4A4DA

Crystal structure of the n-terminal domain of the human dead-box rna helicase ddx5 (p68)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
253
structure length
253
Chain Sequence
b'PKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE ATP-DEPENDENT RNA HELICASE DDX5
publication title The Variable N-Terminal Region of Ddx5 Contains Structural Elements and Auto-Inhibits its Interaction with Ns5B of Hepatitis C Virus.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 77
structure length 253
sequence length 253
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4a4dA00
2WMNB 2HLDA 4WOPA 1JB1A 1B0UA 2EFCB 2GEDA 4MKIA 3BH0A 2REXB 2F43A 1ZNXA 1ZM4A 3PFIA 3A4MA 5AWFC 4PHFA 1E94E 2D2EA 4PAMA 3TSWA 3EPKA 3SBEA 5D3MA 2EWVA 1N6IA 4GDFA 2OXCA 1COWA 3AP3A 4BZPA 3PUXA 2WAYA 3X1DA 2Q9BA 1UBGA 4YXWD 4AYWA 2Q21A 4GOKA 1F2UB 3JZMA 4BLRA 2ZANA 3GLFB 3RVBA 1JAIA 2IHYA 1P9RA 3B13B 2GTPA 1VG0B 2IYZA 4Q02A 1Q1ZA 1EESA 1Z0DA 4DVGA 1CJVC 1KYIA 3CW2A 1Z3IX 4IDOA 4A82A 4DSNA 1JR6A 4V03A 1E0AA 1AGPA 1E96A 3A1VA 5CJPA 1XJCA 3Q5EA 1E2LA 1N6LA 2FWRA 3IEVA 4HLQB 4PANA 2RKOA 2VO1A 1OLOA 3FB4A 1FOEB 1RZ3A 1U2RA 3HPQA 4HUQB 4JBXA 3PENA 4QGAA 1NLZA 4UXJA 3LH5A 3TSZA 3QSYA 3CPJB 4I1VA 5B64A 4HLCA 4CEHA 4W5JA 3W34A 4BLTA 2RGXA 2YWHA 1G7CA 4HLUA 2JAQA 3EZ7A 4KYIB 5HCNA 4MDEA 1XPUA 4MA4A 4GNKA 4V0MA 1TQ2A 5KYKA 4XSHA 1P2VA 4LJ5A 1E2MA 3D8BA 2DWOA 2BC9A 5KDLA 3A37A 4M2LA 3SN6A 3H2YA 4LBZA 2ZTSA 2FE4A 1XPRA 2ZYTX 3ZH9B 3RNLA 3AGQA 3TW4A 1E9SA 4BLOA 1TNDA 5HZHA 5L3SB 5LBIA 4Q03A 5BXQC 2QE7A 3VR5A 4B3XA 5JS8A 5JJLA 2OLJA 4QBIA 3GLHE 3MLEA 4HSEA 1QG4A 2F1IA 2BM1A 1ZNZA 2XNSA 4P4SA 3QXCA 2R2AA 4JLNA 3U7GA 2QTHA 2XJ9A 1U0JA 1Q3HA 3SJCA 4NYJR 2YKGA 4CEJA 1HY3A 3FKQA 2JJ8A 4V02A 1ZM2A 4LRWA 3WHKA 4Q9KA 2AHOA 3TUIC 1GKUB 3LBHA 4CIDA 1GL6A 2QMHA 2GK6A 1ZIOA 4Q4AA 2BBOA 1L4UA 4URVR 2G9NA 4KFUA 4XD7A 4BASA 1Z6AA 5H1YA 3UXMA 4TSFD 3RS5A 4JLVA 3F8TA 2DCUA 5AUNB 1X86B 2OESA 4PHHA 3KB1A 5EP4A 1FZQA 3CH4B 4TN1A 1EFCA 4KSBA 4Q9IA 1TU3A 2CJWA 2XB2A 1YZGA 1SXJC 1VKJA 1FQKA 2BBWA 3HR7A 5CDFA 4QHTA 8OHMA 2PEYA 3DVLA 1XZQA 5BYKA 4KFSA 4X8HA 2DR3A 3U3OA 2X2EA 3TUZC 1S9DA 5LD2C 1ZP6A 2J9RA 1KIMA 1GUAA 5AUPB 1PUIA 2I1QA 1DAKA 2OBNA 4NONA 2YOGA 1KGDA 1Z28A 4YMTA 1G6HA 2XGJA 1RIFA 5ELXA 1YRAA 1KI6B 4TL6A 3GJXC 4YONB 5G41A 1VIYA 3TNFA 4HATA 1U98A 2LWIA 4TYYA 2GF9A 2XJ4A 4DB2A 4LJ8A 3P1JA 4G5OA 4DCTA 1ANKA 3VNVA 4AY2A 3K70D 2Q0HA 5KSPA 1DAMA 3Q7QA 4QHSA 1YHNA 1UAAA 1R5BA 3OF5A 1XZPA 4EAQA 3CPEA 4EIWA 4HLDA 4I1OA 3K0CC 2QI9C 4ZCIA 2FMXA 2J41A 1YZTA 4UQOA 3X1WA 1QZXA 1TAGA 2A5DA 3BAFA 4ZDWA 3VX4A 2CVFA 3RRZA 1P5ZB 1OV4A 4PQFA 5G3YA 3RS2A 1XMJA 2PLFA 2JLWA 5ANRB 5AJWA 3RRMA 4ZDIA 5FTJA 3I3SR 2CLSA 2H17A 2O0KA 1XD2A 3C41J 4B76A 1KO5A 3CWZA 5JFGA 3I8XA 3PITA 5FFMA 5SZIA 3PUVA 5J4YA 1Z8FA 3FDIA 2QSZA 2ATVA 2IUSA 2OZEA 1SXJB 4TL8A 2GCNA 4US0R 2PX0A 1P9WA 2AK3A 4BLSA 5LD2B 3V9PA 1CIPA 3IHWA 2WWWA 2R6CA 1ZD1A 4PAOA 3CZQA 2GJ9A 3K1JA 3EIHA 2REOA 1Z2AA 5C2JB 3LXRA 3D7MA 2VL7A 4H1VA 4TQAA 5JI2E 1Z0JA 4TLDA 4RD0A 5JEDA 4TT3A 1MO6A 4RFSA 3SYKA 2RGEA 2IUUA 2HUPA 4YMWA 4ERNA 3H84A 1IN7A 1KJYA 2YC2C 2ZQ5A 1M2OB 1GOTA 2ZUDA 3RS3A 1NIJA 5L3RA 2BOVA 4MRNA 1XMVA 1H8EA 3QXXA 4Z1MD 1R8QA 3WP1B 4IKEA 3BFVA 3C5HA 3R8FA 1X1RA 1W1WA 3GLFE 3NC0C 221PA 2OUKA 2VP0A 1NSTA 2KE5A 2BMJA 1C4OA 1WF3A 2DYKA 5LB2A 1SZPA 1N25A 1SGWA 3B60A 4TL9A 1W0JA 4XWKA 1OXTA 3LBIA 5JHHB 3FHCB 3IPYA 4PFSA 1KSJA 3EW9A 3OFNA 3AQ4A 1YZQA 4JLPA 4L4UA 4X8MA 4PC1A 4DT1A 4EPRA 4LYHA 2WJHA 4DKXA 5H70A 3WNDA 1AS3A 3CLVA 2IYSA 4IHQA 1BMFD 2J45A 3KXIA 5TVKA 3NKVA 3SYLA 1EWQA 1LF5A 1WQ1R 4Q7MB 3LDAA 1KI1A 1QVRA 2AKYA 1A1VA 3TK1A 1ZM7A 1P2TA 1II0A 1KKLA 1S9HA 1X3SA 4N0EA 2FZ4A 5JCZA 1P72A 4DUGA 2JGNA 1EX6A 2GDJA 1CR1A 1P6XA 4FMCF 2ZYWX 4TL7A 3W5IA 4QG7A 1GAJA 3O8BA 2RGNC 2WWIA 3NHAA 4C30A 2KI5A 3ZZTA 4KCGA 3KUDA 3U4QA 3EC1A 3THWA 3ZZ0A 5CK5A 2RGDA 3GLIA 2QGNA 2ZU6A 4LBVA 4PC6A 5KO2A 1DAIA 4B6FA 1CBUA 1KI3A 1WP9A 3FMPB 4NYMQ 2QAJA 4EQ6B 1IY0A 4PPGA 5KNBA 3B8HA 3LFUA 2RCNA 1RKBA 1SVOA 2CCKA 3MG9A 3Q85A 4DZZA 3OAAD 4B3DA 1JEEA 3AVUA 3FOZA 4GSYA 1AZTA 1QHYA 4PSKA 2BMEA 4X8LA 5EXXA 4ZKEA 4C0SA 5TDHA 4NYJQ 1ZCBA 1N5LA 1OFUX 1PJRA 1U94A 2AN9A 3ZS8A 1GL7A 3Q3JB 2ODNA 4C3ZA 3RRYA 5E7IA 3NH6A 2NO0A 2PMKA 4TWZA 2WBLC 4I4LA 5CLLA 1XJQA 2VTKA 4L8GA 3CB4A 2ZSFA 1LTQA 1XTRA 3GJ0A 1F2UA 3P4XA 1VHTA 3T12A 1G3MA 1E69A 5AK0A 3GLFA 3NIBA 4EFMA 3WRXC 4D82A 1UKEA 2ERXA 3AKYA 4IDPA 5KNCA 1KI7A 3M1IA 4HEJA 3L0IB 4UNNA 4IW3B 4M1WA 4CT4B 2JLVA 4QJ5A 2XSZD 5FL7D 1XXHE 1NRJB 1ZYUA 2F9MA 5CIQA 4AKIA 1CRQA 4US1R 1DBSA 2ODEA 4HUQA 4B44A 2QEQA 3G5UA 5JECA 1KO4A 2A9KA 3TW8B 3WNCA 2IYLD 1NKSA 2JA1A 2MSCB 5JRZA 3CUEF 3CH5A 1ZINA 4URXR 3LXXA 1OJLA 4B3BA 1TL7C 3QXJA 1XB2A 4MQBA 5KSZA 4LI0A 4RZ2A 3WXMA 1KK0A 4DEYA 3PEUA 4C0LA 3FHTA 2P6UA 4XTRA 1NN1A 4ITRC 4R71A 3H1TA 4LHYA 1ZC4A 5CM8B 2H57A 3KKMA 4JVSB 2P6RA 1T5IA 4DC9A 2FSGA 4DLRA 1H8HA 1ZAKA 2QZ4A 3TAHA 1OE0A 3GJ3A 1GILA 1U0LA 3T61A 5JEEA 2JDIA 4D0GA 4HAVA 3LVRE 3ZDQA 2VHQA 1LF0A 3AKEA 3GMTA 1F48A 2C95A 3PUZA 4RFVA 5A4JA 4Q48A 2J3EA 2MMGA 