4A4FA

Solution structure of spf30 tudor domain in complex with symmetrically dimethylated arginine
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
64
structure length
64
Chain Sequence
b'ASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SURVIVAL OF MOTOR NEURON-RELATED-SPLICING FACTOR 30
publication title Structural Basis for Dimethyl-Arginine Recognition by the Tudor Domains of Human Smn and Spf30 Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 10
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2011-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4a4fA00
2RJCA 3PMTA 2E6NA 1G5VA 2HQXA 2LDMA 4PL6A 4BE2A 3OA6A 3OYMA 2DIGA 2GFAA 3NTHA 4IUVA 3O8VA 2EQUA 4BDZA 3L2UA 3L2VA 2L89A 2X4YA 4BACA 1WJSA 3QKJA 4OVAA 4GY5A 2R5AA 2RO0A 2MWOA 5C0MA 1XNIA 4HCZA 2X4WA 3OMGA 4QQGA 2WACA 4IUQA 3META 4Z02A 3NTKA 2IG0A 4IUUA 3QIIA 3OYIA 3C4SA 5D6WA 4ZTJA 2RJDA 2LVMA 4IUPA 3UT1A 3E9GA 2G3RA 3FEOA 4IKFA 2DAQA 5FRNA 3LYIA 3S6WA 3MEWA 4UC4A 3SD4A 3L2RA 2CKKA 2EFIA 3Q1JA 2RHYA 3OYAA 3LX7A 3QBYA 4N4GA 3E9FA 1MHNA 4II1A 3H8ZA 3MP8A 2O4XB 3OYDA 2X35A 4FL6A 2BKDN 2R58A 3DLMA 4BDYA 4E7IA 4E7HA 2RHXA 4A4FA 5D6XA 4E7LA 3P8HA 3LGLA 3BDLA 5KE3A 3LLRA 5J39A 3F70A 2EKOA 2M0OA 2RI3A 4B9XA 3EAEA 2HQEA 2RHZA 3M9QA 3L2QA 3OMCA 4CRIA 3PFSA 2BUDA 2DIQA 2RJEA 5M9OA 5C6SA 2RI5A 3OYNA 3OYHA 2D9TA 4LD6A 2EQKA 4C5HA 2LRQA 4QVZA 1OZ3A 3P8DA 4Q5WA 4RG2A 3MP6A 2RI2A 1KHCA 4C5IA 1OZ2A 5FRMA 4E7JA 5IAYA 3OYGA 5KE2A 2LTOA 2XDPA 2K3YA 4NS5A 3OYBA 3GOXA 2E5QA 1OI1A 3KUFA 4QW2A 4BE0A 5D6YA 2M16A 2P0KA 3DB3A 3MO8A 4QQDA 4N4HA 2L3RA 3S3MA 3OYCA 2MWPA 3CEYA 2BIVA 4A4HA 3UWNA 2XK0A 3OY9A 3FDRA 3NTIA 3PMIA 4N4IA 3QJ6A 4IUTA 2GFUA 5IN1A 1SSFA 2R57A 4BD3A 5J26A 1H3ZA 3PNWC 2GF7A 4C5EA 3OS0A 3OYJA 3S3OA 3ASKA 3L42A 5KH6A 3S3NA 3DB4A 2O4XA 2NLUA 2JTFA 1N27A 2QQSA 5CIUA 2PQWA 1WGSA 3MEAA 3OQ5A 3OS1A 3OYLA 1OYXA 2LCCA 4C5GA 2RHUA 1WJRA 2L8DA 3FLGA 4E7KA 4PLLA 1RI0A 2JZ2A 3LH0A 3LGFA 2YRVA 3ME9A 3MEVA 4A4GA 3OYKA 2B8AA 2X4XA 3MP1A 2EQJA 1WJQA 2EQMA 4PLIA 2RHIA 3ZEHA 3OB9A 4X34A 3MEUA 3L2WA 4FU6A 4IURA 4A4EA 4EDUA 5KCOA 3FC3A 2M1HA 5FROA 2RJFA 2VYTA 4ZTFA 2R5MA 3OS2A 3OYFA 2QQRA 2K3XA 4B9WA 2FHDA 4BE1A 5KCHA 3H6ZA 2F5KA 4L59A 4QQ6A 3OYEA
chains in the Genus database with same CATH superfamily
1HXDA 2KRNA 3OA6A 2X9HA 4IUVA 3ER0A 3T9NA 1VQLT 1N9RA 1LVKA 4V2SA 3PVQA 1K1ZA 2YUQA 1S72A 4MMKA 4IIMA 1N8RR 2YUPA 5LJ5d 1C6VX 4P5NA 2QGFB 1TWBA 1X2QA 1M30A 4RTXA 1JJ2P 2YUNA 2XD0A 1RAGB 2D1XA 3EH1A 4F7UG 1AZGB 4JS5A 1S1NA 3F70A 1VYTA 2L5QA 4JZ4A 4F7UE 4B9XA 3BW1A 1R0CB 4OMMA 3RR6A 3VKIA 5LJ3g 1HJDA 3PFSA 2BUDA 1CSKA 4MZTA 2EAYA 5M9OA 2DMOA 4C8QA 1Y96A 5FU6C 2L3SA 2HMAA 1VQ9T 2JVVA 1GCPA 1OZ2A 1YJ9A 4M78F 1ZA1B 2KVQG 2E5QA 3M5AA 2DYIA 5A0LA 1M3BA 1VQPT 4DOWA 1M4ZA 3CC2Q 3M0RA 4N4HA 2RK1A 5GANj 1KQSA 2CUDA 5GAOq 2DL7A 1QVFS 2PNIA 1WPYA 2K5LA 2KSSA 2J7IA 2CH4A 1PG5B 2DYBA 2O4XA 1WXUA 2GQIA 2W10A 1SF9A 1KQ1A 2H8HA 1ARKA 3OYKA 4CC3A 4F04B 1D0XA 4OMQA 8ATCB 1NJIC 2XI9A 4X34A 2RQUA 3OYYA 3L2WA 2JOYA 4QKUA 1I81A 2DLPA 3FC3A 4ZTFA 4C0FA 4B9WA 1AWJA 3CXCP 2E6ZA 4RTTA 2DX1A 4LDVA 4HVVA 5IXFA 1YJNT 1V76A 4FW2A 3L2VA 1M1KR 2JS0A 2RF0A 5LJ3d 4M7DA 3QPHA 2A0FB 4Z89A 1JJ2A 5I11A 3OMGA 4C8QC 4FCYA 1M2VB 2CSQA 2BE7D 5CR2A 4IUQA 3CCVT 2EGEA 2XHCA 2ENMA 1QLYA 2EJFA 1ZSZA 1HYOA 1SRMA 2BZYA 1RAIB 2EW3A 3URGA 2QXFA 1NBEB 3VV0A 1ZUUA 2FPDA 1M3CA 4EMKA 1I5OB 1B7TA 2R58A 3G1JA 4DEXA 3CC2A 4HA8A 3VS2A 2A7YA 2NWMA 4J8OA 4M7DG 3RDVA 4RCCA 5GANg 1QVGP 2FEIA 4O6JA 3SB2A 1Y0MA 1YJWQ 3HTRA 1WDXA 1X6BA 2CSIA 1PNJA 3P8DA 3QJYA 4AFSC 4C8QD 2XDPA 1N8RC 5CKEA 1VQNQ 3JB9J 2P0KA 2KK4A 2H3EB 3S3MA 4AFUC 2KRSA 1Y57A 2JM9A 1XOVA 4M7AC 3PNWC 3JCMg 3OS0A 4A63B 1TU0B 5GAN4 1I1JA 4QVCA 1M2OA 2DO3A 3QHSA 3RKWA 2EGAA 1ZSZC 3GF5A 4GLKA 3M55A 2E3HA 5AT1B 1WXBA 5KCOA 2DTIA 4EMKC 2GCXA 1KD1U 3VYGA 2VC8A 1D3BB 2A37A 3H6ZA 2ESWA 5CKDA 4KH1B 4OMPA 3G71T 1WHLA 5LJ5f 1Q81U 4OGEA 4HVUA 2DBKA 2FPEA 1KC8C 2DIGA 3JCMV 3H0IA 1MGQA 3HRUA 5KYWB 3QKJA 4JZ3A 3E2UA 2I2LA 2NUPA 1PC0A 1XNIA 4M7DD 2OTJQ 1QCOA 4IUUA 4LDUA 3EGXB 3QWYA 4JPBW 1YJWA 2JUFA 2EYYA 3E9GA 4RTZA 1KQSS 2DJQA 4C92A 3VS4A 1QVGA 1OU8A 4LUDA 5HCKA 1NYFA 2CUBA 2KYBA 4Y92A 3HRTA 3EFOB 1N8RU 4CI0C 3JCMQ 1VQNA 3DLMA 4PJOA 5I2MA 1W70A 3CPWS 3BDLA 1CKBA 1TH7A 1PRLC 2RK2A 3EAEA 4XTYA 5FU6B 4JS4A 2MI6A 1M1KC 3QWXX 4VUBA 4LD6A 1XJWB 3AT1B 3CCJT 2AZVA 2I0NA 4RG2A 3CCUT 2RI2A 1Z9ZA 3EG3A 5IAYA 5KE2A 3VS1A 1RAFB 3MHXA 4KGVB 1I07A 4LXCA 3FDRA 2LC4A 1Q7YR 1YCYA 2GF7A 2IIMA 2PZ1A 3BY7A 2E10A 3H9NA 1BI1A 3CCLQ 5KYUA 3I9QA 2FRYA 5LJ3e 1YHQT 1M90U 5LJ3f 3VS3A 4C92C 4ZGJB 2YT6A 2OTJA 2CH4W 1QCFA 2DD4A 4KBMB 4JJNK 3V8LA 1QWFA 2FHDA 4PJOC 4QQ6A 4PJLA 2VGNA 2Y4YA 4C8QB 2OX7A 4DQ2A 4BACA 2VXFA 3OBYA 4KT0E 2RPNA 4NL3A 2LJ3A 1RAHB 1PSFA 1UUEA 3CMET 2HAXA 3JB9D 1AZEA 1BK2A 2G3RA 2AKKA 3OSSC 3GNFB 3HL8A 1WHGA 3V7RA 4C92D 3GLXA 2O4XB 1IREB 2LJ1A 1SHGA 2PVDB 2YXYA 2D6FA 2O01E 2DXUA 2EIFA 1EFNA 2QQAA 1TXQA 4PJOD 3WVEB 2M02A 4GLMA 4R56A 5GJWB 3JRZA 3RMSA 3CCLA 1OZ3A 2DZCA 2A28A 3OYGA 2LX7A 4R0KA 4NS5A 3JCMc 5J3BA 4QQDA 2A36A 1U3OA 2DF6A 3I56T 1UG1A 1WA7A 5GJVB 2F5TX 1Y07A 2GTJA 2LT4A 4PKCC 1SSFA 2DTOA 5J26A 3VS5A 1W1FA 2RNAA 1AT1B 1ZSZB 1TSFA 3FLGA 2C06A 1YIJT 2XIDA 2EGCA 1Y71A 4PJMA 4EMKB 1I5LA 4M77A 4IURA 2HSPA 1UGPB 2CZ1B 2RQTA 3OYFA 2RJCA 1VA7A 4M75A 3NGPA 2LNVA 2X3XD 3FIFA 1IZ6A 2M0YA 4X9CA 2KQWA 1Q7YC 2LQNA 1VQ4Q 2V26A 2OAWA 2RO0A 3MPUB 1FMVA 1YBYA 5GAOn 4FSXA 2V8JA 2IG0A 3OYIA 3CMAQ 3I5RA 4JRQA 2Y90A 2J6FA 2K7AA 4J9DA 2DM1A 3HFNA 2J05A 1HD3A 5LJ5j 2BE9B 4XTVA 3JSCA 5FU7C 2QI2A 1JQQA 2WSEE 4E7HA 1PWTA 3VRZA 3WXMB 3NMZC 2RI3A 1QP2A 1SHFA 2HQEA 1OULA 5GAN7 2YSQA 5CKHA 2LRQA 1A0NB 1ZBJA 3V7CA 2MOXA 4M77C 1PCXA 4C5IA 1KHCA 5KYYA 4A53A 2F1LA 2LZ6B 1QVPA 3RNJA 2YUOA 3TSZA 1BIAA 5GAMh 1RAEB 4M75C 1VQOQ 3RKYA 7AT1B 2NUPB 4FYVB 1QKXA 1T0JA 1VQ7Q 4FT4A 4XTXA 3REAB 2EYXA 4ZGDB 1D1CA 2F2WA 2AIRB 5ECAA 1H3HA 1WHHA 1PD1A 2LCSA 2RM4A 4C92B 2L8DA 1Q7YU 1VQ5Q 1VQ4A 3N5BB 3LGFA 1MMNA 3MP1A 2DVJA 5AYFA 2K5FA 4A4EA 4NOYA 4MMLA 4PJOB 4EDUA 1WYXA 3CMAA 3FJ5A 4M77D 2KRMA 1YITQ 3EFOA 3SEMA 4KGZB 3PMTA 4ORZA 2GNCA 3VUBA 2FO0A 2EQUA 4M75D 1P92A 1W2BA 1VQ8Q 4E2FB 3I55Q 2EYZA 2D0QB 2WACA 3EG2A 1ZQ1A 2DA9A 3META 3CC4Q 3PTAA 4EPCA 3UT1A 4Z88A 3S6WA 3A8HB 3JCMW 5LL6S 