4A48A

Crosstalk between cu(i) and zn(ii) homeostasis
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
66
Chain Sequence
AQTINLQLEGMDCTSCASSIERAIAKVPGVQSCQVNFALEQAVVSYHTPQILTDAVERAGYHARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE COPPER-TRANSPORTING ATPASE PACS
publication title Investigating the Role of Zinc and Copper Binding Motifs of Trafficking Sites in the Cyanobacterium Synechocystis Pcc 6803.
pubmed doi rcsb
source organism Synechocystis
molecule tags Transport protein
total genus 20
structure length 66
sequence length 69
chains with identical sequence B
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2011-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4a48A00
1R6YA 2GCFA 2XMKA 1KVIA 3HF5A 1ULRA 2L3MA 1TR0A 2BJDA 2RSQA 3DXSX 3KKFA 5B0FA 5IXUA 1YJRA 2K7JA 2IYIA 3VTIA 1Q4RA 1MWYA 2OFGX 4A4JA 1V3ZA 5B08A 1QUPA 1LQ9A 2FIUA 4HL9A 2VH7A 3BF4A 3BM7A 1Q8BA 3HFKA 5K9FA 1KVJA 4YEAA 4A46A 1FE4A 2W4CA 2IYGA 4Q2MA 2JDJA 3HHLD 1FVSA 2HFNA 1FESA 3BGUA 2OP5A 1KQKA 1K0VA 3IWXA 1OPZA 4Y2KA 2HFOA 2G9OA 1AFJA 4ZA1A 3QGPA 4A48A 4A47A 4U9RA 3WDOA 1SI9A 1RJJA 2KT2A 2VV5A 3QMQA 2N7YA 4OJHA 5KAKA 1TUVA 2OD4A 2ROPA 3FMBA 1OQ6A 5B0BA 2QIFA 2ZDPA 2OAUA 2XMMA 3BB5A 4NPOA 4ZOSA 5A6WA 4F67A 1APSA 2FTRA 1TL5A 1S6UA 2AJ0A 2HIQA 2KT3A 3HHLC 3LGNA 1Y3JA 3LGMA 1S6OA 2FB0A 1GXUA 2QYCA 1X7VA 3DCAA 3I9ZA 1N5VA 2AP6A 4NL5A 1Q53A 2BJEA 4OJ3A 3IWLA 2ROGA 2ROEA 4OIXA 5F0WA 2XMWA 4DL0C 2BUNA 1JWWA 2ZDOA 1VQSA 2K1RA 3HHLA 2OMOA 4OJGA 1TL4A 3HDSA 3LO3A 2N4CA 1IUJA 2OKQA 3UDCA 2W4DA 4DN9A 2N4DA 2K1RB 3GZ7A 1URRA 2QLWA 4FNHA 3HHLB 4HH0A 3BR8A 5F0UA 1P6TA 1X8DA 5B0DA 4Y2MA 1FE0A 1VQYA 1X0PA 1TZ0A 2EW9A 1FEEA 1GXTA 2GGPA 2HLTA 2BYCA 1CC7A 2LXFA 1CC8A 2XMUA 2LDIA 4EFAC 3MCSA 4HH1A 2PD1A 2LQ9A 1YJTA 2RU9A 5T7LA 2GGPB 2HLUA 2RMLA 1AFIA 2AJ1A 1Q8LA 3TNVA 2K7KA 2PGCA 1CPZA 2ACYA 3HX9A 1YRXA 3F44A 2IFXA 2GFFA 5T7LB 4YDXA 1YJVA 2XMJA 3KG0A 4OJ1A 3E8OA 3CJKA 2QLXA 1YG0A 1N5QA 2OD6A 4Q2LA 1N5SA 3BDEA 1XBWA 3FRYA 4HI2A 2Q3PA 1OSDA 1SQEA 1YJUA 1U7LA 3CJKB 4DPOA 1AW0A 2XMTA 1Y3KA 1SB6A 3BN7A 1MWZA 4HI1A 2BBEA 2GV1A 3T9NA 2W4PA 2HQIA 5B0GA 1N5TA 1OQ3A 3KG1A 1WD6A 3FGVA 5B0EA 1Y9OA 5B09A 5B0CA 3KNGA 2FHMA 2OFHX 1FD8A 2KKHA 3K7RA 1W2IA 2K2PA 1Y0HA 2LQBA 2RILA 3MZIA 2GO8A 2KYZA 2XMVA 2AW0A 2CRLA 4QOTA 4Y2IA 5A6PA 3TOQA 1FVQA 1P8GA 1JK9B 2ASYA 5B0AA 4FNIA 2GA7A 3TRGA
chains in the Genus database with same CATH superfamily
2QSWA 2YWFA 1RK8A 1ZM4A 2ALYB 1YIJS 1TL3B 3HCXA 4B3SF 3GYNA 4BLGA 3JTNA 3RBZA 2FVCA 3VZHA 3JB9k 1HI0P 1AFJA 4JV0A 1NK5A 4LRCA 4F2SA 3R2CJ 3WDOA 3V6KA 1TELA 2H9ZA 3BB5A 1X7VA 2CAJA 2J7UA 4LRFA 3TUPA 2KT5A 5E3PA 1JKHA 1KRPA 4P10A 2NUHA 5CCMA 3DLLQ 1ZA2B 1VLOA 4AQYJ 2P6TA 3K0JA 5IZHA 3BSOA 5JXSA 3R5AA 1RWKB 5LJ5Y 1GMWA 3CJTA 3MM6A 1W25A 2JOQA 3BDEA 1TL1B 4J9QA 3WC0A 3PYFA 4CM2A 2HBYB 4ES1A 2DGWA 5L9NA 3ENWA 3NGKA 2ZH3A 3GG0A 4BCAA 3TOQA 3PKMA 1SPBP 4EO6A 2Z2ZA 3UD5A 4ZLNA 3M2VA 3THTA 2HNDB 5THWA 3HHNB 1T9WA 4ECSA 1U02A 2Q79A 1ZBTA 4ZHRA 1K44A 4JV1A 2RIJA 1DARA 4FYYB 2W2PP 1R27B 3I9ZA 1HBMB 2G2YA 4CTAB 1YBUA 2NPIA 3JQKA 3R5JB 3K89A 5AE1A 2C2DA 2OI2A 3P4UB 4L76A 3T1HJ 3KG4A 4NEZA 3GV5B 2SXLA 4K2XA 2C3PA 2KXNB 3HXMA 2EFVA 5HMYA 2RF2A 1N8RT 1WG1A 3HD1A 1QJHA 1C4CA 2IFXA 3U1MA 4DPTA 3M8WA 2HGNA 2MQLA 2Q3PA 3NCPA 1RDRA 2PT0A 3CDAA 2R2SA 2W2MP 3PCOB 3W66A 2JEFA 5B0GA 4IH5A 1RWPB 1YJNS 3MM9A 3K5MA 2HFVA 2HVIA 4I56A 1XK8A 3FEYB 5B0FA 3PZPA 3V6DB 3KLEB 3VZIA 4HR2A 5HANA 1XR6A 3EZUA 5IFMA 3UD3P 5ETNA 5A8KA 4DF8A 5L9XA 3DRSA 1S1XB 4DR2F 4ZA1A 2J9DA 4DF4A 1NB2A 2AP6A 1SC4B 3DLGB 5KFYA 1YI2S 2R7RA 2J9CA 2RKIB 4P75A 5D0EA 5K14A 2NS1B 1N4LA 2BW7A 1EQMA 2BA9A 4C3LA 1FWLA 2VBXA 2RH3A 2V8VA 4J9NA 4NLGA 2R8JA 1U1MA 4I2QA 3UD4P 2CJYB 4FVCA 2OPPA 1VQMS 1U24A 3BJYA 3AA8A 1U7LA 3M4XA 3CJKB 1GMUA 2VC0A 3K8VA 4RW7B 3KNGA 1SC6A 2LQBA 3RW7A 3GFHA 2UUBF 1F60B 4PXCA 3TRGA 4DL3A 3MF5A 1S77D 2YY3A 2HZCA 3HFKA 5J2QB 1GAOA 3V6JA 1LWFA 3ZC4A 4F2RA 4DQSA 3OVAA 3DM2B 4OX8A 5E3AA 1KQKA 3C19A 2M9KA 3E01B 3CCQS 1Z2LA 3KLGA 1JLCB 4DL5A 1JLQA 4HACB 2I5JB 3R9LA 3EZOA 5MLCV 3LGNA 3V81B 2HMIA 3HMJG 4F4ZA 4AUKA 1LFPA 4ED7A 1UW4A 3RRKA 4Y00A 1YSJA 3M2RB 4P6QA 4KPYA 2XG8A 2N4CA 1RWNB 3G2XA 3VQSA 4B9VA 4TYAA 1D8ZA 4ES2A 1S12A 5HQMA 3H8YA 4NA1A 2K3KA 1EQ0A 4K4SA 2PGCA 4P7TA 4JYAJ 2EG1A 2D7SA 2HVHA 3RAMA 2YKOA 4URQU 1S1TA 1NU4A 1FD8A 1ZTWA 2W7PA 1Y0HA 1UFWA 4OZJA 2UUCJ 4ED5A 4V19J 2UP1A 5IT4A 3ZZYA 2CNNB 4G3IA 3JTPA 2FUG9 4O3NA 4RBVA 2MKKA 1Q4RA 4ECZA 1M1HA 3B4MA 1VRTB 4DV6J 4QYZK 2DBBA 3A12A 3DLBA 3BKTA 4CH7A 3ILOA 2BE2B 1RTDB 1NNDA 3FEXB 4ER8A 4NYPA 5LM7E 3B54A 4C7QA 1WSVA 1QDUB 1N54B 4KYZA 2V69A 1RU2A 3WX8A 2HNZB 2UUWA 2WAQD 1RHMB 3Q8VA 1ZPVA 1X0PA 4ZP8A 3DMJA 2KZZA 2E7WA 4FS2A 3PRBA 2HBZB 1UEKA 3Q2SC 1YTYA 3BQ2A 1MN7A 3R5CA 4HI1A 1BC6A 1VRQC 4HDGA 5RUBA 1JLFA 2BABA 3LP2A 3MUMP 1NXIA 1P8GA 1IKXA 2XMKA 3BYPA 3DXSX 2NSCA 4C6AA 4RO0A 4P2SA 2Y1LB 1HQUB 2IYGA 2Z30B 1UL3A 3TVYA 1D9FA 3HVWA 1T11A 2XMMA 2CUYA 4ZITA 1YRTA 1AXQA 4LF8J 1DLOA 3ISNC 1T0TV 3VQTA 4MMOA 4LFBJ 4G1IA 2MQQA 4USMA 4FF4A 2AGOA 2XZDB 4U67Q 3A4TA 4K4VA 4NLWA 