1T6NA 1YR6A 4Q5IA 2A30A 1U9IC 4B34A 1S96A 3VHXA 1GZSA 2BV3A 3KJIA 3O47A 4AK9A 5UKDA 4V0OA 4EUNA 4AYTA 3TBKA 2VP5A 2AD5A 2XOKD 3ONWA 3TUJC 1NF3A 5FBLB 2Y8EA 5SZKB 1SXJE 1VG8A 3PR1A 2G6BA 4UXIA 2A3RA 4WBSA 2ONJA 1E2EA 4KVGA 1YU9A 4FINA 4IVRA 5KSOA 1Z6TA 3K70C 3KQUA 3W3ZB 3BRWD 4ZDKA 5E95A 1E9FA 2JJ1A 1PZNA 2FFAA 1R8SA 2N46A 1RYFA 2QGZA 2ZRBA 3B1YA 3VMFA 3A36A 2J0UB 2CNWA 1GWNA 2QAGA 3E70C 3FPAA 3SJBA 2IW3A 1QHSA 3ZYCA 3B2EA 5TB5A 2R6DA 4DWJA 4IOKA 2QL6A 1G20E 2HXSA 1KI4A 2C77A 1YZKA 1OIVA 2FF7A 1EFHA 5FPHA 4E5UA 3FVQA 2GXQA 4LHVA 2JCSA 1NN5A 1E79A 1AQYA 1Q0UA 1TF5A 4MRPA 4YDSA 5CYOA 1RE0A 1JI0A 2ZYVX 1AS0A 2B8WA 3G0HA 1J70A 4QGGA 3R7WB 5IK2A 4CEIB 1KJWA 4P31A 1P73A 3N2EA 2V54A 3V00A 2FSFA 4D80A 1WE2A 1ZJ6A 1KI6A 4Q9LA 2ZJOA 1CEEA 3NDPA 1NMYA 3DL0A 4P3YA 3UMFA 1G5RA 1W46A 2AFHE 4MYCA 2Q9AA 4PQYA 5DISB 5BN4A 3CNOA 5DSZA 4L5BA 3LW8A 4TTPA 1KMHB 4YC7A 4IDQA 3QY0A 5IDVA 4WA7A 1KDRA 3GLGB 4BZQA 1HQCA 3I4LA 1P9NA 4P33A 4QGFA 3THXB 4DLUA 4LJ7A 1CLUA 2FJUA 3K70B 2ZYUX 2RHDA 3KUCA 1WDTA 5KOYA 3C5CA 3H86A 2C03A 5DN6A 5FBVB 4Q21A 1U8ZA 2ODWA 2GXUA 2VF7A 2AK2A 1GIAA 2WOOA 2R9VA 3HYRA 3C14C 2HYIC 3D31A 4LV8B 4BE7B 4ASUD 3P32A 4K81B 3W9YA 3CR8A 2PBRA 3TQFA 1G5TA 1FNMA 1OH7A 3TRFA 4P4UA 4A4DA 1SXJA 621PA 1KK1A 4Q9JA 2WWYA 4HB0A 2YC4C 1SHZA 2GZDA 1P4SA 2WSMA 1C9KA 5E7JA 4YMVA 2GCPA 5FTNA 3AF3A 4ACBA 5HZKA 1II8B 3QUSA 2P3SA 4CYMA 3T15A 2EU8A 2WMOB 1K5GA 4RKFA 2DFLA 2ZJAA 4C7OB 4M1YA 2EFHB 3L82B 3UK6A 4EJSC 4CT5A 5EUQB 4LK2A 1E1QA 2CLCX 2OCAA 4AKHA 4DDVA 1HQYE 4AYXA 3BK7A 5CM9C 1E2QA 2D3WA 3CX6A 1NIPA 1WCV1 1NMZA 1RRGA 2R44A 1ZUHA 2VHJA 2WJIA 3UG6A 3I8SA 3MD0A 2IWHA 1N6NA 2HJVA 3GLHB 1JR3D 4II7A 5AUOB 1U0HC 2XXAA 1MO5A 2VEDA 4FIDA 3MWKA 1YR8A 2VIIA 2QP9X 1DVRA 2FNAA 4JLJA 3QVUA 2F3TA 1NBME 2HT6A 1F6BA 1XTSA 2IS4A 1G21E 1OKKD 3KQNA 2IEYA 3KL4A 2GK7A 2V6JA 4BZXA 1DAHA 4US2R 2GCOB 1JXOA 3GJ8A 1UKYA 2ZI7A 4G1UC 2FG5A 1HEIA 5B2ZA 4ZIRB 3MJRA 1KO7A 1KY2A 1U81A 1YQTA 3ECCA 1MKYA 3DMNA 1T3LA 3B78A 4LCBA 4TMWA 2ZR0A 2PLRA 2RH5A 1OH8A 2NZ8A 1YKSA 4ARZB 3RABA 4QJ3A 3WY9A 4PX9A 4FMDF 3JVUA 4G5RA 2GJSA 3AP2A 4GMXA 1DARA 4C4PA 4EJSB 1G16A 1TX4B 1CTQA 3BWDD 3EG5A 4JYBA 3W3AA 4EPXA 4EQ6A 4L15A 1MV5A 4GT1A 4BFSA 2N1BA 1SKYE 4HB4A 1XTIA 5E4FA 4KYUA 1XTQA 3FFAA 2ZVQX 5GADl 3W6PA 3AP1A 1LVGA 1MT0A 2ZRMA 4KLZA 3U6KA 1P60A 1E9DA 1Y63A 4A0HA 1PLJA 3P4YA 1VPLA 4QJ4A 2WKPA 3RHFA 1E1RA 1KZ7B 4OQFA 1SVSA 3QKRB 3O8RA 3L0PA 2I1VB 2FOLA 3B1XA 4BFWA 3KTAB 5FI1B 3UATA 2J0VA 2CXXA 1MH1A 2C9YA 2N42A 2WWGA 4IFEA 3SU8A 3UANA 2QMEA 1SVMA 4HB3A 5FTLA 3HU2A 4BEJA 3BFXA 2QQ0A 2GKSA 3T5GA 2RGCA 4ZCLA 1P62B 2Q3MA 3IILA 3CF6R 4YXWA 1GDDA 2JIZD 4FXPA 4C0AC 2JATA 3ZGXA 1DO2A 2FGJA 2RGNA 1AA9A 1R6BX 2C96A 4R2IA 3U60B 2WM9B 2QPTA 1N0UA 2QT0A 1M7BA 3NBYC 2GBLC 3PV0A 3QENA 4PC7A 2RHMA 5AJXA 1WXQA 3NEYA 1YZNA 3PG5A 4F92B 4LC0A 2D7CA 1J8MF 2FEMA 1A5TA 2RAPA 4PZZA 4MH0R 2C04A 1QF9A 3MWYW 3VQTA 3UWKA 1S2MA 1IAQA 2OO7A 4O2RA 1J7KA 1QHHB 1F3OA 1UBEA 2O0JA 3R9WA 4NCNA 3AVTA 1G8PA 1I2DA 2H8KA 5KU1A 1S3GA 2FA9A 1AKYA 1Q12A 2H92A 1CJTC 1W4BA 5EP1A 3KKNA 1HURA 1W47A 1HA3A 3ZQJA 1F2TB 5J47A 4EFLA 1NJFA 1CS4C 4DCSA 1KSGA 1I4DD 1V43A 1WBDA 2RGAA 1OHHA 3L0SA 4FWIB 2CE7A 4IJMA 3GLGE 5F98A 1NG1A 5FBRB 4OHYA 1N6KA 5FR1A 4Z51A 2YZ2A 3NBZC 4LX0A 1D5CA 4IXNA 1BOFA 4TQ9A 2OE2A 2WOJA 1F5NA 1US8A 3FKSA 1OH6A 1BIFA 3A4LA 3WRYC 1N6PA 1NBMD 1SQ5A 2J46A 4OI2A 4JSYA 2HT1A 2OCYC 2ZE6A 2KBEA 4GP6A 3CR7A 4KLNA 4DLXA 2OSBA 3K0FB 1T3HA 4PTLA 5JS7A 3RWMB 3AVYA 3L43A 4JZKA 4D2IA 2NGRA 1Q21A 4KSCA 2PT5A 2ZSAA 3EIQA 4RD3A 4Y0VA 4RZUA 4XWAA 2H5EA 4M53A 1LV7A 3FMOB 4D4LA 3IDQA 4MKHA 3W8NA 3VKHA 1KNXA 2A5GA 5DHFA 1FMLA 5JWHA 2IS6A 2B7CA 2IS1A 1LNZA 4NZYA 3QPWA 2PL3A 4U02A 2HLDD 2ORWA 3REGA 4A92A 3SQXA 2G3YA 5C4GB 1OSNA 1TF7A 5KPJA 4M8NE 5G40A 1C1YA 2O8DB 3MFYA 1E32A 2BVNA 1T3SA 3GPLA 3CRRA 5GJVC 1EFRA 4NYMR 4KAXA 4KI0A 2XZOA 2O8FB 2BWJA 2VQSA 2YYZA 3QBVA 3R7WA 2ZJ5A 4CEIA 3KQHA 1JNYA 5FOXA 4D25A 1IY1A 2NO1A 2PZEA 4M1KA 2VSFA 4IOJA 3ZLJA 3P20A 1EX7A 4M9XA 4GI7A 2QSYA 1F60A 3W6NA 3GFPA 1GKIA 2R65A 3TVDA 1Z6YA 2B21A 3AVQA 1GITA 1KMHA 2BJVA 2W6JD 1EWRA 4JBYA 3ZVRA 3SQWA 1W2GA 3GLGA 1R0WA 3KQKA 3THXA 2AWOA 3QPUA 2MSEB 3EWSA 1G3QA 2O8CB 2ZREA 2O0HA 3EX7C 4DXAA 1ETUA 1FUUA 4B2LA 3RS7A 4BFZA 1UADA 2C2HA 1G4AE 1WRBA 1AK2A 1E9BA 5J4VA 1S4QA 2IYUA 2NG1A 4H1UA 2JLXA 1DOAA 1KSHA 1ZM9A 3BH7A 4JJZA 2QNRA 4E03A 4BPBA 1XXHB 1N0WA 3QBTA 1YVDA 2BKEA 4OQMA 3REFA 3KZ1E 3I72A 1KI8A 4MYUA 3PUYA 1XRJA 4TZ0A 4AIIA 1IXSB 1IXRC 1LFDB 1GNPA 3IQWA 2Q6TA 2OCBA 4KO8A 2XEXA 5FUYA 5IF9A 1NNEA 1UEJA 3NC1C 5DIFA 2XAUA 3BGWA 4HDCA 4N0DA 1TTTA 2IF2A 2GXSA 4IFBA 1PV4A 3I5XA 1R0ZA 4HZUB 1II8A 3RDPA 2DWQA 1GRRA 2Z83A 3B1WA 4JT4A 3U7HB 2EFEB 4WXPA 1W2HA 1N5JA 2CL0X 4C7OA 4WZ6A 4DSOA 2UZ3A 3ADCA 1NN0A 5FOWA 4BUJA 4QXAA 3QPVA 2BIFA 4NBSA 1HT2E 4HDOB 1XBTA 3LBNA 4OK6A 3OIYA 2DBYA 1SVWA 2O5VA 2IWRA 1UM8A 2ERYA 1R5NA 3MAAC 1RRCA 3GFOA 3GLHA 4I81A 4D6PA 4DLSA 3LWNA 3HPRA 4YDHB 1Z6GA 4XSGA 5EUMA 5C18A 1ZVQA 2CHGA 5FBQB 1FTSA 4LYJA 3TGPA 2B7BA 4V0LA 3PCRB 4QGHA 1HV8A 2V1UA 1PLKA 2HCBA 2V8OA 