2ZPGB 1X43A 3C94A 2LNHB 2VUBA 2MMPA 3E9FA 4D6WA 2EYQA 3UATA 4BDYA 4M78C 2XU8A 4A4FA 5D6XA 2EJGA 5KYUB 3LLRA 1VQOA 2AK5A 1NE8A 1VQ7A 1FX7A 3X26B 4GBQA 2WSFE 3HSBA 4F17A 2RJEA 2D9TA 2O31A 1WNLA 3CCQQ 2CZ0B 1UGVA 4J9EA 1VQ5A 3CCST 4J6XA 3P8BB 4EIKA 1RUWA 1JRIA 4LD9K 4RTYA 2DEQA 3RBBB 2HKNA 3PIPA 4KULA 1H8KA 1TOVA 2AT1B 1M9SA 3QJ6A 4BD3A 4RUGA 2P4TA 3MCAB 5KH6A 1YITA 2EPDA 2JMCA 4B6MA 1IGQA 4HXJA 1M8MA 2L3PA 1Q86U 1R8OB 4KRTA 3H0HA 4JRIA 4E7KA 1RLQC 3MEVA 2QAZA 2KGTA 1VQ8A 2OTLQ 3INZA 3G4ST 4IIOA 3I55A 2KDSA 2MF2A 3CCEQ 1PM3A 2LMJA 3CC4A 3CBMA 3QDRB 2V1RA 5GAMj 3CD6T 3NHNA 3R6NA 1KC8R 1ZUYA 1KHIA 4BE1A 2OJ2A 1WQWA 5CQYA 3FJPA 2FZGB 4BE2A 1AHJB 2LX9A 4C8QG 4DBFA 1R77A 1I8FA 2JT4A 1EZZB 3JCMb 1YI2T 4C8QE 2RD1A 2HSEB 2D8HA 4BI4A 4OB1B 3I35A 2O2OA 1Z9QA 2HCKA 1K73C 5FU7B 4QVDA 3LYIA 2FZKB 2V1QA 3CCQA 2EFIA 1KSWA 2VASA 3ZFJA 4O5VA 3OYDA 4M7AA 1XQHA 1M27C 2CS7A 2O88A 2IVWA 2DERA 2ATCB 5DY9A 1GCQC 3BDUA 1X75C 3EG1A 1RL2A 5EC7A 4M77B 2NUTA 1B34B 2KAFA 5C6SA 3OYHA 3OYNA 2CZ6B 1AD5A 2EQKA 4HKEA 4OMLA 3G6EQ 4M75B 2M9UA 3THKA 2VWFA 2OTLA 4KUIA 3MO8A 3CCEA 1WZOA 3CC7Q 4F7UF 3OYCA 3A1PA 2JXBA 2ZCFB 4AG2C 2YLBA 2K79A 1VQLQ 4ME7A 5GAMg 1AWXA 1OEBA 3L42A 4L6V5 1ZBXA 1VQKT 4M7DE 5A0GA 4CC7A 4AT1B 2QQSA 4FYXB 3OS5A 3M0PA 4LE9A 2JZ2A 3LH0A 2DXCA 4J9BA 4RTVA 1NJIU 3TREA 2ROTA 2M1HA 2K3XA 2CYZB 3KXTA 1ACMB 5I22A 2RQRA 3OYEA 3QXEB 2YRDA 3HRSA 1VQMT 5A0DA 4BDZA 5DLOA 3CXCA 2KEAA 2KYMA 4DOVA 5KYYB 5C0MA 2X4WA 4QQGA 3UDCA 3OW2P 1VQ9Q 2HBWA 2FVUA 4J83A 4JLIA 5GMKe 4WF2A 3CCRT 4XK8E 4XAXB 2RJDA 2LVMA 2QTVA 3JV3A 4HCCA 2X4JA 1VQPQ 4DA4A 2G6FX 1SSHA 1B3QA 4X1VA 4M78B 3VS6A 3G6EA 3J81E 2IPOB 1V29B 5GANd 2LJ0A 1OV3A 2RHXA 3BFMA 3CC7A 4M7AD 2CP0A 4DBRA 1H92A 2VV5A 1U8RA 3VS7A 3AHUA 5I2SA 4RTUA 3M9QA 1VQLA 4XTWA 1G83A 3JAME 1FMKA 1BB9A 3E1SA 1YWPA 3EFRA 2K57A 2HL5C 4MDWA 4MZPA 3A5ZB 2QEXT 2AHJB 4OMOA 5I21A 1IB8A 1WIEA 1K9AA 4DBHA 2H3JA 3JCMd 2J6KA 4RKUE 1VQ6T 2EBPA 2P4RA 1UHFA 1YJNQ 3HKSA 4M7DF 3JB9G 1PKSA 2HKQB 3M0QA 2ABLA 2NLUA 1NLOC 5CIUA 3MEAA 3OQ5A 2J06A 2LCCA 1K4US 2RHUA 3CCVQ 4JRPA 1KK7A 4C92G 1QCNA 2B8AA 1VIEA 2EQJA 1MV0B 4C92E 1UB4A 1VQ9A 4C0ZA 1Q95G 1ZSGA 1MMAA 4K11A 1GL5A 3QUIA 4PJOG 1VQPA 1JJ2S 1QP3A 1YN8A 3R6OA 3OW2A 2NUZA 4PJOE 5FW9A 2F69A 3M4YA 2ZPFB 1KC8U 1D1AA 2QA4T 3PE0A 2AZSA 2CGHA 1I4K1 2ZAEA 3JCMX 2JTMA 2QYZA 3M0SA 1ZHIA 3RKXA 2O9SA 1AOJA 2GBQA 5GAOl 5CKFA 3ZL7C 2E1HA 2HDAA 2COYA 1QWEA 2QQ9A 2RHYA 1K8AR 5LJ5h 3OYAA 1MUZA 3EG9B 3RIRA 3DLLA 3CCMT 2MPXC 1GBQA 1MHNA 1QMCA 4A54A 5HY6A 4FM4B 4FSSA 2VKNA 5KE3A 2DFUA 5IXBA 4J5YA 4LUEA 2PUOB 1YJNA 1M1KU 4CRIA 2KT1A 1UJYA 1KFZA 2QG9B 2SEMA 1TG0A 4AFQC 3O5ZA 3CCVA 3DKMA 2LQKA 3EG0A 1V1CA 3GOXA 4QW2A 4J9CA 2M16A 3G71Q 5GAOp 5GAN6 4LDWA 2DEUA 3X20B 2BIVA 3CXCS 1K0XA 1BCOA 4J9IA 5IN1A 2R57A 4J7IA 2HEQA 1H3ZA 2FYKA 2XG8D 4PK4A 3QO3A 4N0AA 3OYLA 2QQBA 1S72T 4A4GA 5HKCA 2MK5A 3ZEHA 4M7AB 3KBGA 2MYSA 2KXCA 4A4KA 1M5Q1 2VYTA 1ZA2B 1WFWA 1QVFP 2HQXA 2NUTB 1AWOA 1PRMC 4PL6A 4RMOA 2GFAA 3FB9A 5GANe 1UDLA 1QVGS 5GANf 2KMTA 5CO7A 1C1AA 3CCJQ 3RUXA 3CCUQ 4JLGA 1NG2A 1B34A 4ZTJA 1YJ9T 2L3QA 3PGGA 2DAQA 3MEWA 4UC4A 1U1TA 3A8MB 3LH5A 3SD4A 4FT2A 3SHWA 2C0TA 2DVEA 1HSQA 2JM8A 1T3LA 5CVIA 3G71A 2LCLA 1OOTA 1ZLMA 3JCMe 4E7LA 2DD5A 4FIBA 3JCMf 4N0AC 2RHZA 4FYYB 2WSCE 1NEGA 3TSWA 5GMKj 4M77G 1YHQQ 1T3SA 4JRKA 5GAOm 2EKHA 4XU3A 1G3WA 4CC2A 1X2KA 3MP6A 3NPFA 4M77E 3GPLA 3TQ7P 3OYBA 1OI1A 1UGQB 1CKAA 4M75G 1JEGA 1IGUA 3OBWA 2RN8A 2HBPA 3LW5E 1GRIA 1K8AC 3WVDB 3UWNA 4M75E 2W0ZA 3QSUA 3C0CA 3TU4K 3UA7A 3L1AA 4XTUA 3QZ9B 2KT8A 1U1SA 4LNPA 3CMEQ 1N27A 2PQWA 1IO6A 2P0PA 2VXEA 1QVFA 1GFCA 3ME9A 2F2XA 2EQMA 3CCJA 1JXMA 3OB9A 3CCUA 5CCAA 4KUDK 4J9FA 3I5SA 2MAMA 1UTIA 1SEMA 5FROA 4M78A 3OS2A 4LN2A 2DKGA 1X6GA 1QW1A 3CC2T 1Q82R 1PHTA 5CQXA 3NTHA 2QDYB 2YHTA 1FXXA 1G3SA 4OVAA 4MZMA 1K73R 2XDBA 2YLCA 4HCZA 3X25B 4Z02A 2BTTA 1KIKA 1KQ2A 2E4HA 4RCBA 4IUPA 1YHQA 3FEOA 5CKBA 3GP8A 2X51A 4ELZC 1WX6A 4PJJA 3RERA 3I56Q 2A08A 3LX7A 4OB2B 2X35A 2QTXA 2YDLA 4FL6A 5LJ5g 2K2VA 2JMAA 1M1GA 5LJ3j 2DXBA 4HT9A 3MJXA 1DJ7B 2EJ9A 1YIJQ 1OX8A 2VVKA 4C0DC 1GBRA 4M77F 3HFOA 3CMEA 1PKTA 2ZPBB 2ZGWA 1U06A 5FRMA 1KQSP 2HD0A 3G7ZA 1KD1R 3U23A 2CP6A 2L3RA 4XU1A 4HCBA 2XK0A 1Q81R 3H41A 4JDSA 3NTIA 4N4IA 2GFUA 1R0BG 3CPWP 2HZYA 3OYJA 8AT1B 4F7UA 3VU3C 2YRCA 3V8KA 3RMQA 1YWOA 2KNBB 1WI7A 4J7FA 1VYVA 4LDYA 1MMGA 1YP5A 2YRVA 1YJWT 2X4XA 3A8OB 4FU6A 2DXTA 4Y28E 3SWNC 2CZ7B 2CP3A 5GMKi 1VQNT 2K4YA 5KYNA 2AKLA 3EG9A 5IHKA 1GCQA 1WHJA 3I56A 2XICA 4M78D 1FYNA 3EFSA 3O8VA 2DL3A 1NEBA 2ROLA 3EH2A 1I0CA 2X4YA 2R5AA 4J9GA 3PT9A 3NTKA 4BI3A 3J80E 1ABQA 3C4SA 1YIJA 3ULRB 2DK3A 2LQWA 1UGRB 1H641 2XKOC 3HPWA 2DNUA 2HNIA 5FRNA 2E41A 1M3AA 1RI9A 3C12A 4RTWA 3MP8A 1MV3A 3IQLA 4E7IA 1N9SA 2C0IA 3QZ5B 3P8HA 2BZXA 3M58A 1Q82C 2B86A 2K6DA 1D0YA 1F1BB 3L2QA 2QASA 4JJBA 1N6AA 5KYXA 4WTOB 2C0OA 1M90R 2RI5A 4BUGA 1BI0A 5GAN8 3CPWA 2OTJT 1VYUA 4R55A 4E7JA 1G8XA 2DBMA 1TUDA 4PJNA 3DB3A 1UEBA 3EGDB 4OB0B 3LWIA 4NL2A 2BZ8A 2JTEA 1UHCA 3SDZA 2J6OA 1FMWA 2ECZA 3BE3A 5CK9A 3CBPA 1AEYA 3GNGA 1GXIE 3C95A 4C5EA 3ZBDA 2LP5A 3ASKA 3CBOA 3S3NA 1TTHB 4XTZA 2JTFA 1K76A 4ZN3A 4X9DA 4D8KA 4OB3B 1NM7A 1RI0A 2L0AA 1LJOA 2X3WD 3M59A 5EG2A 1MNDA 4M7AG 2MIOA 1W2BS 1AWWA 1W4SA 5DLQE 4M7AE 1KD1C 1RADB 5KCHA 4L59A 2PVOB 1C0MA 4C0GA 2DE0X 3GBQA 2XMFA 1Q81C 2LT1A 1VIFA 1UFFA 1WJSA 4GY5A 1WHKA 1Q82U 2CP7A 2A3LA 3CCLT 3VYHB 4JJDA 1RACB 2E70A 4QT7A 3CCSQ 1OPKA 2KROA 2QGGA 4KH0B 1K73U 2FPFA 2DRMA 1D1BA 3TCJA 1G3YA 4N4GA 1TS9A 3H8ZA 2P0QA 5IH2A 2JNGA 3M54A 4KGXB 1E6HA 1UJ0A 4OMNA 4BI8B 4C8QF 1SPKA 1X6OA 2EKOA 1TUGB 4C0DB 1M1FA 1O9SA 4E6RA 4YTLA 5D7UA 3M4GA 1K9MR 4M7DC 3G4SQ 1BCMA 1UE9A 1W6XA 4C5HA 4QVZA 3M0TA 3CD6Q 4ATOA 3EHQA 5GAMd 2RH2A 4RG8A 2QDLA 2E12A 2K2MA 1OQKA 2CT4A 5LJ5e 3DB4A 2K9GA 1YI2Q 2HQHA 1QKWA 1G2BA 4DBQA 3SWNB 3V8JA 1MMDA 4BY6C 2CP2A 4ZN1A 3QG1A 1M90C 4PLIA 2D8JA 1IXDA 2CREA 4M7AF 4OF1A 3CCSA 2PUKB 2ZZDA 1NPPA 2RJFA 3JCMP 1BI3A 5IHIA 5GAN3 2VGMA 4PFPA 2DETA 2E6NA 1M8VA 1VUBA 2LDMA 3OYMA 4Y91A 1X27A 5A2QE 2L89A 1X01A 1E7OA 4HT8A 4EMHA 3D7SB 4FYWB 2MWOA 1WQ7A 1KG1A 4DEYA 1OX9A 1YNZA 4OMFB 3G4SA 1ZX6A 2JN0A 4IKFA 1VOMA 5GMKl 2SRCA 1XTDA 2KI7A 2CKKA 4BB7A 1EX4A 3NFCA 3JCMJ 3CD6A 2EWNA 3M53A 2K5IA 1BIBA 1TUCA 4F7UB 4XQ3A 1VQKQ 1AVZC 1D09B 1WXTA 