 3QRQA 4JI6J 3OT9A 3KUGA 4M5LA 4CLPA 5J1PA 5C42B 4K4UA 2YQ0A 4Z37A 1C1BA 3V6DA 3MGJA 2FHMA 3KK2A 3ILLA 1TKTA 2OGUA 3K89A 4KTQA 1NM2A 1RB0A 2V4JB 3TZXA 4PWDA 1NB7A 3ENAA 3DLGB 3N01A 4WE1B 4PQUA 4N8OA 2JNJA 1NHKL 1ZAXA 5KTQA 1WD6A 4F4AA 3TQ1A 4HH0A 4Z7CA 3BBFA 2OTJS 2RUSA 5IT9U 1U1KA 3J80Y 3MMAB 1S4EA 1SCJB 3WZ0A 3Q8PB 1N8RT 3MPDA 1ZTTA 3GIMA 2F4FA 2E5IA 2FVCA 3CDUA 2Q1LA 1C2PA 1S5ZA 2RQMA 2ACMA 1HWLA 3B6BA 1LXJA 4OI2A 3WDOA 3DOKA 2AYGA 2IMWP 2O67A 4LR9A 2JLEA 1SL0A 3ZTQA 5ETSA 2YX7A 5GAHI 1VQKS 4L3KA 5KFBA 2DNNA 4DR4J 3LPYA 2DR9A 4I6AA 1JLCB 1S1TB 2M88A 4IDKA 4DUZJ 4PUOB 2AKWB 3NBPB 1WSRA 3QO9A 5KFZA 2AJ0A 1S6QA 3LF0A 5KOWA 4LF9J 4WYLA 5CH7B 3GJQB 5GAEI 3FBBA 3KWMA 4B3TF 1HBNA 1JLAB 2X7IA 1WOOA 4OZ0A 4RW4B 2PMZD 1RT7A 3CC2S 4F4XA 1SJ3P 1K8AT 1NZAA 2VPWB 3V6JA 5JJBA 1PAEX 2LQJA 3UI3A 1BXNA 2XYPB 4YP3A 4KHPF 4ES3A 3QGPA 3T41A 1UCNA 4F4YA 1YDLA 5L38A 3G82A 3R9LA 2JL9A 5DM6Q 4NXNJ 2D3OR 2UZAA 4F2RA 1JLEB 2MSSA 3NAHA 5C42A 4B3SF 1H74A 2PFFB 4IOBA 3TW0A 1UL3A 2KG0A 4DR5J 2CKWA 4EYHB 2IYIA 5KG6A 2QX0A 2V4JA 4RBUA 1FJEB 1EX8A 2HWIA 4OI1A 1R0CB 4WE1A 1X0PA 2Z58B 4B08A 3ET6A 1WTBA 3AHPA 3BO3A 3TZWA 1VBYA 1VRUB 2FVQA 3PO5A 4N76A 4X4NA 5JUMA 4ZLJA 3O6QA 1OY9A 3KK1B 2QTWA 1TUGB 2BJDA 3HHLB 2V8PA 5DRKA 3S8SA 2ZM6F 4Z7YA 2I5JB 4RBTA 4J91A 4RW7A 4DR6J 2NUHA 3ZFVA 3Q24A 1ZYQA 4PKDB 3GFHA 4DV7F 3HJVA 2QFJA 1K1QA 1RE1B 4LUBA 1G1XA 2DTJA 2CA9A 2NUUG 5CZXA 1GNKA 2ASDA 5D0HA 1HFEL 1WHWA 3FEYB 3K8WA 4CO1A 1DQ8A 1WKKA 2K8GA 3PHEA 4ZVFA 4TY8A 1I6JA 3A12A 1RAEB 5KFUA 2MKIA 4GC7A 1YLXA 1D9AA 5HBMA 3HLUA 3K5NA 1P1TA 3M7VA 1RTDB 4DX5A 2OHDA 4KGKA 2WVFA 3PFEA 1KP6A 1MMNA 3IS9A 3UNGC 4CLKA 3J81U 3VALA 1M5PC 1WF1A 2ZHOA 4QU7A 1RTIA 3Q8UA 5L8RC 2GIRA 2XZTB 2HFZA 1RT7B 3M8YA 5CYJA 2L41A 2VHGA 1ZZNA 1QSSA 5DG9A 1WG1A 1HBMB 2NZ4A 1NU4A 3UDVA 2ASYA 4QYZK 1A7GE 2CVIA 2O5DA 3BGFA 1DRZA 3T1YF 2GHVC 1L3UA 2GZOA 5KG0A 3OR1A 3SSRA 3RW6A 3NL0A 5B0GA 2RQ4A 3N0VA 3JTPA 5HANA 2ALYB 2BE9B 1U1PA 3AB4B 5DQIA 4NZ7A 4OI3A 3VCDA 5T7LA 1JWWA 1Q8IA 2MY7A 3QT8A 4KV8B 1VLOA 3DLBA 1OYDA 4MKVA 2WK4A 1TKXA 4R8UA 5AE3A 2CPJA 4PG6A 3PCOB 3KK1A 3CCMS 3IM8A 2Y8WA 1Y7PA 2GVDB 3DMJB 4DQQA 4P2MA 2MZTA 4USKA 3G96A 4TLQA 3LP1A 3MAAA 4KFBA 5SZTA 4O3NA 4JI0J 2F1FA 4HT7A 1HNWF 3B82A 3UWTA 1TL1B 4OLOA 3U1LA 2JFDA 2M8HA 1UFWA 3CJ4A 3QT6A 1PJ5A 1P9QC 2FB0A 3AB2B 1PBAA 3KFWX 4A8FA 1WNEA 3GWCA 3MPVA 3TZYA 4LF6J 3RW7A 3WX8A 2AX1A 1XWLA 1T94A 3PO4A 5A8RB 4NLVA 4DZ6A 2VFUA 2W9BB 2GFFA 2A18A 2EVZA 4ZHRB 2F9DA 1SKRA 4LSNA 4NXMJ 2V5HG 1WSVA 2DCLA 3DLKA 4HL9A 8ATCB 1KFSA 1RTDA 4LJMA 3M9NB 3BO2A 2E5GA 4OHZA 4ID5A 1RT4A 1RAIB 3HHLD 3HVTB 3BH6B 3U1MA 4CIOA 4OQJA 2F5GA 2VONA 4ZP6A 2JSXA 4NLTA 1FKOA 3FK4A 1EQMA 1SC1B 1IKXB 1K44A 2R7QA 1NZ8A 3MM8A 3PEHA 4OYXA 4V1Ak 5DS7A 3N6MA 3OR1B 5D78A 4ZJQA 1A6LA 1VI7A 2CDRB 2DPJA 2E5LJ 4ED1A 1FVQA 1CJUA 3MM6A 1RU1A 3D6TB 3UD4P 1XQIA 1NKBA 3BKUA 4DL6A 