1SKQA 4OL0A 4F38A 5DYIA 1YJ5A 4HI0E 2PJZA 4OI1A 4DB4A 2GCOA 3U7FB 4TYWA 2WKRA 5DE3A 3Q5DA 4UJ5A 2AL7A 4ZIRA 3AVVA 2VSOA 2EQBA 2DFTA 3ZZUA 1XTKA 2DY1A 2ZJYA 2QBYB 1GRQA 4AURA 2V4ZA 3HDTA 3WBJA 2OAQ1 4ZPXA 3RYTC 2DB3A 1Z07A 1KJZA 3RAPR 3AGPA 3EZ2A 3CONA 3QG5A 1R0XA 3NXSA 3TMKA 2VLIA 1JQJC 5AUQA 4EJSA 2X2FA 2J7PD 3ZD6A 1VG9B 1KOFA 3WYGA 4KVAA 4B2PA 3VKWA 1G7RA 1XEWX 5DYGA 3VX3A 4TLEA 5EE5B 2G0NA 2XNDA 2O8EA 2AWNA 1X8LA 4PPQA 2W2TA 2OILA 4JVLA 1ZBDA 4Q18A 3VFDA 3SI7A 4TLBA 1KK2A 4NPHA 3OAAA 3RANA 1LW7A 521PA 1TF2A 1VMAA 2R6AA 2ZSBA 2IYRA 3IIMA 3QKRA 4J0QA 4B33A 5FOTA 1IQPA 2A5YB 1OPXA 1QVAA 1Q20A 3WMEA 3KTAA 2ZI6A 3QKSB 2OEPA 1G19A 1UFQA 1NLYA 3W6OA 3OEED 1Z08A 4PPFA 4PPNA 5HKKD 3DOEA 4LUCA 4HB2A 3IUYA 1KKMA 1OFHA 3LY5A 4NU0A 4CZ2A 4QBGB 5FOVA 2OBLA 2WVJA 1BKDR 3B9PA 4M1SA 3LQRA 1NN3A 4MUBA 3H0KA 3RLFA 3O8CA 2IXGA 2E1RA 1DAFA 3K0EA 4CF7A 2AFIE 3UMRA 5JBQA 2G1JA 2V3CC 5G53C 4DBLC 3NDBB 1JJVA 5DGXA 1VYUA 2HXYA 1K5DA 5L8VA 3SJAA 2A2ZA 2EWWA 1G18A 1KDOA 5CLQA 4Y0AA 1VDZA 3L8ZA 2CLDX 5FTMA 1CULC 4UNPA 1R5OA 2GEVA 1E4YA 2ZETA 4JLDA 5FOUA 4W7SA 2F1HA 2GHIA 4MRRA 4XOIA 1OYYA 2GVZC 4RD2A 5FL7A 2NPFA 2RB4A 3ADKA 2O8BB 2GZAA 3KDSE 4IXMA 2BM0A 1AN0A 5FI0B 3UIEA 4MDFA 1H8ED 1Z5ZA 3BE4A 4R98A 5JJIA 1XCPA 5HTKA 4DLVA 3DKVA 1G8GA 1X6VA 5HR5A 4LHZA 2J0QA 4BRWA 4EPTA 4CRWB 2EYQA 1I4TD 2FPMA 1F2TA 4ZI2A 4WAUA 2H16A 3OZXA 3QF4B 4Q4HB 1IY2A 4BFTA 2KBFA 5EE0A 1RYHA 3KFVA 2GF0A 1ESNA 3KX2A 1WA5A 5EP3A 3U6BA 1TQDA 3OFND 3THYB 2QENA 4Z8YA 2Z0MA 4JKYA 3B5JA 4M1TA 2ZJBA 3RC3A 1SHKA 3BC1A 5DI9A 2ZI4A 2C98A 3GJ4A 4AG5A 2V7QA 2B92A 3K0FA 2IXFA 2P0EA 4KODA 4FWTA 5FH9A 1W36D 1W44A 1Z0AA 2YWFA 2IYXA 5JI3E 3C15C 2ZRJA 3TLXA 4A0RA 3EC2A 3VR3A 3BIFA 3ASYA 3GJ5A 3JVVA 1G6OA 4B3FX 4A1FA 121PA 1L2TA 4CGZA 3RRNA 5F3WB 3P26A 1PVOA 4P4TA 5FPYA 4NCIA 1OXVA 4NP6A 4NYIR 1CR2A 3DPUA 3OIUA 1U8AA 5AJVB 2OXRA 4JLOA 3K53A 5JSZB 1YZLA 5FL3A 1MOZA 1MO3A 2ANBA 2ZIAA 1X8JA 3CO5A 3NTUA 4OHZA 4XH9B 3IIJA 5FUWA 2J1LA 3KFXA 3GFTA 2ZI5A 3BD9A 3NHBA 4BFUA 3A1WA 4XVRA 2O8DA 3QKUA 5L3SA 2QORA 4TYQA 3EPHA 1SKYB 1ZU4A 2XX3A 4QBHA 1IOZA 2F55A 2QMUA 4CDGA 2O8FA 3QEOA 4C0QC 1ZIPA 4TTRA 4JKIA 2F43B 3TR0A 2F1RA 5CK4A 4O2LA 5CYPA 3TH5A 5A0FA 1UF9A 1JR3E 3TIFA 3BB4A 4OJQA 1EGAA 4MYHA 1QDEA 3GEHA 4JJKA 4OK3A 5GJWC 2Z4RA 2HDNB 2UZIR 1FL9A 1MR3F 1ONBA 1M7HA 4DDWA 1XCMA 2HF9A 5TARA 4S35A 3GJ6A 1Q44A 2VPPA 3DHWC 1DE0A 3QVVA 4XIGS 4QC2A 2O8CA 3KJHA 2IC5A 4O3MA 2R6FA 4TMZA 2GZHA 1N5KA 5JHGB 3T06B 3A1UA 2EYUA 1Z63A 1CXZA 4BLQA 1XTJA 3MJHA 3A6PC 3C4JA 1CJKC 5EXSA 2F9LA 5GVSA 4W9MC 4E22A 2VP4A 1XXHA 4NCHA 4BFXA 1S1MA 4PXAA 3I62A 2W6IA 1JXMA 3PQCA 4FCTA 1A2BA 1N6OA 5B58C 2IF0A 2GJKA 1UDXA 3PXGA 5BYJA 4ASUA 1W49A 2VA8A 4K8OA 3VR1A 4DCNA 1NY5A 1KI2A 4A15A 3X1ZA 3E1SA 2IXEA 3ZIAD 3T1OA 3IO5A 1RW4A 3CRQA 3SEAA 3EWAA 4D0LB 1HYQA 1N6RA 4OKSA 1FX0B 4URUR 1KTVA 1N5IA 3OEHA 2JLZA 3SDZA 4KFTA 2J7KA 4B3CA 3PJRA 4GFDA 5K8LA 3OE7A 2XTNA 2WIAA 5HPYB 2PJRA 4ACAA 3ADDA 4TYNA 2GNOA 2QROA 1JPNA 4UNSA 3DOFA 2XTZA 1KSFX 3IBYA 2JASA 2V6IA 1IXZA 2IYVA 3K8YA 1LS1A 2J5XA 3EAQA 3U3RA 3CNLA 5JCPA 2CHVA 3QXHA 3O8DA 4NMMA 5L3QB 3TR5A 3FWYA 4WZAE 1Z2CA 5EP2A 1W5SA 1DEKA 2IEZA 1JR3A 4B48A 4UKDA 2JJ1D 3SFVA 4Q1EA 1FPMA 2QT1A 4RD6A 3UKDA 4B74A 5DLQC 2WPDD 3L2OB 4QOSA 2ZE5A 2CNWD 3QKTA 2JEOA 3I73A 1Y3AA 1ZUNB 4NTZA 1UBCA 3THOA 4N1AA 1FQJA 2JJ2A 2QUZA 4U00A 2EVWX 3MWLA 1VTKA 2NOAA 2ZUBA 4OQLA 3QE0A 2C99A 4FN5A 4DHEA 2QBYA 3PIRA 1OT3A 1R4AA 4M9SA 2KB0A 4E07A 4F4CA 4AC9A 3DZDA 1Z0KA 2CMKA 5EZ6B 3EPLA 1VHLA 1JEDA 1KAOA 3ZVNA 1LY1A 4KJZA 4EFNA 4QM6A 3ZVLA 2GRJA 2J59A 2C78A 2ZI9A 3PUWA 1HTWA 1G7SA 2CCGA 1YRBA 4MGZR 4ILEA 3CF0A 2ZU0C 3CZPA 3UG7A 2QP4A 1W0KA 3HU1A 1T9HA 1DAEA 1E9CA 3K0CA 1G7TA 4KU4A 3CRVA 4RD1A 5FPSA 3B6EA 4BRUA 3VKGA 2ZRPA 3KB2A 1T5LA 3BBPA 5HE8A 1Q22A 4PZLA 1FTNA 3VU9B 3AB3A 1AM4D 2YOFA 4DLWA 3W5JA 3U7EB 3VR2A 4A9AA 4JVNA 3EASA 4ABYA 2PEZA 3LRPA 3ZS9A 3A8TA 5DN6D 2DWPA 5CJ2A 1PUJA 3QKSA 3B9QA 3T34A 3SNHA 1V5WA 5J40A 1CU1A 1EXMA 4NYIQ 1KK3A 5KUTA 2ZSEA 4GMDA 4DDTA 4Q1BA 1Z0IA 5BW8A 2AX4A 2GJ8A 4Q9HA 3E2IA 4LC1A 2IYWA 3LX8A 3IIKA 3B82A 2WWFA 1T8TA 5HCIA 1IHUA 2IHBA 3ZQ6A 1NVUQ 4QFMA 1CP2A 2IBMA 3GQBA 4PSVA 5KNDA 1VCNA 3SFZA 1OB2A 1E2KA 2EFDB 2FSIA 1NJGA 1W48A 1IJFA 1T91A 4JIMA 2YINC 4DLYA 2RMKA 2TMKA 2JIZA 1JBKA 2D4HA 5EJEA 2MMCA 1W36C 2XTMA 1JQLB 2IUTA 4DSTA 1QHGA 5TV2A 4A36A 1TEVA 1E2PA 3LV8A 4M1MA 1G8HA 5M04A 1E1QD 2O8BA 1KNQA 2HEIA 1LS6A 4BEBA 4LBYA 3U3MA 4H9GA 1OFTA 5K8UA 4JS0A 4V0NA 4MITA 1J99A 2QN6A 3U44B 1D6JA 1VG1A 4W5HA 4FCVA 4TMXA 2GAAA 3RS4A 3WNBA 4QHYA 1A4RA 1KAGA 3F5FA 3QF4A 3TSOA 4B32A 4YQFA 4ESHA 4Q4HA 1ZM3A 1AQUA 3WBKA 1W4AA 2ONKA 3X2SA 4IVQA 2CE2X 4RZ3A 4PHGA 1P75A 3T35A 3WP0A 2SHKA 3AUYA 3I5YA 4PO9A 2G83A 2C9CA 4URYR 3THYA 3CX7A 1GRNA 3MUFA 1W4CA 4IRUB 2PCJA 1NL3A 3ND9A 4A8JC 3CPHA 1I4LD 3IO3A 2UKDA 3A1SA 3QI2A 1ZW6A 3FFBA 1NBMA 1WB9A 2BBTA 4YMSA 4R7ZA 4D4JA 1BS1A 5CITA 3PEYA 2OBMA 3EZ9A 2O52A 4LPKA 3SHWA 1XEXB 5KDOA 2XB4A 2Z5FA 3N70A 4QM7A 2BKUA 4V0ME 1RPZA 1E2FA 2ZS9A 2OAP1 2WICA 2QM7A 2P2LA 1CJMA 2IA5A 3U2QA 5JSZA 