4A4DA

Crystal structure of the n-terminal domain of the human dead-box rna helicase ddx5 (p68)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
253
structure length
253
Chain Sequence
PKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE ATP-DEPENDENT RNA HELICASE DDX5
publication title The Variable N-Terminal Region of Ddx5 Contains Structural Elements and Auto-Inhibits its Interaction with Ns5B of Hepatitis C Virus.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 77
structure length 253
sequence length 253
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4a4dA00
3EIEA 1OFUX 2F1IA 2YINC 1MO6A 3CH4B 4Q4JA 5HE8A 4DLYA 1VYTA 2C5LA 1UBGA 1UKVY 2J46A 3K9NA 3IGFA 1EX7A 1ESNA 3KB2A 5BW8A 3WNCA 5E4FA 4DDTA 4OHYA 1NJFA 3W5IA 2NQ2C 4HLDA 4LHVA 2ZI6A 4OJQA 3OIYA 1KOFA 1KIMA 4JLBA 4LBWA 2WV9A 4GDFA 3CR7A 2JDID 1Q1BA 4IDQA 4KODA 1Z6AA 3KJEA 4CT5A 3VR1A 1MO5A 3SR0A 2V3CC 1EGAA 1OB5A 1GUAA 4DSNA 4DWJA 3U2QA 5A4JA 3PEUA 1NSFA 5HTKA 3CF6R 1IY0A 3NC1C 5EP1A 1W4AA 2B7BA 2G0TA 3EZ7A 2FE4A 4FMCF 4LDJA 4ZI3A 5AUQA 1E2MA 1OFHA 2OLKA 1R0XA 1JR3D 4IRUB 1LS1A 2RGNC 3VHXA 3ZGXA 4BGDA 2VF7A 1GIAA 2BOVA 2ZANA 3LFUA 4BEJA 5M04A 1U8ZA 1ZP6A 2QTVB 4JVSB 5HCNA 2EU8A 3SZRA 3EC1A 1S1CA 2BMFA 2IXFA 2F9LA 3QKSB 3A36A 3G0HA 5FTLA 3QEJA 5FOSA 5B57C 1P2TA 3VKGA 5K8IA 1ZM3A 1OJLA 2QENA 1X6VA 3FMPB 4LI0A 3OEEA 3REGA 2QAGC 4OQLA 4DDWA 2ZJ2A 3B1VA 3A4LA 2A5JA 3CX7A 1S1MA 3IIJA 1CJMA 2AXNA 4Q1BA 2GWHA 4EPTA 3U3KA 3LQQA 5FTKA 1BYUA 1I2MA 1N6NA 3WYAA 4O25A 4AG6A 5KTYA 1IHUA 4QFMA 4OHXA 3U7HB 4DEYA 4V03A 4PFSA 1TEXA 1K5GA 5FR2A 2QQEA 2QT0A 2WIBA 3FKQA 5GJWC 2N46A 3T12A 4TZ6A 2O8CB 1XZQA 2FFHA 3GJ4A 1AN0A 2D3WA 3BOSA 3Q72A 4RD1A 1I4DD 1W44A 2JASA 1BO6A 3U3MA 3SC3A 3ZIAA 5CK4A 3N5CA 3UK6A 1HYQA 1S2MA 1S0UA 2HT1A 2C78A 4IDPA 4I1VA 3E2IA 1BKDR 1VHLA 1XPUA 4PANA 1GRRA 1G6HA 4TLDA 4ZO4A 1F3OA 2G3YA 4LHYA 1DOAA 2IF2A 4GZMA 2CEAA 2V55B 4IW3B 5IF9A 1G19A 3MD0A 3VX4A 1Z0JA 2WKRA 4F91B 2VHCA 4R2HA 2CL0X 3B85A 1IY1A 3AH8A 3LW8A 1QHHB 2KI5A 1XEXB 1P72A 4RD2A 4ON9A 1Z5ZA 4JLMA 3A1VA 1TU3A 5JWHA 5CIWA 3MAAC 1JALA 4EPWA 1RE0A 1M6NA 3B60A 3CZQA 5EE1A 1G3IA 1SULA 3CNNA 2H92A 2JAQA 3QEOA 5J47A 3AEZA 2QNRA 1OH6A 1G6OA 2HLDA 2QEQA 1F2UB 2R62A 2QRZA 2ZTSA 4DLUA 1RKBA 1UAAA 1A2BA 2OM2A 1TNDA 3WYFA 2ZYTX 1L4YA 5EUQB 1EFCA 3EIQA 3WYGA 1EESA 1TF2A 1XTIA 1P3JA 2WMOB 3VU9B 3F0TA 3QKSA 1E0SA 1AA9A 2QZ4A 2G88A 2D2FA 2WHXA 4P4TA 2X77A 2QP4A 1XMSA 2ANCA 3PG5A 1GOTA 2RGCA 1VIYA 5DYGA 2CCJA 3QF7A 4JZKA 4X8LA 3B9QA 3M6AA 2XX3A 1KI6B 2OEPA 3CX6A 2J7KA 3A4NA 3BORA 3QKUA 1KKMA 4Q1EA 4TYYA 4C0SA 4NYIQ 2I1QA 2GBLC 4CEJA 1G7RA 3DDCA 5JJLA 1YZTA 3L0PA 5TARA 1N3BA 4Q7LA 4B35A 3PENA 4GP6A 4TWZA 1X1SA 3NKVA 1RC8A 3I5YA 3CNOA 1XP8A 3U7FB 4XVRA 1TMKA 4I1SA 4Q01A 1QDEA 3HR7A 5GJBA 1FPMA 2ZYVX 1E9AA 1MH1A 1DAGA 1W36C 1ZD9A 1XTSA 2IYRA 2WPDA 4JVNA 4XWOA 2O8CA 2ZREA 4Q5IA 2RGAA 4UXHA 4PO9A 3LV8A 1YZNA 3H4MA 4RD3A 2IYZA 3BRWD 5AK0A 3L2OB 2QMOA 2GJAA 4Q9LA 3K0AA 1Z83A 1W36D 2GZDA 3SI7A 2EFCB 3UATA 2E1RA 2BCGY 1QVAA 1WBDA 421PA 621PA 1KI1A 1OXSC 3AF4A 4LOAA 3PXGA 4JT2A 1W0JD 4CIDA 1HT1E 4MA4A 4KXFB 1KDTA 3K09A 1OHHA 4KLNA 1UKZA 3TNFA 5E95A 3WMEA 4Q21A 4Y0AA 2V6IA 3FMIA 3GLFE 1Z2AA 4E09A 2XSZD 5DGXA 4IVQA 5J4KA 3AVOA 2P5SA 1ZNYA 3QVUA 5FH9A 2DPXA 2BMJA 1XNJA 2C04A 3MGCA 4DCTA 3KJIA 1VIAA 4QM7A 1Z6TA 3ONWA 4P3YA 4TMVA 2JIZA 4KU4A 4NPHA 1FQJA 3KKNA 4P32A 1KO8A 3MUFA 1VCIA 2XOKA 4ARZB 3JZAA 2FJUA 1AGRA 1P2SA 1XJQA 2DFLA 3A1WA 4PO8A 3ADDA 2VRWA 4M22A 3RS4A 4BWYA 1XRJA 1F2UA 2J7PA 2ZJBA 1R8QA 3K9LA 4MGZR 4D25A 4XD7A 2A2ZA 1Z0KA 2W0MA 1E2QA 1I4LD 1NL3A 5L8VA 5JSZB 4F4CA 2ZRFA 3UG7A 3FOZA 3H2YA 4GT1A 5BN5A 3QF4B 1CS4C 1W5TA 1BOFA 2FX3A 3IBYA 4US0R 1A1VA 4UNPA 1NJGA 2OUKA 2EVWX 721PA 1N6IA 3C15C 4JIMA 1TL7C 4PC6A 2QN6A 2JJ2A 3THYA 3QXSA 1KTVA 1XXHB 5C18A 3EPKA 1E2DA 4C0BA 2W6JA 4DC9A 5AJYA 3TIFA 3ZD7A 3L0SA 1A7JA 1U0JA 1HV8A 5FFMA 3TAHA 4PAOA 4D81A 4DCVA 8OHMA 3G82C 4LPSA 4JLOA 1Y63A 3PUZA 3RABA 4URUR 1DPFA 2YWHA 1TQ6A 1AK2A 1K8RA 1XZPA 1ZU4A 2BEKA 3FFAA 1OYWA 1N0UA 4OQNA 2PEYA 4IEIA 2JEOA 2P6RA 4PC3A 4B3GA 3K9GA 4KBFA 2ZIAA 1NSTA 1P9WA 2OBLA 1S9DA 3T15A 4DLSA 4EUNA 2WJJA 4MRVA 4AKEA 2HJGA 4MKFA 3LAWA 2GXAA 2BBOA 2WWFA 1Q0UA 3VR3A 1KO7A 2VP4A 3RSOA 1AS3A 3M4YA 2WSSD 1KZ7B 5EP2A 2YHSA 5KDOA 1NKTA 1ESMA 1UADA 2NO9A 1E9FA 2OFWA 3AP3A 2V1UA 1YE8A 1LW7A 3FTQA 4L9WA 4CEIB 1E4YA 1DAHA 1OXXK 3LVRE 4JKYA 3TH5A 3D3QA 3GLGE 2F1RA 4IFEA 2ZJ5A 2IYSA 1ZC4A 1NBME 1AIPA 1HH4A 2FGKA 4M53A 4BZPA 5L3SB 1AQYA 3KFVA 3DM5A 4EIWA 1S4QA 1T8TA 5EP3A 4BLOA 4OHVA 1Q1ZA 1W2HA 4L4UA 3THOA 1ZD8A 5LPNA 3H1TA 5GVSA 2W2TA 5EJEA 5JFGA 4ARZA 2DHRA 1HE1C 1W4BA 1ZNXA 2Q6TA 3A1TA 4NYJQ 5DHAA 3EZ2A 4EAQA 1SXJC 2F3RA 2WWIA 3K53A 5KNBA 2G0NA 1H8HA 2OFOA 1R2QA 3ZZUA 1LFDB 4ESVA 3SBEA 2W0SA 4NYMR 1KSHA 221PA 4A9AA 1UKEA 5DSZA 3IO3A 2GVDC 1SXJD 2J59A 1Q3TA 1XEWX 2RGXA 2QROA 3LX5A 4GFDA 4DUGA 1GFIA 3ECCA 2Z4SA 3NVAA 4Q02A 1G291 4HAYA 4Q1FA 1ZAKA 3PCRB 4OK5A 4RCYA 1N5JA 5F98A 4WA7A 1G3MA 1G3UA 1FL9A 1WXQA 3BH0A 1KJYA 2JLZA 4MYCA 4OQXA 4PPGA 3VKWA 3CONA 5CM9C 4ASUA 1IN7A 