3EZUA 3OLAA 4ECVA 2ZUAA 1V6HA 1WACA 4LQ9A 3EPGA 1HNVB 1XERA 3POTA 4LSLB 4DL7A 4FYYB 1XMOJ 1HI0P 1O6XA 3CO0P 3OFGA 2I1RA 3ZTRA 3C3LA 4HI2A 1QSYA 1FK9A 2RS8A 4HACA 4MFBA 4B9VA 4PABA 4FXVA 4PYAA 1WHVA 2M2BA 2DGXA 2CNLB 3DFEA 3IN5A 2R2UA 1T05A 4F0KA 3BZQA 3VAGA 1E6YA 3SSSA 2BQUA 2D9PA 3MPYA 3NWGA 4KHMA 1FXRA 3SV3A 2C3YA 4KR0B 4Q45A 4QCLA 1X9WA 3MPUB 1HW8A 1JNRB 4H4OA 1QLNA 1HPZB 3D5MA 1QDUB 2GVZA 1GEHA 1MNEA 3B8HA 2A2CA 1ELOA 2LXFA 3VZHA 1VISA 3DHWC 4PAAA 1JJCB 4QWBA 3DDKA 3G71S 5A8RA 1XR7A 3ETOA 5HJYA 4U67Q 4MH8A 2MQLA 2MZ1A 4G6VB 3I55S 4UF4A 4HHHA 4CCHA 1A9NB 3W66A 4KKOA 3CDWA 4FNIA 4LF1A 5E3AA 5KT3A 1RT4B 2V34A 4J5OA 4Y2KA 3WHIA 3PW7A 1V9OA 3PVXA 2AYBA 1T9TA 3NRBA 4H4MA 3IR6B 4K4YA 1F0XA 2QO3A 2FJXA 1HI8A 4R0EA 1NJIT 1RT2B 1QE1A 1B64A 2XHWA 5IT0A 3K5OA 2AJ1A 4CNZA 5DM7Q 2K1RB 3MM8B 2YH0A 4UOFA 2FLOA 3Q86A 4RNHA 2OEJA 3OXGA 1LEOA 4BLGA 4DPUA 4C4WA 2A3JA 1EHWA 4I6WA 3J81j 1YRTA 4FKXA 2L9NA 3D54A 1CJUB 3CCUS 5L1IA 4URGA 2GX8A 3VGSA 5J1EA 2W9CA 1W26A 3C15A 1J2VA 4WWSA 1ZAVA 4B9TA 1Y5LB 1MN7A 2CQGA 4E2FB 1UAWA 5D77A 5HVHA 1QM9A 3L9ZA 2R7UA 1QTNB 3QMQA 2ZHAA 2W9CB 4MFBB 1AZSA 1RBAA 3HD1A 2E66A 3LW5C 2H54B 3M8QB 1FE4A 3M8SA 3DOLB 3R5CA 2VOOA 1OPZA 2C2MB 2MPUA 2VV5A 3DHXA 3QJLA 1N5YB 2YKPA 3BYPA 4X4QA 1D0EA 2AP6A 1NHUA 2DGTA 2RVJA 3LQVA 4F3QA 4X62F 3CIMA 1Q81T 3GG0A 4F26A 1E6VA 1EAYC 1RWWB 2COLA 1KR4A 4ECZA 1SKWA 4J9VA 3GILA 3MECA 3CDEA 3TA1A 3ISNC 2LLZA 4CM2A 2WW4A 3E01A 5D4PA 5KFJA 3RBEA 4JV1A 4JI7J 2FTRA 1L3SA 4ZP7A 1EP4B 1G6BA 2ZOFA 3N6LA 3TO8A 5AE2A 4UQGA 1WWHA 1JLGB 1QJHA 2B4PA 2NS1B 4IG3A 4LRFA 2W8KA 5HQMA 1GMVA 1REVA 3CO9A 2DISA 3THVA 3A4TA 4H4MB 1B7FA 2JEFA 1RHQB 1YGYA 1FE0A 1H2VZ 3DLEB 4OZ2A 4B3MJ 2F4VF 1FCAA 1S9EB 5CABA 1F9FA 2HNDA 4HDGA 3OUYB 2LXUA 3HF5A 1RUSA 2DO0A 5LJ3Y 4KPCA 2V6AA 1TUWA 2MGZA 2FHJA 4NLUA 3RYLA 4DN9A 5M2UA 1TKDA 2BE2A 4F04B 4UOCA 1U1OA 2R8JA 1W2IA 2NXCA 2JLFA 3QAUA 4LR8A 2Y0SD 3TVYA 5HJXA 1R3NA 4DG1A 1D09B 1M1KT 1RAFB 2DRDA 1H7WA 1I5OB 3GJSB 2ZH3A 2MMYA 3WIVA 3DRYA 4DR5F 1UA1A 1IKYB 4LSZB 3WBZA 1RAJA 3C16A 2YH1A 1WOSA 2B4UA 2YNFB 4A8WA 3AA8A 1S72S 3NMAA 2B51A 3T1HF 3QZ8A 1WC3A 1PSDA 1XMOF 1XR5A 3RBXA 2B8PA 1WF0A 3B78A 3JSYA 1IKVB 4IO1A 4IH7A 4RUBA 4YN3B 4O3OA 2B5JB 3I56S 1AUDA 2QC3A 3OL9A 2BACA 4Y0FA 1E6VB 3IG1A 1V3ZA 3HVWA 3KXDA 5H9FJ 1IBKJ 3C19A 1SPBP 3KJVB 2JRSA 4MTPA 3LP0B 3CGIA 3ZZOA 2FVRA 1TVRA 2B6AA 4QIWD 2HNZB 1PYSB 1TUVA 2BJEA 2BEFA 1FRXA 2DXFA 2EKNA 2GGPB 4ZPTR 1KVKA 2HAFA 3EPIA 1HNXF 2F8HA 1TL3A 3MR3A 3OTBA 5DO2A 5IV3A 2GA7A 4JP8A 2QMWA 3AAWB 4YB1P 2OEMA 5HP1A 4I64A 4L76A 4LF8F 3UNYA 2BM1A 5D0GA 2MHEA 1TK0A 4DQPA 3DLEA 4HH1A 1J27A 4Y6IA 3G6VA 4J9NA 1D1UA 5KFVA 4ZITA 1IM6A 1S79A 2HWHA 1FTRA 2XG8A 3JQMA 1M5HA 1GT8A 2RKIB 2XSJB 4OIXA 4OHXA 3HKWA 4TY9A 2DPIA 4OI4A 1RKJA 3UN3A 1S9GB 3UN2A 4F3OA 4ZCKA 5AJ3J 3RRHA 3I6PA 3KMQA 5ETOA 3BGOP 5I3PA 2JHEA 2RQKA 4WPAA 1ZTWA 3GCWP 4DG1B 