4RCYA 1W4RA 1IN5A 5SZJA 3CRMA 4LWZA 2QA5A 3AM1A 4DCUA 2H1LA 1S0UA 2Z4SA 4KV9A 4C2TA 2VH5R 4HAYA 1E0SA 2F6RA 4P0TA 2NO9A 4B73A 1Z83A 4W5WA 1WMSA 1XEWY 1CKEA 5EE1A 2WSSD 2X8AA 1DG1G 3RSOA 1ESMA 1K8RA 5GJCA 1NP6A 4CVNA 3U61B 3SBDA 5DI3B 5H68A 2D62A 2W0SA 3KXKA 4Q1FA 3R8CA 4A8JB 3QNUA 4MKGA 1E0KA 3SJZA 2VHTA 2ZRDA 4B35A 1N6HA 2ZEJA 3NG1A 4LJYA 4UXHA 2JLUA 4MGIR 1XD8A 4E09A 4UNQA 2P67A 4P32A 2CK3D 2OFOA 2PX3A 2WV9A 2FFBA 3LA6A 3NBFA 3LLMA 4Q7JB 4LJ9A 4Q4JB 1MRNA 1TMKA 1NVWQ 2BJWA 1XX6A 3BB1A 3CM0A 4LHWA 3CNNA 4U7DA 1TU4A 4F91B 1Z6XA 1G291 1E98A 2NO6A 2ZRCA 1G8YA 2W6JA 4B75A 2J0UA 1SVKA 2FGKA 3L0OA 1UDWA 2AXNA 2FPKA 3IQXA 3U5ZB 2V55B 1QG2A 2CDNA 2ORVA 3OIVA 4GP7A 3W90A 3VR6A 5CDFE 3NEJA 3ADBA 1AGRA 2BCGY 1UEIA 4TSFA 1AZSC 3TE6A 5EXTA 4NL4H 1GNRA 1O87A 1T8UA 4ZKDA 2DFNA 4R9UC 4D4KA 5KTYA 4LYAA 3AH8A 4PO1A 1DG3A 4M21A 2J0SA 2QAGC 2ZPTX 3SE0A 3FMIA 4UNRA 1BYUA 1RFLA 2D06A 1UPTA 1OFIA 2JLRA 4IOLA 2ZRNA 4NCJA 2KSQA 4D81A 1Z47A 1FFHA 1COWD 1JECA 5AR1A 4C0HA 4BECA 4HUTA 1OIWA 1OHHD 3AKDA 1U9IA 3IEUA 1ZD9A 1FX0A 1Z22A 2LKDA 4GL2A 1VYTA 3B85A 3TAUA 3FKSD 1QBKC 2ZJ2A 1ZC3A 2BCJQ 4KITB 2CVHA 1GFIA 1GSIA 2IYTA 3B1ZA 3BORA 1NVVR 2D2FA 4DDUA 3NH9A 2ZRHA 1K6MA 2R62A 4DSUA 4RVCA 2WIBA 2HCJB 2BHRA 2CL6X 4HYYA 4OI0A 3FGNA 2WJJA 1IN4A 4PR0A 4JMPA 1YR7A 1ODFA 4TZ6A 4WW0A 2VP6A 4Z54A 2WTUA 1RJ9B 3MRSA 4I99A 3LO5A 2FSHA 4NCKA 4WXRA 1BO6A 1E3MA 5L3QA 2WAXA 3EZ6A 2ZJZA 4FMCB 5H8WA 4V0KA 2F1JA 3PEVA 4F4IA 2NIPA 3KJEA 3VNUA 2FH5B 5EXPA 5IRCD 1LB1B 1E2NA 2ANCA 2ZE8A 3AF1A 1Q1EA 3QQ5A 4JL5A 4UJ3A 1GVNB 2JLQA 1E9EA 1L7VC 2VBCA 4TMTA 2ZRGA 3Q72A 2IK8A 1X1SA 4AI6A 1IJEA 2QRZA 1EFUA 2QAGB 3PVSA 1TQ4A 3LW7A 4Q1AA 3S1AB 2WZQA 3QXSA 2G0TA 1JJ7A 1TEXA 3LD9A 3J81k 2YNMA 4G0NA 3BH6A 2QE7D 1IBRA 4A6XA 2OHFA 3DM5A 3QG1A 3W8RA 1EFRD 1OXSC 2OV2A 3K9GA 4LZZA 1TPZA 2YV5A 2HF8A 3Q7PA 4JSTA 3HU3A 4KHZA 1RRFA 2YVUA 3B1VA 2ZRAA 5FUXA 1A2KC 1G3UA 1VYVA 1VIAA 4NH0A 4Q47A 3RC8A 3MWJA 2RGBA 5BN5A 1R10A 1X8KA 3N5CA 4JYCA 2OFXA 4TLAA 2VRWA 2G1KA 1XU4A 2J7PA 1ZU5A 3WHLA 1ZCAA 5TXGA 4PZYA 2K5UA 2R8RA 4OHVA 5JWRA 4MGYR 4LJ6A 4Z1MA 2HJGA 3VU9A 1S8FA 3A58B 4IEIA 3MGCA 4TQUS 5F9HA 4FMBB 1JPJA 4QNRA 4XD7D 1SULA 2ORIA 5K8IA 4G5QA 1UJ2A 1VECA 3K0AB 2HV8A 2QM8A 1GL9B 1KO8A 3SR0A 1W5TA 3IBGA 1KY3A 1XPOA 4RD4A 4M9ZA 1G8FA 4TTQA 3TKLA 2VHCA 3DEFA 2B6HA 1JAHA 1T4GA 4GOJA 1BMFA 1UBFA 3OEEA 4FD2A 1G4UR 4B47A 5HKKA 2Q9CA 1ZUIA 4IDNA 1QHNA 3GLIE 1U99A 1M6NA 2QU8A 3BFKA 2FV8A 3T5DA 1FP6A 2PZGA 4ARZA 5D3QA 4JBWA 3DKPA 2QRNA 4G5SA 2QMOA 1EFTA 1Z0FA 3LAWA 2JLSA 3P27A 2C8VA 2FFHA 1R7RA 1H65A 5FR2A 3K09C 2AD1A 4Q19A 5DHAA 2CEAA 1PLLA 4DEXA 2X19A 2VYFA 1QHXA 5JWOA 3WMFA 2ZRKA 1J8YF 4LGMA 4MKFA 1FNNA 1P2UA 1II9A 4M9QA 1XEFA 1SVIA 3KJGA 4B43A 2FEOA 4OK5A 3U44A 2BDTA 2OT3B 4OI4A 1N2CE 4GBMA 1QHIA 5FUVA 2ZAOA 5TMPA 4JLBA 4WVFA 4OJKA 4AG6A 4DRZA 4PQRA 1MABB 1XDBA 1DTSA 1E2GA 5CB8A 2CCJA 2PCLA 4GOXA 3SC3A 4LYFA 2XXAB 2OG2A 1G1MA 1IN6A 4Q00A 5FOSA 3WYAA 2D74A 1U8YA 2FFQA 2NPIA 2P5SA 4NDZA 4Q1DA 3TQCA 4BFYA 4A2PA 2L0XA 3AVWA 3CBQA 3U3KA 2E9SA 3ICEA 5DNYB 3DO6A 1ELOA 2CL7X 1YZUA 3HYTA 1E2HA 2B8TA 1EK0A 5KPDA 5E7MA 5F2EA 3GEEA 4OHWA 5LPNA 2H7VA 1P7CA 2ZR7A 3GJ7A 4JLAA 3EARA 2GEUA 1OIXA 4OBEA 2V9PA 2RGGA 1ZMXA 4RCZA 1G3IA 5G3ZA 3VAAA 4Q7LA 3OHMA 4TT3D 2XSZA 3CF2A 4LOAA 5C1BA 3I92A 4I1UA 1XEXA 4QKQA 1P2SA 1TQ6A 3AKCA 2ZROA 2MSDB 1QHHA 3FYHA 4C2UA 1E2DA 4URZR 1HT1E 4EKDA 1GKYA 5L3VA 2V1XA 3SHFA 2FU5C 2NO7A 4S2EA 4D4MA 1NVVQ 4PAQA 3HR8A 2ZS7A 3T1VA 2XNDD 3D6TB 5JRJA 2J87A 1KDTA 1D2EA 5J4KA 1VCIA 3A1TA 1D9ZA 1DELA 1J90A 2YWEA 1FMJA 2GETA 2A78A 1CR0A 1W0JD 1HE8B 3MMPA 1J2JA 4RJLA 5EZ5A 2I3BA 3C7KA 4YLGA 3MSXA 2AKAB 5DI3A 4YMUA 3VHLB 4C0JA 4MRSA 4QBFA 3SS8A 4DIDA 1UKZA 4POAA 4A8JA 4XWOA 2ASEA 4ZO4A 5LB4A 3N2IA 1I2MA 4MUAA 1Q1QA 3DM9B 5EQTA 2WJVA 2EW1A 2QG6A 3F3YA 5CIWA 3ZVMA 2ZRLA 3WYFA 4LV6A 2IL1A 4ZV4A 2GBLA 3FE2A 4DUGD 5A5GA 2GWHA 1KMQA 4C9BA 2FN4A 4TMVA 4BLPA 2QTFA 3WMGA 3BERA 4B3GA 4FCWA 4Q4JA 5BWMA 2XOKA 4C0BA 4M0LA 3ICQB 3ZD7A 3BXZA 1AJEA 1N3BA 1FUKA 4HDQB 4LY6A 4WIAA 1HH4A 3I32A 3KXLA 5GVRA 2ZE7A 1OH5A 1OW3B 1R2QA 3UWOA 3SZRA 2YHSA 4JL8A 2A7QA 2WWHA 1G41A 4OQXA 1N0VC 1R0YA 4G5GA 4Q66C 4QNMA 3U3JA 2KWIA 4U5XA 1NG9A 1YR9A 4M4SA 4LV5B 4A0FA 4BWYA 3M4YA 4AKGA 3A4NA 4HLUC 4A6PA 2QQEA 4HAZA 4M22A 3AF0A 1ZD8A 2GVDC 2X1VA 3PEWA 1E0JA 3EZFA 3ASZA 3RS0A 2G77B 3EXAA 2EFGA 1CRPA 4KBFA 4PC3A 2X77A 3KQLA 3KKOA 2PZFA 5KHOC 2OCPA 2VHUA 2VP9A 2ZRFA 2FDCA 2ZVPX 5BN3A 3CRW1 5D3MB 3ZIAA 4IEEA 3IKJA 1L8QA 4QRHA 2IYYA 4AD8A 4JL6A 3E5HA 1D8TA 4IVPA 4MRVA 1E6CA 4EPYA 3ETLA 4N3NA 2FZLA 4KBGA 5P21A 4LDJA 2V7QD 3CKLA 1US8B 1KDPA 3EPJA 4G01B 1P3JA 4L9WA 4GZMA 3AF4A 3H4MA 4MGKR 2PMDA 5KSYA 2NZJA 4XVQA 3T1QA 2YJTD 1RJ9A 1E9AA 1G3RA 1XP8A 3B7GA 2YOHA 4Z8XA 5K8TA 2ZITA 3X1XA 1CF4A 1ZNYA 2REBA 3TJZA 4ESVA 2XZLA 3HP1A 2HYDA 4X8OA 3OIWA 4DJTA 1QRAA 4HAUA 2BEKA 3DDCA 2Z43A 3F0TA 4FMDB 2VF8A 3AF2A 1DAGA 1XD9A 2CBZA 3VR4A 5KDDA 5HE9A 4CEHB 1Z06A 3ND8A 2QY9A 2BMFA 3KKPA 1NI3A 2WPDA 1D2NA 1JALA 4JLMA 1ZRHA 1S1CA 2CHQA 1H8HD 5C46F 5TY0A 3L8YA 1IONA 4PSAA 3S1AA 3D3QA 