1KK2A 3FWYA 1OE0A 5EP4A 4E03A 4C0AC 4EFNA 1XXHA 4R71A 4QBHA 4DJTA 1DG3A 4BEBA 3DVLA 2QBYB 5AJZA 2YWEA 2L0XA 3KB1A 4FCWA 3KFXA 3B13B 4PHGA 4N3NA 2OG2A 1JEDA 1K6MA 3ZVRA 3SN6A 3OF5A 2ZSBA 4NCJA 2JJ8A 1RRPA 1RJ9B 2QGNA 2ZR7A 1N2CE 2RGBA 2REXB 2X1VA 1SXJE 3AGQA 1CF4A 2ZRAA 4QC2A 1JXMA 2ZUDA 4QBIA 3JVVA 3VR6A 4DEXA 1DAIA 2A30A 3TAUA 4CYMA 4TTQA 3ZZTA 1JPJA 1G21E 3R8CA 2P67A 4TZ0A 1GP2A 1WA5A 3KJGA 2D2EA 3VTKA 1N6OA 4OI1A 4YLGA 5J40A 4MQBA 3AF3A 4IDOA 1ZU5A 2QSZA 2FF7A 2I3BA 1FMJA 3V4RA 4CEIA 4M9SA 1J99A 4ZDKA 1E9SA 3NXSA 3SJZA 3UXMA 3ZLJA 2QTFA 3HU1A 3ZYCA 3SJBA 3R8FA 2GK6A 3V4FA 3UMRA 1P60A 3MMPA 2HDNB 4YDHB 3K9HA 4AC9A 2FFBA 4B47A 4QRHA 3ASZA 1RFLA 2GILA 5KSPA 3NDPA 5L3SA 1T5LA 2ATVA 3NHAA 2FSFA 1R8SA 2A78A 2ANBA 1DAMA 1YR7A 5DI3A 5EZ5A 4YQFA 3TVDA 2ODBA 2X8AA 3JVUA 2EFHB 3C5HA 1KK3A 2ZRLA 2EWVA 4TLCA 4I99A 5LD2C 2ZRNA 4ZIRB 2ONJA 4TYWA 5CM8B 1II0A 4G5SA 1ZUIA 3RSLA 2Y8EA 1G8HA 1W5SA 2WWXA 3I61A 4HAWA 5BXQC 3WP1B 1E9BA 3X1ZA 5H68A 3CX8A 4PPQA 1FTSA 1CR0A 2X2FA 1FMLA 4G5GA 4Z1MD 3IO5A 1OH7A 1L2TA 3AVWA 2DFTA 2FMXA 3T1VA 3QKRB 4BFYA 4HDCA 1NMXA 3C4JA 4OQMA 4JLKA 2RCNA 3GCGA 1E9RA 3DMNA 2JLXA 1E9EA 4M1KA 1J90A 2QGZA 4Q4LA 4Q9KA 4BECA 1E2PA 1MV5A 4GOJA 2BJWA 1BH2A 5DN6D 1FW6A 5EE9A 1Z07A 1QZXA 2DY1A 3BFXA 3UIEA 3U7GA 1DADA 3W8RA 1PVOA 3CPHA 2V1XA 5E7MA 1XPOA 3OFND 3Q7PA 3KKQA 3WHKA 1J2JA 4DRZA 2IUTA 1G8FA 3CRRA 4PHFA 4R7ZA 2HYIC 2O8FB 3QBVA 4PPFA 4A8JB 1OXTA 2N1BA 3K0FB 2OHFA 2Z43A 5P21A 5SZJA 5CDFE 1NVXQ 1RJ9A 4JS0A 4Q1DA 3FMOB 4NMMA 2FDCA 2EFEB 2ZI4A 4Q9JA 1NVVQ 2C9CA 4DB2A 1XMJA 3AF2A 1KNXA 5FBRB 2QU8A 521PA 1R5OA 1Z0DA 4EJSB 3LVQE 4I81A 2C96A 2NMVA 3CR8A 4HUQB 3PQCA 1O3YA 4XIGS 2BVNA 4XWKA 5BN4A 2XAUA 3PEVA 3LBHA 2WICA 4ZDIA 1M2OB 2IYQA 2GJSA 1G16A 2MSCB 3EZ6A 3Q5EA 1M74A 2DR3A 4GSYA 2P5TB 2BBTA 1G7TA 4HAUA 3TSWA 4M9QA 1P2UA 4UKDA 5FPTA 4M1OA 1TAGA 2AKYA 4A2PA 2ORVA 3OE7D 4QGAA 5KO2A 4LBYA 3TMKA 2R6AA 5JS8A 3AKDA 1BIFA 4IDNA 2VTKA 4DSOA 4IOMA 4W5HA 4BRUA 3IQWA 1JB1A 1X8LA 4KFRA 1KDOA 3QSYA 3THWA 4ZIRA 3AVYA 5CITA 3SYKA 3BBPA 2RHMA 3IIKA 4ZDWA 3K0CA 2XNSA 2WJVA 1G3QA 4HB4A 2PCJA 2C77A 2GEUA 2IT1A 5FOVA 4BASA 3WXMA 5GJVC 2KBFA 3IHWA 1XD2B 4FMDB 1JNYA 2WVJA 3EA5A 4K81B 3SS8A 4G3XA 3R9XA 2FFQA 3KX2A 2V7QA 3CW2A 3KUDA 1YZLA 4IXNA 4IJMA 2BHRA 2QI9C 1UBCA 3IPXA 4NKRA 3BFVA 1ODFA 4TL9A 3ZQJA 4QNRA 3L0OA 2YZ2A 2Z4RA 4I1UA 1D2NA 3FMFA 1JR6A 2B8WA 1QVRA 2OCBA 5FUYA 1QHYA 5SZKB 3RDPA 2O8FA 1VPLA 4A8JA 4AK9A 4F4JA 1KDRA 2QL6A 1WF3A 1PLKA 1FP6A 2GXUA 3FYHA 4JYCA 4URYR 4B3FX 1W46A 3PV0A 1L4UA 4OYHA 1FOEB 4CEHA 1E1QD 1E4VA 2E9SA 5EXPA 2PMKA 5GADl 1P75A 2NPFA 2RKOA 4BLPA 1Q44A 3IEUA 4LV6A 2CLSA 4G0NA 1EWRA 1EXMA 3FKSA 2J0QA 5CK5A 2YYZA 4JL5A 3QJYA 1KMQA 4A0FA 4G5QA 4MRSA 1MT0A 1EFRD 2AWNA 2OO7A 1H8ED 3GQBA 1Z0IA 1VMAA 4AI6A 5KSOA 4URVR 2CK3A 3SQWA 2EFDB 1TTTA 1Z08A 2ZSEA 4OJKA 1T3HA 5CYOA 1TPZA 5CLLA 3VNVA 4PZYA 1SKYE 5FI1B 4DLXA 2J0SA 1KJWA 5JEDA 1QHGA 1QG2A 1LTQA 4LYFA 1YR9A 2J0UB 5F2EA 1II8B 1OIVA 2XTZA 2QMUA 5DYIA 1XCMA 4FMCB 4TMXA 3C5CA 4N0EA 1UFQA 2QAGB 1XPRA 4D4JA 1OKKA 1G4UR 2J5XA 1OF1A 1IXRC 2AKAB 4TQUS 1OIXA 2J45A 1E2LA 3OEHA 1JQLB 3I32A 5FOUA 3EPHA 3VQTA 1ZUHA 1N6PA 2HYDA 3U3OA 1OFIA 2A7QA 2ZE5A 1P6XA 2PLRA 4QXAA 4HZIA 1NG1A 2CCGA 4D0NA 1XMIA 4D80A 2F55A 1G5PA 3K0SA 4LWZA 2IBMA 1TQDA 1XD2A 4GMDA 1NNEA 1XBTA 2WJYA 3QPUA 3IILA 3T1OA 3LO5A 4BQSA 2RGGA 1WB9A 3WBJA 3AKCA 1E32A 4GI7A 2DYKA 1LS6A 2P6NA 4A0GA 1U0HC 3MLEA 2D62A 1D2MA 1E79D 3BH7A 3SNHA 3W6PA 1T5IA 4P0TA 1CULC 3ZJYA 3CKLA 4IKEA 1KY3A 4UJ5A 2ZU0C 4UXIA 2Q0HA 1TF7A 1U9IC 4JLJA 2JDIA 2GZAA 4EPXA 1R0WA 2VL7A 1SVKA 4OBEA 4Q4AA 4W7SA 5LB2A 2TMKA 1ZINA 1IN4A 3IHLA 4QKQA 1UDWA 2H17A 3NBFA 1Z6GA 3EWSA 4CDGA 2FZLA 2CBZA 1QBKC 3LX8A 3SU8A 2Z5FA 1FFHA 4HI0E 1JR3A 3BS4A 3CM0A 3OHMA 4JKIA 2QORA 3B1ZA 1G41A 3CPJB 2NO1A 4KI0A 4IXMA 2FH5B 3HP1A 4ZPXA 3WBKA 3E5HA 3SOPA 2W83A 3HYTA 2OBNA 3PEWA 4F7WA 3SDZA 1E2GA 1DBSA 2JLYA 2NIPA 5JECA 3GP8A 3GLIA 1PLLA 3R9IA 4C2UA 3EPJA 2ZYUX 2AXPA 1Z47A 4DCSA 1N6RA 1PV4A 1OSNA 4UNNA 4HAXA 3MWKA 5IRCD 4L8GA 4OK6A 2GXQA 5DISB 1II8A 3FFBA 4GRAA 4PO1A 3O8CA 4DCUA 3OIUA 4ESHA 3ICEA 3A58B 2QAGA 4KO8A 4Q00A 4QGHA 2D7DA 2PJZA 1DO0A 1CR2A 1VTKA 2IF0A 3PFIA 2VHJA 3LY5A 1HEIA 2QA5A 3P4XA 2IYTA 1VG9B 1I4TD 1T3LA 4PSVA 1Z29A 2ZI5A 1TQ4A 2R9VA 5JRJA 2GKSA 2GTPA 1W36B 2D74A 2VSFA 5KNCA 2A5GA 4HLUC 5KPJA 5K8TA 4TYQA 3H86A 1Z6YA 1W48A 2IX3A 3CF0A 1KAGA 2I4IA 2GJKA 3W3ZB 2XZOA 2R6GA 2IA5A 2V8OA 4B3XA 2ZS9A 1OW3B 3KKMA 3LWNA 3P1JA 2ZSFA 2XJ9A 3BFKA 2IYLD 4A2QA 1CP2A 5AUPB 1DEKA 1SGWA 1G8GA 2RMKA 3REFA 4D2IA 2H18A 3NEYA 2ZI7A 2NO6A 1D2EA 2R6CA 4ZV4A 4TMWA 1FQKA 2GA8A 1W7AA 4U5XA 4C0KA 3NDBB 5IDVA 1EG7A 5DLQC 2JLUA 4V0OA 3LD9A 5DE3A 3RS7A 4ZI2A 2OXRA 3BWDD 5JI2E 2OFXA 3CH5A 5JJIA 2ZPTX 4CZ2A 4B48A 3DZDA 1GNPA 4KJZA 2KB0A 3GFTA 4YMSA 5TMPA 1UM8A 1S96A 3WHLA 1P4SA 1FX0B 5BN3A 1G5TA 1GSIA 4XWAA 4EKDA 4DB4A 4TLBA 1RRCA 2ZR0A 3X1WA 2YV5A 5D3MB 4V0NA 2KJQA 4AY2A 2GDJA 2J41A 2ZI9A 2A5FA 3RS2A 2REBA 4HUTA 5J4YA 3I8XA 3X1YA 3LRPA 5BYJA 4F38A 4A15A 2XNDD 1KDPA 2EW1A 4ACAA 1GRNA 3PUVA 2BM1A 3ZS8A 4HAVA 