3DYAB 2B9EA 3MHYA 3VVUA 4DX6A 4W92B 3R1LA 1LWFA 4KJIA 4P7VA 2I0XA 5IQQA 2VA3A 3H5YA 4CO3A 2W7AA 3DRSB 2YNFA 4USVA 4N41A 2KT5A 1T9UA 2KXFA 5FDLA 1NK5A 2EFVA 1JKHA 5ETTA 1GXLA 1S1XA 3I5AA 5LMUJ 4OYZA 2CPDA 4WFZA 2ZH1A 1IKVA 4F0HA 2FLPA 1S77D 2Z0GA 4WU3A 4JUZA 1JLFB 2LCWA 4M5GA 4C3LA 3PKMA 5C25B 2YKNA 4X4SA 1RHJB 4N7TA 2XY7A 3T1HJ 1NJYA 3PX0A 3K17A 1LWCB 2GIQA 3G2XA 2CPYA 2GW8A 1EB0A 2EPIA 2FHKA 2H3EB 5JVGQ 1AROP 4NASA 2OFHX 4ENOA 1NNDA 4GKKF 2E7VA 1J5EF 4ZP8A 1T8EA 1RTJB 5LXRA 4Q8EA 4FBUA 4F7VA 3M2UB 2RU3A 3D67A 3H0PA 2F8MA 4WFBQ 5L1LA 4A47A 1UPMB 3MMCA 4ZCMA 2J0SD 5A0YB 4ZDNA 3DXSX 3H2VE 2ZZMA 4A8SA 2AGOA 1Y00A 3HHLC 3JYTB 4DUZF 3FQKA 1ZM2A 2RKIA 2MLYA 3R6GB 1V3SA 4RW9A 5HSPA 3KTQA 3DDNA 5EX3A 3C6UB 3X1LB 1VBKA 1RJJA 5BR8J 5JVHQ 2BVZA 2HIYA 4DV0F 3TJAA 3HHDA 3KG0A 2ZBCA 3DLLQ 2A1BA 5DJBA 4NEZA 2IJFA 4NLSA 3CMES 3A8IA 5DQGA 5AXMA 2W9AA 4CWBA 4QW9A 2WRMA 4FNHA 4EGLA 3T5KA 1B3TA 2WVDA 3Q89A 1KBRA 5AT1B 4DL3A 2P9GA 2CQPA 3ILJA 4BWMA 2C42A 4ANEA 1VQPS 1RT3B 2ADBA 2C3OA 4CLSA 4LF7F 1R89A 2G0IA 2CRLA 5F8LA 2ZJRQ 3KK2B 1JLBB 3H42A 1S1WB 1IBLJ 5C25A 3NGRA 2MQPA 5ETRA 1RAHB 3EMTA 3M8WA 1M0SA 1YBUA 5A8KB 4RUCA 1LWCA 2QYGA 1SV5B 2J8SA 4X4VA 2XWXA 1JXVA 2CJXB 3NWRA 1FDNA 3DOMB 3S1TA 2F8EX 1VJWA 2HHWA 2FC9A 2EFQA 4I0WA 5F8GA 4OYBA 3K7RA 5A8WB 3F56A 2LFVA 2R7TA 1FJ7A 2FZCB 2PE8A 4ANDA 1JMTA 2XMMA 3FZ2A 3H98A 1HL6A 2AGQA 2UXDJ 4Y2MA 3CD5A 4AUKA 4KGXB 2JVRA 2HQDA 1EJ7L 2ACYA 2NXUA 3CDBA 1RCOB 3MCNA 3MEGA 1P9YA 3GSDA 5A2QY 4YR2A 4ZPWR 2NQPA 3SSQA 3NNCA 1DLOB 3IBCB 4WKRA 1MWQA 1S12A 2AWZA 3VTIA 4ZS6A 5KFQA 4JYAJ 2VG5A 2OPSB 3QYYA 1QVFR 3H59A 3NBPA 1VIOA 1RBLA 3GP9A 3NEKA 3SCJE 4DX7A 2ZOGA 3FZBA 1N6QA 1QUVA 1CJTB 1QAJA 1SIWB 3EGWB 3SDEB 4B3MF 3MURP 1OS5A 1UWBB 4DR2F 4V19J 1S4FA 3AY0A 3E2EA 4YS2A 3MI7X 1HR0J 2VG7B 1HYSA 3UO0A 2UUAJ 4LT6A 4TLRA 2UUBF 2BQ3A 2NPIA 1T02A 3R5GA 1W2BR 3CF5Q 4X65J 2JZ5A 4O44B 3AOAA 4UY85 5J1NA 4K4SA 1KTQA 1NAQA 4TYBA 5HLFB 2KFZA 1PKUA 1IR1A 2B9WA 2HK2A 3H20A 5B0AA 3GSIA 2MLXA 1V5IB 4NLGA 4K5SA 2DHSA 1IBMJ 2V50A 1X9MA 1ZM9A 1NHVA 2LA6A 5T14A 3A3OB 4W4MA 3B4MA 3UCUP 3MXHP 3R7BB 3AA9A 1Q5YA 2LQ5A 5A8KA 1O0PA 1UEUA 2QLXA 3AFGA 3D0HE 5GAHU 4AL6A 2HVZA 1SV5A 3A13A 4UTGA 4DSKA 3W5YA 3FRZA 3QFHA 1L5UA 1R8PA 2BKNA 3HK2A 4FP9A 2LU2A 1A0OB 1SIZA 3HHLA 1HNZF 4K4VA 4PPDA 4RW7B 1TK8A 4NXNF 4FYWB 2BJ3A 4KB7A 4WTOB 2QLJB 2CWKA 3ISND 2K3KA 4M5IA 3NNHA 2KZZA 4E8UA 1MN9A 2EK1A 1F9EB 1BQXA 1K0TA 2DEIA 1RTHB 2CPHA 2QGFB 5I3QA 2HLTA 3OTOJ 1DLOA 1MLAA 1MMDA 5BYQA 4KBIA 1U0HB 4DPYA 2EBGA 5CD4H 4M94A 3CPWR 3SCKE 1X4BA 2RAQA 2VFSA 5IM0B 5EWFA 4DSFA 1C0UA 3ILIA 2VFVA 3MM5A 3QWPA 2HS0A 1URRA 4KYZA 1C1CB 2K7JA 4DPOA 4D3HA 2KHDA 4YMEA 1DTTB 5CCMA 2ZZNA 1UWBA 3K5PA 4CO0A 3R1HA 3RBDA 3PJ9A 5EX0A 2YKMB 4OYWA 1S0OA 3PACA 2BJ7A 4G1QB 5GMDA 4URQU 2KT2A 3MDFA 2HHTA 2ZUGA 1VHFA 2HG4A 1DAXA 3ICLA 4L6V3 4HYKA 2DK2A 1SJFA 1S1VB 3W2WB 