1BYMA 3M56A 4WCIA 2E64A 3LGLA 3FRNA 2KR3A 1BBZA 3OMCA 1VQ4T 2KXDA 5GMKh 3EHRA 2QK0A 2DIQA 1GFDA 5FWBA 2JS2A 1YI2A 4D8DA 3UPUA 2V8KA 4Q5WA 2FL7A 2LTOA 2K3YA 3LWHA 5HK0A 2DTHA 2OI3A 5IHNA 3CMAT 3JB9H 1Y7XA 3CEYA 4A4HA 1VQMQ 3OY9A 4HCKA 1D0ZA 4FW1A 4IUTA 3S3OA 3JB9I 4PNOA 2ED0A 5CAIA 2E65A 3A98A 1OYXA 2ZPHB 4C5GA 3PVLA 3CCRQ 1Y96B 2KE9A 4AFZC 4PLLA 3M0UA 1K9MC 1E6GA 3TEEA 3A8GB 1IRXA 5IT9E 2DPPB 1B07A 4ZNXA 4EMGA 6AT1B 3MEUA 2LQ8A 1YCSB 1JU5C 3EGUA 1OPLA 1FWZA 4HVWA 1NPRA 4JJCA 3JB9F 4ELYC 3H0FA 1JBMA 3UF4A 1G5VA 3VUZA 1X69A 1VQOT 2PVGB 2V8IA 5KYXB 3VJPA 3PIOA 3L2UA 1VQ7T 1VQKA 2E3IA 2OAUA 4C92F 1LPLA 4L5GA 3CQTA 1RAAB 3E19A 2QEXQ 4AMCA 2PTKA 1VQ5T 2FB7A 4PJOF 2CDTA 4LDXA 1VQ6Q 4ESRA 3L2RA 1ZUKA 2NYSA 3QBYA 4II1A 2DJZA 3GIBA 1OU9A 3EGDA 3X28B 5GAMe 1YITT 2ED1A 5FLXE 5GAMf 4M7DB 5J39A 1VQMA 5LJ3h 4Z8AA 3VS0A 3X24B 1LNXA 2M0OA 1Q86R 4M4ZA 3J7AF 1SRLA 1KJWA 2CP5A 5GAN2 1LOJA 1VQ8T 5GAOr 4TVRA 3I55T 2L2PA 4ANJA 2ZPIB 5GMKm 1ABOA 1JB0E 3CC4T 3CCRA 1G3TA 1K9MU 3SFMA 4F14A 2CT3A 4OGCA 1M2VA 2DRKA 2ZPEB 4BE0A 1EIFA 2M51A 2O9VA 2MWPA 3HP9A 4XU0A 1J3TA 1PSEA 2KY9A 1IHVA 4J6YA 9ATCB 2QA4Q 2F2VA 2DILA 4PFOA 4BY6B 3OS1A 3TVTA 2VB6A 2RA2A 1WJRA 3VRYA 3OW2S 2COWA 1BI2A 5L8RE 3CCQT 3CCMQ 1NYGA 2QEXA 1NZ9A 2E5KA 2GQVA 5DM7R 3HHTB 3QYHB 1MNEA 1VQ6A 2F5KA 1W2BP 2DL4A 2DL5A 4PFZA 3MKDA 3UA6A 2PU9B 1T0HA 3M57A 5FWCA 2FG0A 1O75A 4XU2A 2DZ9A 3QYGB 3QIIA 5D6WA 2EQIA 2HL3A 4MDXA 5HK3A 2OTLT 5L23A 2RQWA 3CCET 3Q1JA 5GAN5 3RESA 2RMOA 2EYWA 4OP0A 1N5ZA 1LCKA 1JXOA 3A8LB 2BKDN 4AG1C 4F16A 2P84A 5GANh 2YWWA 1UGSB 4J6WA 4E7ZA 1D3BA 1S72Q 1SG5A 2QA4A 2EVRA 2Z0WA 1UECA 1JO8A 4J9HA 1NJIR 5KYWA 3REBB 3SWNA 2XDDA 1YFNA 4M78G 3KFVA 2MCNA 2FRWA 3KUFA 5D6YA 3EGXA 1IHWA 4M78E 2JW4A 2COZA 2RB6A 1K8AU 4CC4B 3CCMA 3JCMh 3PMIA 1NLPC 2FZCB 1K0SA 1U5SA 4JUVA 1SKUB 1HK9A 1RABB 2JJ9A 4ZGEB 1BKBA 1WLPB 1BU1A 4E47A 1WGSA 1Q86C 2D0NA 3CPFA 3QDFA 1YJ9Q 1QQJA 1WHMA 2K3BA 2DL8A 2KBTA 1PD0A 2RQVA 1WJQA 2RHIA 4M75F 2Y4XA 1RLPC 3G6ET 3V7SA 3L2ZA 3OSVA 2GGRA 4E7SA 2GTOA 2R5MA 2QQRA 3CC7T
chains in the Genus database with same CATH topology
2RJCA 4M75A 2F69A 3M4YA 1Q81C 2LNVA 1HXDA 2ZPFB 3FIFA 3OA6A 1IZ6A 1KC8U 4IUVA 2LT1A 3ER0A 4X9CA 1VIFA 3T9NA 2KQWA 1Q7YC 1VQLT 1N9RA 2QA4T 1WJSA 2CGHA 1I4K1 4GY5A 2RO0A 1Q82U 3JCMX 4V2SA 2A3LA 1YBYA 5GAOn 4FSXA 3CCLT 2JTMA 2IG0A 2V8JA 3VYHB 2E70A 3OYIA 1ZHIA 3RKXA 4MMKA 1S72A 5GAOl 5CKFA 2E1HA 5LJ5d 1K73U 4JRQA 4P5NA 2Y90A 2QQ9A 2RHYA 3TCJA 5LJ5h 3HFNA 3OYAA 1G3YA 3DLLA 3RIRA 5LJ5j 3CCMT 4N4GA 1MHNA 3H8ZA 2P0QA 3JSCA 4XTVA 2QI2A 5FU7C 2JNGA 4A54A 3M54A 5HY6A 2XD0A 2WSEE 4FM4B 4F7UG 4JS5A 4BI8B 4E7HA 4C8QF 3WXMB 1X6OA 3JCMW 5KE3A 3F70A 2EKOA 4J5YA 2L5QA 4C0DB 4F7UE 2RI3A 1M1FA 1QP2A 2PUOB 4B9XA 1O9SA 2HQEA 1YJNA 4YTLA 3BW1A 1M1KU 3M4GA 4CRIA 3VKIA 5LJ3g 4M7DC 3PFSA 2BUDA 4MZTA 2EAYA 5M9OA 5GAN7 4C8QA 1Y96A 4C5HA 5CKHA 2LRQA 5FU6C 4QVZA 3V7CA 1VQ9T 4M77C 4C5IA 1KHCA 2JVVA 1OZ2A 3CCVA 4A53A 1YJ9A 4ATOA 4M78F 3DKMA 2KVQG 2LQKA 2E5QA 3M5AA 3GOXA 4QW2A 1QVPA 5GAMd 5A0LA 2M16A 1VQPT 4DOWA 1M4ZA 5GAOp 5GAN6 4LDWA 4N4HA 1BIAA 2RK1A 2RH2A 3X20B 2BIVA 4RG8A 5GAMh 3CXCS 5GANj 1KQSA 4M75C 3RKYA 2E12A 5GAOq 1QVFS 1WPYA 2K5LA 4FT4A 2KSSA 2R57A 4J7IA 5IN1A 1H3ZA 4XTXA 5LJ5e 4ZGDB 3DB4A 2O4XA 2FYKA 2XG8D 3QO3A 4N0AA 3OYLA 2RM4A 2QQBA 4C92B 2L8DA 1Q7YU 1KQ1A 1S72T 1VQ4A 3SWNB 3N5BB 4A4GA 3LGFA 3V8JA 3OYKA 4BY6C 4ZN1A 3MP1A 3QG1A 5HKCA 1M90C 4PLIA 5AYFA 3ZEHA 4M7AB 1NJIC 2XI9A 4X34A 2K5FA 3OYYA 3KBGA 3L2WA 4A4EA 4NOYA 4MMLA 4M7AF 4PJOB 4OF1A 2JOYA 4EDUA 3CCSA 4A4KA 1I81A 2PUKB 2ZZDA 1M5Q1 3CMAA 3FC3A 1NPPA 2RJFA 2VYTA 4M77D 4ZTFA 3JCMP 1BI3A 4B9WA 4C0FA 2E6ZA 2VGMA 5GAN3 3PMTA 2E6NA 4LDVA 1M8VA 1VUBA 2HQXA 2LDMA 4PL6A 4RMOA 3OYMA 2GFAA 3VUBA 4Y91A 1YJNT 2EQUA 5A2QE 3FB9A 3L2VA 2L89A 1X01A 4M75D 1P92A 5GANe 4M7DA 5LJ3d 4HT8A 4EMHA 1W2BA 1QVGS 5GANf 3QPHA 2KMTA 5CO7A 1JJ2A 2MWOA 2D0QB 3RUXA 3OMGA 4C8QC 5CR2A 2WACA 4IUQA 1ZQ1A 3META 1WQ7A 1KG1A 4JLGA 1B34A 3PTAA 4EPCA 3CCVT 4ZTJA 1YJ9T 2XHCA 4OMFB 3UT1A 2EJFA 3G4SA 2JN0A 3PGGA 4IKFA 5GMKl 2DAQA 3S6WA 3URGA 3A8HB 3MEWA 1XTDA 1U1TA 2QXFA 3A8MB 4UC4A 2CKKA 4FT2A 5LL6S 3SD4A 2ZPGB 3VV0A 4BB7A 2DVEA 3NFCA 3C94A 3JCMJ 3CD6A 2EWNA 2VUBA 2MMPA 3E9FA 3M53A 4D6WA 2EYQA 4EMKA 2K5IA 1BIBA 5CVIA 4F7UB 4XQ3A 4BDYA 2R58A 4M78C 3G71A 2LCLA 2XU8A 3CC2A 4HA8A 4A4FA 1BYMA 3M56A 5D6XA 2EJGA 3JCMe 4E7LA 2A7YA 2E64A 3LGLA 4J8OA 3LLRA 5GAOr 2DD5A 4FIBA 3JCMf 1VQOA 3FRNA 1NE8A 4M7DG 4RCCA 4N0AC 5GANg 1VQ7A 2RHZA 4O6JA 3SB2A 3OMCA 1FX7A 1VQ4T 2WSCE 5GMKh 3X26B 2WSFE 4M77G 5GMKj 3HSBA 2DIQA 2RJEA 4JRKA 2D9TA 5GAOm 1YI2A 1WNLA 4XU3A 1G3WA 2CZ0B 3UPUA 2V8KA 3P8DA 4Q5WA 3MP6A 4M77E 3QJYA 3GPLA 1VQ5A 2FL7A 4C8QD 3CCST 2LTOA 2XDPA 4J6XA 2K3YA 3OYBA 3P8BB 2DTHA 5HK0A 1JRIA 1OI1A 3LWHA 1N8RC 3CMAT 4LD9K 1UGQB 5CKEA 3JB9J 2P0KA 2KK4A 4M75G 3OBWA 2DEQA 3JB9H 1Y7XA 2HBPA 3PIPA 4KULA 3S3MA 3LW5E 3CEYA 4A4HA 3WVDB 1K8AC 3UWNA 3OY9A 4M75E 1XOVA 3QSUA 3TU4K 1M9SA 3QJ6A 4M7AC 4IUTA 4BD3A 3PNWC 3L1AA 2P4TA 3MCAB 3JCMg 3OS0A 4XTUA 5KH6A 3S3OA 3JB9I 4PNOA 1YITA 3QZ9B 1U1SA 5CAIA 1N27A 2PQWA 2E65A 5GAN4 1OYXA 2ZPHB 4C5GA 1R8OB 1Q86U 1Y96B 4QVCA 4JRIA 2P0PA 4E7KA 4PLLA 2VXEA 1K9MC 2DO3A 3MEVA 3TEEA 3A8GB 3ME9A 3QHSA 3RKWA 1QVFA 1VQ8A 3INZA 3G4ST 2DPPB 3I55A 5IT9E 2KDSA 2EQMA 2MF2A 3GF5A 4GLKA 3CCJA 4EMGA 3M55A 3OB9A 3CCUA 3MEUA 3CC4A 3CBMA 5CCAA 2LQ8A 3QDRB 5GAMj 4KUDK 3CD6T 5KCOA 2MAMA 2DTIA 1FWZA 5FROA 1NPRA 4EMKC 2GCXA 4M78A 3OS2A 1KD1U 3VYGA 1KHIA 3JB9F 4ELYC 2VC8A 2DKGA 4BE1A 1D3BB 3H6ZA 5CKDA 1WQWA 3G71T 1QW1A 3CC2T 1JBMA 5LJ5f 5CQYA 3FJPA 1Q81U 1G5VA 4OGEA 3VUZA 1VQOT 4BE2A 2PVGB 2V8IA 2DIGA 3NTHA 5CQXA 1AHJB 2QDYB 1MGQA 3HRUA 3JCMV 3VJPA 3PIOA 3L2UA 1VQ7T 2LX9A 4C8QG 2YHTA 3QKJA 1FXXA 1G3SA 2OAUA 4OVAA 4C92F 1VQKA 2I2LA 4MZMA 1I8FA 4L5GA 2XDBA 1XNIA 2YLCA 4HCZA 3JCMb 1YI2T 4C8QE 4M7DD 3X25B 4Z02A 2RD1A 4IUUA 1KQ2A 4BI4A 4LDUA 3E19A 4OB1B 1VQ5T 1YJWA 2FB7A 2JUFA 4IUPA 4RCBA 4PJOF 3E9GA 3FEOA 5CKBA 1YHQA 3GP8A 1K73C 1KQSS 4LDXA 5FU7B 4C92A 4QVDA 3LYIA 3L2RA 4ELZC 3CCQA 1QVGA 2EFIA 3RERA 3LX7A 3QBYA 3ZFJA 4O5VA 4II1A 2DJZA 3HRTA 3OYDA 1N8RU 3GIBA 4M7AA 4CI0C 1XQHA 3JCMQ 4OB2B 2X35A 2CS7A 2QTXA 4FL6A 3X28B 3DLMA 5LJ5g 1VQNA 4PJOA 2K2VA 5GAMe 5I2MA 2IVWA 1YITT 5DY9A 3CPWS 5FLXE 5GAMf 1M1GA 4M7DB 