4M9XA 3T34A 1GL9B 2XTMA 3K09C 4RZUA 3FPAA 3GJ8A 2FSGA 3LBNA 2P2LA 5K8LA 5EXTA 3AGPA 5CB8A 4TTRA 5AJVB 1VYUA 2ZU6A 4AIIA 4D4LA 2WWYA 2D4HA 4C30A 2IYWA 2GBLA 3B8HA 4I4LA 3P32A 4XVQA 2BEJA 3BGWA 3DKPA 3ZD6A 2OV2A 3O47A 2WWWA 5FUVA 2WOJA 1KI4A 1OT3A 3GLHE 4E5UA 2V54A 2Q3HA 3EC2A 2LKCA 4A0RA 5L3QB 1CIPA 3HPRA 3GFPA 3P20A 1UKYA 4CVNA 4FD2A 5JRZA 1QHHA 3OAAD 2AL7A 4UJ3A 2QE7D 1XEXA 2VLIA 2FA9A 4BFZA 2UVQA 3VFDA 4N1AA 1YZUA 3RHFA 2VSOA 1W0JA 1JJ7A 2LWIA 1VDZA 2FEMA 2XOKD 4JYBA 1NY5A 4NU0A 4RD4A 4WBSA 5HKKD 4NTZA 3AUYA 4C4PA 4QGFA 3WRXC 1ZJ6A 2CVHA 3ZZ0A 2XSZA 2EQBA 4AD8A 3CUEF 5G53C 2BKUA 1VCNA 3RRMA 1G7SA 5KU1A 1W1WA 2NZ8A 4QHTA 1KI8A 5C2JB 5HCIA 1ZM4A 5BYKA 3VU9A 2OLJA 4D4KA 1E2KA 2WZQA 3I62A 2F3TA 3CBQA 4TN1A 3CPEA 1E9CA 4R9UC 3W5JA 3BB3A 4M4SA 4MUBA 1RYHA 2FSHA 2GETA 1KI6A 3CRQA 4JBWA 3A8TA 2BM0A 2IS1A 2C8VA 4FCTA 4FMBB 3NHBA 3DHWC 2ZJOA 5DO9A 4L9SA 1SXJB 4WZBE 1NN1A 2Z6VA 4UNQA 4B71A 1U2RA 4PZZA 3RANA 5TXGA 4JL8A 3SFVA 3V00A 1K5DA 2JJ1D 3W9YA 4DDUA 1WRBA 1NBMD 5JMTA 1U90A 5D3MA 3B1YA 3C7KA 1E2IA 5JI3E 2B21A 4HLQB 1D8TA 1MRSA 1XMVA 4M9ZA 2J1LA 3GEIA 1AJEA 4Q66C 1NP6A 3UPUA 2XEXA 4II7A 2BBWA 3L8ZA 2IHBA 3IIMA 3IBGA 4C9BA 3Q3JB 2Q9AA 1P62B 2CVFA 4JVMA 4MYUA 3TSOA 4BE7B 4DLZA 4E22A 1CTQA 1MR3F 5L3RA 4B76A 1JBKA 2G1JA 3HR8A 4O3MA 2CHVA 2DFKB 2CNWD 1S3SA 3BAFA 1B0UA 3ADKA 3W3AA 2ZEJA 2DB3A 2O8DB 1HE8B 4URXR 2XB4A 1R7RA 2ASEA 3VX3A 3L43A 2ZJZA 4ILEA 2RHDA 1G5RA 4JLNA 3KKPA 5L3QA 1N6LA 1Q12A 3DPUA 1J8YF 1YR6A 3TQFA 2CE7A 4JLPA 3NBZC 4LHZA 2WSSA 4D4MA 2X2EA 5AWFC 4X8OA 1ZMXA 3SJAA 3U61B 1E2NA 2ZAMA 2PZFA 1J70A 4RKFA 4LK2A 1T8UA 5CJPA 4ACBA 3J81k 5FTJA 1KSFX 3DOFA 1CR1A 2VP2A 5EE0A 3PVSA 3QOFA 1U94A 2GEVA 2YNMA 1NRJB 2JLWA 1AKYA 3SHFA 5KUTA 4M1WA 1MKYA 1CKEA 3ETLA 1TEVA 4KITB 5FBVB 1EX6A 3B9PA 3MWJA 1GAJA 3MCAA 3N70A 5JSZA 3B82A 3E1SA 4B34A 1RVDA 4GNKA 4M0LA 2HEIA 4RJLA 4TLEA 1U98A 1GM5A 2Z83A 1BMFD 3QF4A 3U4QB 1V43A 2SHKA 4LJ7A 1WQ1R 1NF3A 2IXEA 2ZS8A 4FI3C 5JS7A 2MSEB 3KQUA 2HXSA 2ZE6A 4ASUD 1QHNA 821PA 1CLUA 1H65A 2IS6A 1BYIA 5TB5A 2HV8A 3X1XA 4JBYA 3GJ0A 1VCOA 4B2IA 2F7SA 1VHTA 1ZUNB 4Q7JB 1CJVC 1WDTA 1YZGA 5LD2B 1ZM2A 2OESA 1KSJA 4M21A 1IN6A 2V4ZA 1Z06A 4EFLA 1NIJA 3AQ4A 5CIQA 4RFSB 1D9ZA 1XCGB 3JZMA 2CMKA 3B5JA 3OIWA 4YXWD 4AKGA 4JL6A 1VKJA 3B2EA 5FOXA 2W6ID 1NN0A 1KO1A 5B2ZA 4MGIR 4YONB 4LZZA 1E96A 4RD0A 5IK2D 4LYAA 1HQYE 2ZS7A 2CL6X 3CO5A 1UBFA 2QSYA 4BRWA 2JLVA 4XTRA 1XTQA 4CF7A 5E3HA 1XXHE 2FGJA 1D6JA 2VEDA 4CW7A 4DKXA 1ZIOA 1G4AE 4DSUA 2NZJA 4AURA 5JBQA 3I8SA 4YMUA 2EFGA 1KO4A 2DWPA 1UJ2A 3EA0A 4JLDA 3R7WB 1IXZA 3M0EA 4FWIB 4LYJA 5FBQB 4BFXA 5B58C 4U00A 2KWIA 2OAQ1 3R9WA 4HB3A 4PR0A 3A1SA 2XXAB 4A0HA 2BCJQ 4KSCA 1KAOA 1I2DA 1JQJC 2QG6A 4BUJA 3ND9A 3I92A 4DLTA 1N6KA 4M2LA 4PC1A 1SZPA 1RZ3A 1T91A 4V0MA 4AWXA 4HLCA 3T1TA 3TUZC 2F1JA 4LHWA 4YDSA 3VHLB 1ANKA 4HSEA 4ZCLA 4OI2A 1X8KA 3FDIA 3PIRA 3SEAA 4LY6A 2V6JA 4JT4A 3QBTA 5GVRA 1XJ0A 2FPLA 5KOYA 1T0JB 4HZUB 1TUEA 3L82B 2PZEA 4LJ8A 4B6EA 1AKEA 1M34E 4S2EA 2RAPA 2IEYA 4EPYA 2PZGA 3U3JA 4KHZA 3K1JA 1MABB 2YOHA 1R10A 1KK1A 2UZ3A 4RZ3A 4XJXA 3ZVLA 1CRQA 3FHCB 3KKOA 2GNOA 2IYXA 3C41J 5KPDA 4IOLA 2IYUA 2QBYA 3BXZA 5CB6A 2FWRA 3FGNA 4M1TA 5F9HA 3DOEA 3KUCA 3LBIA 3QUSA 2JLRA 3CB4A 3HWSA 3Q85A 3WNDA 5CJ2A 1X1RA 4FINA 3BD9A 2P0EA 2HJVA 1OV4A 3MJHA 3QKTA 4RFSA 5F3WB 3X2SA 3KXIA 2VO1A 3L0IB 3D6TB 4BLRA 4IFBA 1NG9A 3AUXA 1SHKA 3FVQA 1E1RA 2ODWA 4FIDA 1KMHB 3AKEA 1VECA 5DN6A 3AVQA 5JJKA 1G64A 2CE2X 5JZVA 3PR1A 2N42A 2F9MA 3OFNA 2GESA 1QHIA 1AS2A 1YRBA 1P5ZB 4YMTA 1HA3A 1XTRA 5DHFA 1SKYB 4NYMQ 3GEEA 1COWD 1Z2CA 4RFVA 3EXAA 2HF8A 4L16A 4D0LB 3LXRA 4OHZA 3NH9A 5AUNB 4FWTA 4B6FA 2PMDA 1C9KA 1F5NA 2IEZA 3I1FA 2WSMA 3K70C 4DHEA 1FP7A 2ZUCA 2ZRGA 2FFAA 4NZYA 3VMFA 2KE5A 3R7WA 4A36A 2GCPA 5FPYA 3EARA 2FSIA 3QXJA 3TUJC 2GVZC 3NIBA 2WWHA 3BERA 2ZJAA 3K70D 2FPMA 3BB4A 2EYUA 3AF1A 4TSFD 1IXSB 4AKHA 2IC5A 2YOGA 2QP9X 1DS6A 3HYRA 2QPAA 3BC1A 1XWIA 4KFSA 1JEEA 1XB2A 2OAP1 1ZRHA 2WJGA 5JLJA 1QRAA 4BFWA 4DIEA 1LNZA 3KXKA 2WBLC 3UKDA 2XB2A 1WE2A 4TT3D 1W49A 2HT6A 5TY0A 4QL3A 1T9HA 3IKJA 1XTJA 1W0KD 5TVKA 5E7JA 3OE7A 4TYPA 4HZUA 1W4RA 2BJVA 4J0QA 3T06B 1CU1A 1LF5A 2GEDA 3IDQA 4Q4JB 2QY9A 5BQ5A 1CJTC 1M1YE 1HT2E 3QKRA 1MABA 5H70A 1S9HA 1ZIPA 4RZXA 4QHSA 4O0MA 3KQLA 3ZVMA 1QHXA 1E94E 1EK0A 3QNUA 4MKIA 3CWZA 4FW9A 1YU9A 4XSGA 4BLTA 3M1IA 3BE4A 5FUXA 2H57A 3U3RA 1S8FA 2JLQA 4Z8YA 1NVUQ 2B8TA 3K0FA 4M8NE 2IXGA 3T1QA 4PQYA 4IDHA 2C9YA 2CLCX 1Q3HA 1YZQA 3AV0B 1A2KC 1XD9A 3IUYA 4DCNA 3SJCA 4A82A 1GVNB 1G18A 4CRWB 1KMHA 1P9RA 3E70C 2OCPA 3BJIC 5FPSA 1HY3A 1UDXA 2J87A 4EJSA 1IOZA 3FKSD 2VHTA 2YKGA 3ICQB 1OLOA 4HUQA 2YVUA 2ECKA 2R8RA 2QMHA 5IHPA 1GTVA 4DBLC 4MDEA 3VR5A 1SVIA 4IVRA 1GITA 1G17A 4KYUA 2VSXA 5EZ6B 3KQKA 2IHYA 3H0KA 4M1YA 3UANA 2F43B 4A6PA 4EPVA 1OFTA 2OCYC 4DT1B 1AS0A 3ZS9A 5BWMA 1E1QA 1OIWA 1B23P 1E69A 1R4AA 2ZRPA 3QXHA 4A4DA 2AD5A 4B75A 2LCFA 3T61A 4B43A 3AB3A 1X3SA 1GZSA 5FL7D 4F92B 4KVGA 1ZM9A 2VQSA 3I73A 3TKLA 4BFSA 2WIAA 2PT5A 5EQTA 2CHGA 3Q8XB 4WAUA 2VP5A 4CT4B 2ZRBA 1OKKD 5EXSA 1U0LA 1IN5A 5IT5A 3W8NA 2OE2A 3HU3A 