3Q8RB 2QT7A 5EUHA 4DR7F 5GMKa 1UZHA 1FT8A 3K0JA 1XNQF 5ETPA 2HVEA 4OZ5A 1WC4A 3M32B 3MCOA 4RO0A 1FKAF 2FVPA 3ZZZA 1JXLA 3I31A 3HSDA 4JB8B 4LBPA 3P5TL 1GK8A 1U6FA 3DGPB 3FEZA 3GONA 4EI2A 2R2SA 2VFTA 3DXBA 3TX0A 3W9IA 3VR1A 2XNRA 1YZ6A 4DSEA 2MSTA 3GFZA 3KLFB 1RI7A 2BE7D 2QSFA 3Q2TC 3NNAA 4C98A 1YK9A 4DZDA 3SFGA 3OD2A 1BUXA 3SQGB 3UVJB 5GAGI 2CYYA 4C8OA 5KG4A 4LF5F 1Q95G 4QR0A 3SV4A 1IBLF 4M1KA 3MAAB 1GAOA 1N32F 1FESA 4NYOA 2BABA 3V5RA 4TU7A 1AYEA 3MCMA 3D0IE 1CJKB 2DNZA 3OL7A 2UVRA 1CULB 1IWAA 1XIQA 3T6BA 4Y3CA 3HDSA 3GFYA 1ZA2B 2L08A 5GAGU 4CTAA 2DEJA 4USHA 5KT6A 4YFUA 3MUVP 3JB9k 1NSAA 2HURA 3HZEA 4QWEA 3GR0A 3H25A 1NEEA 2FY8A 5EGYA 5IM0A 2EG2A 4ZJOA 1N0VC 1LK5A 4ZVPB 5CAAA 5IZHA 1WI8A 2C2RA 4HVZA 1FTCA 4NI2B 2N82B 2YNGB 4ZVEA 3DLKB 2DNRA 3JSMB 2QA2A 5T41A 1DTTA 3GJRB 3IMQJ 4JI4J 2VODA 2W8LA 1UP1A 4B02A 3TA2A 4RNMA 2VICA 3HVTA 3IC1A 4U95A 5BR8F 2GIFA 3EX7B 5LSLA 1VQ6S 4X65F 2A2DA 2R9LA 4FKYA 2VJUA 1UW4A 2DB1A 2V2KA 3JQKA 2C2NA 2ZKUA 4CH7A 2UUBJ 3DM2A 3RAXA 4DR2J 5HQ8A 2MQ8A 4ZN1A 2D69A 3HP6A 1BWEA 3TUZC 3BM7A 2PIIA 3W64A 3KNAA 1GMWA 2KG1A 1S0NA 4JBCA 3NXZA 4DR3J 3A8JA 4NLWA 5HMZA 3A8EA 1WG5A 3F73A 3KHRA 2B43A 3EGNA 5LSOA 3OTEA 4O23A 1X60A 4NCAA 2CPIA 3N28A 1GTEA 2AD9A 4I67A 1IBCB 4X62J 4M5NA 2R42A 3FBCA 1V3RA 1Y0HA 2MZRA 2V2VA 2KH9A 2WHOA 3G8TA 5BXIA 1K9MT 3T5LA 1QSLA 1N32J 2DHXA 3RAQA 4X66F 1CJKA 1UTAA 1UVKA 5KFYA 1RK8A 1HBOB 1WC5A 1TMMA 4C11A 1I94J 9ATCB 2F9JA 2QMUB 4RU9A 1KSPA 4PG8A 1Q53A 3J7A1 3TAMA 4FF2A 3W63A 2FDNA 3FJ2A 3HFKA 1F3FA 1RHKB 2ZD1B 4ICLB 4P2XA 5IT4A 2HKEA 4RX6A 2XM3A 1U1QA 1N52B 1KQKA 1RYSA 1DTQB 2J7KA 4C8NA 3W1YC 2V2QA 2EW9A 3SQOP 2V4QA 4B3TJ 4HHUA 3W5ZA 3CB4A 2D9OA 2B3TB 2VASA 4ZOSA 2RRNA 4GC6A 4LF9F 1Z2LA 2DH7A 4DU7A 3S7RA 2MLZA 1AFIA 3US5A 1S0MA 3R2CJ 3KJNB 4TYAA 3CMQA 4XO0A 4N5SA 2R8GA 2G9OA 3KLEB 3OVAA 4DWIA 5KT5A 1CJVB 2JFKA 3PRBA 2XCAA 5FIIA 4ILLA 3HULA 1NK7A 5C24A 3EICA 2CQ2A 3FNNA 4ZCLA 3CWJA 1S1UA 4NCGA 1U1RA 2WBRA 2YVSA 4DSIA 4HI1A 1YTYA 4DS4A 1U0SA 2C1EB 2G2ZA 3NGUA 2V2ZA 4ID8A 4PR6A 4DF8A 1VBXA 2DGWA 4USWA 1DZ5A 4A8QA 4LFBJ 1VQ7S 3VQTA 1WKJA 3I4HX 4NA3A 1U48A 3EJMA 2DVIA 1SKUB 3GR1A 3CCLS 1Z1ZA 3BGRA 1PJ6A 1B0VA 2PN6A 3VF0B 2IFXA 1LW2B 4YB7A 3OBIA 3EZ5A 1WOPA 2CNNB 5BYSA 3D28A 3BS9A 3IFEA 3R27A 2QZ8A 2LQBA 1I94F 1RWKB 2FJWA 2CQDA 2W7OA 1WELA 2BA9A 4U7UD 2HFUA 4OZ1A 1TELA 2VBZA 1Q79A 2BJ9A 4DMZA 3HX9A 5CCLA 3UR0A 4K4XA 4KAIA 4DJBA 4IRDA 4WTYA 1UFKA 2V8GA 2XZDB 4B9NA 4HLBA 1ZH5A 1R0BG 2XZWA 1TAQA 5F9NA 1AA1B 1R6YA 3BB5A 3VGTA 4PXDA 3EXCX 1IJEB 2CDQA 2RRAA 1C1BB 2K06A 2W2PP 4CRJA 3MUTP 4FPRA 4Y28C 3J7YI 2NYHA 4YY3J 3D0GE 4IYQA 3HZGA 2FLNA 2E1RA 2HZVA 1KS2A 2IJNA 4PQUB 3OTDA 3FFIB 2E7WA 2LDYA 3RB3A 4C8ZA 4ED5A 4DV0J 2L3MA 2MEWA 3JTNA 1HKAA 3CCQS 4FS2A 4ELTA 2OPRA 2B8QA 2MKCA 2K2PA 4IKAA 2GAHC 2B9XA 2CQCA 3CJRA 4WBFA 2H51B 1SQFA 3I82A 3IO1A 2F4VJ 1HQEA 2VBYA 5HK4A 3D7SB 