4HZUA 1AIPA 2JDID 2ODBA 1W7AA 3GCGA 4JLKA 5BQ5A 5SZHB 2AR7A 2WWXA 5FTKA 4BGDA 3LVQE 2WJGA 2ZI3A 1U90A 4WZBE 1GP2A 5J4HA 3VTKA 2C9OA 1NMXA 2QTVB 4A0GA 1ZNWA 1M74A 5GJBA 3I61A 4F4JA 1TUIA 4P4SB 3K9HA 4OHXA 3NWJA 4DLZA 1M34E 2H18A 4TYPA 1G5PA 2ZRIA 4O25A 3NVAA 1MO4A 3DMDA 2WJYA 4ZDJA 4CEJB 2E87A 4FI3C 2PT7A 2KJQA 4RSGA 4B71A 2ZAMA 4B2IA 3FTQA 3BS4A 721PA 4Q1CA 3LNCA 2R6GA 2ZSDA 3K0AA 3IGFA 4XTCS 2NMVA 4Q4AB 4QL3A 5AJZA 1P61B 1XMIA 4D26A 4IOMA 3SOPA 4PC2A 1M8PA 1OKKA 4A2QA 4RY2A 1YE8A 2Q3FA 5FBWB 1DADA 3V4RA 1NSFA 2W6ID 3AVOA 1OF1A 4HAXA 4NHOA 1E79D 1G64A 1M1YE 4L9SA 4AWXA 5C4MA 3R9XA 3OESA 4F7WA 1RC8A 2W83A 4HAWA 2QPAA 4F93B 1CJUC 4KFRA 2CJWB 3ZJYA 3M6AA 3LLUA 3RSLA 2ZJ8A 4GZLA 4RKEA 2P5TB 1NVXQ 4XVUA 5IK2D 3GP8A 2P65A 1A82A 2GA8A 2Z6VA 4GPTA 5IT5A 4NE2A 1OXUA 3UMSA 3FHOA 3OEHD 1IM2A 1E4VA 2XZPA 1S3SA 1E99A 1E2JA 3K0SA 2A5JA 2NQ2C 5AJYA 1A7JA 3Q9LA 3OE7D 1AKEA 1E2IA 2NTYC 3JZAA 4GRAA 1GG2A 2DPXA 1XJ0A 3QF7A 3UPUA 3CX8A 4EDHA 1XCGB 4LJ4A 4ON9A 1XF9A 4M1OA 4CW7A 3K9LA 4IDHA 5JZVA 1TADA 3I1FA 5EE3A 3CIOA 1T0JB 2BMDA 1FP7A 2IT1A 1SVLA 2VP2A 3AEZA 1Z29A 1MABA 2ZM5A 4MYTA 1AS2A 4RZXA 3TVTA 1T0HB 5B30A 821PA 5JJKA 4G3XA 2WHXA 2W2XA 4AKEA 5EE9A 2ZS8A 2P6NA 1BYIA 1KHTA 2IS2A 1SXJD 2AXPA 2IX3A 2D7DA 1BH2A 1G9XA 1MRSA 2OM2A 421PA 4BFVA 1XD2B 5FPKA 2XITA 2JJ2D 2VSXA 3IHLA 3R9IA 1UKVY 4LSGA 1OXXK 1RVDA 1G17A 4A2WA 4K46A 1CR4A 1OB5A 1E9RA 2FPLA 6Q21A 2ATXA 1GTVA 1NKTA 3MCAA 5E3HA 3IPXA 4ZI3A 4JT2A 2F7SA 3EIEA 3K09A 1B23P 3LX5A 3FMFA 4URWR 2Q3HA 1L4YA 2ECKA 3NBXX 4C0KA 1TUEA 4I1SA 3RWOA 2JLYA 2FX3A 2W00A 4LJAA 1IN8A 3C8UA 2LKCA 3CWQA 3SYNA 1KO1A 4RFSB 1FW6A 1W0KD 3KKQA 1M7GA 5F9FA 2GJAA 2W2VA 2G88A 4FW9A 5IHPA 2C5LA 3AUXA 4EPVA 1XMSA 2GXAA 4BQSA 5JLJA 1DPFA 3QEJA 4XJXA 1DS6A 4HZIA 1HE1C 3M0EA 2BBSA 3G82C 2LCFA 1EG7A 2O8EB 4PHTA 1HUQA 4Q01A 3QJYA 1NLFA 3T1TA 4OYHA 2DHRA 3QOFA 3GD7A 5J4LA 1GM5A 2OLKA 5FPTA 5J5CA 2WSSA 2ZUCA 1VCMA 1OYWA 2QPOA 2DFKB 4B6EA 3GEIA 2ZXUA 4DCVA 4DT1B 1DO0A 3DZ8A 4DLTA 2WKQA 3EA0A 2GESA 4DIEA 4OQNA 2UVQA 3HWSA 5DH9A 4KXFB 3BB3A 1KZGB 1VCOA 3AVPA 2I4IA 4D0NA 3HJNA 5DO9A 1D2MA 2W0MA 1W36B 1Q3TA 2GAOA 3QIAA 3LQQA 3V4FA 2CK3A 3AVXA 3EA5A 4Q7KA 3R20A 4JVMA 1Q1BA 2QP3A 5JMTA 1Q57A 2IYQA 1KI9A 3AV0B 2F3RA 1XNJA 3U4QB 3THWB 3X1YA 3BJIC 3GLIB 3BOSA 2BEJA 2W58A 4PO8A 1D9XA 3C16C 2OFWA 2PH1A 1NY6A 1XFAA 2ZR9A 3Q8XB 4R2HA 1WBBA 4LBWA 1O3YA 4O0MA 1RRPA 2A5FA 5B57C 4TLCA 5CB6A 2YWGA 4NKRA 4Q4LA 4ZCMA 4EPWA 5LDDC 3K9NA 4LHXA 4LPSA 1E1RD 2GILA 1XWIA 4TMKA 4L16A 1GNQA
chains in the Genus database with same CATH superfamily
2WMNB 1GV1A 2HLDA 4TUYB 2GPJA 2ZAGA 4WOPA 3D3NA 2JS7A 2AQIA 1ZNXA 4YFVA 2H2FA 2G63A 1PWYE 3A4MA 1FC0A 1STOA 3IQZA 5CHEA 4PAMA 3HB9A 1N6IA 4GI2A 4NNPA 4WOJA 1Z18A 1N2CB 1VLLA 3AP3A 3HJGA 3TN7A 5I8PA 4HWOA 5ADHA 1GG5A 1UBGA 3BJEA 2QVLA 3VAZA 4JC8A 4Z86A 4KOEC 3GFSA 1P33A 1F2UB 1KQ3A 2ZANA 1NVDA 2DT5A 4J9VA 2P62A 4G56A 4ALLA 1JAIA 3B13B 1F4VA 1GGHA 4KB5A 5EWJA 3L46A 1EESA 3U80A 1D0VA 4DVGA 3USES 1JE1A 1Z3IX 4IDOA 5D7BA 1ODTC 4NBRA 3WNZA 1FVOA 4Z2AA 1D1SA 1X9GA 2DMRA 1E96A 1MGPA 1XCBA 2H4YA 3BCUA 4L4XA 5CJPA 1D03A 4YRCA 3F3SA 5TPWA 2L82A 2CYBA 3SQOA 4HLQB 3WGKA 3UNXA 5KYXA 1LUAA 1P1KA 3SP1A 1SC4A 2ZYDA 4GI3A 4Y2JA 1FLAA 1ZKMA 2Q8PA 1EFVB 3PENA 4OP2A 4QGAA 4ENVA 4NENA 1BHJA 1RWNA 3TSZA 2WRZA 2WUEA 3FR8A 1O1YA 1YJ8A 2EDAA 1QRSA 5LP6C 5KHLB 3EZ7A 4DV0B 3SNKA 3EVGA 1T26A 4DYHA 1TQ2A 4YALA 5K03A 4BKUA 1EM6A 5BWNA 1XRSB 2C8LA 1NNLA 1NZFA 1VLHA 1GCUA 4C6HA 4QYIB 2V7TA 2VDOB 3QFFA 1QZTA 1BN6A 3HWX1 4YO8A 3CYFA 5MN4A 2B99A 3PDCA 3H2YA 3QVWA 1C30B 1BFDA 1IWBB 1SUBA 1ECLA 2HIGA 3R3HA 3H2KA 1Q1NA 3R5KA 1V7ZA 5HBGA 1RRKA 3TW4A 1E9SA 1UR5A 2D1FA 3AJ8A 1TNDA 4URFA 4AZWA 4DE5A 5L3SB 1XZEA 2QE7A 4OIMA 4BMSA 5JJLA 1ZUD1 2J33A 2X5XA 3PP8A 1BQEA 5ELMA 5DLPA 3MLEA 3S7ZA 1ZNZA 1VRVA 4HFNA 1B3RA 2P6OA 3HJCA 2VZ8A 5KS2A 1CZOA 1SELA 3T1HB 1PR6A 3QXCA 2R2AA 3ZC3A 4JLNA 9LDBA 5KSWB 1V11A 4IWNA 1QC5B 2XJ9A 1U0JA 1U2GA 1JA1A 3E5NA 3R7NA 2YKGA 3UV3A 1YL7A 3FKQA 2VYVD 4G8BA 1B2LA 3ZWNA 4CM9D 1DRKA 5K3BA 4J7AA 1NC1A 1FP2A 4V02A 2Y3IA 2BFFA 4BPRA 1ZM2A 1I7LA 1DQSA 1E66A 1XQ6A 3CSDA 5JYEA 1NXQA 3TMYA 4DUZB 1Z5WA 5H5JA 4EO4A 1JG1A 4CIDA 1JJFA 2VBIA 4WT7A 1DKMA 3H5WA 2FR8C 4RPHA 2NN3C 2I9KA 4LDAA 5CDGA 4E4YA 3EWNA 3DC2A 4UZEA 3IPLA 4BASA 3ETCA 1PJTA 2VQ6A 1R27A 2CKDA 2IOQA 3H87A 1TTQB 4P7GA 1I6MA 4TMYA 5F4ZA 2EGUA 3VDQA 2WU1A 1JYFA 3TOXA 3DTVB 5FLXA 1PR2A 5EP4A 4TN1A 3UA4A 2A4KA 1TU3A 1IMOA 2XB6A 1FQKA 2BBWA 3HR7A 4ETWA 5CG1A 5G0SA 3I1IA 4NEHB 4CTMA 8OHMA 4XKJA 4JXXA 1Y4ZA 3D64A 1YB6A 3ZLTA 5JAHA 1N2OA 1WW3A 2YASA 3C3JA 3FH0A 3FMVA 3U3OA 5LD2C 4YT5A 1HDXA 1O5IA 1ZP6A 1KIMA 3DHEA 4PICA 3VO8A 1QLWA 1E3JA 2A88A 2I1QA 3KOWA 3AHHA 4S1NA 4BX0A 1G5HA 4D9IA 4IR7A 4F5WA 5BWLA 1Z28A 2XGJA 1TMGE 3E58A 4MULA 5FA5A 1YRAA 4TL6A 4WA8A 2X0NA 3LFTA 5G41A 3TNFA 2LD4A 2W6OA 5J23A 5ARCA 2QVGA 3E53A 4TYYA 2XJ4A 3DE0X 4LJ8A 4RPLA 1FF9A 1U1GA 3L8MA 4XPIA 5KSPA 1DAMA 3OCVA 3PR3A 3U0VA 1XZPA 1QX3A 3FIJA 4EIWA 3TDNA 2QI9C 4I4CA 3UJAA 3WLLA 1TMYA 4JI8B 1YZTA 4UQOA 3CVYA 3SQNA 3JD2A 2A5DA 3BAFA 