3FHTA 2QTHA 1UEIA 2XTNA 2ZXUA 1N0WA 4LJ5A 3RLFA 1AZSC 1W47A 3CRW1 3NC0C 5LB4A 4KFTA 4Q03A 1FTNA 5FL3A 5HE9A 1R5BA 2D7CA 4EFMA 2FPKA 1W4CA 2P65A 1E0AA 3AVXA 2QM7A 3EW9A 5FI0B 2XJ4A 3PUYA 5TDHA 1NLFA 4AYXA 3DZ8A 4US2R 3OIVA 4NYIR 3DMDA 2OT3B 2J9RA 3EAQA 1FZQA 2GAAA 1MO4A 1ZVQA 2ZUBA 2R6DA 4X8HA 4ABYA 3QQ5A 4JSTA 2AHOA 1G1MA 3TRFA 1RRFA 2WMNB 2IWHA 4DVGA 1KYIA 4ZCMA 2B7CA 5FUWA 1R5NA 3TR5A 5A0FA 2RGEA 1G20E 3B1XA 3GJXC 1MOZA 3RVBA 1OXVA 4BFVA 1KGDA 2BC9A 4RZ2A 3C8UA 2G9NA 4OL0A 2BDTA 4G5RA 1DE0A 2IL1A 3PJRA 3EWAA 2PEZA 3C14C 3QE0A 4DZZA 4UXJA 4TLAA 1XEFA 3ADCA 2GCOB 4PAQA 1VG0B 3OEED 4C2TA 2UKDA 4Q1AA 3CF2A 5AJXA 5H1YA 2RB4A 1KY2A 1E79A 3THXB 4LJYA 1SVOA 1DVRA 2W2VA 3PUXA 4RKEA 1TF5A 3QG1A 1P61B 2K5UA 4Q7KA 2W58A 5ELXA 2WM9B 2ZRIA 4GBMA 3O8DA 2RGNA 1DTSA 2F43A 1E6CA 5C1BA 4DT1A 5EUMA 2ZRMA 2ZI3A 3F8TA 4O2LA 5DNYB 3KDSE 4LX0A 3RRNA 1U9IA 2NO7A 3ZIAD 2B6HA 2H5EA 2WAYA 4TL7A 5SZIA 1N5LA 2ODEA 3P4YA 3UMSA 3ZQ6A 4CEJB 5JWRA 3HJNA 4LC0A 2J0UA 4LJAA 4QJ3A 1YQTA 3HU2A 3GJ6A 1KO5A 3A6PC 4KV9A 4LUCA 3EPLA 1JR3E 3GLFB 2GJ8A 2AFIE 2VYFA 3GLHB 4MYHA 3FE2A 1R0YA 2Z0MA 2ZSAA 3BH6A 3KL4A 3QENA 2XZPA 3TUIC 4QHYA 4TL6A 1JECA 3U44B 1IJFA 4B33A 4W5WA 1ELOA 2O8BB 4HEJA 4DLWA 4AYTA 4HATA 1KSGA 1OB2A 4JJZA 2ZJYA 3G5UA 2FZ4A 2GHIA 3VR2A 3K0AB 2MMCA 4ZKDA 1HUQA 5J4LA 4KSBA 2ZRJA 3GLIE 3B6EA 5FOWA 4RD6A 5F9FA 4RCZA 1E9DA 4Q9IA 2DWQA 2ZRHA 4S35A 2ZETA 1Z28A 3GD7A 3RS5A 2REOA 3C16C 1E2FA 3Q7QA 3GFOA 1DAFA 1HURA 1SVSA 4EQ6B 3GJ7A 2NGRA 2QQ0A 2MMGA 1US8B 2DCUA 3MSXA 4K8OA 1ONBA 4NH0A 5FBWB 2HLDD 3UG6A 1ETUA 2F1HA 2IYVA 3CWQA 2GZHA 5ANRB 3FHOA 2WOOA 2GAOA 1PUJA 4QGGA 3AVPA 1PJRA 3VAAA 1CJUC 3SHWA 1NN3A 1Z8FA 1XX6A 2FN4A 4G5OA 1EFUA 4LCBA 2Q3MA 4WVFA 2PX3A 3CRVA 2VF8A 3A4MA 4C0JA 1PZNA 1UPTA 2GCOA 2MSDB 1DO2A 1Z0FA 1YRAA 4HYYA 4TMZA 4HLUA 5EE3A 2O5VA 2IYYA 4V0KA 2VH5R 1IY2A 3GJ3A 2OXCA 4LJ4A 5TV2A 3X1DA 1XD8A 1CJKC 1E99A 2HXYA 1M8PA 1GL6A 1M7BA 3THXA 2WTUA 1F2TB 4PQFA 4BZQA 2ONKA 2C98A 3AF0A 4IHQA 5FR1A 1LF0A 1TADA 3K8YA 4FCVA 3WMGA 4D6PA 5L3VA 4BPBA 4ITRC 4XTCS 1NVWQ 1VCMA 2QPOA 3NWJA 2GF0A 3EZ9A 2NPIA 2VP0A 1GKIA 3P26A 4QBGB 2WPDD 2C95A 2VHQA 2BV3A 1WMSA 1F6BA 4UNSA 3THYB 1N5IA 4Q4HB 1IBRA 3SE0A 4MGYR 1SKQA 2QMEA 5CLQA 1GKUB 4LYHA 3EX7C 4MRRA 5G40A 5KDDA 4NCIA 4NYJR 3PEYA 1AZTA 1P2VA 1SVLA 3H84A 4D0GA 4LV8B 1L8QA 4W9MC 4O2RA 2O0KA 3V9PA 1DG1G 2H7VA 3B1WA 3GLFA 3GLGB 3GLHA 1TX4B 4WIAA 1Y3AA 1YJ5A 2CDNA 1YR8A 4NP6A 1OHHD 1RPZA 5UKDA 1Z3IX 3AVUA 1G9XA 2CXXA 4GZLA 2W2XA 2BMEA 4GL2A 3RRYA 4JVLA 3U44A 2DFNA 3NBYC 2O8BA 2XNDA 2BMDA 4EPRA 1RRGA 1DARA 4XSHA 1PUIA 3RNLA 3RS0A 3BB1A 3U6KA 4LGMA 2C2HA 1S3GA 2NTYC 1A82A 2D06A 2OBMA 4R2IA 3SQXA 3UMFA 2JIZD 2WJHA 4HDOB 3RWMB 5A5GA 1LY1A 4Q9HA 2H1LA 4TQ9A 4C3ZA 2OZEA 1ZM7A 1D5CA 1NI3A 4EQ6A 4CGZA 3O8BA 2GCNA 1YKSA 4PTLA 1US8A 3ZH9B 5J4HA 4LV5B 2ODNA 2J7PD 4KBGA 3Q5DA 1ZNWA 3HPQA 4XD7D 4OKSA 2RGDA 3QG5A 4N0DA 4QNMA 3RRZA 2EYQA 3AP2A 5DH9A 5JCPA 5LDDC 3I72A 3MWLA 3TR0A 1G7CA 3W6OA 3OAAA 2QE7A 4PC7A 4GP7A 4HAZA 2A5YB 1J8MF 1CR4A 3ZDQA 5HKKA 5KDLA 4FXPA 2Q21A 1W2GA 2JJ2D 4QOSA 3LLUA 1OH8A 3U7EB 2WJIA 1SVWA 3KXLA 1DELA 4B44A 1IQPA 1IONA 4BLSA 2FOLA 2QT1A 2W6JD 1SVMA 2PJRA 1F2TA 1J7KA 2ZRKA 2AWOA 4NCHA 1RIFA 3CZPA 3ZVNA 1FX0A 1R0ZA 4QJ4A 3W90A 1U81A 1ZCBA 1FNMA 1QHSA 2CCKA 3CRMA 4QG7A 2ZVPX 4AG5A 4Q4HA 1KHTA 5GJCA 4B3BA 4OHWA 1ZC3A 5FTMA 4D82A 4B3DA 2Q9BA 1OPXA 2A9KA 1GILA 3EG5A 4U02A 4WZ6A 3F5FA 4LSGA 2AD1A 1Q21A 3AKYA 1P7CA 3NTUA 2GRJA 4TTPA 4W5JA 2ZVQX 1N25A 1NIPA 4LJ6A 4D26A 3KJHA 3GLGA 1Z22A 2I1VB 4H1VA 2JJ1A 2X19A 4ZKEA 1F48A 4RVCA 1NBMA 4Q19A 5CYPA 4KVAA 3QXCA 3WP0A 1YZKA 4B73A 5KNDA 1JAHA 4MYTA 4DLRA 3SFZA 3WMFA 1Q1EA 2AFHE 5HPYB 3IEVA 2PBRA 4GMXA 2PLFA 2XITA 1G8YA 3AP1A 3MG9A 4TMTA 4QM6A 3A37A 2ERXA 2CHQA 2ZQ5A 3RYTC 1AQUA 4LRWA 1X86B 2AK3A 3I4LA 3QXXA 4B3CA 4IOJA 2GF9A 1NMZA 3RAPR 4WXRA 2ZITA 1YHNA 1FNNA 2CNWA 2A5DA 1ZCAA 4P33A 3DO6A 1H8HD 4OI0A 2E87A 1N5KA 4TYNA 2ZR9A 2GJ9A 1T0HB 1C4OA 1DAEA 2EWWA 1XCPA 5G3YA 1P73A 2G1KA 4B32A 1NVVR 4PC2A 4DUGD 4GPTA 1TUIA 1KI2A 1LB1B 3TGPA 1MRNA 5DI3B 3KTAB 2UZIR 4LJ9A 1LVGA 1A4RA 4B74A 3LLMA 4R98A 3T35A 3EIHA 2IW3A 3R20A 4A2WA 1FUKA 2FNAA 4QBFA 1WCV1 4PSKA 4JBXA 4A6XA 3ASYA 4JLVA 5KSYA 1IN8A 4LBVA 3Q9LA 2QPTA 3LNCA 2WKPA 4DXAA 1IJEA 2JGNA 1E2HA 1UEJA 1SXJA 4MRNA 4X8MA 1ZNZA 3NEJA 2Q9CA 3WNBA 1BMFA 1XJCA 2R65A 3MFYA 1V5WA 3TSZA 4V0LA 3T5DA 2R2AA 3D7MA 2JATA 2IWRA 1C1YA 5JEEA 1YVDA 2ORIA 4MH0R 4P31A 4POAA 5FPKA 2NO0A 3VNUA 1NKSA 2O52A 1M7HA 4C0LA 1IAQA 1Q1QA 4TL8A 1SHZA 2QP3A 1E2JA 1Z0AA 5SZHB 1D9XA 4ZDJA 5C4MA 3AVVA 6Q21A 3ND8A 1CEEA 2ZM5A 4C7OB 2ZRCA 3BK7A 2XGJA 3GMTA 5E7IA 4BZXA 3DEFA 1JPNA 2LKDA 4LPKA 3AM1A 5DI9A 5JWOA 4NL4H 3OESA 4AYWA 1R6BX 2AR7A 2O8DA 4YXWA 3LQRA 4DSTA 2Q3FA 2W6IA 1ZBDA 4UNRA 5HZKA 3EZFA 2IS4A 4G1UC 4PZLA 2C9OA 5IK2A 3B78A 1L7VC 3U5ZB 3TBKA 2ORWA 2BKEA 4A1FA 3U6BA 3L8YA 2DWOA 1SQ5A 4YMVA 1EFTA 4DLVA 3I5XA 2A3RA 3A1UA 4OI4A 4Q48A 1JAIA 1ZD1A 4KAXA 3LW7A 3VR4A 2ZYWX 1OYYA 3SBDA 4H1UA 2PH1A 3WRYC 1E2EA 5DIFA 5JHGB 4HDQB 5B30A 3NG1A 4GOKA 4PPNA 4PQRA 2HCBA 2R6FA 3SYLA 4ERNA 