1U25A 1OJ4A 5C24B 1J5OA 4WIIA 4LMZA 4DLEA 2HNYA 3N5BA 4C3MA 2MGZB 1NDKA 3IA0A 2G2OA 2PMWA 4NLOA 2MHNA 1M90T 4F3MA 2UXBF 3M6VA 3ZTPA 2HQ3A 2H9ZA 1F9HA 2E7XA 1IXKA 3IBFB 4UOGA 4OI0A 3L7UA 3L09A 1Y3KA 2XY5A 3QGIA 3RRGA 3CCWA 3MOJB 3EXYA 1HQUA 3FMBA 4FYDA 2PDAA 4L73A 2E9TA 3FGVA 1ZPVA 1S6QB 1U09A 1VYAA 4WK1A 4DQRA 4EYIB 5K8PA 2HGLA 4XTTA 4CO5A 3EYZA 4RW4A 2XWYA 4OV1A 3KDNA 4ECSA 1VR6A 4DI6A 3MAHA 1OMSA 1HD0A 2ZEJA 2IVMA 1BQNA 4IUFA 3G82B 1ZAWA 5D8HB 2CPXA 2XLJA 1RHUB 2DIUA 3HSGA 3UCZP 1FDDA 1MWYA 1H7XA 4UOHA 5CQGA 2ILZA 4WFAQ 2RUGA 5G0RB 3J80U 4PYDA 3WC2A 1TL7B 3TEHB 1VJQA 2MKYA 2OSRA 5K14B 2NCKL 2QEXS 2XMVA 2NZCA 1QAYA 5GVQA 3D4JA 3CT9A 3EZOA 3KJQB 3SI8A 2KVIA 3L4BC 7FDRA 4DDFA 2V63A 2Z56B 2DNHA 5JXSA 1BQMA 2XO6A 5C2GA 1SQEA 2CQ0A 4YR0A 1RDRA 2OPRB 3ZZPA 1X5OA 2V0NA 3CD0A 4JI8J 1TKTB 1MWZA 3FUYA 4IFVA 4P71A 1NDCA 2XC9A 5C7PA 2N4CA 4PWDB 1P1LA 4C8YA 1S6PB 3HHKA 1O51A 4O3RA 2VFRA 3PKYA 5D0EA 2ADCA 2UP1A 1FDAA 3PTWA 4B17A 4LF5J 3M05A 2E5HA 4IO9Q 4OYOA 3R8YA 1KFDA 2CPZA 2VQEJ 5F8JA 4ZCIA 3TA0A 4Q0BB 4J90A 3JS9A 4PPZA 2X1AA 4IR1A 5HO4A 3P49B 3LANA 5ADZA 3ZTSA 4PEOA 1HBUA 2R3VA 1IN0A 5DDQC 2LQ9A 5L39A 1LK7A 2IHR1 4RNFA 2XI3A 1MU2B 1RWOB 3UDLA 2RU9A 4Q7AA 1B70B 4CLFA 3S01A 2BYCA 4GRSA 3P45B 1YJWS 1VDHA 1Q86T 2DGOA 5KFXA 4TN2A 1UJ4A 1IBKF 1NJZA 1PYTA 3SYZA 2CXEA 4TU9A 1T03B 1TKZA 4ECXA 1JQGA 2B4VA 3A1YG 1HBMA 1BGXT 5I4MA 3HFVA 2D1CA 1S9FA 2HMIA 1GTHA 2VPYB 2U1AA 2DNLA 4EZ9A 3M9MB 1WF2A 1X4GA 2E9RX 1JLAA 4FVCA 3MD3A 4GVLA 1NKEA 1YITS 3BGLA 2FHJD 1EQ0A 1OO0B 2W25A 2ZH9A 2LQ8A 1RZMA 2MZSA 2DXDA 1K0VA 4H54A 4DCPB 3MEEB 1LKZA 4O4RA 3TRGA 4F4ZA 2DY1A 1PCAA 3ENQA 1DQ9A 3LO3A 4J9UE 2MQQA 1Q8BA 2V94A 4ELVA 2CPFA 2AW0A 1YKWA 2HS3A 3I5BA 2HBRB 5EDWA 2R2TA 1C4CA 2H65B 4DV4F 4LFCF 2DGSA 3W7BA 5BJRA 2M70A 2Q3PA 4JI2F 2ZJPQ 3CW2C 3JYTA 5KFFA 2DR7A 2BZ2A 4OJGA 3LP1B 2GHWA 4KFBB 5C2CA 1LQ9A 1N0UA 2V8HA 2OH2A 4LIRA 2ZH6A 3HCXA 4QYZJ 2IC3B 1VQSA 1YJ7A 2OD4A 2VH7A 5E41A 4FXDA 2LP4A 2RS2A 3OXLA 4CO2A 2V9WA 4EMDA 1KNZA 2KL8A 1PILA 2ZVSA 2JEJA 3FSIA 1ULRA 1T9WA 4ZLLA 2BANA 2CG8A 1JJHA 3DDIA 4ZVQB 2C2OB 2Y1IA 4RWXA 2ATLA 4USIA 5ETVA 4OV6A 4ECRA 2YNIB 4I7FA 4LBHA 1H2UX 4LSNB 4NWBA 4O4GA 4RR5A 3R3TA 4UW2A 4OX9F 1KD1T 1MU2A 2AZ1A 1SBRA 4HR2A 4IFYA 4K8RA 2CJAA 3EM1A 3QGHA 4P2SA 4F2SA 4KPYA 5KG3A 1X4FA 3CDAA 1X4CA 3EGVA 4C0OC 2YX1A 2ASJA 3NGSA 3L95X 4IOCQ 1YBTA 4EZ6A 1T03A 1QVGR 3NCPA 2FJBB 4ZPVR 1JLBA 1R31A 1D8YA 1PYOB 4I56A 1KVJA 1FVSA 3TI0A 3SIPB 1FKOB 2L9WA 3BQ1A 1IKXA 3KMSA 2GJ2A 3BN7A 1VGYA 4ZMMA 7FD1A 2BDPA 2L9DA 2HFNA 1FFSB 3AJ2A 1RTIB 3O2IA 5THWA 1FHTA 1CC8A 3MM6B 4HEA9 2XGQA 1K73T 2BX6A 1X5TA 3QIDA 5LT5A 2LEBA 2K7KA 4AFFA 3BSCA 1QUPA 2RDJA 4ED2A 2MQOA 1HNZJ 1HNVA 4LSLA 3GIJA 1YI2S 2KFNA 1KWMA 2RF2B 3E8OA 4Y2CA 4QBUA 3THTA 3W60A 5I42A 3D3CJ 3NS6A 2O3DA 2ZDOA 1T9YA 1NCLA 3ETMA 2C2KB 4HACB 1T9XA 1SH3A 4PZVA 1RT6B 2HWTA 2QFIA 1IQTA 3QJJA 