4C8OA 1LWCA 1PIEA 7FD1A 4CQ1A 4USIA 3PJWA 1ZZFA 4EGLA 2OGUA 1VQ5S 1RZMA 3UCZP 4GVBA 3KMQA 1MNEA 3PO5A 4WK3A 4J7CA 1TK5A 1ZOTA 1HHSA 4X4QA 1VK8A 4NLOA 2HBQB 1OSCA 2HGMA 1T8EA 2KZMA 4M5JA 1F9HA 2I1RA 4FNIA 1QM9A 1WSRA 3CJ4A 3CF5Q 3VGVA 4DG1B 4F4AA 1KC8T 2WB4A 4GKKF 2AEFA 1RT4B 2DJWA 3PX6A 2IMOA 1H2UX 2CQ3A 2MSSA 3CJ3A 2VD3A 1T05B 2WW4A 1IKWA 5CYJA 2W2NP 3SFGA 3UDEA 4OMFG 4F7VA 3D4JA 2CPHA 2ZDPA 3NNAA 1T9YA 5DJBA 2JFKA 4YHHF 3A8JA 3QJJA 1H73A 3DKDA 5K8MA 4KHMA 4U6PA 4WCEQ 2C2KB 2QLWA 3P96A 2PFFB 4NX9A 2OPQB 3T6BA 3R1HA 3H0PA 5H1SV 1FRHA 2ACYA 4I67A 4WK1A 4OJ1A 3GWCA 2XSJA 2WONA 2RS2A 4NLSA 2R8IA 3I31A 2HW3A 4M5MA 3MEGA 1U1QA 3KUGA 4RUBA 1KKHA 3FEZA 4IFVA 2XMVA 4XIUA 1Y4ZB 2M8HA 4PWDB 5GAEU 4WWSA 2XWXA 1RTHB 5CCLA 3KJNB 2OO4A 1MWYA 2Z2MA 2DISA 4IG0B 2HBRB 5F41A 4OX6A 1PC4A 2HRUA 1AB8A 3FKBA 3IRXB 3MEKA 4RL1A 2CQCA 3D0IE 3HPOA 2ZITA 3TANA 2VKZG 1JB0C 4RW8A 4DR5J 3RTVA 4OYAA 5FDLB 5KAKA 1TKDA 1MW7A 2EFNA 5B0BA 2ZBCA 3J80U 1LW2A 2YPYA 1YBTA 2ROGA 1SJFA 2I0XA 4CO5A 4MIWA 2ZJRQ 4JI2J 2W4DA 1JXEA 1SKUB 2J0WA 3D68A 4HH0A 3CO0P 2WBRA 2HZAA 2N3LA 3KNAA 1D8YA 3IA0A 4JI0F 1VCTA 5KT7A 2J6SA 3C66A 1VDHA 1ZH5A 3G6VA 1YG0A 2WBMA 3UQSA 1YJUA 1S6QB 3G96A 1KHWA 3MUVP 2W4PA 3JQMA 3W62A 3RYLA 2ZOFA 4LREA 2Z58B 4AQYF 2CZ9A 5CYMB 3DRPA 5D3GA 5HP1A 1YJ9S 2GJIA 2B4OA 3CTRA 3DOLB 4DBQA 3KKFA 2QG9B 4X4SA 5SUHA 2ZFHA 1S76D 4KBIA 2W7OA 2MSTA 1KTVA 1T03B 3VWSA 4CLKA 5CYMA 3KK2A 4J9MA 4ZS6A 1U47A 2ZHOA 3SCJE 3IS9B 1JLGB 1RT2B 1QAYA 2AD9A 2OH2A 2YNFB 2ZC4A 3PR5B 1Q7LB 2QYGA 2Z4PA 1REVB 1VYAA 1RT3A 5K20B 2QMUB 4KQZA 3RR7A 2MHEA 4U8VA 2B51A 3FZBA 3MOJB 3GTYX 3M30A 1SBRA 2MLXA 2DRDA 1AFIA 1RHJB 2VUGA 1TKXA 3VV2B 3OR1B 2DNMA 2LDYA 2PI4A 1TUGB 3RZAA 3R1LA 3GIIA 1U2CA 1K8AT 2G13A 2R7QA 4W4MA 4RBTA 2FLNA 2MJNA 2F1FA 2RQMA 3G6XA 2OFHX 2VA2A 2LU2A 4B9TA 1QAXA 2HWHA 2AJ2A 2E9TA 4D3HA 5FIIA 1ZA1B 1LW0B 2GMLA 2F4FA 3OHBA 1NDKA 4X65F 3MURP 2DVIA 1XR5A 2NZ4A 3HFVA 2HHXA 2CQ2A 3PTWA 4A48A 1UPMB 4OJHA 4N8OA 2BJ8A 5L1LA 1KQGB 4B02A 3GR1A 4DCOB 3MTKA 3QBCA 1X4DA 1X4EA 1B99A 3KDNA 2M2BA 2OKQA 2PO4A 1SQGA 2ALZA 3GQCA 1XR7A 2GHWA 2V2QA 3W3SA 3B78A 5A0YA 1HYSB 1ZYQA 2GGPB 2CVIA 5KFOA 6FDRA 4ZPDA 3NNCA 2U1AA 5D8HB 1PO6A 3CJ5A 1SB6A 1SXLA 1DY3A 3GYGA 3MEEA 4E8UA 1DURA 4H4OA 3NAHA 4X4VA 4WP8A 4PYAA 2V8HA 3RB4A 3SIPB 2MY7A 3V5RA 4OZ5A 4DV4J 2AIRB 2K7JA 4R8UA 4WBFA 1X9SA 1BQNB 2YVSA 4OHVA 3R97A 3GCWP 4ZPWR 1S72S 1GT8A 1TV6B 1Q16B 2MPUA 1RJJA 2AYEA 2OD4A 5ETTA 4NPOA 4ZOSA 4NL5A 4OJ3A 1RAHB 5IOLA 4IFYA 2C3OA 4OV6A 5CQGA 2OPSA 2R7VA 9ATCB 1F6TA 2JFDA 3DLEA 5E0OA 1TK0A 2Z56B 4CLWA 2D3ZA 4EO8A 5KT5A 3M8PA 1E6YA 4PXDA 3S6EA 4N7TA 4JI4J 3JQJA 2VG7B 4LBPA 1Y00A 1U2FA 3PFOA 1FKAF 5A8RB 4CYUB 3BGRA 5I3UB 4J9RA 3FK4A 4PPZA 2QL9B 1M5VC 1YQHA 4PXEA 2UVRA 3W5YA 1Y11A 4KSEB 1Y3KA 3KLHA 4KH1B 4ICLB 1W2IA 5A6PA 1TKZB 2CIMA 4UY8T 4CLFA 2GA7A 1H2TZ 2A6MA 3I0RB 4JYAF 3EGWB 2CKWA 1UZHA 1HL6A 1WHWA 4LFCF 5JVHQ 4AFFA 1RWMB 3F41A 3NS5A 2UUCF 3M05A 4UQGA 3U02A 1SVDA 3CVKA 3TEHB 5DRKA 2BANA 2GMHA 4DX7A 3PW2A 2DR9A 2GIRA 1BQXA 3CD6S 1Q8IA 5D4PA 1F9FA 3FUYA 5JMNA 2EW9A 3W2WA 4UQTA 5EWEA 1HI8A 5L8RC 1SH3A 4LQ9A 2DD8S 1X5PA 1L3TA 3MM7B 3D3CJ 3LUYA 4KO0A 1CJKA 1FK9B 5LSOA 3U1NA 2COLA 4KHPF 2ILZA 2CRLA 2UVWA 1UPPA 4WFAQ 3ZZUA 2KRRA 1YZ6A 2GCFA 3AY0A 2RSQA 3LTOA 1VBYA 2PEBA 2HQFA 3UNGC 4H4MA 2J0XA 3N0VA 1N48A 3PO4A 1VS3A 2B0GA 5CYQA 1KR4A 3T5KA 1QTNB 1S79A 1NK0A 2QJ3A 1NKCA 4HYKA 3HO1A 4FYVB 5EX0A 3MPUB 1NSKL 1P6TA 3NGSA 3NWGA 3PRDA 1O6XA 3QGIA 1BQMA 4CLUA 4MT1A 3IP0A 2VASA 4WFNQ 4LF8F 2XMJA 4PG4A 4LFBF 1CJUA 1VRUA 3CE8A 2YNHA 1MWZA 1SL2A 1SC3B 3ZZTA 2CA9A 6AT1B 3CCZA 1EKSA 2C28A 4EU0A 4M63A 4LVNP 3RB3A 4KJIA 4XPCA 3HF5A 2RDDA 3C6TA 4A4JA 4C0BA 1Q8KA 3AOCA 1OJ4A 2RUSA 3CGIA 2V67A 1FNMA 2HRTA 4LR8A 2ABYA 3VAHA 1QAIA 3LP0B 4BWMA 1IWGA 1F2HA 3N6NA 1JXLA 4M1KA 2PC6A 2LEPA 2MZJA 3H5XA 4KGZB 4OIXA 1U0HA 5L38A 1KLMA 1S1UB 3KK3A 4TQSA 4IR9A 2XGQA 3UE2A 1FXLA 4CO1A 2K1RB 3GP9A 2QRRA 4F0HA 2XSFA 2ZVIA 3O1LA 4EUVA 3HT0A 2M70A 4DLGA 2PE8A 2Q66A 2PFDA 3K57A 3MAQA 3TJ8A 3KK1A 3V4IA 1GNKA 4TU9A 4J90A 4NLXA 1PYTA 2OD6A 2WZ1A 4ECRA 2MJUA 5EHHA 5BYRA 1WDTA 2EEYA 4LBIA 4ECQA 3AD9C 2V2KA 4YB6A 3IBCB 5I42A 1S1VB 2BKNA 2R7WA 5DGAA 3RUBL 1GQEA 5B0AA 2XWYA 3D7SB 3FBEA 1RT6A 3W5ZA 4ZP6A 2BQUA 2DEJA 2OMLA 4O4RA 2W25A 3AD7C 2DPIA 3RBDA 5JVGQ 2DGVA 1KS2A 3D6MB 4CWBA 3NKYA 5C25B 1FJGJ 4N41A 2UXBJ 4O4GB 2MGZA 5GADU 5DDRC 3H4DA 2N7YA 4KGMA 2XI2A 2CWXA 3CCLS 2HHUA 2C3UA 1U4BA 1WKLA 4KKOA 1IJEB 1HBNA 3OJSA 4LIRA 1YLXA 1DQ9A 1C0TA 4Y2MA 4FS1A 4F3OA 5EUHA 3GJSB 1CC7A 1NDLA 2YQ1A 3LWLA 2UXCJ 2V6AA 4RWXA 2IC3A 4QJVA 2DRAA 2O66A 2MKSA 2W9BB 3ET6B 2VPYB 1SIWB 7FDRA 8RUCA 4DR7J 2B5JB 1A0OB 1LWXA 5F8MA 5J2MA 4ILMA 4DJBA 2IM2A 3G71S 2GIFA 3CJ0A 1N5YB 1FT8A 4DUZF 3VTIA 5IV4A 2XS2A 2E7XA 4DPWA 4OYBA 2QLFB 3CWJA 5D4NA 2KJWA 2WB1D 1M5HA 5ETPA 4X4NA 2IDEA 2F8HA 1UETA 2GW8A 2VV5A 3X3UA 2UVUA 4OL8A 1VQ8S 1NJYA 1U1LA 4QZVB 1K1QA 1KWMA 1R3NA 5F8LA 5D4LA 4RW6B 2BXJA 4HEA9 3HSGA 2IY5B 1YBAA 1HR0J 2EFGA 5CZVA 1G4CA 2DPJA 2L9DA 1N34J 3A3OB 3GONA 3I9V9 1WC5A 4CT9A 4Q2LA 4LSZB 1P1TA 2ASJA 4DV2J 1OIAA 