1NN5A 2QRNA 2YC2C 2CJWB 4MKGA 4G01B 4URWR 4TMKA 5AUOB 4HB2A 1HTWA 1ZW6A 1FUUA 4P4UA 3K70B 3MWYW 1DAKA 4Q1CA 4IOKA 3U4QA 1XF9A 4M1SA 4LC1A 4NCKA 1BS1A 2IUUA 2G6BA 4QJ5A 3KTAA 3SYNA 3KQHA 5AJWA 4NONA 4KLZA 1UBEA 4C0HA 3THWB 2VA8A 4H9GA 5KYKA 5HZHA 3RC3A 1GWNA 3OZXA 2QAJA 5CDFA 1KI7A 4V0ME 5JCZA 3TVTA 5K8UA 4MKHA 2VHUA 1WP9A 2ATXA 4DIDA 1WBBA 2KSQA 3N2IA 1Q22A 3KQNA 3T5GA 4Q47A 1EWQA 4Z1MA 3KZ1E 5G3ZA 2VPPA 3DL0A 2O8EB 4JMPA 2W00A 4K46A 3BIFA 3LA6A 4WZAE 1KI3A 1AM4D 3RWOA 4P4SB 2R44A 2P3SA 5C4GB 2YOFA 1T3SA 2ZROA 3TQCA 5HR5A 1E1RD 2NG1A 121PA 2PCLA 1NY6A 1ZYUA 5B64A 1TQ2A 1T6NA 2RH5A 4NDZA 1Q57A 5KHOC 4C7OA 1GNRA 3F3YA 3QPVA 4JJKA 1XDBA 2WKQA 4YC7A 3QPWA 1P9NA 1U99A 2J3EA 3TK1A 4EDHA 2CLDX 3QVVA 2FU5C 3U60B 3W6NA 3ADBA 4MGKR 5EE5B 4CEHB 2YC4C 3DM9B 3D31A 2H8KA 1VG1A 2C03A 4U7DA 3IPYA 5G41A 5LBIA 2ZSDA 2ZJ8A 1M7GA 1GKYA 1KI9A 1XFAA 1QF9A 2IS2A 2V9PA 1G3RA 2CL7X 2DBYA 5FBLB 1TU4A 4OK3A 2IK8A 3UWKA 1OH5A 4Z54A 2PL3A 4PAMA 2VIIA 4PX9A 4TQAA 2GXSA 4LHXA 2FV8A 2YWGA 3QI2A 3MRSA 4Q18A 2XXAA 2O0JA 2NOAA 3GEHA 4M1MA 1CRPA 1RYFA 3K0CC 3PUWA 1VG8A 1COWA 2C99A 4GOXA 1NMYA 2BWJA 3NH6A 1G8PA 4LBZA 1II9A 2ZE7A 2JA1A 1NLZA 5FTNA 3IQXA 3AVTA 2JLSA 2KBEA 3D8BA 4RSGA 4WOPA 4Q7MB 4US1R 1KNQA 3I3SR 5FOTA 4RY2A 4C0QC 2CJWA 4PSAA 4PXAA 5JHHB 3S1AB 1E0JA 1PLJA 1VYVA 1X8JA 4PHTA 2G77B 4TSFA 4YMWA 4MITA 4BFTA 4Z51A 3FB4A 2HF9A 3TLXA 3LDAA 2ZRDA 4MDFA 3RS3A 2QM8A 2V7QD 3UWOA 1CBUA 4NCNA 4I1OA 4WW0A 2G83A 4F4IA 1JI0A 1KJZA 1QG4A 5J5CA 1LV7A 1XEWY 2JCSA 1KK0A 4A8JC 3TE6A 1N6HA 4A92A 2PT7A 4TT3A 4XH9B 1Z63A 2ZAOA 4JLAA 4NE2A 4L5BA 1XU4A 1O87A 4KYIB 1MO3A 1W0KA 2XZLA 1N0VC 4NHOA 4KCGA 2OILA 1JXOA 2J0VA 2HCJB 4AKIA 5EXXA 2AK2A 3TW4A 4V02A 3EASA 2P6UA 3PITA 4KFUA 4EJSC 2O8EA 1U8YA 2GK7A 2B92A 4L15A 3GPLA 4PHHA 3W34A 4NBSA 3N2EA 4P4SA 4DDVA 1E0KA 4MUAA 2F6RA 2AX4A 1E98A 1E3MA 1T4GA 2WAXA 3B7GA 3DKVA 4BLQA 1GL7A 4B2LA 3MJRA 2BBSA 3QY0A 1GG2A 3CLVA 3CNLA 4Y0VA 1JJVA 2IUSA 2PX0A 3QIAA 4ZCIA 5J4VA 1F60A 1KZGB 5AR1A 2YWFA 3RC8A 4Q4AB 4MRPA 3CIOA 2CK3D 2FG5A 3TJZA 5D3QA 1GRQA 4BFUA 2VBCA 2VP9A 1HQCA 2QUZA 2H16A 2AN9A 1A5TA 4URZR 2YJTD 2BIFA 3LXXA 3WY9A 4XVUA 1UF9A 4FMDF 2FEOA 4E07A 4JSYA 2HUPA 3GJ5A 3K0EA 2O0HA 1GDDA 1Z6XA 1IM2A 2WWGA 4IEEA 3VKHA 4UQOA 1GNQA 1NLYA 1OXUA 3NBXX 5FPHA 5C46F 1EFRA 2ZE8A 4IVPA 3HDTA 1H8EA 3OEHD 4B2PA 1KKLA 4HB0A 4WXPA 2VP6A 3GLIB 2OSBA 3LH5A 1Q20A 1CXZA 4OQFA 3P27A 4FN5A 1AGPA 1EFHA 1U8AA 5KSZA 2ERYA 4F93B 2OCAA 5FL7A 1RW4A 5H8WA 4XOIA 3S1AA 4Z8XA 3TW8B 3O8RA 1XTKA
chains in the Genus database with same CATH superfamily
5FNVA 2AG1A 4DQXA 4PZ9A 2F1IA 3NTRA 2R85A 2C5LA 1E7RA 1Z6ZA 3DA8A 1ISJA 2Q8PA 4GYJA 1UBKS 1EX7A 1ZUD1 1GPKA 1EJBA 2JFFA 2PLWA 4GH5A 4HQ6A 5KNDH 1AOXA 1ESNA 3RHSA 3OTWA 4JLWA 4L1KA 2PSHA 3S2ZA 3WNCA 4I7EA 1L8LA 4J0HA 3AKZA 1NASA 5K6AA 3LT0A 4OTZA 4QU9A 5L3ZA 1RQ7A 5HRUA 1WV1A 2F4NA 2EZUA 3M6WA 4W8HA 1BE1A 3TXAA 5BQXA 2JDID 1Q1BA 3DL4A 1Z6AA 4G89A 3S5JA 1JPVA 1BG6A 1MO5A 3LPMA 3MYYA 4FDVA 5K1ZA 4CKEA 2GA9A 2HSDA 4Z9YA 4R2LA 1K63A 1T9AA 1BQ3A 2YH2A 4KL8S 5THXA 1GUAA 4DSNA 4DWJA 1MN6A 3BSYA 5HTKA 3EZNA 1WY7A 4L4YA 4EMSA 5L4NA 3NC1C 1VZ2A 1W4AA 1Y89A 3GFRA 3GXOA 1ZDMA 2PLNA 4HPJB 4LDJA 3QNMA 1K6IA 1O5OA 4ZI3A 1OFHA 3H11B 1R0XA 3PUJA 3OY7A 4PYOA 1LS1A 3VHXA 4BGDA 3FY4A 2FPPB 5C5DA 3PHHA 2FB9A 1U8ZA 4BEJA 1Y8AA 2EU8A 1Z4IA 4BWGA 4DCPA 2ZWAA 2BMFA 3QKSB 1LA2A 1V3VA 3A36A 3KQVA 5FTLA 2ZOSA 4I2VA 5FOSA 3W5AA 1W59A 3MXOA 1UJBA 3VA7A 3EVGA 3VKGA 4JBGA 1XA0A 2HA3A 3IUQA 1L5YA 2AJCA 2DSNA 1C3EA 3FMPB 1JDZA 3B20A 4OMUA 4PONA 5J2TB 1N2ZA 1ZMOA 1MJGA 3REGA 2CXHA 2XE7A 5ALWA 4OQLA 2BRUC 2PU7A 1UBRS 2ZJ2A 3A6KA 3CX7A 2A5JA 3G1TA 4MA5A 2HIGA 1QGAA 5LMUB 1S1MA 3A26A 1RACA 4EZEA 3GXBA 2AXNA 1YDEA 5CH5A 3RSZA 3DOJA 3A1FA 2R5NA 3PGXA 4HGZA 1XQYA 5FTKA 1BYUA 2R4UA 3RYCA 3MTDA 3F5SA 3WYAA 4LXUA 4O25A 1D1QA 2IU6A 4AG6A 1IHUA 2H06A 4BVAA 3U7HB 4BN4A 2AV6A 1B6SA 5GJWC 1UKCA 1KBZA 2QQEA 4HOYA 4INZA 4CQNA 3FPJA 2D3WA 3BOSA 4FT2A 5GV7A 3E5NA 3GRUA 4GLBA 5JLAA 3RK0A 1I4DD 2JASA 4C2BA 3EPLA 3U3MA 2FR1A 1Q2XA 3PHGA 1L6RA 4JC8A 4KMMA 4O29A 3ZJUA 3HK2A 3LECA 3UK6A 1HYQA 1YCFA 4D9MA 5IBRA 1NVKA 2C78A 2HU5A 3GH3A 2IUEA 3E2IA 1RI1A 1WHTA 1B42A 2QKYA 4YRIA 3BQNB 2QQFA 3T8YA 1K6XA 2PK3A 4FFBB 4OHFA 2IZ0A 1UZNA 3DFZA 3G85A 1F3OA 3DMRA 4LHYA 4X1IB 4H7KA 2B30A 1DOAA 4GMGA 2IF2A 2I2FA 2V55B 5B58T 5IF9A 5KVAA 1G19A 5DGHA 2W2KA 1ZH0A 3M3DA 3NHKA 3E15A 3O9ZA 3VKUA 2B1JA 2VHCA 4BO1A 4HQFA 4R2HA 2OAGA 3ZXYA 3PYLA 1DDGA 3WB9A 1Z68A 3TR6A 2XIJA 3EK2A 3F9RA 4B4WA 3HCFA 3IL2A 2KI5A 3AUFA 4F8EA 4RD2A 2C8JA 4ZARA 4DMHA 1NAIA 2HJ9A 4R5HA 2AXEA 3MINA 3QQPA 4L5AA 2HQSA 3A1VA 3ANNA 3JRNA 4PPYA 1MZPA 2PV7A 4WSOA 4RTQA 5BVHB 5DULA 5EEHA 1Y1SA 3HJBA 5EE1A 1RWKA 2VQFB 2XE6A 4P5PA 3CNNA 1OH6A 2JAQA 4IQ0A 1MCZA 1TKBA 1LX6A 2QNRA 4OP3A 4RWEA 2QRZA 2ZTSA 4R0MA 1DG9A 2JAPA 3CUYA 5BWLA 5HYVA 3TFOA 1WETA 1UAAA 4W5NA 4DTIA 3UHPA 1GTMA 1VKZA 2BDUA 2JIPA 5EHGA 2ZYTX 1L4YA 1M33A 5EUQB 3SKYA 3RI3A 2C3PA 2WMOB 3I09A 1K92A 1REQA 2Y93A 2ZJFA 1IJKA 4MVJA 5EWLA 3ZV7A 1QPGA 2D2FA 4WEOA 2WHXA 3KJZA 2P2ZA 2X77A 