2KU7A 4MKAA 1R43A 5GMEA 3TUJC 4ITSA 1TU0B 3VAKA 1UEVA 2AJ4A 2ZDPA 3AODA 1R0AA 1N6QB 1TKXB 1CJTA 1S99A 1N5QA 4ZLNA 4U7CA 1DFDA 3I4PA 4QU6A 2Q43A 2QA4G 3T3FA 4LVOP 3N5FA 3DMJA 1GH8A 1H6KX 1RA7A 1RT5A 2DHAA 3DKDA 5K20B 4DUTA 3MUMP 2XS7A 1RKIA 3MR7A 1U6BA 4M8LA 2F40A 4GO5X 4J7CA 1U45A 4DUYF 2NYIA 2NXNA 4ED0A 4IFYB 1CPZA 4K4WA 2MKHA 2WSFC 2GS8A 3TOQA 2FHOB 4CLWA 3CULA 1WC0A 4WZQA 2FJEB 1XMQF 5CXTA 2C3PA 2PC6A 3BH7B 2H5EA 1NK6A 4QW8A 2YWKA 2UU9F 3KUEA 3QATA 1FDBA 1RISA 4PG4A 4ZVOB 4ZVRB 3Q0AA 4MMOA 2CQ4A 2DNYA 4P52A 4DV2F 2EFNA 3BDPA 1ZOTA 2DY9A 3Q8YA 1QD1A 4ID5B 4KSEB 2ZE2B 4YDXA 4CLYA 2HHUA 2R4FA 4CLTA 2KM8B 1YJRA 5E3PA 2R8HA 5LMNJ 1S48A 4ZJLA 1UPPA 2YPYA 3PYGA 3GMGA 4R25A 4DBQA 4CZCA 2DR5A 1U2RA 3CXCR 3GYGA 3CJ0A 2QSWA 4X66J 1N48A 1BE4A 2OMLA 1R8HA 3QRPA 4PRFA 5F8NA 2J6UA 1T05B 2PA8D 3ZNUA 3GE9A 4PG5A 1H2TZ 1SVDA 3GB0A 3HHNB 2Y1JA 3LWMA 1QAXA 2DNMA 2HHPA 2QL5B 2ZWOA 3EE3A 5IWAJ 1CS4A 2CFXA 3MR6A 3EUNA 1U4BA 4B9MA 1U0HA 1M5SA 2M5YA 4MIBA 1FRHA 1R8CA 2VQFF 2OMOA 1N5YA 2AYEA 4DS5A 3BBCA 2YKAA 3C8YA 5KG7A 4BWJA 3AXMA 4K59A 2OELA 5AXNA 1YSJA 2KB2A 2B9YA 3ENVA 3VQSA 2V9KA 1FWKA 1DURA 5F3TA 3R97A 5JMNA 3BJYA 3VAIA 2YX4A 1VQNS 5D3GB 4ZK7M 1IKWB 2IDLA 2XS5A 2YKMA 3K8VA 1NRKA 2N7CA 4G1QA 3AOCA 3IGNA 1E6YB 1TTHB 1FD2A 1KOOA 1MROB 5KFKA 5J2NA 1KQGB 4E0DA 2E9ZA 5KFWA 1F6TA 1TR0A 3LGMA 2OO4A 4USMA 4ECQA 2UUAF 1WEZA 3D1QA 2YQ3A 3ZZUA 4ED7A 1S1VA 2I8EA 1X7VA 3CCRS 2FGCA 1EP4A 3LPEA 4D3GA 5AJ3F 3O8WA 3KG4A 4IG3B 4J9SA 3EGZA 5CD4A 4ATNA 3UCGA 2XLIA 5M2RA 3MTJA 4N77A 1GXTA 1PGZA 3DLJA 4Y00A 2DITA 1RT1A 2VKZG 2DH9A 3LOUA 4KKOB 1JIHA
chains in the Genus database with same CATH topology
1SUQB 3OFFA 5EHHA 3OFEA 4I2QA 4K4ZA 1WHYA 2HAIA 2FIUA 2XSFA 2HVHA 4C97A 2QLWA 2BE2B 3G9CA 3QAEA 3SQGA 1RT2A 1QE1B 2V8VA 4G3IA 1HWKA 3M8RA 1YWXA 4LIWA 1JLQB 2DGQA 3QIPB 2MKKA 3J7ZT 2J0XA 4XAKA 2KYZA 5IT9Y 2G1DA 2DNGA 1FRMA 3KHLA 1R7IA 2J8AA 5LJ5Y 4MK8A 4X4UA 4QZVB 1NH8A 4ZP9A 4ECWA 1DBDA 1X5SA 4RW6A 3M6XA 2FJDB 3DRXA 1SH0A 2DNQA 3KOAA 2DJWA 4YUDA 2YNGA 4F4KA 4RZRA 4Y2IA 4B9LA 1Q7YT 2XO7A 3NAIA 4WCEQ 2LDIA 1IKWA 3IR5B 2O66A 4KQZA 4QIVA 4KC5A 3OHAA 2QRRA 2HIQA 2YY3A 2A10A 4WXOA 2QIFA 3NCQA 4FF1A 2NREA 5DG7A 2JLGA 3I0SA 3E51A 1I1GA 2WTFA 5J2PA 3BGUA 3GQCA 3PFOA 4YDDB 4ED8A 2PMHA 5HI7A 3CCVS 1SXLA 3NCRA 2X51A 1G3OA 3ISZA 2I38A 4L3NA 2P9EA 5F0WA 1VQLS 2DNOA 2BBEA 3JTOA 1S76D 2WB1D 4WKYA 5J2QA 3Q23A 1N5VA 2Q79A 3B4DA 5L1KA 5G4DA 2XMKA 1S9EA 2WSEC 3FRYA 3GYNA 3OUYA 2ZH2A 4B3OA 1BLUA 4TXSA 4C0HA 4CT9A 1LWFB 4XIUA 1JLQA 4CT8A 2PEHA 3ITHA 1K1SA 2JVOA 3U27A 3TAQA 3I96A 3DRRA 4WFYA 3MOZA 1JKHB 5GADU 2VPZB 2KRRA 1UVIA 2IA6A 2VD3A 4DV6F 3T9ZA 3K59A 1YJ9S 4C2MA 1YJTA 1UVNA 2Z2MA 1UKUA 1CQMA 2KDOA 1D3WA 1R27B 4I2PA 4MYUA 1CLFA 1CC7A 2J6SA 3QWUA 2MZQA 1CSJA 4QPTA 1T7PA 4Q43A 1FJCA 1N5TA 5HN0A 2D74B 2HHHF 4J9PA 3I0SB 5B08A 5B09A 2M7SA 1QY7A 3ENWA 1JK9B 1TVRB 