2Y8YA 5J1NA 2DR6A 4ID5B 2MLYA 2X1FA 5ETMA 3CD5A 5B7WA 2OSQA 4NOHA 3DXBA 4C98A 3LAKA 1N6QA 5D15A 3B8HA 1OO0B 3G86A 3KXDA 4DCJB 2VU5A 3BBCA 1X4HA 1RHQB 2JLFA 4PZVA 1FJEB 1FESA 1X4FA 3TAQA 4DPXA 1FRJA 4LF4F 2HFOA 4IUFA 2YNIB 1J2VA 5KFPA 5KG5A 1OQ6A 2EC0A 3UNYA 1CEZA 2GVDB 2ACMA 4DUYF 4NCGA 2F8EX 4TN2A 1SV5B 5HROA 2X3GA 2K06A 4XDCA 2NXUA 1IBKJ 2XGPA 3L7OA 1ITPA 3HZGA 3M1VA 3RRGA 5LMNJ 4B3OA 4CIOA 2P6SA 4OI3A 5L39A 1CJVA 2YX4A 1RBAA 3GJRB 3JSBA 1N32J 1OQ3A 3K7RA 8ATCB 4TKTA 2AW0A 1VQNS 2D74B 4DUTA 2NLWA 4IR1A 4I6AA 1NZAA 3DOKB 2RE1A 3RG6A 4BBYA 5F8HA 4KRWA 3R27A 3HFZB 4WU2A 3GE9A 1U0SA 1EETB 3G87A 3PXGa 2G9OA 2ZD1A 1NHVA 1FEHA 3G9CA 1WC6A 3MM8B 3RGIA 4CLLA 2AJ0A 2FB0A 3MMAB 4DV4F 5HBMB 4CLYA 2AU0A 4DL0C 1RT5A 1SJRA 1TVRA 2WOMB 7AT1B 5ETRA 1T02A 2LMIA 5IM0B 4ZIVA 2A6OA 3C3LA 1FE0A 4QQBA 3DYAB 1JJCB 3CCSS 5H9EJ 4RW4B 3LANA 3OSPA 2VQFJ 1HNWJ 1IQTA 3FVYA 4JI6J 1TTHB 1JJHA 1MROB 2CQIA 3THPA 2E1RA 2MKIA 3KJQB 5E7OB 1YGYA 3I56S 1U1RA 4A8SA 2WVDA 1QY7A 3JSMB 1NKEA 1D1UA 1OYEA 3SDEB 1L3VA 3FZ2A 5ETKA 4GMKA 1NH7A 4I7FB 4K8RA 1WORA 3CCWA 1J5OB 4JI4F 3OUYB 4NI2B 2DK2A 1VC0A 4FYWB 1FWKA 5LOQA 1I94J 2OELA 4YQWA 2EBGA 3RJMB 3LP1A 3CSKA 3G8TA 2B4VA 3N28A 2D3OR 3BGUA 4LQ3A 3NL0A 1UMJA 2ZEJA 4DR1J 5CH7B 3ICLA 3T9ZA 2DXFA 4ZLJA 5IT0A 1JLAB 4JUZA 3W5XA 2FTRA 2Q6CA 4LF6F 1LK7A 5KFEA 1NDPA 1DFDA 5KFUA 3D0HE 5E33A 1MU2B 4Y3CA 3CCES 1OS5A 4OFZA 1CJTA 3QIPB 3DLKB 3ZZRA 3QRRA 1YX2A 3M2UB 3AXKA 4N5SA 1AUSL 5EX3A 3IXQA 3ZXWA 2BOPA 3QWPA 1HNXJ 4WIQA 3QGGA 3MAAA 4A8OA 3PACA 1RA7A 4PUOB 1CULB 5KG2A 3FGVA 3DHWC 1XTZA 3KLIA 1TL7A 2GO9A 1B3TA 2QA2A 1T9VA 2W9CB 4KT0C 4MKYA 5IQQA 2B56A 2VONA 1RTIA 1KVJA 5J1EA 3PG9A 4JOUA 4X66J 4ZLPA 4GKJF 4QPXA 1WHYA 4F4XA 3EZ5A 5K8PA 1DQAA 5C7PA 1RYSA 2GX8A 4K59A 3RW6A 3B82A 3QZ7A 2Q1LA 3IR6B 4X64F 2YX1A 4NLYA 2VBZA 3RR8A 1R0AB 1S1WA 4OX9F 3MECA 3FCWA 2BJ3A 1RAOA 3W64A 3PYEA 2GFFA 2POKA 1BWVA 4HHHA 2UVVA 4AXJA 1TKTB 2DHAA 1DTTA 4R5PB 2QTWA 4ZVEA 4DPOA 1AW0A 5F3TA 3SMZA 2BBEA 2QA4G 3UN3A 3A1YG 3VAKA 2Y8WA 3TVKA 4ED3A 3LALA 3IRWP 1F9EB 1R8BA 3SQGB 2HGLA 2D3UA 2UV8G 4F4KA 3MGJA 3OD2A 3EGVA 4ED1A 2YWHA 2VPWB 3B4DA 3MMCA 2VOOA 3KUEA 1TUVA 4DL4A 1C1CA 4J37A 4NWBA 1Q53A 4B17A 5GVQA 4BWJA 4OLOA 1F0XA 2DHGA 2HFUA 1TL4A 3BR8A 3VHQA 4I1TA 3M8QB 2MZQA 4EK2A 2XY5A 4C4WA 1IWAA 1ZTTA 1Y7PA 2C3YA 2W01A 2FC8A 3J81U 1WTFA 5KG3A 1HQ2A 5K8OA 3LH2S 1UCNA 4FKYA 3D6HB 1H74A 3D67A 4PKDB 3AAWB 4Q43A 4PAAA 1IQZA 2EI5A 3MXHP 2BMBA 3MR2A 1NK4A 1ZS6A 4YR3A 3EJMA 3WIUA 3CMAS 4FF3A 4ECXA 2LFVA 5IWAF 2IVMA 1NJZA 3H5YA 3GIJA 3VAGA 1Q7YT 2PEHA 1PJ5A 3Q8UA 4QR0A 2ILYA 3UDLA 3P3DA 1S6PB 4ZCIA 1FJGF 4IOBA 3Q8YA 1SJ3P 1UWAA 4ZPBA 3UVJA 3MD1A 4J91A 1UEVA 2CQ4A 3W9JA 5LMUJ 3EDRB 3T5HA 1RHUB 5IC6B 3AD8C 4JBCA 3KUHA 2VB6A 3NBPB 3HJVA 4F4YA 4YB5A 4B3MF 2OTLS 1B7FA 4FKXA 2LLZA 4JP8A 3IO1A 1C4AA 3JSYA 1FXRA 2JSXA 3M6VA 1R89A 4FPRA 1S9GB 3AH6A 1O8BA 3C15A 1AZSA 4NRUA 3TW0A 3IWXA 5A8WA 3ISND 1JLBA 1NKBA 3D1QA 1UA0A 2FJDB 2OLWA 1FI4A 2V8DA 4PG8A 2DO0A 1HNIB 2UUBJ 1HWJA 2ROEA 2H48B 2JLGA 2N3OA 2HK3A 4FN5A 1WF0A 9RUBA 4DV5F 2GVZA 4QYRA 4HVZA 3O44A 3M9OB 3NGUA 3HKZD 4RNFA 3W9HA 1XWLA 4TU8A 3ENVA 1HPZA 1WELA 1M5SA 1KOOA 5I3QA 3TUIC 3MMBB 4DOZA 2A2DA 1X31C 1LK5A 3I5AA 1VQ9S 4GRSA 3Q8PB 4J9VA 2GQCA 5BJRA 3OVSA 2AJFE 2FIUA 4HL9A 1Q8BA 5HMWA 4HTIA 2JZ5A 4IOAQ 1UWBB 3N4WA 3M8SA 1N0VC 3DI6B 3BS9A 2E29A 1CQMA 3WIVA 1RT7A 3TZZA 3TO8A 1RE1B 4HTJA 3OTOJ 2ZBQA 1RSCA 1T9TA 1IKVA 4N8NA 1UVJA 3ELHA 3AHPA 4ILRA 5HVGA 3R7NB 3PJ9A 2Z57B 2W7AA 2CDRB 3IFEA 1NJXA 4FF1A 4ZVOB 4IOCQ 2UV8A 2RQKA 4FYXB 5J1PA 3N6LA 5KOXA 3N9UC 3H4BA 3FRYA 3L95X 5M2RA 3NAIA 1CBKA 1HMVA 1WKKA 2KKHA 1AYEA 4F04B 4FYDA 4DSFA 1NPPA 5DETA 4WE1A 2IDLA 1WOOA 1BGXT 2YKNB 2CPEA 5LMNF 2L3MA 5AXLA 4P2MA 4D3GA 5HQLA 1J27A 3MM5A 1V3ZA 1WACA 2J76E 2FZCB 3C6UB 1JX4A 2E5JA 1OPIA 4PQUB 2ZH8A 2QIFA 5F8GA 3QLHB 4ZDNA 2HIQA 2W24A 4R0JA 3U27A 1YHQS 2L41A 2V4JA 4YUDA 2ZDOA 3ZNUA 3GV7B 2IRUA 3HHLA 3HDSA 4QPTA 2N4DA 5C42B 1B70B 3FFIB 5C2CA 2A0FB 4DI6A 1Q95G 3VGUA 2CQDA 4Y6IA 4C11A 1YJVA 2HQCA 2O1PA 2N82B 3FBBA 4XK8C 1WOSA 3TJAA 1SQEA 2KFZA 2ZWPA 1FKPA 2A18A 4UOHA 2RDJA 1JMTA 1V5VA 4IDKB 3IG1A 3KDOA 3IBFB 1H72C 3BSAA 1LXNA 1QVGR 4I64A 5D0HA 4C9DA 2YNGB 2XLKA 2RU3A 3ZZ0A 3OVBA 2QMXA 1HNWF 3RBEA 4U95A 4NYZA 4JI6F 3UO0A 2N7CA 1ZAWA 4ES3A 4QBUA 2WSCC 1IKYB 2VBYA 3W9IA 2L48A 3RU0A 3IMQJ 5E5NA 1RAEB 1HA1A 3D1HA 5AXNA 4TQRA 4UZBA 1WTBA 1UFKA 2DH7A 2I9SA 1I94F 2OMOA 4KY3A 1FX4A 2R7OA 1NZ8A 3EWGA 3WC2A 2F4VF 1TZ0A 2XC9A 2RHQB 3KWMA 4ZVUB 1VC6A 3DRRA 2QT7A 4KC5A 2F8MA 3NCRA 4YHHJ 3ITHB 1HQEB 2YKMB 5ETVA 4WIIA 5KG4A 1WEZA 2NXJA 1KN6A 2G0CA 4DX8H 2EKNA 3MZIA 2CJ9A 4L73A 2HFZA 4Q44A 2CADA 3NWRA 2HYIB 3D54A 1RT1B 4MKBA 1HNXF 3HK2A 4WTOB 3GLJA 2D9OA 4DR3F 2XHCA 1KFSA 1RTJB 1YJWS 3QZ8A 2FHJD 4U9RA 4NLUA 4OZ3A 4CNZA 1S57A 2WW8A 3CO9A 2LCWA 1NPRA 2CQGA 1GXUA 2GNKA 2KFYA 4KR0B 4AD6A 4ZPTR 3SCIE 5AE3A 1HW8A 4QW9A 3UDCA 3KYLA 4I2PB 2R4FA 3AJ1A 4X66F 3OT9A 1WHXA 2RRAA 3CD0A 2NSBA 3GMGA 4M5DA 1M5PC 1IXKA 3ILIA 3LOUA 1X4CA 1NK6A 2HNYA 2CG8A 1IBLF 2LP4A 3L9ZA 3HZEA 2RVJA 4Q0BB 2F9DA 2OEMA 3D1OA 3KG0A 