3AETA 3FBGA 3RYFA 1P5ZB 1OV4A 3RS2A 3E9CA 4BDSA 2PLFA 4X24A 4ZEWA 4FT4A 3H2ZA 5AJWA 1QG6A 3HXKA 5ANRB 4BMZA 5CAEA 5JS6A 4U0KA 5K0NA 3IMFA 4LDRA 2O0KA 4MVYA 5EUCA 1GY8A 1FK8A 4XYBA 2EIXA 3DV2A 4BB5A 2CB9A 1NMQA 3KS9A 3QVMA 3FDIA 4GR4A 4QAQA 3ICWA 4XFDA 4BO4A 3HKCB 4WKOA 2OZEA 3JALA 5TX7A 1F8UA 4ZMRA 2YXBA 4ZTUB 3E9YA 2GCNA 2DLNA 1OZHA 3L6BA 1C2TA 1FP4B 2A1IA 1DUVG 3TFOA 3U7QB 2QU7A 4PG5A 4EECA 1Q17A 3LWDA 2YHIA 1TXGA 3IHWA 2WWWA 3KQVA 5JSKA 4N0QA 3BQNB 4CL8A 1ENOA 2Y2VA 3PJFA 5GPBA 1E8MA 3LXRA 1U2SA 4MINA 2RHWA 4B7ZA 3SQDA 1GXSA 3WLOA 1PS9A 2W6CX 2HUPA 3ACBA 5LSAA 4YUZA 4EG0A 3O8OB 3TLBA 3GFRA 2DQSA 3IBCA 3RKUA 2BOVA 2H51A 3LHIA 4KMSA 4MRNA 5DBEX 4Q3LA 1JAYA 3C5VA 1XMVA 3ZY4A 3K20A 4Z1MD 2XUOA 2D00A 1P77A 3EC7A 1NYRA 2C0PA 3C5HA 2VXCA 2C9BA 3GDWA 4TV8B 3GLFE 1UUFA 3DEJA 2FDRA 3I0ZA 3NC0C 5DEIA 3UY4A 4CKWB 1NSTA 2KE5A 1RMTA 2BMJA 1WF3A 1EUDA 2W2PA 1N25A 3IQEA 4P7JA 4CF6A 1XZJA 1NUQA 1T25A 4KWHA 4JODA 5DKFA 1OXTA 3AY7A 3LBIA 3FHCB 1MB0A 2AFHB 4PFSA 1QRDA 3OLXA 2BTQB 4J0KA 3EW9A 1CW2B 1OLSA 3AQ4A 3OFNA 4D9FA 4B8WA 1KEEA 1BJKA 1PJ3A 3U19A 5JPDA 4LYHA 2WJHA 4F8JA 3E7PA 1FLDA 2FXVA 3CLVA 3VU3A 2OOKA 1NJ6A 1HYGA 3LTNC 4XEHA 2QJFA 3KSUA 2I7CA 1EWQA 2DKOA 1V71A 3SYLA 4CV1A 3D6HA 3LDAA 1KI1A 2RI1A 2X2PA 4Q15A 3B5EA 2A92A 3D2BA 2QVBA 4GXQA 4HRVA 4N65A 3TK1A 4F5YA 3FF4A 4GXRA 3D6UA 3KHKA 2MINB 1MX3A 4MW0A 2VDVE 5K0JA 1P6XA 2ZYWX 2NU6B 2HIMA 5DOZA 1ZONA 2IQ5A 2YFQA 1FDIA 3JQDA 3ZWWA 2WWIA 1QDUA 5CA1A 4GX1A 3ZZTA 3D3KA 6YASA 3EC1A 1YS4A 2XAAA 2NYAA 1WDMA 3D7KA 1K6IA 2WJ6A 2XVAA 3E3LA 5DT2A 3OX3A 3IUJA 4LBVA 3JWPA 5BORA 4BVEA 1CBUA 1KI3A 3FMPB 3NDJA 1D2AA 4HQNA 2QAJA 2FWAA 2J8ZA 1M6HA 1B74A 1SR8A 4FZRA 3B8HA 4UATA 3LFUA 5GM2A 5BSFA 1RKBA 1SVOA 1WSAA 2HQBA 2OB1A 5DGHA 2COEA 1CB7A 3AL2A 3DBHB 4UMFA 3E84A 5LDGA 4DZZA 1JEEA 3FOZA 3HH8A 3ENWA 1AZTA 4PSKA 4PRLA 5A4FS 3H11A 1NPTO 3ISVA 4B0OA 4H7IA 1SCUB 1ZCBA 2C59A 2GX6A 4KJXA 4GOLD 1L4MA 1GM5A 1GL7A 1PDOA 2J3JA 3Q3JB 4Q34A 5EIAA 1QS0A 3RF7A 4R1PA 4C3ZA 1KQGA 5A6VA 2XECA 3BMNB 3NH6A 1G5QA 1A27A 1ZH6A 4G5YA 4EL0A 1O96B 1F9EA 1JP7A 1QTIA 3RADC 4LXHA 3STXA 3DCYA 4KAFA 1RCUA 3CB4A 4O4IA 5BVGB 3QFRA 3GJ0A 1CQIA 2FRDA 1EZ4A 3H1FA 1CWUA 4XDGA 1GNVA 5C5DA 1G3MA 3R5FA 4EZBA 2UUBB 3CVOA 1HT3A 3P0IA 1K88A 2C3YA 5KNCA 1JPUA 3VJKA 1HEUA 4C03A 4IW3B 5EGNA 3K4QA 5GGYA 4QPJC 4P6VF 1SZDA 4JQZA 1LBSA 2C4MA 2HAEA 3DMRA 2R6HA 3PGKA 3PQ6A 4Y6LA 4YASA 4IEFB 1G21B 3OMWA 1J5XA 3UK2A 3CVUA 1EFKA 1NBEA 1NRJB 2Z9BA 1JSZA 3QWHA 3SIRA 4HCJA 4US1R 1WS6A 3RASA 2ODEA 2M1ZA 3ETEA 2QEQA 3OKAA 1KO4A 1QH1B 3WNCA 2IYLD 1CZRA 1NKSA 4RMJA 1PJQA 2ECOA 4LXUA 3CUEF 3PDJA 1F6DA 1Y37A 3CBGA 1H69A 3ZE9A 1OJLA 3QXJA 1SMKA 5KSZA 3RAJA 4I36A 2VR1A 3FSGD 4DEYA 3PEUA 3HCRA 3BWBA 4RQTA 4DSUA 3ZK9A 4EG3A 3KYDB 1Q11A 5TC4A 4O4JB 4G2TA 3INTA 4UFNA 2NWQA 3KKMA 4JVSB 1DRJA 1T5IA 4DC9A 1U0BB 1N9KA 1OE0A 5ICSA 4OGLA 1RWMA 1VI5A 1Q16A 3UV7A 3V8QA 4L4RA 1LRKA 3RFTA 2NZXA 2WHEA 2XF8A 3LYHA 5HRCA 2Y2UA 5BRAA 3PWZA 1LF0A 1SZJG 4XRGA 3F9RA 3AY6A 2PUCA 4W6QA 3P2KA 4Q48A 5LZ7A 5TMEA 4GYWA 2J3EA 3EJWA 1O0SA 1T6NA 2CWWA 3JQRA 1Z4MA 3DV0B 3OD5A 1U0EA 1WKCA 1XLWA 3NGXA 4C87A 4EQ6A 5DT9A 2AF3C 1VL8A 2OV6A 3KJIA 4GLJA 4EVSA 3IUMA 3QEMA 3PYLA 3FUUA 4EUNA 2O1SA 1PHPA 3N3AC 3RJ5A 1GGNA 3ED1A 1WZEA 1NF3A 3DO8A 3P2OA 3T7TA 2Y8EA 3E4DA 5IH3A 5T4FA 5U4QA 3SQLA 5CD9A 4BCBA 4Y2QA 3F6CA 4WBSA 2HA6A 2ONJA 4EZEA 5FP0A 4M1QA 2P68A 1YU9A 1FU8A 2QR2A 4M0EA 3T6KA 4LXQA 2AYYA 1Z38A 3SM9A 5KSOA 3SVZA 4GICA 3KQUA 3PXAA 2VOJA 3LZ6A 5ALMA 2JJ1A 4ZDKA 1R8SA 4PXSA 3B1YA 2GASA 5E1BA 3EGDB 2HWKA 1NT2A 1Y80A 2SBTA 3KJQA 2J0UB 3ZJ4A 1GWNA 1CJCA 1FYDA 1BMTA 3TF5A 3J7AC 2C4WA 4MHSA 4G25A 5TQJA 5TB5A 3FDFA 2R6DA 3N8DA 3ZZ1A 3KZNA 4IOKA 5DM2A 2QL6A 2GBCA 1I4OA 1RTTA 5BUSA 1GUFA 3Q9NA 3C5EA 1DP4A 2XUZA 5ERXA 4PZ0A 1GDHA 5FI3A 2WD8A 2AW5A 4LHVA 2HW8A 2P1ZA 1AQYA 4WXEA 5ABPA 1SM4A 2YQ5A 3O4RA 3TQHA 1NM5A 5IH7A 2GN4A 3A3YA 3HDVA 3TW0A 3V1MA 1W5BA 1KVSA 2I2BA 1E7SA 1AS0A 4NG4A 1QE3A 4ZAFA 3DWFA 4KMOA 4K03A 3U9LA 5CFQA 4HWRA 3G0HA 2V98A 1WCXA 1C9EA 1BCRB 1DRVA 3Q4GA 1RDFA 4YECA 1KJWA 1P73A 1KFKB 3N2EA 3TSAA 3G0CA 3U56A 1SCDA 3ZUPA 3C0KA 2ZJOA 5EHNA 3PVCA 4RM3A 2QD4A 3DL0A 1TAUA 3G3EA 3FB1A 3U3ZA 1RI3A 5CPBA 4PQYA 1UQTA 2G04A 2VI5A 3IPAA 4MW1A 1XCOA 3LW8A 3QLTA 4EI8A 4CLOA 3TEJA 4EW1A 3HDQA 2CXUA 1Y5NA 2JBAA 3HO8A 1UJ6A 2B2NA 3MXTA 3I4LA 4FBMA 1P9NA 4UHBA 4C7XA 3GLGB 3ID6C 3QHAA 4FIZA 1B1CA 1SQ0A 2A59A 2VJOA 4FYKA 4LJ7A 3OUZA 4ZRMA 3K70B 1DCKA 1SUAA 3JWJA 3NR2A 3DNMA 4IIDA 4E0BA 1ORHA 4L27A 2MSKA 5FBVB 2XYRA 4Q21A 4M0KA 3ABOB 4TKVA 3QELA 4D3ZA 5ESWA 3HYRA 3C14C 3RVMA 3TO5A 3D31A 1U2QA 3ODGA 4BE7B 3V2IA 2VG8A 3PFKA 4JGBA 4NJEB 3Q8KA 3AL3A 1JW9B 1U2TA 4K81B 3CR8A 1U7TA 4I9UA 4NK5A 2VF4X 1ORTA 2ES4A 2V3VA 2QUAA 2PY6A 2O05A 3HXMA 2QN1A 1GTSA 1SXJA 4PQEA 2OKCA 1EXDA 3VUFA 5IVKA 4B7UA 2AV6A 4UOQA 4X7BA 1PTJC 4ZD6A 2YC4C 4XM0A 2FPPA 2GZDA 3L8EA 2PTGA 4U9UA 1C9KA 3R40A 4ZTBA 2I03A 2CL5A 5AVUA 2ZZMA 4ZVVA 1BMDA 5FTNA 3H6KA 1ZH4A 3UMBA 3D6AA 4M6WA 4ACBA 3TR6A 4UTXA 2QPLA 3SLRA 2XDQA 1R16A 1FCJA 4CYMA 2G80A 1QYDA 2E85A 3EHDA 