1S2GA 3A3YA 1XMSA 3LQKA 4E94A 4DQVA 5DYGA 4JZKA 3B9QA 2CT8A 2QRJA 4HH3C 4MI9A 1L7AA 3KT0A 2CF6A 4KO3S 2J7KA 3CZRA 3B6IA 4UCFA 3UAGA 3QKUA 2DX7A 5EHIA 4B09A 4Q1EA 1GGKA 4C0SA 4BMYA 4E2WA 4QAQA 2I1QA 1LDEA 3L8GA 2GBLC 3TNYA 1YR3A 1GTG1 4IH9A 4EUFA 1N3BA 4PYIA 1RQPA 3GVIA 3PENA 8GPBA 4ZOCA 1RI5A 1U9JA 4ARSA 1EX9A 4BKQA 2GZ1A 3AFHA 4I1SA 4EG5A 5GQSA 5GJBA 2Z8XA 1NJ8A 1J20A 2PR2A 2P9CA 3FFXA 3PU6A 3FI0A 3KQQA 4XWOA 1W36C 2ZREA 2O8CA 1OREA 3U1VA 3BMQA 4YK7A 1YOVB 1LRJA 3GEDA 1G55A 1QV9A 4J2TA 3NHPA 5EEGA 1DBVO 1M8GA 2IYZA 2RHCA 3IMKA 5I5GA 2QMOA 4Q9LA 3K0AA 2ZBEA 2PY6A 1SBNE 2EFCB 2XBLA 4G0PA 2BCGY 1T8PA 3GW8A 3WZLA 2VYCA 1ZSVA 10MHA 1HZJA 1WBDA 421PA 5JAMA 1GADO 3RBXA 4D3FA 3AF4A 1SCIA 1RJFA 4DHWA 5AESA 2PXCA 1XRNA 2NVBA 5TEWA 5IKPA 4I3FA 1UXIA 5CA0B 2X3YA 1OHHA 4KLNA 4BV2A 4CI9A 1T9ZA 3H16A 1NP3A 3OQ6A 3RK4A 3EXIA 3QHAA 1PBTA 1CNFA 3NBKA 3K9WA 1NLUA 1ZNYA 3QVUA 4N3AA 1QOQB 5ADWA 1JRLA 4EI7A 1J1ZA 3EVAA 2XRZA 2HA0A 1XNJA 3QM1A 4GICA 4GKBA 1JDTA 1M8FA 5T5QA 1A5ZA 5HM6A 3ONWA 4D8VA 2L17A 2JIZA 3A9RA 3LT1A 1I0LA 4NPHA 4YRDA 5CU7A 5DYYA 1L1RA 1FQJA 5F7ZA 3MUFA 1HDGO 4UM7A 1UC8A 1VCIA 3L6DA 3EVDA 3OZTA 3JZAA 1TOAA 1AGRA 3P8ZA 4PO8A 1TJYA 3FPBA 1U28A 1R0KA 2GN8A 3QVKA 5IULC 1MRZA 1XRJA 3EZLA 3I58A 2J7PA 3K9LA 1NFQA 4C4XA 4BPRA 4CQMD 2W0MA 2OO3A 3ZDBA 1NL3A 5BNZA 4IX9A 4R2WA 1P33A 1Z4OA 2VCYA 2QRMA 4F4CA 1DTEA 1VHDA 3IFSA 5AW9A 3PNVA 5TJ9A 5JVDA 3FOZA 3VC3A 3HR4A 3M6VA 3QF4B 4MCIA 4MUFA 1T2VA 2QTBA 1ES9A 3DMGA 4ZQBA 1W5TA 1CUGA 4EP1A 3K15A 2ONCA 1EG2A 3IBYA 5BV8A 2D2VA 1ZK0A 4UNPA 1HPLA 3IAS6 2ZDGA 2OUKA 3TGWA 1EVZA 721PA 1N6IA 4YWHA 4PC6A 1THMA 1RWVA 1ESEA 2PS0A 1MJ5A 4YV7A 4AMUA 4PZUA 3VAYA 1GFSA 1KTVA 2C5SA 5K8VA 4JC5A 3A05A 3GRVA 4IGFA 4X7MA 1KEZA 3TGLA 1T6BY 3FFTA 4QDOA 3L0SA 2O1SA 1A7JA 3TIFA 3ZD7A 1M0WA 3TAHA 1GG5A 8OHMA 5ARDA 1ESCA 2QK4A 2XVXA 4UQLA 3PUZA 1F8XA 1XZPA 1K8RA 1ZU4A 2Z6AA 3PYMA 2JEOA 3RUAA 1IWBB 1QIEA 3KKKA 1SPXA 2FP3A 3F1LA 3N53A 1BRTA 2Q5IA 4HO1X 3HUDA 4LCJA 4PC3A 2OBLA 4WXYB 5ELMA 4F1JA 4PLVA 4U2DA 1N36B 1CZHA 3LAWA 2IQIA 4HDKA 2C2WA 2AN1A 2GX6A 3IODA 3ACCA 2PRJA 3BWCA 3LC0A 3D4LA 4MDHA 4TKUB 3R74A 3VISA 2PFGA 2ERCA 1EDZA 1P80A 2ZIWB 3M4YA 5EP2A 1W93A 2D1YA 3M9WA 1UADA 1ESMA 2YNMC 2GD1O 3EDYA 2OFWA 4E4YA 1A96A 1R64A 2DSTA 3OP4A 4RVGA 4CEIB 1E4YA 2G06A 3CKYA 3H83A 3NKFA 2WFZA 4MYSA 3K32A 4IIUA 2SKCA 3GELA 1HBJA 2M32A 4DUYB 5L7WA 3RUFA 3LFHA 2I4TA 1AIPA 4IHKA 1HH4A 3ORHA 5F12A 1V26A 1BEEA 5L3SB 3F3SA 1MX5A 2VYVD 3PNPA 4WFKA 3WX0A 3HNRA 1T8TA 3LG2A 4BX0A 4M37A 4BO7A 2OGSA 5CDTA 1H6DA 1FPQA 1Q1ZA 1RCTE 1W2HA 1ZD8A 2OD2A 5LPNA 3M5CA 3WE7A 3RAGA 2IUYA 1P7ZA 3RU9A 3V55A 3L6UA 1XZKA 2J6CA 2Q6TA 3A1TA 3FNFA 5DHAA 4M36A 1P45A 3EZ2A 4Q3DA 4ZAYA 1KDYA 3QU5A 2F3RA 2ISCA 3K53A 5JAUA 5KNBA 1D7AA 5JCOC 5GONB 2JFNA 3URKA 3OI7A 3JQ8B 3AERB 4H3VA 2VPZA 1LFDB 2M6LA 4ESVA 3UMGA 221PA 3KUXA 4WKBA 3R4CA 4HT3B 5I9BA 5DSZA 5K45A 1F8FA 1SXJD 2J59A 1CUIA 1XEWX 3IXLA 2QROA 4I5IA 2WNHA 4J76A 4PVCA 1ZW1A 4GX2A 3ECCA 3ND7A 4Q02A 5J1SB 5DBGA 2J6HA 3VJLA 4BB9A 2GAJA 1YL6A 2DY0A 1G3UA 2EG9A 2XVZA 5FWYB 4MYCA 5EWMB 4PPGA 3SKXA 3C3PA 3O31A 1K9VF 3ONVA 1IN7A 3OTGA 2HZ7A 1H0HA 2ZTVA 2WD7A 5AICA 3WB0A 3LYLA 2B99A 3IP1A 2IDZA 2WF5A 4OFZA 2GS9A 2G9QA 3LCVB 1Y5RA 1CNMA 1J0AA 4C5AA 2PUDA 1N3IA 2L0XA 2L42A 2OCGA 4IZHA 3UAYA 1U0BB 2VHWA 4BV9A 1CETA 2QD3A 3OG9A 3EZYA 2B5VA 5GONF 1J5PA 4E3ZA 2YW2A 4P1ZA 4QLAA 2JJ8A 4WERA 5CT5A 1FP1D 2FPGB 2RBGA 3U0VA 2REXB 1SXJE 1QTQA 3IBTA 4UUPA 4QBIA 2FF5A 4A27A 3VR6A 4MB2A 3SC2A 1NBOA 1QB8A 4JV5B 5CFZA 3BWYA 4DEXA 3TAUA 1VE7A 1JQ3A 2B4RO 1PSZA 1N2SA 1A7UA 5D84A 4JN6B 4X20B 1ADYA 1C4XA 5ESXA 1GP2A 3R8CA 1WA5A 1D1TA 2PYZA 3KJGA 4EYEA 1N6OA 4ANFA 1HL7A 4OI1A 4YLGA 3RTEA 3W4KA 1RDFA 3DFKA 5J40A 5ERGB 4LQ4A 1GCAA 4GOMD 4IIDA 1FMJA 1OLUB 1BN7A 1GGNA 3T94A 4C22A 2FZWA 3NXSA 3OETA 3SJZA 3UXMA 4ZDKA 2BTQB 5HKAA 1GAXA 4E46A 4L0QA 7MHTA 4JEMA 1R6XA 1SC1A 1Q15A 2OQ2A 1IY9A 5FQNA 4YDHB 2CUKA 1ZH2A 4FFRA 4B47A 3N0WA 2D1SA 1H05A 1YS2X 4ZRNA 3TQIA 2GILA 3EIWA 4ARCA 2GBCA 2WKWA 4YH1A 4RS4A 3ROQA 2ATVA 3STHA 1IUPA 3WWDA 5A5DA 4CKBA 3RADC 3IMFA 4ABTA 1ML4A 1TT7A 3BHNA 1A8IA 5CCXA 4N49A 3ZWMA 2HDWA 5ECDA 3V7NA 5DI3A 4MWCA 3T38A 3RM3A 1YCGA 2VAMA 1M10A 3TVDA 2X8AA 3LUFA 4MP3A 4U9IS 4D8UA 2ZRLA 4TZTA 4I9NA 4I99A 5BORA 2FPWA 1NQXA 2ZJ1A 1QX3A 4OHOA 1PSDA 3KEFA 2BZ1A 4G5SA 3GH1A 4FU0A 3EUEA 3RSLA 1G8HA 2WHEA 4QOHA 3HCWA 3ZWBA 3ZNNA 4CJXA 4LZLA 2FKNA 3WP1B 3CZMA 1CCWA 4MUIA 3H42B 3TZQA 3WRYA 4DIFA 5KWSA 1HT3A 3K6SB 4YJHB 4FFPA 3CX4A 3P2EA 3FUWA 3LHSA 1FMLA 1PW5A 4XB2A 3W78A 2GM5A 3CEPB 1GUZA 2W71A 3R9XB 3AVWA 4J49A 5A3VA 4BFYA 4XD2A 1NMXA 2JFBA 2QOEA 3MS2A 1QWSA 2IYFA 4H7IA 1PDOA 2RCNA 2R25B 1TMOA 2AHRA 3GCGA 4ZAVA 4Q4LA 2QGZA 1UDCA 2HH9A 1QF6A 4AJ4A 4BECA 1E2PA 3S6JA 1HG0A 2BJWA 4JYMA 3QJ5A 2B98A 3PTZA 3BFXA 3UIEA 4UTRA 4AM8A 2X0KA 3U7GA 1PVOA 1XPOA 2V1XA 3EAGA 1M0EA 3OFND 3Q7PA 5ARBA 2TRSB 3UHJA 3VUFA 1G8FA 4R7ZA 1O96B 1TLLA 3GT4A 2VUSA 4MQEA 4PPFA 2YIDA 4A8JB 1OXTA 4ZYTA 2Z43A 3I01M 5JANA 3H2GA 3SZ3A 1RJ9A 3ZHOA 4JS0A 3TZHA 1SZCA 4GI5A 3VU8A 3DOUA 5K3FA 