3BDLA 5J39A 1VQMA 5LJ3h 3X24B 3BDUA 1X75C 1TH7A 1LNXA 5LJ3j 2M0OA 1RL2A 2DXBA 2RK2A 4HT9A 3EAEA 1DJ7B 4XTYA 5FU6B 2EJ9A 2MI6A 4JS4A 1M1KC 3J7AF 4M77B 4VUBA 5GAN2 1B34B 2KAFA 1LOJA 4C0DC 1VQ8T 5C6SA 4M77F 4TVRA 3OYNA 2CZ6B 3HFOA 2EQKA 4LD6A 3OYHA 2ZPBB 3I55T 2ZGWA 2ZPIB 3CMEA 4HKEA 3CCJT 5GMKm 4RG2A 3CCUT 1JB0E 2RI2A 3CC4T 3CCRA 5FRMA 1G3TA 5IAYA 5KE2A 1K9MU 3SFMA 2HD0A 4OGCA 2ZPEB 4M75B 2M9UA 3G7ZA 4BE0A 1EIFA 2OTLA 4KUIA 3MO8A 3CCEA 2L3RA 4F7UF 3OYCA 2MWPA 3HP9A 4XU0A 4XU1A 2XK0A 3MHXA 4HCBA 2ZCFB 1PSEA 2KY9A 2YLBA 3FDRA 4J6YA 2LC4A 4JDSA 3NTIA 4N4IA 2GFUA 4ME7A 5GAMg 1YCYA 2GF7A 3OYJA 3L42A 3BY7A 1ZBXA 4L6V5 1VQKT 4M7DE 5A0GA 4F7UA 2E10A 2QQSA 3VU3C 1KC8C 3V8KA 3OS5A 4BY6B 1BI1A 3OS1A 3RMQA 2RA2A 1WJRA 4J7FA 4LDYA 3OW2S 2JZ2A 3LH0A 2YRVA 1YJWT 2DXCA 5LJ3e 2X4XA 1YHQT 1M90U 3A8OB 5LJ3f 1BI2A 1NJIU 4C92C 4ZGJB 3TREA 5L8RE 2OTJA 3CCQT 4FU6A 2DXTA 4Y28E 3SWNC 2QEXA 1NZ9A 2DD4A 2CZ7B 2GQVA 4KBMB 5DM7R 3HHTB 2M1HA 3V8LA 4JJNK 3QYHB 5GMKi 2K3XA 1VQNT 2CYZB 2FHDA 2K4YA 1VQ6A 2F5KA 3KXTA 4PJOC 4QQ6A 3OYEA 3QXEB 3HRSA 3I56A 2XICA 4M78D 1VQMT 3EFSA 2VGNA 5A0DA 3O8VA 2PU9B 2Y4YA 4C8QB 5DLOA 4BDZA 3CXCA 4DQ2A 2X4YA 4BACA 2VXFA 3M57A 3OBYA 4DOVA 1O75A 4KT0E 4XU2A 2R5AA 2DZ9A 5C0MA 4NL3A 1PSFA 2X4WA 4QQGA 3UDCA 3CMET 2HAXA 3QYGB 3PT9A 3NTKA 2FVUA 3JB9D 4BI3A 3QIIA 3J80E 4J83A 3C4SA 4JLIA 4WF2A 5D6WA 5GMKe 3CCRT 1YIJA 4XK8E 2DK3A 2RJDA 1UGRB 1H641 2XKOC 4XAXB 3HPWA 2LVMA 4MDXA 4HCCA 2G3RA 2X4JA 5HK3A 4DA4A 2HNIA 3OSSC 2OTLT 5FRNA 3GNFB 2E41A 3CCET 3HL8A 3Q1JA 4M78B 5GAN5 3RESA 3V7RA 3G6EA 3J81E 3C12A 4C92D 3GLXA 3MP8A 2O4XB 1IREB 1V29B 4OP0A 5GANd 2PVDB 3A8LB 2BKDN 4E7IA 2D6FA 2O01E 2DXUA 2EIFA 2RHXA 1N9SA 3BFMA 3QZ5B 5GANh 3CC7A 2QQAA 1UGSB 3P8HA 4M7AD 3M58A 4J6WA 1Q82C 2VV5A 1U8RA 4PJOD 1D3BA 3WVEB 5I2SA 3AHUA 3M9QA 2QA4A 3L2QA 1VQLA 4XTWA 3JAME 1N6AA 4R56A 3E1SA 2RI5A 3EFRA 3JRZA 2K57A 4BUGA 3RMSA 3CCLA 4MDWA 1BI0A 1OZ3A 4MZPA 3SWNA 2DZCA 5GAN8 2XDDA 3CPWA 2OTJT 4M78G 4R55A 4E7JA 3A5ZB 3OYGA 2AHJB 2QEXT 3JCMc 4NS5A 3KUFA 5I21A 5J3BA 5D6YA 2H3JA 3DB3A 4QQDA 4M78E 4RKUE 3JCMd 1VQ6T 1UEBA 4OB0B 2RB6A 3LWIA 4NL2A 1K8AU 3SDZA 3CCMA 3I56T 3JCMh 2F5TX 1Y07A 3HKSA 3PMIA 5CK9A 3JB9G 3CBPA 4M7DF 2LT4A 4PKCC 1SSFA 2DTOA 3GNGA 1GXIE 5J26A 3C95A 4C5EA 3ZBDA 3CBOA 3ASKA 4JUVA 3S3NA 1HK9A 4XTZA 2NLUA 2JTFA 4ZGEB 1BKBA 4E47A 5CIUA 4ZN3A 1WGSA 3MEAA 3OQ5A 2LCCA 4X9DA 2RHUA 3CPFA 1Q86C 4OB3B 4JRPA 3FLGA 2C06A 1YIJT 4C92G 1RI0A 2XIDA 2B8AA 1Y71A 1VIEA 1LJOA 1WJQA 2EQJA 2RHIA 3M59A 4M75F 5EG2A 4EMKB 4C92E 1I5LA 1UB4A 4M77A 1VQ9A 2Y4XA 4C0ZA 4IURA 4M7AG 1UGPB 3G6ET 3QUIA 3V7SA 4PJOG 3L2ZA 1W4SA 3OSVA 2CZ1B 1W2BS 5DLQE 1VQPA 2R5MA 1JJ2S 3OYFA 2QQRA 1KD1C 1QP3A 3R6OA 3OW2A 4M7AE 5KCHA 4L59A 2PVOB 4C0GA 4PJOE 3CC7T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RJC A;  3PMT A;  2E6N A;  1G5V A;  2HQX A;  2LDM A;  4PL6 A;  4BE2 A;  3OA6 A;  3OYM A;  2DIG A;  2GFA A;  3NTH A;  4IUV A;  3O8V A;  2EQU A;  4BDZ A;  3L2U A;  3L2V A;  2L89 A;  2X4Y A;  4BAC A;  1WJS A;  3QKJ A;  4OVA A;  4GY5 A;  2R5A A;  2RO0 A;  2MWO A;  5C0M A;  1XNI A;  4HCZ A;  2X4W A;  3OMG A;  4QQG A;  2WAC A;  4IUQ A;  3MET A;  4Z02 A;  3NTK A;  2IG0 A;  4IUU A;  3QII A;  3OYI A;  3C4S A;  5D6W A;  4ZTJ A;  2RJD A;  2LVM A;  4IUP A;  3UT1 A;  3E9G A;  2G3R A;  3FEO A;  4IKF A;  2DAQ A;  5FRN A;  3LYI A;  3S6W A;  3MEW A;  4UC4 A;  3SD4 A;  3L2R A;  2CKK A;  2EFI A;  3Q1J A;  2RHY A;  3OYA A;  3LX7 A;  3QBY A;  4N4G A;  3E9F A;  1MHN A;  4II1 A;  3H8Z A;  3MP8 A;  2O4X B;  3OYD A;  2X35 A;  4FL6 A;  2BKD N;  2R58 A;  3DLM A;  4BDY A;  4E7I A;  4E7H A;  2RHX A;  4A4F A;  5D6X A;  4E7L A;  3P8H A;  3LGL A;  3BDL A;  5KE3 A;  3LLR A;  5J39 A;  3F70 A;  2EKO A;  2M0O A;  2RI3 A;  4B9X A;  3EAE A;  2HQE A;  2RHZ A;  3M9Q A;  3L2Q A;  3OMC A;  4CRI A;  3PFS A;  2BUD A;  2DIQ A;  2RJE A;  5M9O A;  5C6S A;  2RI5 A;  3OYN A;  3OYH A;  2D9T A;  4LD6 A;  2EQK A;  4C5H A;  2LRQ A;  4QVZ A;  1OZ3 A;  3P8D A;  4Q5W A;  4RG2 A;  3MP6 A;  2RI2 A;  1KHC A;  4C5I A;  1OZ2 A;  5FRM A;  4E7J A;  5IAY A;  3OYG A;  5KE2 A;  2LTO A;  2XDP A;  2K3Y A;  4NS5 A;  3OYB A;  3GOX A;  2E5Q A;  1OI1 A;  3KUF A;  4QW2 A;  4BE0 A;  5D6Y A;  2M16 A;  2P0K A;  3DB3 A;  3MO8 A;  4QQD A;  4N4H A;  2L3R A;  3S3M A;  3OYC A;  2MWP A;  3CEY A;  2BIV A;  4A4H A;  3UWN A;  2XK0 A;  3OY9 A;  3FDR A;  3NTI A;  3PMI A;  4N4I A;  3QJ6 A;  4IUT A;  2GFU A;  5IN1 A;  1SSF A;  2R57 A;  4BD3 A;  5J26 A;  1H3Z A;  3PNW C;  2GF7 A;  4C5E A;  3OS0 A;  3OYJ A;  3S3O A;  3ASK A;  3L42 A;  5KH6 A;  3S3N A;  3DB4 A;  2O4X A;  2NLU A;  2JTF A;  1N27 A;  2QQS A;  5CIU A;  2PQW A;  1WGS A;  3MEA A;  3OQ5 A;  3OS1 A;  3OYL A;  1OYX A;  2LCC A;  4C5G A;  2RHU A;  1WJR A;  2L8D A;  3FLG A;  4E7K A;  4PLL A;  1RI0 A;  2JZ2 A;  3LH0 A;  3LGF A;  2YRV A;  3ME9 A;  3MEV A;  4A4G A;  3OYK A;  2B8A A;  2X4X A;  3MP1 A;  2EQJ A;  1WJQ A;  2EQM A;  4PLI A;  2RHI A;  3ZEH A;  3OB9 A;  4X34 A;  3MEU A;  3L2W A;  4FU6 A;  4IUR A;  4A4E A;  4EDU A;  5KCO A;  3FC3 A;  2M1H A;  5FRO A;  2RJF A;  2VYT A;  4ZTF A;  2R5M A;  3OS2 A;  3OYF A;  2QQR A;  2K3X A;  4B9W A;  2FHD A;  4BE1 A;  5KCH A;  3H6Z A;  2F5K A;  4L59 A;  4QQ6 A;  3OYE A; 
#chains in the Genus database with same CATH topology
 1HXD A;  2KRN A;  3OA6 A;  2X9H A;  4IUV A;  3ER0 A;  3T9N A;  1VQL T;  1N9R A;  1LVK A;  4V2S A;  3PVQ A;  1K1Z A;  2YUQ A;  1S72 A;  4MMK A;  4IIM A;  1N8R R;  2YUP A;  5LJ5 d;  1C6V X;  4P5N A;  2QGF B;  1TWB A;  1X2Q A;  1M30 A;  4RTX A;  1JJ2 P;  2YUN A;  2XD0 A;  1RAG B;  2D1X A;  3EH1 A;  4F7U G;  1AZG B;  4JS5 A;  1S1N A;  3F70 A;  1VYT A;  2L5Q A;  4JZ4 A;  4F7U E;  4B9X A;  3BW1 A;  1R0C B;  4OMM A;  3RR6 A;  3VKI A;  5LJ3 g;  1HJD A;  3PFS A;  2BUD A;  1CSK A;  4MZT A;  2EAY A;  5M9O A;  2DMO A;  4C8Q A;  1Y96 A;  5FU6 C;  2L3S A;  2HMA A;  1VQ9 T;  2JVV A;  1GCP A;  1OZ2 A;  1YJ9 A;  4M78 F;  1ZA1 B;  2KVQ G;  2E5Q A;  3M5A A;  2DYI A;  5A0L A;  1M3B A;  1VQP T;  4DOW A;  1M4Z A;  3CC2 Q;  3M0R A;  4N4H A;  2RK1 A;  5GAN j;  1KQS A;  2CUD A;  5GAO q;  2DL7 A;  1QVF S;  2PNI A;  1WPY A;  2K5L A;  2KSS A;  2J7I A;  2CH4 A;  1PG5 B;  2DYB A;  2O4X A;  1WXU A;  2GQI A;  2W10 A;  1SF9 A;  1KQ1 A;  2H8H