2BE7D 2ATLA 1XJWB 4PYDA 4IG3B 4B9NA 5KG1A 3TUZC 4OYMA 3NRBA 2ASLA 1NJIT 4OI6A 1FVQA 1U1OA 3CULA 4K5SA 1R6YA 5HK4A 1WF2A 2BJDA 4JI0J 1TL3A 2VKRA 2ZJQQ 3QJLA 3E51A 3FQLA 1GEHA 2IAJB 4ITSA 2DCLA 1NK8A 4OHYA 3BQ0A 3EE3A 3GSDA 3H5UA 3PFEA 2Q43A 3MR6A 3WQPA 2RJZA 4RKUC 6FD1A 1Q81T 3H98A 3G82B 3PY8A 1N5VA 4G1PA 1FX2A 3Q23A 2YQ0A 1NDCA 4IKAA 4ZKAA 2KB2A 4NXMF 1IBMJ 3BYRA 2JEJA 4C97A 1GMVA 4OI4A 2WVFA 2I2YA 2VG5B 3J81j 2OHDA 3UCGA 2CQBA 2RU9A 3T41A 4MKAA 3OFHA 2J6UA 1OYDA 3MI7X 3CC2S 2XHWA 2P9CA 1D09B 1TL1A 1N88A 1GX6A 5E3CA 1RABB 3LW5C 3FRZA 1WC3A 3EDQB 3K8WA 2FJEB 4F4WA 1RI7A 4LF5F 4RJVA 4M5IA 2O67A 1V5IB 4DL6A 1FRKA 4MIAA 1I5OB 2X51A 4LJMA 4EBEA 2HNDA 3DNCA 2VG6B 4NXNF 4G1QB 2VJUA 1FA0A 4NRTA 1WHVA 2ZNYA 4USUA 1L3UA 1Q79A 4LT6A 2X1AA 1K0VA 5G0RB 5GAGI 2YWEA 2OPRB 4TLQA 5H9FJ 3QGPA 1QVFR 1HBMA 3HVTB 2HURA 4CTAA 2KRBA 2QYCA 1JNZB 1FFWB 1RYRA 1LWEB 3QAUA 4C8LA 2BUNA 3CMQA 1H2VZ 1IUJA 3QFHA 5C24B 1X0FA 4X65J 3T3FA 3C14B 4USVA 4DSLA 1P9QC 3GIMA 5AJ3J 3QAEA 3PHEA 4FXWA 4UF4A 1C0UB 2I6WA 2C42A 3QT8A 4JI5F 3BN7A 4KV8B 5B09A 5KG7A 3H25A 1S0NA 4MKVA 3H40A 2EWHA 2OIHA 3V6DA 3KLEA 2ZZNA 2WHOA 3D5MA 3WBZA 4KTQA 2IYIA 4NZ6A 3KMSA 5LMUF 3C8YA 3BBBA 3TAPA 4DSIA 2XY7A 1S1XA 2DNRA 3MMJA 2JNJA 3I96A 1H7WA 5KT3A 4E2FB 1JLEB 1TAQA 5T41A 2VL1A 3DLGA 3SBMA 1TU0B 4HT5A 4C8ZA 2ZJPQ 2M3DA 2RKIA 3PYDA 3PJXA 2ADBA 2KG0A 3AOBA 3Q83A 4EYHB 2NYHA 2ZBPA 1NEEA 1NLKL 1IR1A 2ADCA 3ZTRA 2BEFA 2UZAA 3OPKA 2VICA 4U7UK 2DH9A 5KFFA 2BZ2A 3CJKA 4ETXA 2C2RA 4RW7A 2J0SD 5EN1A 4CH1A 3RB6A 4ZVRB 4MFBB 3M6XA 4NCAA 4C2MA 4NYOA 1YJ7A 2KTQA 4RNNA 3KJVB 1RLDA 3ISZA 4W98A 5IXUA 3Q0AA 5J2QA 4ED0A 5D77A 2BJ1A 5T14A 2M4MA 4V1Ak 3TAMB 2DGUA 3DM2A 1S0VA 3D0GE 1B0PA 2CQ0A 4DL2A 3E01A 1GX5A 1JLCA 3NG8A 4HACA 2I5JA 4OZ2A 4LMZA 3V81A 2R2RA 3TA1A 4AL5A 1EZZB 2YKAA 2AGQA 5DDQC 4EZ9A 5IT9Y 3N6MA 3M2RA 3P5TL 3MR5A 5KFDA 3T6JA 2H5IB 4YS2A 4WFBQ 5J2NB 1A6LA 3MCNA 4WKYA 1PJ6A 1G7CB 3M32B 4P73A 1QSYA 4LSNB 1Q5YA 4LFCJ 1I51B 2HQ3A 2ZE2B 4W92B 4RNOA 1XC9A 3ZNJ1 2PD1A 3SEOA 2BKPA 4H4KA 1HBOB 3OTOF 1YRXA 3POTB 2CPFA 2KI2A 5DQHA 4ALZA 4RR5A 1E6VB 2DNOA 2IMWP 2VFSA 3CEDA 2MTLA 3MFIA 1FJCA 1RAFB 2YBVA 2C2ZB 2Y9HA 4YOEA 5DG9A 3DOMB 3BKUA 4C8KA 2CVEA 2KXHA 2RHSB 1VRTA 3IAM9 2OFGX 2PIIA 3ENQA 4O44B 2EC2A 2DH8A 1QAJA 3TA2A 2BE2A 1RTDA 2V0NA 2FJVA 1G3OA 1Q82T 4QIWD 4G65A 3QPIA 4KHPJ 3BDPA 1S6UA 3NOCA 1PYSB 1FKOB 4CLSA 2IM3A 2FVSA 4PG7A 4ECUA 5A2QU 4WZQA 2A3JA 2HNZA 1X5SA 4JI3J 1JNRB 5DS7A 5E2QA 4DFJA 1SUQB 5KFGA 1FNOA 1HNVB 2IIHA 4FVMA 1CQNA 3M8RA 4DV3F 3VGSA 5F9LA 1J5EJ 1PCAA 2XNRA 3MEDB 2LQ5A 2FLPA 5K5MA 1OY8A 4K0KJ 3W2VB 1WD6A 3J7YI 1YRUA 1U45A 4UTGA 4TLRA 1XMQJ 3R5BA 4QOTA 4MYUA 5LT5A 4J9PA 3I0SB 4C3MA 1TFYA 2PSZA 5BR8F 1W2BR 1HQUA 1XMOJ 3BKFA 4WXWA 4ECYA 3N01A 1K73T 4YB7A 1HHQA 2GS8A 1PG5B 3OQ2A 4ZK7M 2UUAJ 1K9MT 1DTQB 3A3PB 4F0MA 4AXIA 2AZ3A 3CJSA 3G4SS 3DLHA 1JQGA 2KL8A 1FDBA 3OLAA 3SQOP 4DXLA 4WXOA 3CD7A 1HI1A 2XB2D 4ED8A 4TVAB 1X4AA 2P5VA 4Y28C 5CAAA 1U26A 1XIQA 2WVBA 3IAS9 2RT3A 3TZWA 1CS4B 3ZO7A 2KYXA 4GC6A 2YWGA 4ZIWA 1WDDA 4KGXB 1NUEA 5HATA 2KU7A 1S9EB 4DG1A 3SV3A 2RD5C 1R31A 1UVNA 1RT4A 1GK8A 4A8FA 4KFBB 1T05A 2XULA 1RACB 4DX5A 4O3PA 4LSLB 2AEJA 1QLNA 5DGBA 2APOA 1BHNA 2KXFA 2HVZA 4F67A 3BO4A 2FJXA 3OR2B 4A8XA 4HHJA 4TYBA 3IC1A 4QWBA 2KH9A 2MQOA 4OJGA 3LO3A 3R5GA 1FHTA 2LQ8A 2HAIA 3JYTB 2AT1B 2OPQA 4RBUA 5GMEA 1HBUB 3FNNA 2AX1A 3TZXA 1AROP 3TARA 2RQ4A 2QFJA 1HIYA 3CC7S 1QE1B 1RGVA 4DQQA 4MK9A 4K4YA 1ZZNA 1Y5NB 3D6TB 3CB4A 3NLCA 2MQPA 2HK2A 5B0CA 1AT1B 2HS3A 4PWDA 2NZCA 1TMMA 4L74A 1RTHA 1NO8A 5AT1B 2J5AA 4IG0A 2EBEA 1U1PA 2AWZA 2VH7A 3IRXA 4LRDA 5KFIA 4DDFA 3Q8SB 1MMDA 1B4SA 5GAHU 4S0MA 2JDJA 2ZKTA 3IGVA 2PMZD 5FDLA 1UJ5A 1BMQB 1IN0A 2ZH6A 5DDPC 5GMKa 2X1BA 2H4YB 3GU0A 4X4UA 4F26A 1GMWD 4QR2A 4DR4F 3LQVA 4DUZJ 4NZ0A 5HI7A 4K50A 4BC9A 2V4RA 5HLFB 1RWUA 5DQGA 2EPIA 3QO9B 5D6GA 2HHHF 1VBXA 4HH1A 2ZH9A 1IR2A 3OHAA 2XM3A 2Y0BB 5DG8A 1FD2A 1S6QA 3CNQP 3KLFB 4ELVA 5KFBA 2G2OA 1IBMF 2D1CA 3M6WA 3JXOA 5BXIA 2HQIA 4QWAA 3ETOA 4UOFA 2GJFA 5KFLA 3VALA 2MZSA 4DV0F 4Y2CA 3DOLA 2FVPA 5ETOA 1EP4B 2B9WA 2M5YA 3A8KA 1T03A 3ILJA 4CO4A 3SFUA 1OY6A 2VFVA 4DQIA 2B3TB 3AJDA 2HSEB 4DV7J 2EK1A 1ELOA 1S4FA 2LECA 4Q2MA 3IS9A 1JLGA 1RT2A 2OEJA 4DS4A 2YNFA 2CWKA 4ZCKA 2U2FA 1REVA 4OLPA 4Y34A 2QEXS 2AHOB 4RU9A 5DLFA 4OZ1A 3H2UB 1VBZA 2QV6A 3OXFA 1REGX 4OYWA 2A2CA 2DNKA 3SSSA 2BE9B 3IM8A 2VQEF 2BJ9A 2YWWA 3L7PA 3F73A 3CJQA 5KFWA 2EFQA 4DN0A 1TK8A 2ZNZA 2G0IA 4LF4J 1RTZA 3OR1A 4DL7A 3DGPB 4ZPVR 2CJBA 1LV5A 3CCTA 4TY9A 2XTJP 1ZM3A 2MKCA 3SV4A 4LR7A 1WWHA 4DUYJ 5F8JA 2XO6A 3GV8B 4LF9J 1AA1B 1V3SA 5J2PB 4QWEA 3L3CA 4EEYA 2QLJB 3NS7B 4FBUA 2J9DE 1LW0A 1FWPA 5AJ3F 2PA3A 3M8ZA 3B6BA 1H98A 3CUNA 1O51A 2JJ4D 4OZNA 2G1DA 4DPUA 1N33J 4LF2A 1LXJA 3CXCR 5SZTA 3AXMA 5C2GA 4NA3A 3OTBA 5E3QA 2LYVA 2MZRA 1FTCA 4F0KA 3ONQA 3SSRA 3GFZA 4DR6F 4M95A 2AQ4A 5KFCA 3HHKA 2JLEA 3AODA 1SC1B 2FD2A 1VQ7S 1GH8A 1KEKA 4TY8B 1HYSA 2GGPA 2IM1A 1T94A 2MKJA 1YJTA 4X2BA 2H1YA 1VBKA 1N52B 2BR0A 3T1YJ 5T7LB 2CJKA 2QLXA 5DZ6A 1QUVA 3GJTB 1C1BB 1XBWA 1QSSA 1M5KC 2B6AB 4L75A 4RW9B 1IM6A 2WK4A 