2EKYA 1S1UB 4NCGB 2VQEF 5J2MA 1YRUA 2R8KA 3MMCB 4J9QA 2HHVA 3BSNA 3HXMA 4LVNP 2ZH7A 1DQAA 3M30A 1TL3B 3H40A 2PI4A 5FD1A 1ZZFA 2CJ9A 3I0RB 5HP1B 3H5UA 2RJZA 1U1MA 1U6ZA 3BGRB 2HW3A 4FXWA 1LW2A 5J2QB 2JX2A 4DSLA 2OFGX 1S97A 4NLPA 3ZZ0A 3TAPA 1NK0A 4NLYA 1XC9A 2EWHA 3OR2A 3BQ0A 1D9FA 2HGMA 1TK5A 3K57A 4DR6F 1YJVA 2IYGA 2XULA 5M2PA 2D7SA 3CJ3A 2FPHX 2CJKA 4ERDA 2MXYA 4A8OA 1KQFB 4FZVA 1KLMB 4DFMA 1RT3A 5E2QA 4PXEA 1FO1A 4F02A 4UUWA 1N54B 3KG1A 2GMJA 2BQRA 1VQ9S 3HHEA 3DRSA 1NO8A 1WI6A 4QWCA 3NG8A 4ZPAA 4TU8A 2IA0A 5F0UA 3KLHA 2O1PA 3PNIA 4I2PB 1NK8A 3NLCA 1S49A 2VUGA 3DOMA 1SJ1A 2PA3A 1D9DA 4OZLA 1YIJS 2E5LF 3OLBA 3OVBA 3RB4A 3TVKA 4DL2A 2ZNYA 4LFAF 2YKNB 4RWWA 1AFJA 2NR0A 2JH3A 1M5VC 3KLIB 1KC8T 2XB2D 2MQNA 1IJFB 1J5OB 2IVYA 3ZZTA 4RNOA 4N56A 4KRWA 5EWEA 3CC4S 2GV1A 3MMJA 3OVSA 5AXKA 2IVFB 4OJHA 2P9CA 4A46A 1C0TA 2CG4A 2P5VA 3QJPA 2NLWA 2KKHA 5A6PA 4A8KA 4MKYA 3NGDA 3CC7S 3M2UA 3IWXA 2IM1A 2XMTA 1VQ4S 2DO4A 1YHQS 2M4MA 2Z8QA 2CQ3A 2Q66A 4DFJA 2X3GA 1UJ6A 2VG7A 2M9KA 3OR2B 1FEHA 3DRPB 4LF6F 1WHXA 3C6UA 5KG5A 4JI0F 2GJIA 4O44A 2BOPA 4KIAA 3FVYA 3MPWA 2DT9A 2FC8A 1N56A 1VIXA 3M8PB 4EEYA 2E44A 4WYWA 3FDSA 3M2VA 1JJ2R 1QAIA 5HMYA 3SMZA 2CJBA 1VS3A 2EFOA 3M4XA 5K14A 4BC9A 3IWNC 3IR7B 3RZAA 4XK8C 3HJFA 5KFGA 5E0OA 1BQMB 5AE1A 3IBWA 3PM9A 2RE1A 5IFMA 1VBZA 1SJQA 4A8MP 4IFVB 5C5JA 4G1IA 2RQCA 2BR0A 2M0GB 4K4TA 4H4KA 3W2VB 1LOUA 2V4RA 2R7XA 4FF4A 1LWEA 3JSRA 4DSJA 3DOKB 3VZIA 1XBWA 2NPFA 3LAMA 1TV6B 4Q0BA 4XPCA 2QMXA 1C0TB 4NMLA 2Z2LA 3NGKA 3RU0A 3TX8A 2HPUA 3E3XA 1HBUB 4DEZA 1CQNA 2HHSA 3QLHB 2UUTA 3UFCX 4IRCA 2VG5B 1FEEA 4NL5A 3HM9A 3H5XA 1HARA 2LECA 3DRPA 2AQ4A 4JI3F 4NRUA 1F5CA 2KZMA 5A6WA 1OQ3A 2MKJA 1MMLA 4RW8B 1WTFA 1EETB 4PQAA 1P27B 1FERA 4FVMA 1HYSB 3CCES 4MYTA 2JDJA 5CZVA 2FVSA 2EC0A 2SXLA 3BR9A 2VG6B 4MIWA 5IS2A 3F44A 4DV5F 3GFXA 4XDDA 3KLFA 5HLFA 3PX6A 2C28A 1VFJA 2PO4A 4ES2A 4B9SA 4NXNF 4GMKA 4Q5VA 1S7HA 1TL5A 3D1HA 2I2YA 4P6QA 3V6DB 1KN6A 5CA5A 3MMBA 1VRTB 1XTZA 1U8SA 4Y2AA 2J9EA 2PT0A 4KE5A 5D4NA 2KO1A 3OXFA 1FA0A 5DETA 3GIIA 3K5LA 1XEZA 2VBXA 2FY1A 4N47A 1FJ7A 3W2VA 2IC3A 2GQQA 2W24A 4M5DB 2XMUA 4L72B 1OSDA 4HDHA 4DN0A 5F8HA 3PJWA 2QA1A 4CTAB 1L3KA 4IH5A 1LW0B 1LV5A 4RLEA 2RB7A 2C22A 3AJ1A 4C8KA 4HKQA 4LQ3A 2WCXA 4MAKA 2G0CA 4MK7A 1HW9A 4IH6A 4N8NA 5HBMB 4EBDA 4BS2A 4O4GB 2B7CB 4P7TA 3AQOA 3HVAA 5D6GA 3KLGB 2PGCA 3PR5B 2RMLA 3IS9B 3KNGA 4K0KF 1HWUA 2J9CA 3R5DA 2I9SA 3M2RB 1L3VA 3R5BA 2KTQA 1JLCA 2MDAA 3PRDA 5FLXY 3GV8B 4PUOA 4A8XA 3MM5B 3I87A 4I6YA 3BEGB 4O0IA 3OW2R 5E5NA 2AX0A 2UUWA 3DM2B 4PXCA 4QIGA 4FN5A 1SI9A 1YBAA 3DCAA 1X0FA 1Y9OA 2QE5A 2R8IA 3MM7A 1M5KC 3PW0A 4KV8A 5KT2A 2DD8S 4ZA1A 5F8IA 4YQWA 3PZPA 3W2WA 1DHMA 2V8DA 2VG6A 2D41A 1Q78A 2RF2A 3LH2S 5HROA 3MD1A 3M6UA 1JLEA 4ILMA 1YG0A 1KVIA 4WU2A 3MMBB 4OFZA 1RQ0A 3Q8SB 4O3SA 4Z2XA 3CSKA 3PIOQ 3PV8A 2CJQA 4OL8A 1HHTP 1R8BA 2CQIA 4X64F 1TL1A 