A;  1ARK A;  3OYK A;  4CC3 A;  4F04 B;  1D0X A;  4OMQ A;  8ATC B;  1NJI C;  2XI9 A;  4X34 A;  2RQU A;  3OYY A;  3L2W A;  2JOY A;  4QKU A;  1I81 A;  2DLP A;  3FC3 A;  4ZTF A;  4C0F A;  4B9W A;  1AWJ A;  3CXC P;  2E6Z A;  4RTT A;  2DX1 A;  4LDV A;  4HVV A;  5IXF A;  1YJN T;  1V76 A;  4FW2 A;  3L2V A;  1M1K R;  2JS0 A;  2RF0 A;  5LJ3 d;  4M7D A;  3QPH A;  2A0F B;  4Z89 A;  1JJ2 A;  5I11 A;  3OMG A;  4C8Q C;  4FCY A;  1M2V B;  2CSQ A;  2BE7 D;  5CR2 A;  4IUQ A;  3CCV T;  2EGE A;  2XHC A;  2ENM A;  1QLY A;  2EJF A;  1ZSZ A;  1HYO A;  1SRM A;  2BZY A;  1RAI B;  2EW3 A;  3URG A;  2QXF A;  1NBE B;  3VV0 A;  1ZUU A;  2FPD A;  1M3C A;  4EMK A;  1I5O B;  1B7T A;  2R58 A;  3G1J A;  4DEX A;  3CC2 A;  4HA8 A;  3VS2 A;  2A7Y A;  2NWM A;  4J8O A;  4M7D G;  3RDV A;  4RCC A;  5GAN g;  1QVG P;  2FEI A;  4O6J A;  3SB2 A;  1Y0M A;  1YJW Q;  3HTR A;  1WDX A;  1X6B A;  2CSI A;  1PNJ A;  3P8D A;  3QJY A;  4AFS C;  4C8Q D;  2XDP A;  1N8R C;  5CKE A;  1VQN Q;  3JB9 J;  2P0K A;  2KK4 A;  2H3E B;  3S3M A;  4AFU C;  2KRS A;  1Y57 A;  2JM9 A;  1XOV A;  4M7A C;  3PNW C;  3JCM g;  3OS0 A;  4A63 B;  1TU0 B;  5GAN 4;  1I1J A;  4QVC A;  1M2O A;  2DO3 A;  3QHS A;  3RKW A;  2EGA A;  1ZSZ C;  3GF5 A;  4GLK A;  3M55 A;  2E3H A;  5AT1 B;  1WXB A;  5KCO A;  2DTI A;  4EMK C;  2GCX A;  1KD1 U;  3VYG A;  2VC8 A;  1D3B B;  2A37 A;  3H6Z A;  2ESW A;  5CKD A;  4KH1 B;  4OMP A;  3G71 T;  1WHL A;  5LJ5 f;  1Q81 U;  4OGE A;  4HVU A;  2DBK A;  2FPE A;  1KC8 C;  2DIG A;  3JCM V;  3H0I A;  1MGQ A;  3HRU A;  5KYW B;  3QKJ A;  4JZ3 A;  3E2U A;  2I2L A;  2NUP A;  1PC0 A;  1XNI A;  4M7D D;  2OTJ Q;  1QCO A;  4IUU A;  4LDU A;  3EGX B;  3QWY A;  4JPB W;  1YJW A;  2JUF A;  2EYY A;  3E9G A;  4RTZ A;  1KQS S;  2DJQ A;  4C92 A;  3VS4 A;  1QVG A;  1OU8 A;  4LUD A;  5HCK A;  1NYF A;  2CUB A;  2KYB A;  4Y92 A;  3HRT A;  3EFO B;  1N8R U;  4CI0 C;  3JCM Q;  1VQN A;  3DLM A;  4PJO A;  5I2M A;  1W70 A;  3CPW S;  3BDL A;  1CKB A;  1TH7 A;  1PRL C;  2RK2 A;  3EAE A;  4XTY A;  5FU6 B;  4JS4 A;  2MI6 A;  1M1K C;  3QWX X;  4VUB A;  4LD6 A;  1XJW B;  3AT1 B;  3CCJ T;  2AZV A;  2I0N A;  4RG2 A;  3CCU T;  2RI2 A;  1Z9Z A;  3EG3 A;  5IAY A;  5KE2 A;  3VS1 A;  1RAF B;  3MHX A;  4KGV B;  1I07 A;  4LXC A;  3FDR A;  2LC4 A;  1Q7Y R;  1YCY A;  2GF7 A;  2IIM A;  2PZ1 A;  3BY7 A;  2E10 A;  3H9N A;  1BI1 A;  3CCL Q;  5KYU A;  3I9Q A;  2FRY A;  5LJ3 e;  1YHQ T;  1M90 U;  5LJ3 f;  3VS3 A;  4C92 C;  4ZGJ B;  2YT6 A;  2OTJ A;  2CH4 W;  1QCF A;  2DD4 A;  4KBM B;  4JJN K;  3V8L A;  1QWF A;  2FHD A;  4PJO C;  4QQ6 A;  4PJL A;  2VGN A;  2Y4Y A;  4C8Q B;  2OX7 A;  4DQ2 A;  4BAC A;  2VXF A;  3OBY A;  4KT0 E;  2RPN A;  4NL3 A;  2LJ3 A;  1RAH B;  1PSF A;  1UUE A;  3CME T;  2HAX A;  3JB9 D;  1AZE A;  1BK2 A;  2G3R A;  2AKK A;  3OSS C;  3GNF B;  3HL8 A;  1WHG A;  3V7R A;  4C92 D;  3GLX A;  2O4X B;  1IRE B;  2LJ1 A;  1SHG A;  2PVD B;  2YXY A;  2D6F A;  2O01 E;  2DXU A;  2EIF A;  1EFN A;  2QQA A;  1TXQ A;  4PJO D;  3WVE B;  2M02 A;  4GLM A;  4R56 A;  5GJW B;  3JRZ A;  3RMS A;  3CCL A;  1OZ3 A;  2DZC A;  2A28 A;  3OYG A;  2LX7 A;  4R0K A;  4NS5 A;  3JCM c;  5J3B A;  4QQD A;  2A36 A;  1U3O A;  2DF6 A;  3I56 T;  1UG1 A;  1WA7 A;  5GJV B;  2F5T X;  1Y07 A;  2GTJ A;  2LT4 A;  4PKC C;  1SSF A;  2DTO A;  5J26 A;  3VS5 A;  1W1F A;  2RNA A;  1AT1 B;  1ZSZ B;  1TSF A;  3FLG A;  2C06 A;  1YIJ T;  2XID A;  2EGC A;  1Y71 A;  4PJM A;  4EMK B;  1I5L A;  4M77 A;  4IUR A;  2HSP A;  1UGP B;  2CZ1 B;  2RQT A;  3OYF A;  2RJC A;  1VA7 A;  4M75 A;  3NGP A;  2LNV A;  2X3X D;  3FIF A;  1IZ6 A;  2M0Y A;  4X9C A;  2KQW A;  1Q7Y C;  2LQN A;  1VQ4 Q;  2V26 A;  2OAW A;  2RO0 A;  3MPU B;  1FMV A;  1YBY A;  5GAO n;  4FSX A;  2V8J A;  2IG0 A;  3OYI A;  3CMA Q;  3I5R A;  4JRQ A;  2Y90 A;  2J6F A;  2K7A A;  4J9D A;  2DM1 A;  3HFN A;  2J05 A;  1HD3 A;  5LJ5 j;  2BE9 B;  4XTV A;  3JSC A;  5FU7 C;  2QI2 A;  1JQQ A;  2WSE E;  4E7H A;  1PWT A;  3VRZ A;  3WXM B;  3NMZ C;  2RI3 A;  1QP2 A;  1SHF A;  2HQE A;  1OUL A;  5GAN 7;  2YSQ A;  5CKH A;  2LRQ A;  1A0N B;  1ZBJ A;  3V7C A;  2MOX A;  4M77 C;  1PCX A;  4C5I A;  1KHC A;  5KYY A;  4A53 A;  2F1L A;  2LZ6 B;  1QVP A;  3RNJ A;  2YUO A;  3TSZ A;  1BIA A;  5GAM h;  1RAE B;  4M75 C;  1VQO Q;  3RKY A;  7AT1 B;  2NUP B;  4FYV B;  1QKX A;  1T0J A;  1VQ7 Q;  4FT4 A;  4XTX A;  3REA B;  2EYX A;  4ZGD B;  1D1C A;  2F2W A;  2AIR B;  5ECA A;  1H3H A;  1WHH A;  1PD1 A;  2LCS A;  2RM4 A;  4C92 B;  2L8D A;  1Q7Y U;  1VQ5 Q;  1VQ4 A;  3N5B B;  3LGF A;  1MMN A;  3MP1 A;  2DVJ A;  5AYF A;  2K5F A;  4A4E A;  4NOY A;  4MML A;  4PJO B;  4EDU A;  1WYX A;  3CMA A;  3FJ5 A;  4M77 D;  2KRM A;  1YIT Q;  3EFO A;  3SEM A;  4KGZ B;  3PMT A;  4ORZ A;  2GNC A;  3VUB A;  2FO0 A;  2EQU A;  4M75 D;  1P92 A;  1W2B A;  1VQ8 Q;  4E2F B;  3I55 Q;  2EYZ A;  2D0Q B;  2WAC A;  3EG2 A;  1ZQ1 A;  2DA9 A;  3MET A;  3CC4 Q;  3PTA A;  4EPC A;  3UT1 A;  4Z88 A;  3S6W A;  3A8H B;  3JCM W;  5LL6 S;  2ZPG B;  1X43 A;  3C94 A;  2LNH B;  2VUB A;  2MMP A;  3E9F A;  4D6W A;  2EYQ A;  3UAT A;  4BDY A;  4M78 C;  2XU8 A;  4A4F A;  5D6X A;  2EJG A;  5KYU B;  3LLR A;  1VQO A;  2AK5 A;  1NE8 A;  1VQ7 A;  1FX7 A;  3X26 B;  4GBQ A;  2WSF E;  3HSB A;  4F17 A;  2RJE A;  2D9T A;  2O31 A;  1WNL A;  3CCQ Q;  2CZ0 B;  1UGV A;  4J9E A;  1VQ5 A;  3CCS T;  4J6X A;  3P8B B;  4EIK A;  1RUW A;  1JRI A;  4LD9 K;  4RTY A;  2DEQ A;  3RBB B;  2HKN A;  3PIP A;  4KUL A;  1H8K A;  1TOV A;  2AT1 B;  1M9S A;  3QJ6 A;  4BD3 A;  4RUG A;  2P4T A;  3MCA B;  5KH6 A;  1YIT A;  2EPD A;  2JMC A;  4B6M A;  1IGQ A;  4HXJ A;  1M8M A;  2L3P A;  1Q86 U;  1R8O B;  4KRT A;  3H0H A;  4JRI A;  4E7K A;  1RLQ C;  3MEV A;  2QAZ A;  2KGT A;  1VQ8 A;  2OTL Q;  3INZ A;  3G4S T;  4IIO A;  3I55 A;  2KDS A;  2MF2 A;  3CCE Q;  1PM3 A;  2LMJ A;  3CC4 A;  3CBM A;  3QDR B;  2V1R A;  5GAM j;  3CD6 T;  3NHN A;  3R6N A;  1KC8 R;  1ZUY A;  1KHI A;  4BE1 A;  2OJ2 A;  1WQW A;  5CQY A;  3FJP A;  2FZG B;  4BE2 A;  1AHJ B;  2LX9 A;  4C8Q G;  4DBF A;  1R77 A;  1I8F A;  2JT4 A;  1EZZ B;  3JCM b;  1YI2 T;  4C8Q E;  2RD1 A;  2HSE B;  2D8H A;  4BI4 A;  4OB1 B;  3I35 A;  2O2O A;  1Z9Q A;  2HCK A;  1K73 C;  5FU7 B;  4QVD A;  3LYI A;  2FZK B;  2V1Q A;  3CCQ A;  2EFI A;  1KSW A;  