2HPUA 2FHOB 3O8WA 1JJ2R 2CZVC 4NLVA 2FVRA 3FMWA 2HS4A 3C16B 1BQNA 2WRMA 4P74A 4USJC 1VGYA 5IV3A 3M8YA 2O3DA 4F25A 1TV6A 3N79A 3QNWB 4HLBA 1W26A 4OYPA 1F3VA 2DHHA 4EMDA 2IJFA 3KTQA 1M5OC 4KIAA 1TL5A 3QSYB 3G6ES 1VISA 3I4PA 2BJEA 5KFKA 2QZ8A 5CHCB 5KFZA 5LXRA 2E9RX 1Z2ZA 3UI3A 2GZOA 4DZ6A 1URRA 1JKHB 2WCXA 2GHPA 4PG6A 2VG7A 4ZVGA 3PIOQ 5A8RA 4CYUA 5I3UA 3KOAA 3HVRA 2KM8B 1EARA 3EM1A 4LF6J 3OFEA 3MM6B 4YMEA 4L6V3 4ICLA 2KDOA 4ZVTB 1RU1A 4A8QA 2LEBA 1TKZA 2YXLA 2R9LA 2G2ZA 1H6KX 1TMJA 2ZUAA 2B7CB 4N76A 4WFYA 4WJBA 3I0RA 2V63A 2IBOA 4LF1A 5AXMA 4YFUA 1Q1KA 4CM0A 2OEKA 4ILLA 4LRAA 3M2VB 4A46A 3TQ1A 2DGXA 3S7RA 1LNQA 4RWWA 3AQOA 1KD1T 2E5GA 4ZHRB 2B7BB 1XNQF 1FCAA 3MD3A 1U1KA 3K5PA 4B3RF 2VPXB 4K4XA 4URSA 4J5OA 1BE4A 3HHEA 2IM0A 2CJAA 3TWZA 3MPYA 2CJXB 4YY3J 2Y3YA 4JV5J 5A2QY 4UT4A 4GKJJ 2DB1A 3C2PA 3DHXA 4ZPCA 1U6BA 3FCVA 3ULHA 2JEGA 2DRBA 2XS5A 3MM7A 2RF2B 1FRMA 3BSCA 1FK9A 2RDIA 2DGSA 4NLDA 1WEXA 1U8SA 3LGHA 4JI3F 4BS2A 3UN2A 4X64J 4X4PA 2CPDA 1RHKB 1T3OA 2BQ3A 3MM9B 4OX9J 3FSYA 1MWQA 1NBEB 3GR0A 4OI0A 4M5NA 5KG0A 4YEAA 2AJ4A 2MEWA 1J5EF 2FVQA 1WC0A 3Q24A 4WYWA 3H5SA 4K0KF 1LOUA 5A8KB 3QRPA 1XMQF 4WKRA 4LFAF 3DRSB 4DPYA 4EWTA 5CD4A 4PCQA 1ZAXA 5MAOA 2FY1A 1ZM9A 2FY8A 1XMOF 1SL0A 1GXLA 1KVKA 2CNLB 1U2RA 2V9KA 4PWWA 3HT3A 2NXEA 4JB8B 1D9DA 2YTCA 5K14B 2UUAF 1G6BA 3UW1A 3W7BA 1OY9A 2A10A 2DHXA 4RNMA 5H9EK 4I2QB 2V8PA 1OSDA 4HHUA 2OPPB 4L3NA 3MDFA 1NM2A 4CNYA 3M9NB 3KHRA 4ECTA 4ED2A 2FHMA 4WTYA 4UOCA 1I3OB 3OJUA 2IJNA 2UXDJ 3W61A 2ZBRA 3LPEA 1I1GA 2FQQB 5EWGA 4Y65A 1FFGB 1YWXA 2E5LF 1ZAVA 4R25A 5CZXA 3P45B 2BJ7A 3LP0A 2G4BA 1LWFB 5KFTA 4IQMA 3E3XA 5LJ3Y 4P9SA 2WSEC 4A47A 2D41A 3PDNA 2BM0A 3FDSA 1SI9A 3NMAA 4MK7A 3L7UA 3KLGB 1JLQB 1UEUA 1SH0A 5IC4B 1S1UA 1EJ7L 1OMSA 2HMIB 3TI0A 1Z4UA 2K1RA 4Q8FA 2QE5A 5U47A 4ZP9A 4ECVA 4YP3A 2FPHX 4I68A 5IWAJ 2M0GB 2FZGB 2RMLA 1RISA 5DG7A 3E8OA 5L1KA 3ILLA 1XQIA 5HN0A 4X62J 1KQFB 4DWIA 1S1VA 4B3TJ 2DGTA 2FYXA 3BQ1A 2DYAA 2IRXA 3I55S 1S1TB 1C2PA 1RWOB 2ASYA 4NLTA 1ULRA 3TYTA 1QSLA 3TZYA 5C25A 2VFTA 3PR4A 3R5DA 4O4GA 3J80Y 4QIGA 3NMRA 1HD1A 4IRKA 3CDUA 2HEKA 2AGPA 3PV8A 2R7TA 2XO7A 1YK9A 3S1TA 3HHLC 4OYZA 4B3MJ 1FRIA 3NGTA 4OYOA 2G1HA 1B7YB 4ZVPB 2MLZA 3K59A 3SXLA 1N0UA 2L9NA 2MZTA 2XEXA 5KT6A 3EUNA 1X8DA 3NS6A 3R3TA 5F8NA 2FJBB 2ZHAA 1CC8A 4FBTA 3MCSA 3P8BB 2V94A 3IGNA 3V6HA 3DMJB 5GAHI 2YKQA 2W9BA 3ET6A 5IS2A 2B5JA 3QWUA 1MN9A 3TVZA 5ETQA 3QT6A 4YB1P 4ZJLA 2BRLA 4DV5J 3CDBA 1JLFB 1CVJA 1N5YA 5EGYA 2JC1A 3LP2B 4PG5A 4CO3A 3Q86A 4Q45A 3BH6B 1IKXB 3CIZA 1LKZA 1N36J 2DR7A 3PW7A 5E41A 3FQKA 4U7UD 1FE4A 4B9MA 2R2UA 1GFWB 2NPFA 2HFNA 1NB7A 1WOPA 2XLIA 3I4HX 2CPIA 2JVOA 3HD2A 3UPFA 1TQLA 1GTHA 2KT2A 4J9OA 1PAUB 2HWIA 1R0CB 2XI3A 4RZRA 4GO7X 4DX6A 4Y2AA 4RW6A 1DLOB 5HVHA 3NEKA 4DV7F 3CJRA 3AQPA 2DY1A 3ZTPA 4A8WA 3MCMA 1NSQA 2HLUA 2AJ1A 1QTMA 1LWCB 4FP9A 1RA6A 1XERA 4I6WA 2RS8A 1KONA 1ICEB 2B9YA 2BM1A 2XNQA 4GVBB 4M5LA 2B8PA 2ZOMA 4ID5A 4DZDA 2MZ1A 3EXYA 3KG1A 4RX6A 1Y5IB 2FLLA 3BGFA 4DLEA 2UUTA 3H7HB 3ZFVA 1RQ0A 1S9FA 3FBCA 2XYGB 5B08A 5K9FA 2KJVA 2VF3A 4LF9F 2HHVA 3QT5A 2YPZA 2YNIA 1NK9A 4OHWA 1X9MA 2ZZMA 4CLZA 1FFSB 5HJXA 1IKWB 2GVDA 3QT7A 4IO1A 5KFVA 5CA5A 3BH7B 4ANEA 3FCHA 4CI0B 4QWDA 2RQCA 5DQIA 4B9SA 4P2FA 3JS9A 4GO5X 1SV5A 2DNHA 1RKIA 1RCOB 1SKSA 3V4MA 4YN3B 1FRXA 4MIBA 4DN9A 4U7CA 2ZOGA 2UU9J 3VVUA 4FNHA 3KFWX 1KQSR 2R8KA 1N33F 4DU7A 1SKWA 1ROFA 4AL7A 2DT9A 4JI1F 3MR7A 4PABA 4TNOA 2BX6A 2F63A 3JAMU 4HI2A 2E1AA 2Y1RI 2XSJB 2WONB 3BR9A 2GV1A 2V2VA 2RAQA 4K7QA 1R43A 3MEGB 3T19A 1FJ7A 4LBHA 3HP6A 4C0OC 3I6PA 2DITA 2HG4A 3DOKA 4IFVB 2FZKB 2KHDA 4WFZA 2DNYA 3T1YF 4P2XA 3DRYA 1EETA 3BN4A 3QYYA 2CPJA 1FVSA 3H2VE 4C8NA 4CZCA 1P9YA 3QGHA 1MG7A 4GVLA 4ID8A 3MM8A 4XPEA 2KM8C 4RW8B 3P5BP 3D66A 3MMAA 2W9AA 1HLWA 5HBMA 3I87A 3UN5A 5BYQA 3OLBA 2WOMA 3H42A 1IR0A 1FXDA 1LW2B 2GMJA 1FNXH 1M1KT 4PWUA 5IM0A 4NASA 4QIFA 3DYAA 3NP5A 1XEZA 3AT1B 2VDIA 2IA6A 4RW4A 4A8YA 2HLTA 4RLEA 2BOAA 1XNRJ 2YH1A 4JI8J 1WJ9A 2KFNA 4AE5A 1MROA 1VHFA 2JC0A 2DXDA 3JSMA 4U96A 2DIVA 4KH0B 2Z8QA 3SDEA 2VPZB 2DNNA 2I38A 4I7FA 1J5OA 2F3JA 2ZWOA 3OUYA 4NI2A 2F4VJ 3OTDA 3DRPB 5D3GB 4R0EA 5HP1B 2P9EA 4KHRA 2LVWA 3OW2R 3HKWA 1WG5A 3BF4A 3BZQA 1HNZJ 3AB2B 2C2EA 4P72A 2I8EA 4Y0FA 1H38A 2O01C 3L09A 3KK2B 1JLAA 2DNLA 2QL5B 5L46A 1VQPS 2QN6B 4F3QA 4K4ZA 3IBWA 3W8GA 4Y2KA 3EGZA 5GMDA 1MU2A 1RT3B 2F5GA 3QIPA 2HIYA 3DLKA 1SH2A 3V2UC 4DR3J 3M2UA 1RKJA 5B0DA 2MB0B 3SZ2A 3GIRA 4M94A 1FEEA 1W7WA 2VA3A 3M30B 2E9ZA 3CC4S 4B9UA 4HDHA 4WP9A 5AE2A 3M6UA 4I69A 1XMBA 1I6JA 1TKXB 3A13A 2CNKB 2WVEA 5KFAA 3TX8A 4PUOA 1CULA 3DFEA 1RHRB 3NY0A 2P9GA 4AT1B 3RAQA 2AJQA 4YY3F 4YDDB 1O5JA 3WHIA 4AYBD 1YZ7A 5HAOA 4JV5F 1HW9A 3VGTA 3KJFB 4QYZJ 2W9CA 5F3ZA 4N56A 1WC4A 1IBLJ 3ZTQA 3T1HF 1Z1ZA 3Q89A 4OYXA 4DEZA 4F3MA 4ERDA 5AXKA 1A7GE 3HULA 1UVIA 5C5JA 3OFFA 1R8CA 4ZPAA 4N77A 2CQPA 3CCMS 2ZUGA 2WTFA 1S4EA 2OJ3A 3UDVA 5F0WA 1U6ZA 2E5IA 4DU8A 1WEYA 2DR8A 2EKYA 3VF0B 2CPXA 1R0AA 2F7VA 3T1AA 3O6QA 2MXYA 4A8KA 2AMCB 2W8LA 4W90B 5A0YB 4P52A 1TKTA 3G6YA 3PM9A 2ERRA 3R7BB 4R5PA 2R8HA 2DTJA 3PNIA 3GSIA 4NXMJ 4PPDA 5K8NA 