3M5CA 2NUTA 5K9ZA 1GZ6A 4M0CA 4RKFA 3EH1A 2ZJAA 1VE6A 4QPDA 2UYGA 3UT6A 4DG9A 4D8YA 1M2OA 2CLCX 2OCAA 4QUJA 3OLWA 2NUAB 5HWSA 4WZBA 5D1NA 5I9TA 4AIRA 3D5EA 4G26A 2P27A 4KAJA 4OOFA 2CJXA 1RRGA 2ADFA 3IP8A 4P84A 4ZARA 4BN5A 2XRMA 1QCZA 4ZO9A 2IWHA 1Q7CA 2WFAA 3GAMA 3AWIA 5F2KA 5CBPB 4N9QA 1RD4A 1U0HC 4YV2A 3K1AA 3GAAA 2YMQA 4RE6A 1M34A 1YR8A 2PRJA 4FGZA 1GR1A 4FGKA 1W0CA 3RUPA 4EKEA 4DBLE 1W88B 4P7FA 2O7VA 1DSSG 2GO1A 1OUMA 2CLOB 2BFCA 3G85A 4QUHA 4WLEA 2HT6A 1F6BA 3AHGA 3HSSA 5B6JA 4EYSA 2IEYA 4N7JA 4QTTB 4JJFA 4HXGA 5HX7A 5K0TA 5IJ0B 2VSNA 3FW1A 1F0NA 4L5IA 2GCOB 5KJ6A 1UKYA 2ZI7A 3GGOA 3GEBA 2NSLA 4HBGA 2WKWA 2C2ZA 4AP9A 5B2ZA 4Z53A 1AN9A 3KLOA 2CJPA 2C0QA 1Y1SA 3ENVA 1K8YB 4RBNA 1MT3A 2QRVB 5IG2A 2PWZA 3ROFA 2JKZA 1RWKA 1T3LA 1RJFA 3D4PA 4RVHA 4EVIA 4KN5A 2BEWA 2E1PA 4K0KB 3C45A 5AICA 3C7DB 4CKEB 1TD9A 4ARZB 4E6EA 4PX9A 3RR2A 1T8RA 3FOFC 4KE8A 4W7IA 1DX9A 2REQB 4C4PA 4JUDX 3AFMA 4EJSB 4YMHA 3E1GA 3EG5A 1PX0A 3GYGA 1JFVA 2YY5A 4H6VA 4J0IA 2OV3A 4XI9A 4C78A 4EPXA 4N41A 2Z8YM 2X8JA 4GT1A 4KPUA 3L92A 5EYPB 4BFSA 5HSGA 1M1NB 5BQXA 1N2SA 2N1BA 2AEFA 3BEDA 3BTOA 4YJHA 4MCJA 2PS1A 3FFAA 4Y9TA 1O4WA 4NZPA 3NIDB 3VR2D 3PFWO 2I55A 2GM4A 2H9IA 4GRDA 2NU8A 1MT0A 2BP7B 3WWZA 3U6KA 1KARA 2NYUA 4OVKA 1PLJA 4L3OA 3P4YA 3VZPA 3EGEA 4QJ4A 2WKPA 1XCJA 3BIOA 3DHNA 3RHFA 5D85A 1B0PA 5AYVA 3RJZA 3KQSA 3FTDA 3D4LA 4MQLA 2BKAA 5K09A 4N82A 3CT4A 3CJTA 1W96A 4M0MA 3B1XA 4B46A 3KTAB 3D4IA 2A1UB 5GY7A 5FI1B 2GHQA 4FFSA 4RV5A 1U0FA 2WHRA 4KR2A 3PQFA 2ZSJA 3RCBA 1GVHA 2EQ5A 3RRJA 1SVMA 2A58A 3HU2A 4EYQA 3BFXA 4MDYA 4BWVA 4NFYA 4CG1A 4PIPA 2GKSA 3EDMA 2YN2A 1WDWB 2RGCA 4ZCLA 1A04A 1TJNA 3RTEA 3CZ5A 1NR1A 3BMOB 4OUDB 3DOJA 1RBQA 3O95A 1GDDA 3OMXA 4FXPA 4NMHA 3QBJA 3DF9A 4WNIA 1V95A 2JATA 4Y6SA 5J5AA 1DO2A 5CT5A 3IP5A 2MCFA 2C96A 4BMDA 3U60B 3JD0A 2QT0A 1DJQA 4PC7A 1AUOA 5A03A 2GBLC 3UO8B 1SIBE 3QU7A 4OJMX 5IHXA 4MVJP 3PG5A 4GS5A 2R1VB 3KVRA 4PVCA 4LC0A 5TR9A 2D7CA 3RVNA 4LF5B 4RLQA 3WAJA 1A5TA 3D4NA 4K9DA 2RAPA 1L6IA 1H0RA 1U8TA 5E4JA 1A1SA 1EZ1A 2PRZA 3ABSB 4XQ0A 4MIKA 3VO2A 4UHCA 3QVGB 1TDJA 1V1MB 1L4NA 3UWKA 1IAQA 3DPSA 4O2RA 2CZGA 5EHGA 3SEFA 1H0KA 3X2EA 3DQPA 1FQWA 3V8NA 3KPJA 2ZYIA 1G8PA 5KU1A 2H8KA 4YPFA 1O58A 1ESDA 4DR2B 1XVLA 1AKYA 2H92A 4MKXA 1CJTC 1MB4A 1W4BA 2HNAA 4BOYA 2R1TB 3FZEA 1ND6A 1W47A 1AOXA 2HHCA 1HA3A 4YWHA 2WD9A 2CNDA 3ZQJA 7GPBA 3K6SA 2VJMA 1W73A 1CS4C 2EDCA 3T3EA 4E5VA 4FPXA 4TTJA 1JJAA 1QTRA 3LYUA 3GJRA 4IJMA 4OHYA 3RVPA 3SC2A 5C8VA 4RENA 3N39C 4LX0A 4X1YA 1YE5A 1D5CA 2N75A 1BOFA 2QX6A 4QQNA 3WQSB 1F5NA 1OH6A 3C5WP 4Q3BA 1IK6A 5DNEA 1T36A 1N6PA 1NBMD 1SQ5A 2EF0A 3CW9A 5AKEA 4PGMA 1Z2EA 2XKAA 3WZLA 2ZB3A 3WRXA 4FZ5A 5I47A 4O2AA 2XIJA 2HT1A 2ZE6A 2KBEA 1I0ZA 3A14A 2QS9A 1OI2A 4GOND 4GP6A 4Y3UA 4DLXA 2FB9A 5E6SB 5KYWB 2HBQA 4CV3A 4UEKA 3STTA 4RQBA 2NQ8A 4EYGA 1NU8A 1T3HA 4ZT5A 3SZ3A 4LE1A 4Q4JA 3RWMB 1YKGA 4D2IA 1IZ9A 4LDQA 2NVUB 1M1UA 1G2IA 1LQ2A 1T5DX 1TTHA 2VAWA 2X7JA 3AR6A 2F17A 4KSCA 4RK1A 5JW6A 3FPCA 4PXYA 2AT1A 3DE6X 1YB7A 3V8BA 1QGYA 5F76A 5AM3A 2GN0A 5C5IA 4JI5B 4BGIA 1XZDA 2BRUC 2IQIA 1QUEA 3AO0B 1WPGA 2NXWA 2CC2A 2OXTA 3H9UA 2W93A 3VKHA 1E61A 1KNXA 3QJGA 5CVEA 1FMLA 3KAJA 1QH8B 5DHFA 3V48A 4HT3B 4Z5XA 1ZH8A 3O75A 5JWHA 3RSFA 2IS6A 1E1CB 3UK7A 2GYYA 2LW7A 1J5PA 3QVLA 4GNRA 4XD2A 4CIYA 1C1HA 1BXRA 1LNZA 2B1IA 3QPWA 2P75A 4N7BA 5LQJA 3L07A 1DEHA 2GZSA 2VP3A 1L1QA 3A3KA 4U02A 4F1JA 2AMJA 3ZTWA 3HCWA 1IQ0A 2GFHA 2BVNA 3RARA 1T3SA 3PNOA 3GPLA 4W5OA 3E9RA 1EFRA 4IH4A 1NMEA 3KZKA 4KI0A 5BXYA 2VQSA 4NULA 4IGAA 2RGWA 2AMVA 3EXHA 5B6IA 5DTMA 1T1GA 4PFJA 3BTSA 5FOXA 1IY1A 5SY6A 2I66A 3UT0A 4EY3A 2EGHA 2UU9B 3LHSA 3WLTA 3IEMA 2ILVA 1F7UA 3GUHA 3HA3A 3P20A 3VKUA 2C3OA 2VSYA 1H2HA 1SU8A 1X94A 3PD7A 4K9KA 3VPSA 2VCYA 3ZBPA 4CCSA 3N7TA 1XQVA 3NJ4A 4S2UA 2OL4A 2AB0A 3HI4A 2XB9A 1XAIA 2B21A 2QYSA 1Y7TA 2C1XA 4I6GA 1H1TA 2DWCA 2G0AA 1E6EA 2JIDA 1GPBA 3AEUA 5EI5A 5JQWA 2WTAA 3GCDA 3NUZA 1CC1S 1KEZA 1T6YA 2O8CB 2ZCUA 4ENTA 2ZREA 2FZWA 1EWTA 3FWKA 3LK6A 4FFPA 2IVFA 3D3WB 5EKXA 1R6TA 3IQHX 1ZZGA 1ZESA 2XVMA 3MTIA 3W7VA 3JAKB 4BJ6A 4J29A 3RS7A 2C2HA 4JITA 1AK2A 4P80A 4P8RA 4DQ0A 2Q5OA 4AM8A 4FR0A 1DOAA 3D3JA 1L8XA 3BH7A 3ZZNA 5HIAA 2O2ZA 3UICA 3ZDDA 3EUWA 3ZWAA 4H4DA 5K0EA 2VZ0A 1BHSA 4Q3EA 3KIPA 4GF5A 5A1TA 3KZ1E 3I72A 4ZCQA 3T5BA 1DXHA 4FD3A 3OT1A 2CLMB 2FUCA 3M3PA 3PUYA 4YAEA 5AHWA 2J85A 4UZSA 4BJ1A 2XOXA 4LI3X 4UHEA 4RQUA 4ZODA 1IXRC 1GNPA 2BTEA 2Q6TA 3NYIA 5CA1F 1CEXA 5FUYA 2VFAA 4CTKA 1TO2E 4W1SA 5I51A 1W34A 1P1JA 2JFVA 3BGWA 1CP3A 3GPIA 2ON6A 1J6UA 2GXSA 1BVRA 1J7JA 1QO7A 3H5NA 2PUHA 4HD8A 2QM3A 1T34A 4U8HA 2PVSA 2WE8A 3MT7A 3I01A 4P53A 1E59A 8ADHA 1ENZA 1II8A 1L7PA 3QMWA 2Z83A 2ET6A 3DWEX 3ENKA 4WXPA 1W2HA 5BPHA 3TNYA 4C7OA 1F1JA 2FP4A 2X4LA 1QP4A 4DSOA 5KYNA 4HMQA 3PTAA 1V3QE 1NJ5A 3WB1A 2GA9A 1HT2E 4QEKA 3VYUB 2C0CA 1C3OA 2CNKA 3IAXA 4X92A 2BEUB 4OK6A 3WKDA 1QVZA 2UZ1B 4HQRA 2DC1A 5FADA 4CBVA 3UH0A 2PBFA 4U2EA 1OX5A 1DBQA 4AB1A 4RL4A 2DEUA 1TJYA 4QDTA 5K3CA 3N7AA 1CFZA 2QLBA 3MAAC 2P79A 5JLAA 4CLRB 3GLHA 3NVKI 1S6YA 3QPCA 4MVJE 4NVRA 4MRMA 3TCNA 