2VAS A;  3ZFJ A;  4O5V A;  3OYD A;  4M7A A;  1XQH A;  1M27 C;  2CS7 A;  2O88 A;  2IVW A;  2DER A;  2ATC B;  5DY9 A;  1GCQ C;  3BDU A;  1X75 C;  3EG1 A;  1RL2 A;  5EC7 A;  4M77 B;  2NUT A;  1B34 B;  2KAF A;  5C6S A;  3OYH A;  3OYN A;  2CZ6 B;  1AD5 A;  2EQK A;  4HKE A;  4OML A;  3G6E Q;  4M75 B;  2M9U A;  3THK A;  2VWF A;  2OTL A;  4KUI A;  3MO8 A;  3CCE A;  1WZO A;  3CC7 Q;  4F7U F;  3OYC A;  3A1P A;  2JXB A;  2ZCF B;  4AG2 C;  2YLB A;  2K79 A;  1VQL Q;  4ME7 A;  5GAM g;  1AWX A;  1OEB A;  3L42 A;  4L6V 5;  1ZBX A;  1VQK T;  4M7D E;  5A0G A;  4CC7 A;  4AT1 B;  2QQS A;  4FYX B;  3OS5 A;  3M0P A;  4LE9 A;  2JZ2 A;  3LH0 A;  2DXC A;  4J9B A;  4RTV A;  1NJI U;  3TRE A;  2ROT A;  2M1H A;  2K3X A;  2CYZ B;  3KXT A;  1ACM B;  5I22 A;  2RQR A;  3OYE A;  3QXE B;  2YRD A;  3HRS A;  1VQM T;  5A0D A;  4BDZ A;  5DLO A;  3CXC A;  2KEA A;  2KYM A;  4DOV A;  5KYY B;  5C0M A;  2X4W A;  4QQG A;  3UDC A;  3OW2 P;  1VQ9 Q;  2HBW A;  2FVU A;  4J83 A;  4JLI A;  5GMK e;  4WF2 A;  3CCR T;  4XK8 E;  4XAX B;  2RJD A;  2LVM A;  2QTV A;  3JV3 A;  4HCC A;  2X4J A;  1VQP Q;  4DA4 A;  2G6F X;  1SSH A;  1B3Q A;  4X1V A;  4M78 B;  3VS6 A;  3G6E A;  3J81 E;  2IPO B;  1V29 B;  5GAN d;  2LJ0 A;  1OV3 A;  2RHX A;  3BFM A;  3CC7 A;  4M7A D;  2CP0 A;  4DBR A;  1H92 A;  2VV5 A;  1U8R A;  3VS7 A;  3AHU A;  5I2S A;  4RTU A;  3M9Q A;  1VQL A;  4XTW A;  1G83 A;  3JAM E;  1FMK A;  1BB9 A;  3E1S A;  1YWP A;  3EFR A;  2K57 A;  2HL5 C;  4MDW A;  4MZP A;  3A5Z B;  2QEX T;  2AHJ B;  4OMO A;  5I21 A;  1IB8 A;  1WIE A;  1K9A A;  4DBH A;  2H3J A;  3JCM d;  2J6K A;  4RKU E;  1VQ6 T;  2EBP A;  2P4R A;  1UHF A;  1YJN Q;  3HKS A;  4M7D F;  3JB9 G;  1PKS A;  2HKQ B;  3M0Q A;  2ABL A;  2NLU A;  1NLO C;  5CIU A;  3MEA A;  3OQ5 A;  2J06 A;  2LCC A;  1K4U S;  2RHU A;  3CCV Q;  4JRP A;  1KK7 A;  4C92 G;  1QCN A;  2B8A A;  1VIE A;  2EQJ A;  1MV0 B;  4C92 E;  1UB4 A;  1VQ9 A;  4C0Z A;  1Q95 G;  1ZSG A;  1MMA A;  4K11 A;  1GL5 A;  3QUI A;  4PJO G;  1VQP A;  1JJ2 S;  1QP3 A;  1YN8 A;  3R6O A;  3OW2 A;  2NUZ A;  4PJO E;  5FW9 A;  2F69 A;  3M4Y A;  2ZPF B;  1KC8 U;  1D1A A;  2QA4 T;  3PE0 A;  2AZS A;  2CGH A;  1I4K 1;  2ZAE A;  3JCM X;  2JTM A;  2QYZ A;  3M0S A;  1ZHI A;  3RKX A;  2O9S A;  1AOJ A;  2GBQ A;  5GAO l;  5CKF A;  3ZL7 C;  2E1H A;  2HDA A;  2COY A;  1QWE A;  2QQ9 A;  2RHY A;  1K8A R;  5LJ5 h;  3OYA A;  1MUZ A;  3EG9 B;  3RIR A;  3DLL A;  3CCM T;  2MPX C;  1GBQ A;  1MHN A;  1QMC A;  4A54 A;  5HY6 A;  4FM4 B;  4FSS A;  2VKN A;  5KE3 A;  2DFU A;  5IXB A;  4J5Y A;  4LUE A;  2PUO B;  1YJN A;  1M1K U;  4CRI A;  2KT1 A;  1UJY A;  1KFZ A;  2QG9 B;  2SEM A;  1TG0 A;  4AFQ C;  3O5Z A;  3CCV A;  3DKM A;  2LQK A;  3EG0 A;  1V1C A;  3GOX A;  4QW2 A;  4J9C A;  2M16 A;  3G71 Q;  5GAO p;  5GAN 6;  4LDW A;  2DEU A;  3X20 B;  2BIV A;  3CXC S;  1K0X A;  1BCO A;  4J9I A;  5IN1 A;  2R57 A;  4J7I A;  2HEQ A;  1H3Z A;  2FYK A;  2XG8 D;  4PK4 A;  3QO3 A;  4N0A A;  3OYL A;  2QQB A;  1S72 T;  4A4G A;  5HKC A;  2MK5 A;  3ZEH A;  4M7A B;  3KBG A;  2MYS A;  2KXC A;  4A4K A;  1M5Q 1;  2VYT A;  1ZA2 B;  1WFW A;  1QVF P;  2HQX A;  2NUT B;  1AWO A;  1PRM C;  4PL6 A;  4RMO A;  2GFA A;  3FB9 A;  5GAN e;  1UDL A;  1QVG S;  5GAN f;  2KMT A;  5CO7 A;  1C1A A;  3CCJ Q;  3RUX A;  3CCU Q;  4JLG A;  1NG2 A;  1B34 A;  4ZTJ A;  1YJ9 T;  2L3Q A;  3PGG A;  2DAQ A;  3MEW A;  4UC4 A;  1U1T A;  3A8M B;  3LH5 A;  3SD4 A;  4FT2 A;  3SHW A;  2C0T A;  2DVE A;  1HSQ A;  2JM8 A;  1T3L A;  5CVI A;  3G71 A;  2LCL A;  1OOT A;  1ZLM A;  3JCM e;  4E7L A;  2DD5 A;  4FIB A;  3JCM f;  4N0A C;  2RHZ A;  4FYY B;  2WSC E;  1NEG A;  3TSW A;  5GMK j;  4M77 G;  1YHQ Q;  1T3S A;  4JRK A;  5GAO m;  2EKH A;  4XU3 A;  1G3W A;  4CC2 A;  1X2K A;  3MP6 A;  3NPF A;  4M77 E;  3GPL A;  3TQ7 P;  3OYB A;  1OI1 A;  1UGQ B;  1CKA A;  4M75 G;  1JEG A;  1IGU A;  3OBW A;  2RN8 A;  2HBP A;  3LW5 E;  1GRI A;  1K8A C;  3WVD B;  3UWN A;  4M75 E;  2W0Z A;  3QSU A;  3C0C A;  3TU4 K;  3UA7 A;  3L1A A;  4XTU A;  3QZ9 B;  2KT8 A;  1U1S A;  4LNP A;  3CME Q;  1N27 A;  2PQW A;  1IO6 A;  2P0P A;  2VXE A;  1QVF A;  1GFC A;  3ME9 A;  2F2X A;  2EQM A;  3CCJ A;  1JXM A;  3OB9 A;  3CCU A;  5CCA A;  4KUD K;  4J9F A;  3I5S A;  2MAM A;  1UTI A;  1SEM A;  5FRO A;  4M78 A;  3OS2 A;  4LN2 A;  2DKG A;  1X6G A;  1QW1 A;  3CC2 T;  1Q82 R;  1PHT A;  5CQX A;  3NTH A;  2QDY B;  2YHT A;  1FXX A;  1G3S A;  4OVA A;  4MZM A;  1K73 R;  2XDB A;  2YLC A;  4HCZ A;  3X25 B;  4Z02 A;  2BTT A;  1KIK A;  1KQ2 A;  2E4H A;  4RCB A;  4IUP A;  1YHQ A;  3FEO A;  5CKB A;  3GP8 A;  2X51 A;  4ELZ C;  1WX6 A;  4PJJ A;  3RER A;  3I56 Q;  2A08 A;  3LX7 A;  4OB2 B;  2X35 A;  2QTX A;  2YDL A;  4FL6 A;  5LJ5 g;  2K2V A;  2JMA A;  1M1G A;  5LJ3 j;  2DXB A;  4HT9 A;  3MJX A;  1DJ7 B;  2EJ9 A;  1YIJ Q;  1OX8 A;  2VVK A;  4C0D C;  1GBR A;  4M77 F;  3HFO A;  3CME A;  1PKT A;  2ZPB B;  2ZGW A;  1U06 A;  5FRM A;  1KQS P;  2HD0 A;  3G7Z A;  1KD1 R;  3U23 A;  2CP6 A;  2L3R A;  4XU1 A;  4HCB A;  2XK0 A;  1Q81 R;  3H41 A;  4JDS A;  3NTI A;  4N4I A;  2GFU A;  1R0B G;  3CPW P;  2HZY A;  3OYJ A;  8AT1 B;  4F7U A;  3VU3 C;  2YRC A;  3V8K A;  3RMQ A;  1YWO A;  2KNB B;  1WI7 A;  4J7F A;  1VYV A;  4LDY A;  1MMG A;  1YP5 A;  2YRV A;  1YJW T;  2X4X A;  3A8O B;  4FU6 A;  2DXT A;  4Y28 E;  3SWN C;  2CZ7 B;  2CP3 A;  5GMK i;  1VQN T;  2K4Y A;  5KYN A;  2AKL A;  3EG9 A;  5IHK A;  1GCQ A;  1WHJ A;  3I56 A;  2XIC A;  4M78 D;  1FYN A;  3EFS A;  3O8V A;  2DL3 A;  1NEB A;  2ROL A;  3EH2 A;  1I0C A;  2X4Y A;  2R5A A;  4J9G A;  3PT9 A;  3NTK A;  4BI3 A;  3J80 E;  1ABQ A;  3C4S A;  1YIJ A;  3ULR B;  2DK3 A;  2LQW A;  1UGR B;  1H64 1;  2XKO C;  3HPW A;  2DNU A;  2HNI A;  5FRN A;  2E41 A;  1M3A A;  1RI9 A;  3C12 A;  4RTW A;  3MP8 A;  1MV3 A;  3IQL A;  4E7I A;  1N9S A;  2C0I A;  3QZ5 B;  3P8H A;  2BZX A;  3M58 A;  1Q82 C;  2B86 A;  2K6D A;  1D0Y A;  1F1B B;  3L2Q A;  2QAS A;  4JJB A;  1N6A A;  5KYX A;  4WTO B;  2C0O A;  1M90 R;  2RI5 A;  4BUG A;  1BI0 A;  5GAN 8;  3CPW A;  2OTJ T;  1VYU A;  4R55 A;  4E7J A;  1G8X A;  2DBM A;  1TUD A;  4PJN A;  3DB3 A;  1UEB A;  3EGD B;  4OB0 B;  3LWI A;  4NL2 A;  2BZ8 A;  2JTE A;  1UHC A;  3SDZ A;  2J6O A;  1FMW A;  2ECZ A;  3BE3 A;  5CK9 A;  3CBP A;  