2X3DA 2ZZTA 5I3PA 2RILA 3MEEB 2B4PA 1HFEL 3LPYA 4H4OB 3SQGA 2V8GA 1OWXA 3U1LA 4IH7A 3AFGA 1RBLA 1JIHA 3PIPQ 4ATNA 4R8UB 3D28A 1VQOS 4X4TA 2AYMA 1F3FA 1RWXB 2NXCA 1SIZA 2M7SA 4LF5J 2UXDF 3PRVA 1VQSA 2HQGA 5GAGU 3BPSP 1KFDA 2NR0A 1Y5LB 4IFYB 4NXNJ 4H4KC 2OPSB 3M8QA 3DLEB 2BYCA 5DM7Q 1T7PA 3TNVA 3M8PB 1E6YB 4CLPA 2O5DA 3Q8QB 3PEHA 1R8AA 3FSXA 4LRBA 2XBPA 3BGRB 4NZ7A 5BYSA 2HHSA 4ZN1A 1UVKA 2BW2A 1N5TA 1M1GA 1B0TA 2MMYA 5D78A 2K2PA 3KLHB 3G8SA 3KLVA 4FF2A 2E7VA 4CO2A 2WVCA 1PC5A 3QQCD 1RB0A 1FDAA 4QWCA 1V3RA 3AB4B 3NNHA 1KHVA 4X62F 1ZM2A 4B9LA 4B3TF 4JI5J 3OV7A 1U1NA 4O3RA 3D9BA 1RAGB 2IBKA 1NAQA 3VAFA 5CD4H 2EFPA 3AJ2A 1X4GA 3HJFA 3GB0A 4O0IA 4B08A 5JJBA 1D3WA 1S6PA 2BANB 3HHDA 5M2PA 1G1XA 1BLUA 1V6HA 2H4WB 1FO1A 5I4MA 1CG2A 1TUWA 1EX8A 2NYIA 3CDWA 1F1BB 2PDAA 2V34A 3W2WB 4DV6F 3HM9A 1P1LA 3EGNA 4M5HA 3OTEA 1S0MA 2XMTA 3NBPA 1Q86T 2IJRA 4KO0B 1CJKB 4UZCA 1HWUA 3BV8A 2XZWA 1WKJA 2G0JA 2V50A 4YR0A 1YITS 5HVFA 1S9GA 4C8MA 3R8YA 2D69A 3BM7A 1AUDA 4H4MB 4TU7A 2MQNA 3ZTSA 2YX7A 3W1YC 2OP5A 2RRBA 2H51B 3J7ZT 2NQPA 5CYQB 1WUUA 3TX0A 1HNIA 3HSDA 1U25A 3BEGB 3AA9A 1N36F 2CPZA 3ENAA 2LXIA 3OFGA 4P7VA 2HVDA 2D9PA 1S97A 2QGFB 2EG2A 2B4UA 2LKZA 1UA1A 3CIMA 4EFAC 2J8SA 2Q6BA 1BQMB 1DZ5A 1N5QA 4C0HA 3WX4A 2IA0A 4ZVFA 3MMBA 4ZJQA 1CJUB 1VRUB 3D6FB 2YNHB 2BV3A 5DZ7A 3JTOA 5KFNA 4IQXA 1MMNA 1UAWA 2OUGA 3MFHA 3EYZA 2HQDA 2CPYA 2VODA 3C6TB 2R7SA 2AV5A 3G8QA 1UWBA 3CW2C 2GAGC 4E98A 3DI6A 4OI2A 2EK6A 1VQ6S 3BGOP 4U8YA 2XS7A 3NOGA 2MQMA 3FC9A 3EMTA 3W8PA 1Y3JA 5H9FK 3MPDA 5FLXU 2IRYA 2C1EB 2JRSA 1VFJA 3MUTP 3BREA 1U0HB 3TEGA 1KLMB 4DS5A 3KK3B 1DHMA 1U6FA 2HRYA 1S59A 5HO4A 3SCKE 3OXGA 3CCVS 1LFWA 1CPZA 4A8MP 1MLAA 3UR3C 5HMZA 3KK1B 2J6TA 4ZCLA 3V4IB 4DSKA 2X7IA 4QU6A 5JUMA 4C3KA 3NGDA 4WF9Q 3O3LA 3EVWA 2UU9F 2E66A 4Z2XA 2CFXA 1T9UA 3EVMA 2ZKUA 3JAMY 2YKNA 3PVXA 2GO8A 3IWNC 5I42B 1JK9B 2KO1A 1DRZA 4K4TA 2MY8A 4ED6A 1FDNA 4DV3J 4DSJA 4J9LA 1RT6B 1LQ9A 3C6UA 3J7YU 3I5BA 2CZ4A 1U09A 2Y0SD 5LL6d 3OXLA 2VZ9A 1EIYB 3VCDA 4PQUA 1NMEB 3QLHA 3OL6A 3FBFA 3OL8A 2MGZB 3LGMA 3ZTOA 1S6OA 1R7IA 5G4DA 5BR8J 5C42A 3A8IA 3X1LB 3FFIA 4TXSA 4KKOB 4BC7A 2AYBA 5ETSA 4DMZA 1HBNB 2W1BA 1C0TB 5IQ6A 5DO2A 2XZTB 5CABA 3HX9A 3L4BC 2Y1IA 2IC3B 4KGKA 5GAEI 4IDKA 4K4WA 4ZJOA 2H65B 3M9MB 4DR5F 4MYTA 5J2MB 1HD0A 3FJ2A 4XTTA 1KOHA 2YNGA 4Z7YA 1XNRF 5ITHA 4JI8F 3U7JA 4FPIA 2XYPB 1PKUA 4JI2F 4KE5A 3NCQA 1IKYA 3M7VA 2HVEA 4ZLLA 4KPCA 2KN4A 2AKWB 2R2TA 4HT7A 4OX7A 5ETLA 1TAUA 3GFYA 4ANDA 5D4OA 2HS0A 2OAUA 4M5KA 1X4BA 1JWWA 3RRHA 2VFRA 2IHR1 1HNZF 2GQ2A 4PEOA 1S10A 1MMLA 1EB0A 3W60A 1U49A 2GC8A 4EI2A 4ELUA 2KG1A 3US5A 2CXEA 1RAAB 3OL7A 2XYHB 3UCUP 1VIXA 2VBWA 3IR5B 3ITHA 2B9EA 4IRDA 3C46A 1HQEA 2YKMA 1FF2A 2C3MA 3DDIA 1FDDA 1Y9OA 3TR5A 3EVOA 2W8KA 2FGCA 5HSPA 1R8PA 3DU6A 2C22A 3T5LA 3Q22A 2AEMA 1RT1A 1KVIA 1EHWA 2GJ2A 1VI7A 1BWEA 4LF7J 1N6QB 4PQAA 1CLFA 2M8DB 3O5TB 5FJ4A 1RTJA 4DHVA 4ZVHA 2R42A 5KT2A 4CT8A 3R2DJ 4KAIA 4KGVB 2ZM6J 3K5OA 2QL7B 2E44A 1WC1A 3CCJS 5KFSA 4ANCA 1KNZA 5LXYA 1UJ6A 3K2YA 4MJKA 2HWTA 4I2PA 3TUJC 4NCGB 4F36A 1SJ4P 2QMWA 3GZ7A 3EPIA 4F8RA 5HROB 1BY9A 2MQ8A 4EZ6A 4Z7CA 3OL9A 3K5NA 4Q0BA 2E1PA 1NJWA 4JV2A 1RXOB 4M8LA 3M1VB 4JI7J 2OSRA 3K5LA 5LSRA 4IG3A 1WI6A 4QU7A 2VC1A 5KFJA 4B3OB 4DR4J 3TP2A 2JX2A 1HKAA 1CJVB 2DCUB 1RWVB 2ZHBA 3SCLE 3DC2A 5D0GA 1S0OA 4IH6A 1YDLA 2EVZA 2HHHJ 1VLYA 2M88A 3SI8A 2IAJA 3HSZA 4H54A 2LU1A 3I82A 2X1GA 1O0PA 4MH8A 2EXUA 8AT1B 3BGLA 4ZVSB 3UR0A 1LEOA 3VR1A 2M52A 1UZDA 3A3NB 4ZP7A 3G82A 2ZD1B 2FDNA 1EAYC 1APSA 4DV0J 1EKRA 3DDKA 2ZBIA 4K5RA 1R0BG 5KOWA 4DV1J 4OZLA 2V4QA 2BVZA 2XY6A 4K4UA 1RT5B 2BKOA 4FXDA 1TVRB 2VG5A 1RBOB 1GXTA 2NREA 3J81Y 2LXFA 4NA2A 1DJ0A 1SKRA 2KVQE 1UVMA 4LVOP 3PW0A 4J9SA 3CT9A 1CSJA 2AX0A 4WZMA 3HVAA 4URGA 2W2OP 2HHTA 1G2EA 5KFXA 2MKHA 5KFMA 1R6VA 2JHEA 4ECWA 2VQEJ 1JJ4A 1H7XA 1F2GA 3ZZOA 4ETZA 1SL1A 4PRFA 2CG4A 2VG6A 3VAIA 3AOAA 3H2LA 3QFWA 1TFWA 4O3QA 4G1QA 4G6VB 1VQ4S 2HKEA 4M5GA 4C48A 3CDEA 1T95A 1RADB 5G0RA 4CO0A 2OPRA 4RU2A 4O23A 1GTEA 3LP1B 3ZZPA 4PXBA 3ETMA 3HVTA 3OBIA 3JSRA 2XMAA 3EX7B 1VHIA 1HARA 4IRCA 4X4OA 1LWEA 3S8SA 1K0TA 2HAFA 1PILA 3IWLA 5KFQA 1F5BA 2RB7A 5C24A 4L72B 3F56A 1H0HB 2VDHA 1RP5A 3C14A 1PSDA 1CJTB 4EBDA 1K47A 2Y1JA 4OI1A 5L1IA 4Z37A 2DXEA 3W63A 4XO0A 1Q8LA 3TA0A 1C0UA 2C2OB 4OV1A 1RAJA 2HHWA 1U48A 4NMLA 1PBUA 2CDQA 5KFRA 4DR6J 4KV8A 2F40A 2ZH1A 3MAAB 3Q2TC 1PGZA 3GYXB 2B43A 1M90T 1N56A 1X9WA 5LSLA 3P49B 2IVFB 4O0NA 5KFHA 3KLIB 1F5AA 1TL7B 1VQKS 2V5HG 2LQJA 3MAHA 4FDFA 2CQ1A 2MYFA 1RTIB 1UP1A 2A1BA 5J1EB 1JLEA 1ZETA 1UFLA 1VJWA 4NLRA 5HMXA 2ROPA 3DRXA 1FERA 1L3SA 4X84A 1A9NB 1DBDA 3MWBA 4USHA 3DLJA 2NUUG 2C2NA 2IPOB 4IYQA 4UW2A 2FHJA 3KHLA 3MHYA 5DM6Q 2LA4A 2LQ9A 1UW9A 1S1WB 2BRKA 1BD6A 3MECB 4ZMMA 3F44A 1KSPA 3GFXA 3SSQA 1N5SA 1NSPA 3LA0A 4QCLA 2GAHC 4B3SJ 4RUAA 1DTTB 4MFBA 5B0EA 3NXZA 3TJ9A 1S49A 3D3BJ 3KJVA 5E3RA 3E2EA 4CRJA 3TAMA 1XN9A 2ZH7A 4PR6A 2ZH4A 3CJ2A 2E5HA 4O3OA 2VOPA 4ZCMA 2JEIA 3PX4A 3MMCB 2DGQA 2P2CB 3WZ0A 1T9XA 2PI5A 3CCRS 4V19X 3DCAA 3BO2A 5J2NA 4J9KA 1C1CB 3TQEA 5M2UA 3MR3A 3M32A 1ZPWX 2VIHA 4LSNA 3GILA 1VC5A 