3EODA 3M5PA 4WTOA 3WX0A 1T8WA 3G5LA 1TFUA 1F51E 3PD0A 5E38A 1WOYA 1U5CA 1Z2PX 2B82A 3VDXA 1K7FB 5ULLA 4R01A 4TXJA 5C3MA 1HV8A 1A9PA 4O4IF 4TOIA 2OVBA 4ZGBA 2V1UA 5CB4A 1QK4A 2JARA 2Z6QA 2GM5A 1U2DC 4U5QA 4RDIA 2YJ5A 4OL0A 2YXEA 5C81A 3P5SA 4M87A 1YJ5A 3QNWA 1FMTA 2IZ1A 2PJZA 1QFXA 3FGZA 3Q7SA 2WKRA 4IBOA 4J0HA 2FYTA 5HJEA 5DE3A 1FDOA 1I5OA 2BR3A 1JLKA 2AL7A 3Q5DA 4H18A 4ZIRA 1U02A 1LDNA 3ZJVA 5FD8A 3GT4A 1CY2A 2VSOA 4HH3C 3JASB 3M6VA 3WRVA 4F5ZA 1XTKA 4YRIA 5JUWA 5G2OA 1Y3DE 3T4UA 2V4ZA 4G65A 4AURA 3WBJA 3A4YA 3LVBA 2AYXA 4KDRA 2FPRA 1KJZA 2O23A 4D56A 3AGPA 3KBOA 4XARA 3UMCA 1D3AA 3EZ2A 4XWYA 3CONA 5HZMA 5M7EA 3OT5A 5AUQA 1Q77A 3QX9A 1SQFA 1RAIA 2FQQA 1KOFA 4R4JA 3WYGA 1N0IA 3UPTA 4HHEA 1LXCA 5JQGA 3PXDA 3L7CA 2P41A 2C8JA 1G2PA 2X42A 4B3RB 1C8LA 3HI6A 1D4FA 3EGXA 3MLAA 3QWAA 2MR5A 4QWWA 5DYGA 1P8AA 4JD5A 4ALJA 1DTEA 3CRNA 4E7PA 1N5MA 1JIVA 3JATB 4PPQA 4X7PA 3CLKA 3DOCA 4R69A 4YI5A 3WGGA 5A62A 5JYCA 3VFDA 3LPAA 3TBFA 1QKKA 1H85A 3OAAA 5DX1A 5J63A 2PPVA 2DH6A 1UWCA 5JDCA 2R6AA 2ZSBA 1BROA 3BKWA 3N59A 2A84A 1NWHA 2VHEA 1MA3A 1Q20A 4LJLA 1K8QA 1HOXA 3I3OA 1FFEA 2ZI6A 3ZE0B 4D9GA 4EHHA 3HUEA 5COBA 3E3NA 3OFVA 1FFAA 3RUHA 3ITNA 3NOOA 2O2YA 1HZZA 1QOQB 1L8AA 1OFHA 4CZ2A 3O4VA 1TVKA 4QBGB 5FOVA 1XZLA 1Q83A 1BKDR 4GXNA 4M1SA 4ZXFA 1OZFA 1KAMA 5AOVA 3MHTA 3HLTA 3D7SA 3K0EA 1XZHA 3KCQA 1EX1A 5AXBA 2AFIE 4UUAA 1K89A 3GK3A 3CJRA 5IARA 2AG6A 4GYJA 4YRFA 5EKTA 1JKIA 3JR7A 4JP2A 4NOJA 1JJVA 3FD8A 3HY6A 1Z39A 2IEBA 1J0AA 4ZCTA 1VCHA 1KDOA 3GEDA 3IUQA 4Y0AA 5JXWA 1R6VA 3L8ZA 2EARA 5FTMA 3BHIA 1EP3B 5AI9A 1VMIA 4JLDA 1IXYA 1H2WA 3PT9A 5IZCA 2E3JA 3JZFA 3EZXA 1F4PA 1W75A 2G1PA 3FCEA 2R5NA 4YCCA 5FL7A 1YIOA 1YJAA 5E9QA 2C7RA 4GAEA 2RB4A 4J9UE 4RUKA 4KN8A 5LBTA 1SO8A 2ZIVB 3NT4A 3OZ7A 2YVKA 2BM0A 4JROA 3EEYA 4QT0A 1AN0A 2C2MA 3AOEA 4J1QA 3ZX4A 3TKYA 4ALIA 4DIUA 3UIEA 5CLFA 3LQ1A 1PBTA 3EFEA 1XV5A 1ID1A 2ZB8A 3FAZA 4O2BF 3DKVA 5HTKA 1UMDA 5DN9A 3U3XA 2BFMA 2G9VA 3RGWS 3A28A 3NXKA 5IMBA 4IZ6A 3M3HA 1W8IA 4C21A 5JDIC 1NDUA 1NW6A 3G1UA 3AUUA 3MQ2A 4K28A 5ITZB 2AJDA 2H16A 3QF4B 4RA9B 5KHAA 2HPHA 4D8UA 1E5LA 3I52A 1Z4KA 1VLVA 4Q4HB 3A1FA 1TYAE 2GN1A 2KBFA 3S2EA 2EFYA 1BOOA 2CZCA 4CIWA 4K3UA 1FVFA 2TS1A 1WA5A 2V5VA 3MOIA 3THYB 3GDFA 1U0RA 2I80A 4MMXB 2Z0MA 4BXOA 4JKYA 4Y67A 2ZJBA 3RC3A 1FDRA 3BC1A 5DI9A 5TGTA 4H3HB 4KQKA 2C98A 5EL0A 3WDKA 1KZ9A 3HXOA 3DULA 3F7OA 2P0EA 2GCEA 4I55B 1UMBB 1TT7A 1W44A 1Z0AA 2IYXA 2YWFA 3AEKB 3GAZA 3KT8A 4GWGA 4QODA 1AH2A 4FR5A 2J0EA 1FTGA 5JSUA 1XDGA 3AR3A 2SKCA 1G6OA 1O97D 5D1HA 4B3FX 4A2CA 1K4YA 4WD3A 3R6WA 3Q3IA 3RRNA 5LLTA 1N1DA 3GUCA 4WY2A 2FSUA 2JL1A 2OGWA 2Z98A 5K4AA 4C0WA 6ABPA 1DMSA 2Y0EA 1ESEA 2Q1WA 4TRNA 4WCFC 3ZQUA 1A9XA 2AFRA 2X9LA 1PR9A 5A4AA 3GFFA 3HMQA 4LOJA 1W36D 2PSFA 2VK4A 4RH3A 3M34A 5AJVB 4JLOA 3K53A 3O8QB 5JSZB 1I30A 1OAOA 4KGZA 1TZMA 1C7QA 4PZAA 1HT0A 2WJWA 4RHYA 2ZIAA 4C04A 3CO5A 6CHYA 1ZWLA 1R4NA 1GPJA 1MVNA 3Q10A 4IXDA 4AMUA 3C3PA 2BL4A 2X58A 5AVVA 3KFXA 2CBXA 5B7PA 2DR2A 3BD9A 1E5TA 4UM8B 1CZHA 4F2GA 1QAQA 1TZ2A 4GO1A 4XVRA 3PQ3A 1M76A 4ND8A 1YUNA 3IDFA 5KWIA 4QBHA 1IOZA 3EULA 2R86A 2C9DA 4JLWA 3VVLA 5FAKA 3VOTA 1ZDMA 4F86A 2WF5A 5CK4A 2FUKA 2JFPA 5CYPA 2BY4A 3TTUA 3EDYA 2ZYGA 1OBCA 3BB4A 3Q1LA 1TZJA 5CX1B 3CWCA 4AP6A 2KLBA 3KO8A 4DAOA 3EW7A 4L9AA 1RXYA 2VUIB 5GJWC 2HDNB 2AN5A 3ENQA 5EFOA 1FL9A 1JJBA 4D4IA 3H2GA 4GL4A 5ALQA 2X9QA 1M7HA 3NATA 1RCFA 2WG2A 1KYWA 2HF9A 4QRIA 1QZZA 4S35A 4LY3A 2VPPA 4KC0A 1DE0A 4QC2A 5FB3A 1Z35A 3GJQA 1HKHA 2AIRA 4ZQEA 3K92A 3HCNA 2IZ0A 4FMPA 4ZO7A 4TMZA 4ZN6A 5G1OA 5I7RA 2YWRA 1WSBA 4LHSA 1MW8X 4ND1A 3ET5A 3B7WA 1YD7A 3A1UA 3H19A 4IJKA 3URMA 1CXZA 1AUQA 5TPWB 4UTVA 4J0EA 2BR5A 4FHFA 4JN6B 1KU0A 4HY3A 1ZGBA 2W11A 5I7OA 4ODIA 2VP4A 1XXHA 4E22A 2CMGA 1V4BA 5BY2A 3U39A 1TZBA 4PRYA 1A2BA 1N6OA 5I8ZA 2ST1A 2ZDHA 5EXEA 4NENB 1QRRA 2IF0A 4YRAA 4BGUA 2VCEA 1UDXA 4LZWA 3EDCA 5BYJA 1W49A 4MS4A 1BFKA 2RARA 4PNPA 1JHQA 4F3CA 2PZKA 4A15A 5ENZA 2YYYA 2C88A 1GUZA 2MWMA 2JD1A 3IO5A 4TX1A 3UWDA 3DZBA 3SEAA 4IUYA 4EKYA 2JCYA 1ZO8A 3U7IA 2PKCA 4BB0A 1Z36A 2VNSA 1I7NA 3PHLA 3PVZA 3T7RA 3NPMA 4D0LB 3M2TA 5KMGA 1IYZA 4DR1B 4BMVA 2WTMA 5DBFA 3E0QA 3O91A 4BVFA 5LZ2A 1DIBA 4X45A 4FFBB 4KI7A 2Q2VA 3B6JA 3O4GA 4DIKA 3DD5A 1P44A 3EFOA 4KFTA 2PJUA 3M49A 4MPJA 2OQ2A 1ZISA 1WTAA 4ZOEA 2E7ZA 4HOYA 4B3CA 3PJRA 5AD1A 4GFDA 3MCZA 3KSMA 2UVDA 2WIAA 3MB8A 5HPYB 2PJRA 3ADDA 5EHIA 2NAPA 5L3ZA 4EVQA 4MLCA 1JPNA 3RUEA 3DOFA 4RELA 4OM7A 1XVVA 3OQNA 2JASA 2LXNA 1IXZA 3A6KA 3AFIA 2J5XA 1GRCA 3CEJA 3K8YA 3N9IA 4L0DA 3U3RA 3NTOA 4OB7A 2G5PA 4BNLA 1YULA 3D1LA 1KMMA 4Z0TA 1MDFA 4L75A 3TR5A 4BTEA 1ZH2A 4DIOA 2OZKA 3DJYA 1Z2CA 5ALUA 4JC0A 1W5SA 2YV1A 5EP2A 4CLHA 2YYSA 4PRKA 2BFEA 2JCGA 1WUTA 3BFPA 5DGDA 4DV2B 2K7ZA 3QA9A 3L2OB 5HKBA 2IPNA 1N8KA 3GUVA 4QOSA 2CNWD 4AN4A 2O9JA 4B45A 1Y3AA 5GIOE 2FN9A 1ZUNB 2Y9PB 5CVUA 1KY4A 4FC7A 1DV2A 2GM9A 1IUKA 3TJMA 1P8JA 1U1DA 4DLLA 4JNCA 4TWJA 4U00A 2EVWX 3WWYA 3FA2A 2BMAA 4OQDA 4GSLA 3UCXA 4CDRA 1AQNA 4YPVA 2AQKA 2HNKA 1Z0ZA 5HF6A 2ZKIA 3GFBA 5D7NA 4WMLA 1J2TA 5LOVB 4FN5A 1KH3A 1LPPA 3GP5A