1AEY A;  3GNG A;  1GXI E;  3C95 A;  4C5E A;  3ZBD A;  2LP5 A;  3ASK A;  3CBO A;  3S3N A;  1TTH B;  4XTZ A;  2JTF A;  1K76 A;  4ZN3 A;  4X9D A;  4D8K A;  4OB3 B;  1NM7 A;  1RI0 A;  2L0A A;  1LJO A;  2X3W D;  3M59 A;  5EG2 A;  1MND A;  4M7A G;  2MIO A;  1W2B S;  1AWW A;  1W4S A;  5DLQ E;  4M7A E;  1KD1 C;  1RAD B;  5KCH A;  4L59 A;  2PVO B;  1C0M A;  4C0G A;  2DE0 X;  3GBQ A;  2XMF A;  1Q81 C;  2LT1 A;  1VIF A;  1UFF A;  1WJS A;  4GY5 A;  1WHK A;  1Q82 U;  2CP7 A;  2A3L A;  3CCL T;  3VYH B;  4JJD A;  1RAC B;  2E70 A;  4QT7 A;  3CCS Q;  1OPK A;  2KRO A;  2QGG A;  4KH0 B;  1K73 U;  2FPF A;  2DRM A;  1D1B A;  3TCJ A;  1G3Y A;  4N4G A;  1TS9 A;  3H8Z A;  2P0Q A;  5IH2 A;  2JNG A;  3M54 A;  4KGX B;  1E6H A;  1UJ0 A;  4OMN A;  4BI8 B;  4C8Q F;  1SPK A;  1X6O A;  2EKO A;  1TUG B;  4C0D B;  1M1F A;  1O9S A;  4E6R A;  4YTL A;  5D7U A;  3M4G A;  1K9M R;  4M7D C;  3G4S Q;  1BCM A;  1UE9 A;  1W6X A;  4C5H A;  4QVZ A;  3M0T A;  3CD6 Q;  4ATO A;  3EHQ A;  5GAM d;  2RH2 A;  4RG8 A;  2QDL A;  2E12 A;  2K2M A;  1OQK A;  2CT4 A;  5LJ5 e;  3DB4 A;  2K9G A;  1YI2 Q;  2HQH A;  1QKW A;  1G2B A;  4DBQ A;  3SWN B;  3V8J A;  1MMD A;  4BY6 C;  2CP2 A;  4ZN1 A;  3QG1 A;  1M90 C;  4PLI A;  2D8J A;  1IXD A;  2CRE A;  4M7A F;  4OF1 A;  3CCS A;  2PUK B;  2ZZD A;  1NPP A;  2RJF A;  3JCM P;  1BI3 A;  5IHI A;  5GAN 3;  2VGM A;  4PFP A;  2DET A;  2E6N A;  1M8V A;  1VUB A;  2LDM A;  3OYM A;  4Y91 A;  1X27 A;  5A2Q E;  2L89 A;  1X01 A;  1E7O A;  4HT8 A;  4EMH A;  3D7S B;  4FYW B;  2MWO A;  1WQ7 A;  1KG1 A;  4DEY A;  1OX9 A;  1YNZ A;  4OMF B;  3G4S A;  1ZX6 A;  2JN0 A;  4IKF A;  1VOM A;  5GMK l;  2SRC A;  1XTD A;  2KI7 A;  2CKK A;  4BB7 A;  1EX4 A;  3NFC A;  3JCM J;  3CD6 A;  2EWN A;  3M53 A;  2K5I A;  1BIB A;  1TUC A;  4F7U B;  4XQ3 A;  1VQK Q;  1AVZ C;  1D09 B;  1WXT A;  1BYM A;  3M56 A;  4WCI A;  2E64 A;  3LGL A;  3FRN A;  2KR3 A;  1BBZ A;  3OMC A;  1VQ4 T;  2KXD A;  5GMK h;  3EHR A;  2QK0 A;  2DIQ A;  1GFD A;  5FWB A;  2JS2 A;  1YI2 A;  4D8D A;  3UPU A;  2V8K A;  4Q5W A;  2FL7 A;  2LTO A;  2K3Y A;  3LWH A;  5HK0 A;  2DTH A;  2OI3 A;  5IHN A;  3CMA T;  3JB9 H;  1Y7X A;  3CEY A;  4A4H A;  1VQM Q;  3OY9 A;  4HCK A;  1D0Z A;  4FW1 A;  4IUT A;  3S3O A;  3JB9 I;  4PNO A;  2ED0 A;  5CAI A;  2E65 A;  3A98 A;  1OYX A;  2ZPH B;  4C5G A;  3PVL A;  3CCR Q;  1Y96 B;  2KE9 A;  4AFZ C;  4PLL A;  3M0U A;  1K9M C;  1E6G A;  3TEE A;  3A8G B;  1IRX A;  5IT9 E;  2DPP B;  1B07 A;  4ZNX A;  4EMG A;  6AT1 B;  3MEU A;  2LQ8 A;  1YCS B;  1JU5 C;  3EGU A;  1OPL A;  1FWZ A;  4HVW A;  1NPR A;  4JJC A;  3JB9 F;  4ELY C;  3H0F A;  1JBM A;  3UF4 A;  1G5V A;  3VUZ A;  1X69 A;  1VQO T;  2PVG B;  2V8I A;  5KYX B;  3VJP A;  3PIO A;  3L2U A;  1VQ7 T;  1VQK A;  2E3I A;  2OAU A;  4C92 F;  1LPL A;  4L5G A;  3CQT A;  1RAA B;  3E19 A;  2QEX Q;  4AMC A;  2PTK A;  1VQ5 T;  2FB7 A;  4PJO F;  2CDT A;  4LDX A;  1VQ6 Q;  4ESR A;  3L2R A;  1ZUK A;  2NYS A;  3QBY A;  4II1 A;  2DJZ A;  3GIB A;  1OU9 A;  3EGD A;  3X28 B;  5GAM e;  1YIT T;  2ED1 A;  5FLX E;  5GAM f;  4M7D B;  5J39 A;  1VQM A;  5LJ3 h;  4Z8A A;  3VS0 A;  3X24 B;  1LNX A;  2M0O A;  1Q86 R;  4M4Z A;  3J7A F;  1SRL A;  1KJW A;  2CP5 A;  5GAN 2;  1LOJ A;  1VQ8 T;  5GAO r;  4TVR A;  3I55 T;  2L2P A;  4ANJ A;  2ZPI B;  5GMK m;  1ABO A;  1JB0 E;  3CC4 T;  3CCR A;  1G3T A;  1K9M U;  3SFM A;  4F14 A;  2CT3 A;  4OGC A;  1M2V A;  2DRK A;  2ZPE B;  4BE0 A;  1EIF A;  2M51 A;  2O9V A;  2MWP A;  3HP9 A;  4XU0 A;  1J3T A;  1PSE A;  2KY9 A;  1IHV A;  4J6Y A;  9ATC B;  2QA4 Q;  2F2V A;  2DIL A;  4PFO A;  4BY6 B;  3OS1 A;  3TVT A;  2VB6 A;  2RA2 A;  1WJR A;  3VRY A;  3OW2 S;  2COW A;  1BI2 A;  5L8R E;  3CCQ T;  3CCM Q;  1NYG A;  2QEX A;  1NZ9 A;  2E5K A;  2GQV A;  5DM7 R;  3HHT B;  3QYH B;  1MNE A;  1VQ6 A;  2F5K A;  1W2B P;  2DL4 A;  2DL5 A;  4PFZ A;  3MKD A;  3UA6 A;  2PU9 B;  1T0H A;  3M57 A;  5FWC A;  2FG0 A;  1O75 A;  4XU2 A;  2DZ9 A;  3QYG B;  3QII A;  5D6W A;  2EQI A;  2HL3 A;  4MDX A;  5HK3 A;  2OTL T;  5L23 A;  2RQW A;  3CCE T;  3Q1J A;  5GAN 5;  3RES A;  2RMO A;  2EYW A;  4OP0 A;  1N5Z A;  1LCK A;  1JXO A;  3A8L B;  2BKD N;  4AG1 C;  4F16 A;  2P84 A;  5GAN h;  2YWW A;  1UGS B;  4J6W A;  4E7Z A;  1D3B A;  1S72 Q;  1SG5 A;  2QA4 A;  2EVR A;  2Z0W A;  1UEC A;  1JO8 A;  4J9H A;  1NJI R;  5KYW A;  3REB B;  3SWN A;  2XDD A;  1YFN A;  4M78 G;  3KFV A;  2MCN A;  2FRW A;  3KUF A;  5D6Y A;  3EGX A;  1IHW A;  4M78 E;  2JW4 A;  2COZ A;  2RB6 A;  1K8A U;  4CC4 B;  3CCM A;  3JCM h;  3PMI A;  1NLP C;  2FZC B;  1K0S A;  1U5S A;  4JUV A;  1SKU B;  1HK9 A;  1RAB B;  2JJ9 A;  4ZGE B;  1BKB A;  1WLP B;  1BU1 A;  4E47 A;  1WGS A;  1Q86 C;  2D0N A;  3CPF A;  3QDF A;  1YJ9 Q;  1QQJ A;  1WHM A;  2K3B A;  2DL8 A;  2KBT A;  1PD0 A;  2RQV A;  1WJQ A;  2RHI A;  4M75 F;  2Y4X A;  1RLP C;  3G6E T;  3V7S A;  3L2Z A;  3OSV A;  2GGR A;  4E7S A;  2GTO A;  2R5M A;  2QQR A;  3CC7 T; 
#chains in the Genus database with same CATH homology
 2RJC A;  4M75 A;  2F69 A;  3M4Y A;  1Q81 C;  2LNV A;  1HXD A;  2ZPF B;  3FIF A;  3OA6 A;  1IZ6 A;  1KC8 U;  4IUV A;  2LT1 A;  3ER0 A;  4X9C A;  1VIF A;  3T9N A;  2KQW A;  1Q7Y C;  1VQL T;  1N9R A;  2QA4 T;  1WJS A;  2CGH A;  1I4K 1;  4GY5 A;  2RO0 A;  1Q82 U;  3JCM X;  4V2S A;  2A3L A;  1YBY A;  5GAO n;  4FSX A;  3CCL T;  2JTM A;  2IG0 A;  2V8J A;  3VYH B;  2E70 A;  3OYI A;  1ZHI A;  3RKX A;  4MMK A;  1S72 A;  5GAO l;  5CKF A;  2E1H A;  5LJ5 d;  1K73 U;  4JRQ A;  4P5N A;  2Y90 A;  2QQ9 A;  2RHY A;  3TCJ A;  5LJ5 h;  3HFN A;  3OYA A;  1G3Y A;  3DLL A;  3RIR A;  5LJ5 j;  3CCM T;  4N4G A;  1MHN A;  3H8Z A;  2P0Q A;  3JSC A;  4XTV A;  2QI2 A;  5FU7 C;  2JNG A;  4A54 A;  3M54 A;  5HY6 A;  2XD0 A;  2WSE E;  4FM4 B;  4F7U G;  4JS5 A;  4BI8 B;  4E7H A;  4C8Q F;  3WXM B;  1X6O A;  3JCM W;  5KE3 A;  3F70 A;  2EKO A;  4J5Y A;  2L5Q A;  4C0D B;  4F7U E;  2RI3 A;  1M1F A;  1QP2 A;  2PUO B;  4B9X A;  1O9S A;  2HQE A;  1YJN A;  4YTL A;  3BW1 A;  1M1K U;  3M4G A;  4CRI A;  3VKI A;  5LJ3 g;  4M7D C;  3PFS A;  2BUD A;  4MZT A;  2EAY A;  5M9O A;  5GAN 7;  4C8Q A;  1Y96 A;  4C5H A;  5CKH A;  2LRQ A;  5FU6 C;  4QVZ A;  3V7C A;  1VQ9 T;  4M77 C;  4C5I A;  1KHC A;  2JVV A;  1OZ2 A;  3CCV A;  4A53 A;  1YJ9 A;  4ATO