4UY85 2HZVA 3IN5A 2QLBB 4RNHA 5FLXY 4N47A 2ZE2A 1Q78A 1VQYA 3I5CA 3RAXA 4Q5VA 2J0QD 1HBOA 2XMUA 3POTA 1VJQA 2DNPA 1VOMA 2CJQA 3J7A1 2E1CA 3QSIA 2JWNA 4RUHA 2XCPA 2OTJS 1XNQJ 2FJWA 1E6VA 4CCHA 3IM9A 2QC3A 4B3RJ 4WP3A 5HJYA 2GHVC 1NSAA 3BO3A 3Q8RB 4LIWA 3UWTA 3K58A 5FD1A 1NRKA 4LUBA 4ENOA 3DOMA 3R6LB 4NLPA 2Z0GA 5EDWA 3GIKA 1SJQA 2Z2LA 4RUCA 2VJVA 2H3EB 4O44A 4DFPA 1HWIA 4DQRA 2YH0A 4OQJA 5EWFA 2PMWA 3HHLD 2YWKA 2QX0A 2L9WA 2PMHA 3GCXP 3GJQB 1FKOA 5A6WA 2D3O1 4OHXA 1M0SA 1KDNA 2B9XA 2XMWA 1IM4A 1TP7A 1VMBA 1HWLA 1SUQA 3J7Z5 1QD1A 2AYGA 3LAMA 3FSIA 1HNVA 3P6YC 2AZ1A 3HLUA 1D9AA 1KBRA 2K8GA 2DHSA 4XAKA 4LFAJ 2J7KA 4I4BA 3UVJB 2MHNA 2NXNA 3MEDA 3QRQA 3W2VA 2UXBF 2QSFA 3H20A 3LF0A 4NLQA 5HL7Q 4DR2J 3I0SA 3DU5A 1F5CA 2KYZA 4OYIA 2ZH5A 3SYZA 2RRNA 3MPWA 1HWKA 5GADI 1S99A 1FTRA 1YJRA 2ZH2A 3R7SB 4HKQA 4USWA 1URNA 4CLTA 1S7IA 2H5JB 2QA4S 5A76A 1DAXA 4Q7AA 1OPZA 2UXCF 3C15B 1AZSB 3PHTA 1DTQA 4NEYA 5A8WB 1JLBB 4Q8EA 1S7HA 1K1SA 3RB0A 4GC7A 3D2WA 4DR7F 5F8IA 2ASDA 4UUWA 2DGOA 4K2JA 4C8YA 1UKUA 1FRLA 2FC9A 2E5LJ 4L3KA 4RPFA 1KP6A 2VHGA 2BACA 1S48A 2GVZB 4DFMA 3I32A 4ZN3A 5KTQA 3HI9A 1Q5VA 1WF1A 4IO9Q 2MDAA 4P71A 1T3NA 1BUXA 3MCOA 4MAKA 4WU3A 3DDNA 2XQCA 3GPAA 1NK7A 3QIDA 4EYIB 1B64A 3N5BA 2BQRA 1CS4A 2NCKL 1HPZB 3IR7B 1Y10A 2LEAA 1P27B 1S9EA 1NHKL 4Y2IA 2JVRA 4QW8A 1WI8A 1RWWB 4KFBA 2IVYA 2V68A 5F9NA 4CDIA 4ELTA 4LSLA 2H54B 2V2ZA 1UTAA 3A8EA 1HR0F 4BHQA 4CP5A 2KHCA 1N34F 2HHQA 2J8AA 2J9EA 4FZVA 3OR2A 4DFKA 1H3DA 1RT7B 2C2MB 4LF7F 4I6YA 4DV2F 2ATCB 2PA8D 1RCXB 1IKVB 4NCBA 1PJ7A 2QFIA 5IT9U 1Q0NA 4I0WA 3JYTA 4WPAA 2KVIA 1HBUA 2ZVSA 3MPVA 4ZVQB 1QE1A 2ZM6F 2LDIA 4KB7A 2FGOA 4DQPA 3F0NA 3PX0A 2R7UA 3NGRA 3VAMA 1B0VA 4WFXA 1IJFB 2R7XA 2WSFC 4MTPA 2F65A 4YR2A 4MK8A 4DCPB 3O2IA 1HMVB 3MOZA 2PN6A 1S5ZA 4NMXA 4WE1B 2VFUA 2V9WA 1TR0A 4DSEA 3BPDA 4JI7F 3PYGA 1QUPA 3MM5B 3MTJA 1ACMB 1IBKF 2DNQA 1NPKA 2FJAB 1PBAA 1BXNA 1X60A 3VVTA 1VIOA 1D0EA 3T5JA 3J7AN 2V4JB 3PW4A 1N32F 1V9OA 1NCLA 5HLFA 2DNGA 3H90A 3HHLB 3DGVA 1MSWD 2DEIA 3QO9A 2CQHA 1UVLA 5DDOC 1SCJB 5L1JA 1IBCB 2R3VA 2QO3A 3R6GB 5D0RA 1NHUA 4OZ0A 5CXTA 2K7KA 2JH3A 3PEJA 1L5UA 3KLFA 2DR5A 4C11B 1PYOB 4DV1F 2GIQA 2H5EA 3ZZZA 2RNEA 3PW5A 1WNEA 3LWMA 1FKPB 3THVA 3IG1B 2XCAA 1KTQA 1EP4A 3BBFA 3DN9A 3CPWR 4USKA 3H59A 2LA6A 3RBXA 2P8IA 3OSNA 3UFCX 3K17A 1RLCL 3KHGA 2DKOB 2W4CA 4USTA 1U8WA 1KLNA 3OTCA 2YQ3A 2BDPA 4QR1A 2VQFF 2DNZA 2J7WA 2KT3A 4LR9A 4E0DA 4OHZA 4ED4A 1L3KA 2YKPA 3DGPA 3ADAC 2DO4A 3EXCX 2B8QA 2LXUA 2DY9A 4YDXA 2R8GA 2FLOA 3DRRB 4GKKJ 4F02A 1RAIB 4AL6A 2GQQA 2F9JA 5J2PA 4DR1F 5HQ8A 2FHKA 4FXVA 3N5FA 1SJ1A 1PAEX 3CJ8A 2RUGA 1X5OA 3QATA 4UOGA 2L08A 2HFSA 1JXVA 4X4RA 1YVFA 3BSNA 4JI1J 1VK3A 1VQLS 1R8HA 2XLJA 3EICA 3QMQA 3FMBA 1IVZA 3W65A 4XDDA 4J9UE 2EFOA 1SQFA 4BDPA 4TY8A 2E1MC 5F0UA 4UUXA 4EBCA 2W2QP 3S01A 3KHHA 1WG4A 1NH8A 3GG1A 2MKYA 4M5DB 4QIEA 3PKYA 5T7LA 3CMES 1YKWA 2HNYB 2K3IA 1HHTP 1C1BA 3QJPA 2B6AA 5KG6A 4RW9A 5KT4A 1UJ4A 2AF6A 2HHPA 4CH0S 2DIUA 2CYYA 1VR6A 1DQ8A 4NE9C 5DLGA 2QA1A 3HSJA 3T9NA 3EPGA 4O3SA 2CNOB 3CCUS 3VAJA 5ADZA 4F50A 4QIVA 2ZC3A 1RUSA 3C16A 4WYLA 2Z2YB 2JL9A 1X5TA
chains in the Genus database with same CATH topology
1PC5A 4C3MA 1TFYA 2QSWA 3B8HA 1FDAA 1OO0B 2YWFA 4QWCA 3G86A 1RK8A 1ZM4A 1V3RA 2PSZA 3AB4B 5BR8F 1X4HA 1YIJS 1W2BR 1HQUA 3NNHA 1TL3B 1KHVA 4WXWA 4X62F 4ECYA 4B3SF 3GYNA 2JLFA 1ZM2A 3N01A 1FJEB 3JTNA 1K73T 4B9LA 1FESA 4YB7A 2FVCA 1X4FA 3TAQA 3VZHA 4B3TF 1FRJA 3JB9k 1HI0P 4LF4F 2HFOA 1AFJA 4IUFA 3OQ2A 4JV0A 1NK5A 4F2SA 2YNIB 3WDOA 4ZK7M 3V6KA 1J2VA 3OV7A 5KFPA 1K9MT 1DTQB 5KG5A 1OQ6A 1U1NA 2H9ZA 3BB5A 4O3RA 2EC0A 2IBKA 1CEZA 1NAQA 3VAFA 5CD4H 2EFPA 3AJ2A 1X4GA 3HJFA 3GB0A 1X7VA 4O0IA 4AXIA 4B08A 5JJBA 1D3WA 3G4SS 3DLHA 4DUYF 4NCGA 2J7UA 1FDBA 1S6PA 2BANB 2F8EX 2KT5A 3HHDA 5E3PA 5M2PA 4TN2A 1SV5B 1JKHA 1KRPA 5HROA 1G1XA 3OLAA 2X3GA 1BLUA 2NUHA 4WXOA 1V6HA 3CD7A 4XDCA 5CCMA 1HI1A 2NXUA 3DLLQ 2XGPA 2XB2D 4ED8A 2P6TA 1FO1A 3L7OA 3HZGA 5I4MA 3K0JA 1CG2A 3M1VA 5IZHA 3BSOA 2NYIA 5JXSA 3R5AA 3CDWA 2PDAA 3W2WB 3RRGA 5LJ5Y 4DV6F 1X4AA 3HM9A 4B3OA 2P5VA 3MM6A 1P1LA 4CIOA 2P6SA 4OI3A 3EGNA 1W25A 2JOQA 3BDEA 5L39A 1TL1B 4J9QA 4Y28C 3WC0A 4ES1A 3OTEA 1S0MA 2XMTA 2DGWA 2YX4A 1U26A 3NBPA 5L9NA 1Q86T 3JSBA 3IAS9 2RT3A 1OQ3A 4KO0B 3ENWA 3NGKA 2ZH3A 2KYXA 3K7RA 4GC6A 1HWUA 2YWGA 4TKTA 2XZWA 2AW0A 3GG0A 4BCAA 2D74B 1VQNS 2KU7A 3TOQA 2NLWA 1S9EB 4IR1A 3PKMA 4I6AA 4DG1A 3SV3A 4EO6A 4YR0A 2RD5C 1R31A 1YITS 1NZAA 1UVNA 3DOKB 2RE1A 4BBYA 1RT4A 1S9GA 4C8MA 5F8HA 4KRWA 3R27A 3M2VA 3BM7A 4A8FA 4KFBB 3THTA 1AUDA 2HNDB 4WU2A 1T05A 2XULA 3GE9A 4H4MB 4TU7A 5THWA 2MQNA 3HHNB 1EETB 4ECSA 3PXGa 2Q79A 2YX7A 1ZBTA 2OP5A 4O3PA 4LSLB 2G9OA 2RRBA 4ZHRA 3J7ZT 4JV1A 2NQPA 2ZD1A 1NHVA 1FEHA 5CYQB 5DGBA 1QLNA 3G9CA 2RIJA 1DARA 2APOA 3MM8B 1HNIA 1R27B 2KXFA 1U25A 2HVZA 4F67A 3BEGB 2AJ0A 3BO4A 2FB0A 2FJXA 3MMAB 3I9ZA 4DV4F 1HBMB 3OR2B 5HBMB 2AU0A 4A8XA 4HHJA 3AA9A 4TYBA 3IC1A 4CTAB 4DL0C 4QWBA 1RT5A 2NPIA 2KH9A 1N36F 2CPZA 1SJRA 1TVRA 2LXIA 3OFGA 4P7VA 2WOMB 2MQOA 4OJGA 3LO3A 2D9PA 5AE1A 2C2DA 1S97A 1FHTA 1T02A 3KG4A 3GV5B 2LMIA 2EG2A 