2DCUB 5LL6d 2KRBA 2F3JA 1FNMA 2XEXA 4NA1A 2XBPA 1NJWA 3CMAS 1OIAA 2XNQA 3LGNA 2ROEA 4NOHA 3U1NA 4ZHRA 2CQBA 5MAOA 5KT4A 4C7QA 3PW4A 3FQLA 4QOTA 3KLGA 3CCTA 2ABYA 5ITHA 4QWAA 4OHYA 2GO8A 2IM0A 3JSBA 3PX4A 2FJVA 1CEZA 2UVWA 2BM0A 1TFWA 3OSNA 3JSMA 3RB6A 2KHCA 3TUIC 4DQSA 2EFPA 1CG2A 4YOEA 5E3QA 2ZE2A 2FLLA 3H4BA 1PC4A 3OTOF 3M9OB 2LMIA 1C4AA 3DC2A 2LKZA 2XY6A 3MM7B 3N9UC 5F8MA 4QR1A 2JWNA 2VB6A 2N7YA 1Y5NB 3I9V9 5DGAA 4JYAF 3DU5A 2FD2A 3KK3A 4EBCA 3KYLA 2HHXA 1F5BA 4EUVA 1HWIA 1HR0F 4DF4A 2YNHB 1FKPB 4JV5F 1VC0A 3HT3A 4BBYA 4PWUA 2WOMB 5T7LB 2IRUA 2R7RA 4ZPBA 1SH2A 3Q22A 4OZNA 3HKZD 3W3SA 1AW0A 3N6NA 1RA6A 1VLYA 1VMBA 3DNCA 1YVFA 4IRKA 4WK3A 1FD8A 2OAUA 3I9ZA 2RD5C 2JJ4D 3PEJA 3GIKA 4DLGA 4AL7A 2VOPA 2J76E 4LF4F 1OPIA 5KFNA 5J2NB 5B0EA 1X4DA 5KG2A 2N3OA 1BC6A 3T5HA 1KHWA 1HBOA 4C11B 5HL7Q 1APSA 1FNOA 3MM9A 2ZHBA 4ICLA 2VZ9A 4ALZA 2W9BA 2Y1RI 4RNNA 1DTQA 3GZ7A 1RT1B 3LALA 3SXLA 1N36F 2J7WA 3SZ2A 4I69A 2F7VA 2IRYA 4R0JA 4DOZA 5KFMA 1N4LA 3OV7A 3MFHA 1HNIB 4E98A 3KLEA 5J1EB 2HRYA 1U1LA 2WONA 3MEDB 5CYQB 1HD1A 2L48A 3V4IA 2E29A 2Z4PA 2CZ4A 3KK3B 2VBWA 1XK8A 1UMJA 2DIVA 2KJVA 1VK3A 3K58A 1FKPA 2OPQB 3PJXA 2UXDF 3IRWP 1G7CB 4HTIA 3DOLA 3SCLE 3OQ2A 4CH0S 2HRUA 2XMJA 2IRXA 3POTB 2IBKA 4WZMA 3DLHA 2XLKA 1FK9B 1BQNB 3FCHA 2MQMA 4DV1F 3H4DA 4J9MA 2C2DA 2CIMA 3OSPA 3M1VB 5MLCV 4X4OA 5G0RA 1KLNA 5KFEA 2CQHA 2J5AA 4H4OB 1HPZA 3TARA 1JLGA 3PW2A 3X3UA 1REVB 2GC8A 1DJ0A 2QYCA 2B4OA 3VAHA 3TNVA 2MKSA 1SJ4P 1G2EA 1YQHA 2Q6BA 2HNDB 2ZFHA 5KFTA 3AQPA 2W7PA 1Q16B 3FFIA 3FEXB 2LEAA 1KHVA 1IUJA 4WJBA 3OL8A 3DU6A 4TQRA 4MKBA 2J7UA 5KFCA 1HNIA 2CVEA 4KGMA 1UVMA 2B7BB 1VQMS 1FF2A 5B0BA 2WONB 2P6TA 3MEDA 5CYQA 2N3LA 1AXQA 3V4IB 1WEYA 1IKYA 2CPEA 3ITHB 1JJ4A 4KHRA 2OPQA 2E1AA 1JNZB 4ECYA 4HTJA 4ZVGA 2MJNA 5DDPC 1WG4A 3V81A 1ZETA 2W4DA 1HA1A 4YY3F 4EO8A 5CYMA 2J9DE 4OJ3A 4F67A 2B5JA 1HWJA 2FUG9 3BSAA 3UPFA 4DQIA 4UY8T 5IWAF 5E7OB 2RDIA 3IG1B 3FSYA 2MJUA 4QYRA 3KLVA 2KN4A 1IQZA 1LFWA 2EBEA 3LP0A 3OPKA 3G8SA 4DV3F 2UV8A 2WBMA 2VL1A 1XR6A 1XN9A 3MAQA 3C6TA 1U47A 2OIHA 4NYZA 3CCJS 2C3UA 4ILRA 5B0FA 1DARA 2UVUA 4I4BA 2KT3A 4I68A 2ROPA 3IRXB 4KO0A 3E01B 2E5JA 2GQ2A 2HQIA 3M30B 3P3DA 2O01C 4C0BA 1S9GA 2P6SA 1N34F 3CCSS 1L3TA 2HFOA 2FGOA 5DDOC 5H1SV 1Q82T 3MMAA 5IQ6A 2KYXA 3N4WA 4X4VA 1FRKA 2OD6A 4QQBA 1W25A 4IG0A 2ZJQQ 1QTMA 1P8GA 1S6PA 2KI2A 2ZH4A 3O1LA 4IQMA 5EWGA 4QPXA 1HHSA 3T19A 1RGVA 4QR2A 5F9LA 1S1XB 3O3LA 4XDCA 3V81B 4NLQA 1TP7A 4X4RA 1Q4RA 1N33F 5CYMB 5H9EJ 1VC6A 1URNA 1Q7LB 1JLFA 1D8ZA 2OLWA 3AH6A 1OQ6A 3QO9B 4I1TA 4JV0A 4B9UA 4MJKA 2VONA 2DRBA 3H8YA 1U7LA 2JOQA 2OPPB 3C2PA 1VQ8S 2OP5A 3PW5A 1NKCA 2RSQA 4Y34A 4V19X 4QIEA 1HBNB 1U24A 6FD1A 4AQYF 1TKZB 2B56A 2MZJA 3MEKA 2ZNZA 3WX4A 4ZKAA 5EN1A 1RTJA 3UW1A 2DGUA 2HMIB 2GO9A 3IAM9 3C6TB 3D2WA 3KJVA 4Q2LA 3RB0A 5SUHA 5L9XA 1X9SA 5KAKA 5DGBA 5I42B 4ELUA 2HNZA 1F2GA 1YRXA 4Q44A 3IRXA 4KO0B