4IYJA 1Q0RA 4PG5A 5KYXA 3THRA 1UC4B 3TMYA 2W4MA 4EW6A 5KJCA 4UUBA 4DR5B 4LKRA 3QPDA 1GU0A 3GUHA 1R5OA 2R8OA 3MGBA 3AI2A 4MUYA 1JG6A 2Y1LA 4IIFA 5ICFA 4C08A 4H6VA 4D9KA 3SF8A 1GQOA 3T6KA 4XIGS 1K98A 1EXWA 1K3UB 1XC7A 4LA4A 4XWKA 2QHXA 2EZ4A 1C81A 3M6LA 4UMVA 3C6QA 3GQBB 1URPA 2IYQA 1GQYA 3Q5EA 5KVVA 3FW1A 2OC9A 1F3LA 1F51E 1K8QA 1LQTA 2BBTA 5FT9A 3MMZA 1HRDA 1KH3A 2ZSHA 2CLOB 3EXHB 3I9V1 1P2UA 3ANYB 1R9GA 1TCVA 1ORIA 3ESCA 2JIOA 2I9PA 3Q3HA 3ONDA 4QECA 4TYMA 1R9MA 3HLTA 2HCFA 2ORVA 3K2BA 3FPGA 4A2PA 4D9NA 4IMPA 4LBYA 4UOZA 5JXGA 5K3EA 2IXTA 2MR6A 2R6AA 4L74A 1BIFA 2WP0A 3WGNA 2VTKA 2ETVA 5HIJA 3IOEA 2B2XA 4W5HA 4XQ0A 5J5VA 2V4MA 1JHRA 4L9AA 1SHJA 4B79A 1X8LA 4RF4A 1KDOA 3PIDA 5IC4A 3P9XA 3THWA 4YJFB 2KW5A 2P9ZA 3A2LA 2ENUA 1KWKA 1NI4A 2XNSA 4HB4A 1G3QA 5CNKA 5EPOA 1OWOA 2QZPA 1ZKMA 2PCJA 4JJ7A 5AK3A 2ATIA 3I83A 4BNFA 5K0GA 4DR7B 3HFGA 4CTOA 3PPYA 3RIMA 5HUQA 4BASA 1N4AA 1MMFB 2YWDA 3KELA 5GJVC 1HLDA 3BWMA 2Z57A 2X86A 1T1JA 3LK7A 4JASB 3TEJA 1I7QB 4COOA 1AKWA 2FFQA 3KX2A 3TEMA 3I76A 2V7QA 2Z2XA 2B37A 1FXWA 1J33A 1UBCA 2BHRA 3IPXA 4LK3A 4NKRA 3A9CA 4IIHA 1IG0A 3I9NA 4BU1A 1QU2A 3R77A 3N7TA 1Z4KA 2BYTA 2XA1A 2RJOA 4QNRA 3L0OA 4EZBA 1ZVKA 1KS2A 1HDOA 3BMCB 2C2GA 1L5VA 1UKBA 3DV0A 4KTTE 4XR4A 4I1UA 2EJCA 4JP2A 4MIOA 4D8YA 3FMFA 2B8WA 5JASA 4RLSA 1DJQA 2OCBA 2X0DA 3X1JA 5SZKB 1UP4A 1KJ8A 1VPLA 2SCUA 3OPXA 3S4YA 4IY1A 4WXMA 1KDRA 2QL6A 1WF3A 2GXUA 1FP6A 1I2AA 1WD7A 3C1TA 2HTEA 3OLQA 4NQRA 1L4UA 1GO2A 4G2TA 3JYHA 4EKNB 2X0JA 1E4VA 3JS5A 2C1EA 4JYPA 4ROSA 1AXGA 2P91A 5AHWA 1KJNA 2PMKA 1B8OA 1P75A 5FUQA 1EUYA 2RKOA 2AEJA 3WAGA 1WULS 2CLSA 4G0NA 1TYBE 4WDRA 5DTEA 2CMGA 2GD6A 3N0RA 4MEJA 3VO1A 4TUYB 4TTVA 3WK8A 8AT1A 1FRZA 1XVVA 3TPCA 2PGJA 2XQIA 3KRTA 4MRSA 4OVKA 3R9KA 2PSJA 1H1LA 2AWNA 2XA2A 2CXRA 4YRRA 3LT4A 1O89A 3EZGA 4PLPA 1BGWA 2CK3A 2PGOA 1N1DA 2H2HA 1TTTA 2EFDB 1W73A 1FTYA 3OQ1A 3IAAA 2H1OA 3STVA 1HLFA 3VNVA 3A9WA 5CLLA 5I8PA 1C3OA 4DLXA 3RUDA 1J49A 3HN6A 3I2GA 5LA6A 4WFQA 1LPAB 3LUBA 2YXDA 2IU0A 5CCEA 1N32B 1FFWA 3G7UA 2QMUA 4ARAA 4TRRA 3NJRA 3HU5A 3OFVA 4V0SA 2E4WA 3SGLA 4ZC1A 1ADCA 2J5XA 1OF1A 4UBKA 4ZVPA 4EITA 1EA7A 1SG6A 3ICPA 1E2LA 4JCCA 2XB6A 1U2SA 1JQLB 3I1JA 4AXXA 4JI0B 3EPHA 3VQTA 3BKWA 5CT4A 4MW9A 4RSMA 4MV4A 1P6XA 1AKMA 9ABPA 1B6TA 5DSXA 3B7PA 2B4AA 2NP7A 3OWHA 2CCGA 2HMWA 4ZHQB 4IJ5A 2Y05A 4D56A 4LGCA 2V6MA 5LQAA 3HM9A 3K0SA 2YS6A 4ED9A 3GJQA 3NBUA 4LWZA 3D59A 1NW8A 2K87A 3WIDA 1IG3A 1XD2A 3HL0A 4ZMBA 1NNEA 1JDBC 4ZVQA 2Q5QA 5AM1A 3OJWA 2WJYA 5E1BA 3T1OA 3BJZA 4MZDA 5EXDA 4BQSA 2RGGA 5KWVA 3WBJA 2WIDA 3ZCQA 5K4HA 1E32A 1R8YA 3ZTWA 5B2FA 2RGYA 2WTAA 3F7MA 4LGYA 2DYKA 4RKRA 1LS6A 2P6NA 1HOXA 1C8KA 3W6PA 1XDWA 4P0TA 4UTPA 1A0OA 1SD2A 1PR1A 2E4ZA 1SQ6A 1CULC 1SWWA 3ZJYA 2Z58A 4B87A 2NUAA 2O7NA 4UJ5A 3ZX5A 2Q0HA 3FPFA 4KQCA 4PBRA 4BAZA 1SHTX 4E30A 4R8MA 4FZJA 1L4EA 4MPJA 4NARA 5BW4A 4TROA 2VCEA 2CWWA 2VL7A 1PR4A 4HHEA 3S40A 5E4TA 4FLEA 2OP0A 3EQ8A 3NBFA 1LZKA 1VI2A 1Z6GA 3TCNA 4ZHQF 2PHZA 3ZE0B 5JFOA 2NU8B 1RPNA 1ODSA 2CBZA 1QQTA 1RAAA 3G0IA 4O2BB 1BXKA 1E58A 2WM8A 3LX8A 4GUDA 3SU8A 5BYAA 3RK1A 1FFHA 5E4YA 3O2SB 4GKVA 1Z26A 5IBPA 2AFIA 3CM0A 1KEEA 4WA8A 4CM5A 1QH1A 3GP5A 4ZPXA 4IXMA 2FH5B 3WBKA 1WF6A 1P74A 2FN7A 1OGIA 3CQ9A 4OA8A 4A8HA 2VJMB 5FLKA 4C5BA 1A27A 5JTTA 4DV2B 2M1ZA 3AJRA 3H8VA 3B38A 4F7WA 3CNBA 3RW9A 1E2GA 1DBSA 2YY6A 1FBTA 1JKJA 1EA5A 4KB5A 1SBCA 4AFNA 2P41A 2C31A 1FNDA 1GTSA 4PF1A 3CT6A 3GL9A 2AXPA 2X3FA 4X3OA 1KVUA 1ADFA 3A27A 2H5LA 2WYVA 4RLQA 2PXHA 1UZMA 3DEHA 1KAHA 1EFVA 3DOIA 5IRCD 2VXBA 3I8OA 3WNQA 2BFAA 1XCJA 1BVYF 1TIBA 2Q27A 3S7ZA 3ICEA 1U4SA 1RFGE 4KO8A 4ND8A 3P2YA 3WMRA 4O2BF 2QV0A 3TQHA 4QTTB 2D7DA 1DU4A 1PW7A 1SIUA 1CSEE 1V8FA 3GWGA 3TW0A 3V2IA 5A2QA 4L3OA 3OTOB 3QE9Y 4BMSA 3Q87B 1JDSA 5E4JA 2QTNA 1MEOA 1QRTA 4PRYA 3DE3X 4MCJA 2P4UA 4X95A 5DTMA 1Q0LA 1HEIA 2QA5A 2HTFA 3BXFA 3T3NA 2IYTA 4DMCA 1I4TD 3RJ9A 3DCIA 4Z9BA 1TQ4A 3TIGA 4BXOB 4QUAA 1I1NA 4KOEC 2GKSA 4FE4A 5AHXA 5IF3A 4BO8A 1N0HA 2FSVA 3OA2A 2VSFA 1CDEA 4N82A 3T5BA 3WOVA 4ZJUA 3IV7A 2X9QA 4EVQA 4MIYA 4KIJA 4L02A 5KPJA 1JSXA 3QWAA 2HRDA 4R3UC 4TYQA 3L3BA 5D3ZA 1LLQA 3HACA 5DU2A 1JXAA 1Y6JA 4Y2YA 3IPAA 3EJ6A 4RF3A 2P1DA 2D1QA 4GWKA 1KAGA 2XZOA 3DDHA 3EVZA 1RXUA 4M0CA 5D5PA 4ZVLA 2UUOA 3DYBA 4B7UA 5EIHA 1R4MB 3H11A 3ILYA 3IMCA 1AMUA 1N3LA 2BPOA 1E6LA 2VAVA 2I6GA 3EVNA 5DTRA 2XOEA 2P6OA 5IVIA 4PN3A 3REFA 1SO8A 1IXYA 4G4SP 2VNIA 2HNAA 1QRRA 2CHUA 1RIIA 2X8WA 3EQ9A 3NEYA 5T7BA 3FCAA 3QIVA 3OFSA 3HDQA 4Q39A 1A5BB 3TOZA 1N9ZA 2D0DA 3KLMX 3WGKA 1QX4A 3LXMA 4C0KA 3KR9A 5IKEA 5L9AA 2JLUA 4V0OA 3JR7A 2HV9A 2UYGA 4CKWA 4XEHA 3LE8A 4TXJA 1J9ZA 4JITA 3V9AA 4B48A 3R3ZA 4B6GA 1JJFA 3E22A 1GNPA 4NU8X 4DF3A 1LRLA 3C70A 3GFTA 3X3HA 4BFTA 3PGKA 1Q7BA 3ZPXA 1JV2B 1ECJA 5IDQA 1U8EA 3EVBA 3O4RA 1P4SA 4BS9A 2G71A 1QFXA 3ZXIA 4J7AA 1A8SA 5LCXA 1V5EA 4P22A 1CE8A 3SZMA 5JC8A 3GNTA 3X1WA 2ABWA 1Z2DA 3LY8A 3U9SA 1SN7A 2BGUA 4V0NA 2BH9A 2J41A 1TZKA 1GZ6A 1SD1A 2P9TA 3CVJA 3HA3A 3I9FA 2XVAA 4HRYA 3UNXA 1Y8QB 3UB3A 3V8QA 1AMNA 1MENA 3MTQA 1H4VB 3ETJA 1O7JA 3BX1A 3OE4A 4WCFC 3PUVA 