2HAIA 5IM0B 2OPQA 3JYTB 2SXLA 3C3LA 4K2XA 2B4UA 1FE0A 4RBUA 4QQBA 1HBUB 3DYAB 2LKZA 3FNNA 2C3PA 2KXNB 3CCSS 1UA1A 2AX1A 3CIMA 4EFAC 1AROP 4RW4B 3HXMA 3TARA 5H9EJ 2EFVA 2RQ4A 2QFJA 5HMYA 2RF2A 3LANA 3OSPA 1N8RT 3CC7S 1QE1B 1WG1A 1QJHA 1C4CA 2IFXA 3U1MA 1IQTA 3FVYA 2Q6BA 1BQMB 1RGVA 1DZ5A 4DQQA 1N5QA 2HGNA 4MK9A 2MQLA 4C0HA 3WX4A 1JJHA 2IA0A 4K4YA 4ZVFA 3MMBA 1MROB 2Q3PA 3NCPA 1ZZNA 1Y5NB 1RDRA 2CQIA 3THPA 2PT0A 2E1RA 2MKIA 3CB4A 3CDAA 2R2SA 1VRUB 5E7OB 1YGYA 2JEFA 3I56S 2YNHB 1U1RA 4A8SA 3NLCA 5B0GA 1QY7A 4IH5A 2MQPA 2BV3A 3JSMB 1NKEA 1D1UA 3JTOA 5B0CA 1YJNS 3SDEB 1L3VA 3FZ2A 2HS3A 3MM9A 4PWDA 5KFNA 3K5MA 4GMKA 1NH7A 4IQXA 4I7FB 1MMNA 1RTHA 3CCWA 1NO8A 1J5OB 1UAWA 4JI4F 3OUYB 2HVIA 3MFHA 4I56A 2DK2A 1XK8A 3FEYB 3EYZA 2J5AA 5B0FA 3PZPA 4IG0A 2EBEA 1VC0A 3V6DB 3KLEB 3VZIA 1U1PA 2AWZA 2CPYA 2VH7A 3IRXA 1XR6A 3EZUA 3C6TB 2VODA 2R7SA 4YQWA 5KFIA 2EBGA 4DDFA 1MMDA 3Q8SB 5IFMA 3LP1A 3UD3P 2AV5A 3CSKA 1UWBA 3G8QA 5A8KA 5GAHU 2B4VA 2JDJA 3G8TA 3N28A 4E98A 4DF8A 3DI6A 4OI2A 3BGUA 2ZKTA 2D3OR 3IGVA 5L9XA 2EK6A 2PMZD 4LQ3A 5FDLA 1UJ5A 3DRSA 1VQ6S 3NL0A 1UMJA 1S1XB 1IN0A 2ZH6A 5CH7B 4DR2F 3ICLA 4ZA1A 2XS7A 3T9ZA 2MQMA 5DDPC 5GMKa 2J9DA 5IT0A 4DF4A 2X1BA 1JLAB 4JUZA 2FTRA 1Y3JA 2Q6CA 4LF6F 1LK7A 2AP6A 3DLGB 5KFEA 1DFDA 4X4UA 5KFYA 4F26A 5KFUA 1YI2S 2IRYA 4ZDNA 4DR4F 4QR2A 4GKJF 3D0HE 2JRSA 2R7RA 3LQVA 2J9CA 5E33A 2RKIB 1MU2B 4Y3CA 3CCES 1OS5A 1VFJA 3MUTP 3BREA 4OFZA 4NZ0A 5HI7A 4DS5A 1KLMB 4K50A 5K14A 4BC9A 3KK3B 1DHMA 2NS1B 1U6FA 3QIPB 2V4RA 2HRYA 3DLKB 3ZZRA 1N4LA 5HLFB 2BA9A 1RWUA 4C3LA 3M2UB 5DQGA 2EPIA 3QO9B 5HO4A 5D6GA 3SCKE 2HHHF 4N5SA 1VBXA 3OXGA 4HH1A 3CCVS 2VBXA 2RH3A 2V8VA 2ZH9A 4J9NA 5EX3A 3IXQA 1LFWA 3OHAA 1CPZA 4NLGA 2R8JA 4A8MP 3QWPA 2BOPA 1U1MA 4I2QA 3UR3C 5DG8A 3UD4P 1FD2A 2OPPA 4FVCA 5HMZA 1S6QA 3KK1B 1VQMS 4ZCLA 3V4IB 2J6TA 1U24A 3QGGA 3KLFB 3BJYA 4DSKA 4ELVA 3AA8A 4QU6A 1U7LA 3M4XA 3CJKB 4A8OA 5JUMA 5KFBA 1IBMF 3PACA 1RA7A 4C3KA 2D1CA 3NGDA 2VC0A 3M6WA 4WF9Q 3O3LA 2UU9F 4PUOB 2HQIA 3K8VA 5KG2A 4QWAA 3FGVA 4RW7B 2E66A 4Z2XA 3ETOA 2CFXA 3DHWC 3KNGA 3JAMY 2ZKUA 1SC6A 2YKNA 2LQBA 5KFLA 3VALA 2MZSA 3RW7A 3PVXA 2GO8A 3GFHA 4DV0F 3IWNC 1XTZA 5I42B 3KLIA 2UUBF 4Y2CA 3DOLA 1F60B 4PXCA 1JK9B 2KO1A 3TRGA 2GO9A 1DRZA 2FVPA 4K4TA 2MY8A 1EP4B 4DL3A 3MF5A 2B9WA 4ED6A 2QA2A 1FDNA 2W9CB 4DSJA 2M5YA 4J9LA 4KT0C 4MKYA 1T03A 1S77D 4CO4A 1RT6B 5IQQA 3SFUA 1LQ9A 2B56A 2YY3A 2VONA 3C6UA 2HZCA 3HFKA 3J7YU 3I5BA 1RTIA 2VFVA 2CZ4A 1U09A 5J2QB 1GAOA 2B3TB 3V6JA 4DQIA 1LWFA 5J1EA 2EK1A 1ELOA 3ZC4A 2Y0SD 4F2RA 4JOUA 1S4FA 5LL6d 2LECA 3OXLA 4Q2MA 3IS9A 1JLGA 1WHYA 1RT2A 2VZ9A 4ZLPA 4QPXA 3OVAA 3VCDA 3DM2B 4OX8A 5E3AA 1KQKA 3EZ5A 4DS4A 5K8PA 2YNFA 4PQUA 4ZCKA 2M9KA 3E01B 3CCQS 1Z2LA 2U2FA 3KLGA 1JLCB 1REVA 1JLQA 3QLHA 4DL5A 2I5JB 3OL6A 4OLPA 4Y34A 3OL8A 1DQAA 2QEXS 2MGZB 4RU9A 5MLCV 3LGNA 3LGMA 3H2UB 4OZ1A 5DLFA 3V81B 1VBZA 1RYSA 2HMIA 1S6OA 1R7IA 2GX8A 5G4DA 4AUKA 1LFPA 4K59A 3HMJG 4F4ZA 4ED7A 1UW4A 3RRKA 4Y00A 2QV6A 1YSJA 3OXFA 3RW6A 3M2RB 4P6QA 2A2CA 2DNKA 4KPYA 3B82A 3SSSA 3QZ7A 2XG8A 2Q1LA 2N4CA 5C42A 3IR6B 4X64F 2YX1A 2VQEF 3X1LB 3FFIA 3L7PA 4NLYA 2VBZA 3VQSA 4TXSA 4TYAA 3F73A 3RR8A 4B9VA 4KKOB 5KFWA 1D8ZA 4BC7A 1R0AB 4ES2A 2AYBA 2EFQA 4DN0A 1S1WA 2ZNZA 4DMZA 1HBNB 1TK8A 4OX9F 1C0TB 3MECA 5IQ6A 3OR1A 5DO2A 4DL7A 4ZPVR 3H8YA 4NA1A 2K3KA 4K4SA 2PGCA 2CJBA 1LV5A 3CCTA 3HX9A 2Y1IA 4P7TA 2GFFA 2IC3B 2POKA 4TY9A 1ZM3A 4KGKA 2MKCA 3SV4A 2EG1A 4AXJA 2UVVA 5GAEI 1TKTB 1WWHA 2DHAA 1DTTA 4R5PB 2D7SA 4IDKA 4ZVEA 4DPOA 4K4WA 5F8JA 1AW0A 5F3TA 2HVHA 3GV8B 3M9MB 3RAMA 3SMZA 2YKOA 2BBEA 4URQU 2QA4G 4DR5F 1V3SA 1S1TA 5J2PB 3A1YG 4MYTA 1NU4A 3VAKA 5J2MB 1HD0A 1FD8A 3FJ2A 4QWEA 1ZTWA 1KOHA 3L3CA 2W7PA 1Y0HA 1UFWA 2YNGA 4OZJA 4EEYA 3TVKA 4ED3A 4ED5A 4FBUA 2J9DE 1XNRF 3LALA 4V19J 5ITHA 2UP1A 5IT4A 4JI8F 1LW0A 3ZZYA 3U7JA 5AJ3F 3IRWP 4G3IA 2PA3A 3JTPA 2FUG9 1R8BA 4O3NA 4RBVA 2MKKA 1Q4RA 4ECZA 3B4MA 1H98A 4JI2F 3SQGB 3CUNA 4KE5A 1O51A 1VRTB 2JJ4D 2HGLA 2D3UA 2DBBA 2UV8G 3NCQA 4F4KA 1IKYA 3MGJA 4ED1A 4OZNA 2YWHA 2KN4A 2VPWB 3B4DA 2G1DA 2R2TA 3DLBA 3MMCA 4HT7A 4OX7A 2VOOA 4CH7A 1TAUA 1LXJA 2BE2B 1RTDB 1TUVA 1NNDA 5SZTA 3CXCR 3GFYA 5D4OA 2HS0A 4DL4A 2OAUA 3FEXB 4NA3A 1C1CA 3OTBA 5E3QA 2LYVA 4J37A 4NWBA 2MZRA 4NYPA 1FTCA 4C7QA 1Q53A 4B17A 3ONQA 5GVQA 4BWJA 3SSRA 1X4BA 3GFZA 4DR6F 4F4XA 4M95A 4OLOA 2AQ4A 1N54B 1JWWA 1F0XA 2DHGA 5KFCA 3HHKA 2JLEA 1TL4A 3RRHA 2VFRA 2IHR1 1HNZF 2GQ2A 2FD2A 1S10A 1VQ7S 3BR8A 2HNZB 1MMLA 2UUWA 2WAQD 1GH8A 1U49A 1KEKA 4TY8B 4I1TA 1ZPVA 2GC8A 1X0PA 4ZP8A 1HYSA 2GGPA 4ELUA 2IM1A 3DMJA 2KG1A 3US5A 1T94A 3M8QB 3OL7A 2MKJA 1YJTA 2MZQA 2XY5A 2KZZA 4X2BA 4C4WA 2E7WA 1N52B 4FS2A 3UCUP 1VIXA 2VBWA 3IR5B 1Y7PA 1ZTTA 2BR0A 3ITHA 2C3YA 5T7LB 2CJKA 4IRDA 2FC8A 3PRBA 1HQEA 3C46A 2QLXA 1QUVA 2YKMA 1C1BB 1XBWA 1WTFA 1QSSA 1M5KC 1FF2A 2B6AB 3Q2SC 4RW9B 3BQ2A 1YTYA 5KG3A 2C3MA 3R5CA 2WK4A 4HI1A 5K8OA 1FDDA 2HPUA 3LH2S 1BC6A 2FHOB 4HDGA 1JLFA 1Y9OA 2BABA 3TR5A 2W8KA 4PKDB 2FGCA 3AAWB 3O8WA 3LP2A 1R8PA 3MUMP 1JJ2R 4Q43A 2CZVC 4NLVA 2FVRA 1P8GA 3DU6A 3FMWA 2HS4A 2C22A 3T5LA 1IQZA 3Q22A 1IKXA