2BM1A 3EXFA 3UWPA 3FUVA 1R27A 1RKXA 1GL9B 2XTMA 1U7DA 4XYMA 3C3KA 2CFCA 1MO2A 3QV2A 3UF0A 3WLMA 2OXFA 2ASVA 5K8LA 1G5FA 3HFSA 1JT9A 3K2QA 4AIIA 5B4TA 2WWYA 3B3QA 5LLTA 4F8JA 3P32A 3P2JA 2ACKA 4LMBA 2BEJA 4EHBA 1JA1A 2WWWA 2WOJA 3T7EA 2B2NA 4WQMA 2YRXA 3O1HB 3WGQA 2GAFA 3PSHA 1CIPA 3HPRA 4P3PA 4CM6A 5G0WA 1E5VA 4CVNA 1TRKA 2WE8A 2B82A 2RONA 3OAAD 1GPNA 3ES9A 5BSHA 3H1AA 2COEA 2FA9A 4I6JA 3KU4A 1YZUA 3A3NA 5DLEA 1QIKA 1JJ7A 1Y7HA 2D13A 2LWIA 3NJ8A 2OWDA 4JYBA 5BVHA 4GGOA 4NTZA 4NVRA 3ZY5A 3GFVA 2B5OA 5TJHA 2IZ5A 4C4PA 4QG3A 1K8ZB 3HCBA 5I4CA 1PJQA 1USKA 3ZZ0A 5BNWA 2XSZA 2ODAA 3HXKA 2X0EA 3ETEA 3A0RB 4P6VF 1JIXA 5T6MA 5AVRA 1DKPA 3TWOA 4KMSA 1PI3A 2NZ8A 4NBRA 2Q0XA 4DLLA 1IN1A 1AHIA 2VJAA 1YUMA 1TGYA 3V48A 1J2UA 5BYKA 1MB9A 2BKXA 2OLJA 4A03A 1A9YA 2Y4NA 1YBVA 2Q46A 3HMQA 1FU4A 3CLRC 3HB0A 4UVGA 1ZHOA 2PX5A 3AJAA 5JPIA 4R9UC 1G9TA 3DOOA 1XCLA 2FSHA 2GETA 3D6JA 3O83A 2X9GA 4CQJA 5ALXA 3DLBA 4G6ZA 1KVSA 3VZQA 1APBA 2BM0A 1K6EA 2O3QA 4FCTA 4EVSA 3QVOA 2JFXA 2XDWA 3CLUC 5LIPA 1SXJB 3CE6A 4RW0A 4WZBE 2QRGA 1T4DA 2JD0A 4DNXA 3D7LA 1DWOA 4UHEA 1HORA 3BSFA 2JJ1D 2OV4A 3FA2A 3OX1A 3W9YA 2WUEA 1Y6RA 1RD4A 1WRBA 1NBMD 4X64B 3ZV6A 3GVXA 1JA9A 2R84A 3IA2A 5JMTA 1PS9A 5KCZA 3HVHA 1TT5B 2Z2YA 3KOZA 2FVYA 2H4HA 1D8TA 1LSSA 1P9LA 3PYXA 4M9ZA 4F45A 4U1RA 3WGZA 4HQRA 1AF4A 4JP8A 2XUZA 1WQ4A 3OX3A 4ZD6A 4II7A 1NJ6A 2IYNA 1A1SA 3M7IA 4JHLA 3Q3JB 4PNEA 3NORA 2OGTA 4JVMA 1EX1A 2CVFA 3QITA 2PVPA 4LY0A 2Z8YA 5LWQA 3EN0A 1CZLA 1SBZA 1GA1A 3JQPA 4CLEA 4N7RA 3H9BA 4DV5B 3AUUA 4MA0A 3N0XA 3PHBE 1B0UA 4R0NA 5FLYA 4MQLA 3U7QB 4NATA 3ZDXB 2N47A 2HWUA 2ASEA 1NTRA 1NVEA 3R44A 1ZGHA 1AXEA 2RHDA 4KQ6A 3GCXA 5L3QA 1B2LA 1Q12A 1QV6A 3E1KA 5C3MA 4G9BA 1N0IA 1U31A 1J6UA 5F2NA 2R6R1 4KUHA 2FMUA 3NBZC 4LHZA 2QD1A 2YYAA 3C6YA 4AQ7A 4X8OA 1SKMA 1WPRA 2O5CA 2Q0SA 3EEBA 2LRHA 3N8NA 4DMUB 2ZAMA 1PK7A 2PZFA 2WABA 4KVFA 2DPYA 2F8MA 3BWBA 3NTXA 1T8UA 3JTEA 1D4ZA 5CJPA 5U1PA 1QP0A 1UPUA 5FTJA 1KSFX 3DOFA 3RTCA 1C7FA 1GLVA 1LJLA 1UWCA 3C43A 4E3WA 2FXIA 2GEVA 2H2IA 2RHRA 1QWOA 1Y3DE 3PJEA 2J9GA 3LKZA 4OJTA 4W4TA 2JLWA 3LPNA 2I54A 5LJLA 4WXEA 2VYND 3WYEA 4FFOA 2L18A 1TEVA 2FQYA 3AR9A 4KITB 1FYVA 1UFOA 3B9PA 3B48A 3MCAA 5FBVB 5I7FA 3OD5A 2ZBUA 4GXRA 2JI9A 2ZP1A 4JBHA 4KV7A 3ZK9A 4YUYA 3LYHA 4TLEA 1U98A 1RWBA 3ZU5A 3PWKA 3QF4A 4RH1A 2OBXA 3K6RA 1IHYA 3O0DA 3CLSC 3KVRA 3PGLA 2EX4A 1NF3A 1I4EB 4JFAA 4FI3C 5F1YA 4CL3A 5JS7A 1JFSA 4HJXA 3KQUA 1V9SA 3E2MA 2JBHA 4K9SA 1CLUA 4EWLA 5CLFA 5KTPA 3C6KA 3OM8A 1BYIA 4LNUB 2HV8A 3G13A 1Q16A 4V3CA 3JSXA 1VGVA 4W6ZA 1ZOSA 3AM3A 3I5UA 4R01A 5JV5A 3U0BA 1VCOA 2ZB3A 2F7SA 3KIPA 4EKEA 3D8TA 3OH8A 5JAIA 2VEOA 3W7VA 3VPGA 2NZYA 2DQ4A 4FZRA 2XUJA 4M1EA 4PZEA 1KR5A 4IDAA 4DYHA 4F6RB 4RX1A 1IN6A 1XKLA 1Z06A 3HBFA 2PRZA 3AIMA 1XCGB 5JAZA 1HE4A 1VKJA 3T7DA 4TGLA 3CLHA 3O21A 1F8UA 1NMEA 2DWUA 2E48A 3ENWA 1JHXA 2H1RA 3Q8LA 4HJRA 4D97A 3H9QA 3GRYA 4TKUA 4AUEA 1RRMA 2PUTA 2J0EA 1XZDA 1GDTA 1HQYE 2CL6X 3CO5A 1YB7A 2JLVA 4ZOLB 5K7SA 1DXYA 2AB0A 2X8LA 3O9VA 4OP1A 4HMPA 2VEDA 4UAGA 4G1CA 5AKKA 4DKXA 5EIXA 4RUKA 1PFQA 2HW8A 1ULUA 2RH4A 4UCXA 1TFRA 1G4AE 1U0TA 1VIVA 5JBQA 3NGMA 4LG1A 4O4LB 5A0VA 1IMJA 1BROA 2CSXA 2ZYGA 1R6UA 4TMFA 3LOUA 4JLDA 1EJ6A 3MNFA 2QN3A 5EIBC 3OA0A 1IXZA 5C35A 4BUZA 3QZUA 4M49A 2ZJ4A 2IEGA 3OBBA 1W581 2BGTA 2BZ0A 2JCXA 2X58A 2Z1NA 4G5YA 3UO8B 4BFXA 1JHQA 4EHLA 2EJUA 3GDHA 4MJXA 1U0SY 4PR0A 3VNAA 2CGEA 2XXAB 3AM5A 3UGJA 3R9WA 1GSHA 2CXTA 4QULA 3HJGA 1I2DA 4K6OA 2PZKA 4WBNF 4ID9A 4G1BA 1IHDA 4XPIA 1VL0A 5HOQA 3WL7A 1RZ3A 4RORA 1T91A 4OLJA 1QLWA 2G7MC 5GONA 4YDSA 5FFFA 3TUZC 5TGZA 3DL7A 1DKQA 3GCZA 2EZTA 1KU6A 4ZI5A 4E31A 2Q1UA 2HQ1A 4OPMA 1LTHR 1LBQA 2OV3A 3CZ4A 2ONZA 3COSA 4OGFA 1XJ0A 3KTDA 1XRPA 1H2XA 1JPUA 1T0JB 1TUEA 2GHQA 7REQB 3RTDA 4B6EA 1M34E 2IEYA 2PWZA 4KR3A 3R6TA 2C57A 2VJPA 4G0XA 5KWJA 2WYUA 4YAJA 1MABB 1QIDA 5EWMA 1KK1A 4D9BA 2EEZA 3OC6A 2HR1A 2XD9A 5K3AA 4MNTA 2WD9A 3ABSB 4RZ3A 2TMDA 3JU3A 1CQIA 3AL3A 1A9QA 4KDEA 4RHYA 1YMVA 4ZTBA 2BT4A 2AJTA 4V24A 4D5GA 2WZDA 3C41J 1WMBA 4RHTA 5KVQA 2ZWMA 3FGNA 4RS3A 5CB6A 3HYCA 4HGNA 4IMIB 4JSRA 4M1TA 2A0XA 3H6GA 4QOGA 4DV7B 3RTAA 1VQ1A 1RJDA 3QUSA 4RMIA 3TS1A 1XGKA 1U9CA 5F7OA 4K40A 2Q4TA 1ADGA 1ULSA 3PR3A 3S55A 2R97A 1P3DA 1ORDA 4FINA 5CJ2A 1Z16A 2FR8C 2HJVA 3BD9A 4GM4A 4RFSA 4YCMA 5ICMA 4W5QA 5MGNA 4LI3X 2VO1A 3L0IB 4FCCA 4P2GA 3RQIA 4BLRA 1XU7A 4IUDS 3DO8A 5C5IA 3RWBA 5A06A 1T36B 4N12A 3WLPA 4GS5A 3QVGB 2NSDA 3P96A 2ODWA 1NTOA 2BJHA 1KMHB 3QVJA 4HNHA 5AI4A 1E1NA 4EB8A 1CUDA 2I33A 3TL6A 3C45A 1U0EA 3AVQA 1GV1A 4QPPA 3M81A 4X20A 3ZQ4A 1G64A 2XMPA 4TKVA 1T5OA 2OTCA 2N42A 5TSDA 1AS2A 3VDQA 2PUFA 3FGZA 1CUHA 2EDCA 4U3JB 4YMTA 1HA3A 4RQBA 2PH7A 2ID7A 2LE0A 4U7PB 1OLUA 4JB8A 3SHOA 2BSQA 3WGHA 2HF8A 4IDEA 1UBNA 1FMTA 2BTQA 4OH1A 1U2QA 4OHZA 3SEZA 5AUNB 1BJTA 2PMDA 1F5NA 3ZKAA 2IEZA 2FQWA 3DQZA 5I8ZA 2MOKA 3PGVA 2ZUCA 1EBUA 5GPBA 1PNOA 1N3YA 1Z75A 1YUBA 2FFAA 3WL6A 4E7PA 3R7WA 3F8WA 1PJ8A 2GCPA 3D3WB 3R2JA 3GOHA 1SQGA 1UK7A 5SV2A 1ATZA 2YHBA 2H0RA 7ABPA 2D0OB 3K70D 4FTWA 3AF1A 4AKHA 2ZQYA 4MP8A 3HVUA 5DLDA 1J1UA