A;  4M78 F;  3DKM A;  2KVQ G;  2LQK A;  2E5Q A;  3M5A A;  3GOX A;  4QW2 A;  1QVP A;  5GAM d;  5A0L A;  2M16 A;  1VQP T;  4DOW A;  1M4Z A;  5GAO p;  5GAN 6;  4LDW A;  4N4H A;  1BIA A;  2RK1 A;  2RH2 A;  3X20 B;  2BIV A;  4RG8 A;  5GAM h;  3CXC S;  5GAN j;  1KQS A;  4M75 C;  3RKY A;  2E12 A;  5GAO q;  1QVF S;  1WPY A;  2K5L A;  4FT4 A;  2KSS A;  2R57 A;  4J7I A;  5IN1 A;  1H3Z A;  4XTX A;  5LJ5 e;  4ZGD B;  3DB4 A;  2O4X A;  2FYK A;  2XG8 D;  3QO3 A;  4N0A A;  3OYL A;  2RM4 A;  2QQB A;  4C92 B;  2L8D A;  1Q7Y U;  1KQ1 A;  1S72 T;  1VQ4 A;  3SWN B;  3N5B B;  4A4G A;  3LGF A;  3V8J A;  3OYK A;  4BY6 C;  4ZN1 A;  3MP1 A;  3QG1 A;  5HKC A;  1M90 C;  4PLI A;  5AYF A;  3ZEH A;  4M7A B;  1NJI C;  2XI9 A;  4X34 A;  2K5F A;  3OYY A;  3KBG A;  3L2W A;  4A4E A;  4NOY A;  4MML A;  4M7A F;  4PJO B;  4OF1 A;  2JOY A;  4EDU A;  3CCS A;  4A4K A;  1I81 A;  2PUK B;  2ZZD A;  1M5Q 1;  3CMA A;  3FC3 A;  1NPP A;  2RJF A;  2VYT A;  4M77 D;  4ZTF A;  3JCM P;  1BI3 A;  4B9W A;  4C0F A;  2E6Z A;  2VGM A;  5GAN 3;  3PMT A;  2E6N A;  4LDV A;  1M8V A;  1VUB A;  2HQX A;  2LDM A;  4PL6 A;  4RMO A;  3OYM A;  2GFA A;  3VUB A;  4Y91 A;  1YJN T;  2EQU A;  5A2Q E;  3FB9 A;  3L2V A;  2L89 A;  1X01 A;  4M75 D;  1P92 A;  5GAN e;  4M7D A;  5LJ3 d;  4HT8 A;  4EMH A;  1W2B A;  1QVG S;  5GAN f;  3QPH A;  2KMT A;  5CO7 A;  1JJ2 A;  2MWO A;  2D0Q B;  3RUX A;  3OMG A;  4C8Q C;  5CR2 A;  2WAC A;  4IUQ A;  1ZQ1 A;  3MET A;  1WQ7 A;  1KG1 A;  4JLG A;  1B34 A;  3PTA A;  4EPC A;  3CCV T;  4ZTJ A;  1YJ9 T;  2XHC A;  4OMF B;  3UT1 A;  2EJF A;  3G4S A;  2JN0 A;  3PGG A;  4IKF A;  5GMK l;  2DAQ A;  3S6W A;  3URG A;  3A8H B;  3MEW A;  1XTD A;  1U1T A;  2QXF A;  3A8M B;  4UC4 A;  2CKK A;  4FT2 A;  5LL6 S;  3SD4 A;  2ZPG B;  3VV0 A;  4BB7 A;  2DVE A;  3NFC A;  3C94 A;  3JCM J;  3CD6 A;  2EWN A;  2VUB A;  2MMP A;  3E9F A;  3M53 A;  4D6W A;  2EYQ A;  4EMK A;  2K5I A;  1BIB A;  5CVI A;  4F7U B;  4XQ3 A;  4BDY A;  2R58 A;  4M78 C;  3G71 A;  2LCL A;  2XU8 A;  3CC2 A;  4HA8 A;  4A4F A;  1BYM A;  3M56 A;  5D6X A;  2EJG A;  3JCM e;  4E7L A;  2A7Y A;  2E64 A;  3LGL A;  4J8O A;  3LLR A;  5GAO r;  2DD5 A;  4FIB A;  3JCM f;  1VQO A;  3FRN A;  1NE8 A;  4M7D G;  4RCC A;  4N0A C;  5GAN g;  1VQ7 A;  2RHZ A;  4O6J A;  3SB2 A;  3OMC A;  1FX7 A;  1VQ4 T;  2WSC E;  5GMK h;  3X26 B;  2WSF E;  4M77 G;  5GMK j;  3HSB A;  2DIQ A;  2RJE A;  4JRK A;  2D9T A;  5GAO m;  1YI2 A;  1WNL A;  4XU3 A;  1G3W A;  2CZ0 B;  3UPU A;  2V8K A;  3P8D A;  4Q5W A;  3MP6 A;  4M77 E;  3QJY A;  3GPL A;  1VQ5 A;  2FL7 A;  4C8Q D;  3CCS T;  2LTO A;  2XDP A;  4J6X A;  2K3Y A;  3OYB A;  3P8B B;  2DTH A;  5HK0 A;  1JRI A;  1OI1 A;  3LWH A;  1N8R C;  3CMA T;  4LD9 K;  1UGQ B;  5CKE A;  3JB9 J;  2P0K A;  2KK4 A;  4M75 G;  3OBW A;  2DEQ A;  3JB9 H;  1Y7X A;  2HBP A;  3PIP A;  4KUL A;  3S3M A;  3LW5 E;  3CEY A;  4A4H A;  3WVD B;  1K8A C;  3UWN A;  3OY9 A;  4M75 E;  1XOV A;  3QSU A;  3TU4 K;  1M9S A;  3QJ6 A;  4M7A C;  4IUT A;  4BD3 A;  3PNW C;  3L1A A;  2P4T A;  3MCA B;  3JCM g;  3OS0 A;  4XTU A;  5KH6 A;  3S3O A;  3JB9 I;  4PNO A;  1YIT A;  3QZ9 B;  1U1S A;  5CAI A;  1N27 A;  2PQW A;  2E65 A;  5GAN 4;  1OYX A;  2ZPH B;  4C5G A;  1R8O B;  1Q86 U;  1Y96 B;  4QVC A;  4JRI A;  2P0P A;  4E7K A;  4PLL A;  2VXE A;  1K9M C;  2DO3 A;  3MEV A;  3TEE A;  3A8G B;  3ME9 A;  3QHS A;  3RKW A;  1QVF A;  1VQ8 A;  3INZ A;  3G4S T;  2DPP B;  3I55 A;  5IT9 E;  2KDS A;  2EQM A;  2MF2 A;  3GF5 A;  4GLK A;  3CCJ A;  4EMG A;  3M55 A;  3OB9 A;  3CCU A;  3MEU A;  3CC4 A;  3CBM A;  5CCA A;  2LQ8 A;  3QDR B;  5GAM j;  4KUD K;  3CD6 T;  5KCO A;  2MAM A;  2DTI A;  1FWZ A;  5FRO A;  1NPR A;  4EMK C;  2GCX A;  4M78 A;  3OS2 A;  1KD1 U;  3VYG A;  1KHI A;  3JB9 F;  4ELY C;  2VC8 A;  2DKG A;  4BE1 A;  1D3B B;  3H6Z A;  5CKD A;  1WQW A;  3G71 T;  1QW1 A;  3CC2 T;  1JBM A;  5LJ5 f;  5CQY A;  3FJP A;  1Q81 U;  1G5V A;  4OGE A;  3VUZ A;  1VQO T;  4BE2 A;  2PVG B;  2V8I A;  2DIG A;  3NTH A;  5CQX A;  1AHJ B;  2QDY B;  1MGQ A;  3HRU A;  3JCM V;  3VJP A;  3PIO A;  3L2U A;  1VQ7 T;  2LX9 A;  4C8Q G;  2YHT A;  3QKJ A;  1FXX A;  1G3S A;  2OAU A;  4OVA A;  4C92 F;  1VQK A;  2I2L A;  4MZM A;  1I8F A;  4L5G A;  2XDB A;  1XNI A;  2YLC A;  4HCZ A;  3JCM b;  1YI2 T;  4C8Q E;  4M7D D;  3X25 B;  4Z02 A;  2RD1 A;  4IUU A;  1KQ2 A;  4BI4 A;  4LDU A;  3E19 A;  4OB1 B;  1VQ5 T;  1YJW A;  2FB7 A;  2JUF A;  4IUP A;  4RCB A;  4PJO F;  3E9G A;  3FEO A;  5CKB A;  1YHQ A;  3GP8 A;  1K73 C;  1KQS S;  4LDX A;  5FU7 B;  4C92 A;  4QVD A;  3LYI A;  3L2R A;  4ELZ C;  3CCQ A;  1QVG A;  2EFI A;  3RER A;  3LX7 A;  3QBY A;  3ZFJ A;  4O5V A;  4II1 A;  2DJZ A;  3HRT A;  3OYD A;  1N8R U;  3GIB A;  4M7A A;  4CI0 C;  1XQH A;  3JCM Q;  4OB2 B;  2X35 A;  2CS7 A;  2QTX A;  4FL6 A;  3X28 B;  3DLM A;  5LJ5 g;  1VQN A;  4PJO A;  2K2V A;  5GAM e;  5I2M A;  2IVW A;  1YIT T;  5DY9 A;  3CPW S;  5FLX E;  5GAM f;  1M1G A;  4M7D B;  3BDL A;  5J39 A;  1VQM A;  5LJ3 h;  3X24 B;  3BDU A;  1X75 C;  1TH7 A;  1LNX A;  5LJ3 j;  2M0O A;  1RL2 A;  2DXB A;  2RK2 A;  4HT9 A;  3EAE A;  1DJ7 B;  4XTY A;  5FU6 B;  2EJ9 A;  2MI6 A;  4JS4 A;  1M1K C;  3J7A F;  4M77 B;  4VUB A;  5GAN 2;  1B34 B;  2KAF A;  1LOJ A;  4C0D C;  1VQ8 T;  5C6S A;  4M77 F;  4TVR A;  3OYN A;  2CZ6 B;  3HFO A;  2EQK A;  4LD6 A;  3OYH A;  2ZPB B;  3I55 T;  2ZGW A;  2ZPI B;  3CME A;  4HKE A;  3CCJ T;  5GMK m;  4RG2 A;  3CCU T;  1JB0 E;  2RI2 A;  3CC4 T;  3CCR A;  5FRM A;  1G3T A;  5IAY A;  5KE2 A;  1K9M U;  3SFM A;  2HD0 A;  4OGC A;  2ZPE B;  4M75 B;  2M9U A;  3G7Z A;  4BE0 A;  1EIF A;  2OTL A;  4KUI A;  3MO8 A;  3CCE A;  2L3R A;  4F7U F;  3OYC A;  2MWP A;  3HP9 A;  4XU0 A;  4XU1 A;  2XK0 A;  3MHX A;  4HCB A;  2ZCF B;  1PSE A;  2KY9 A;  2YLB A;  3FDR A;  4J6Y A;  2LC4 A;  4JDS A;  3NTI A;  4N4I A;  2GFU A;  4ME7 A;  5GAM g;  1YCY A;  2GF7 A;  3OYJ A;  3L42 A;  3BY7 A;  1ZBX A;  4L6V 5;  1VQK T;  4M7D E;  5A0G A;  4F7U A;  2E10 A;  2QQS A;  3VU3 C;  1KC8 C;  3V8K A;  3OS5 A;  4BY6 B;  1BI1 A;  3OS1 A;  3RMQ A;  2RA2 A;  1WJR A;  4J7F A;  4LDY A;  3OW2 S;  2JZ2 A;  3LH0 A;  2YRV A;  1YJW T;  2DXC A;  5LJ3 e;  2X4X A;  1YHQ T;  1M90 U;  3A8O B;  5LJ3 f;  1BI2 A;  1NJI U;  4C92 C;  4ZGJ B;  3TRE A;  5L8R E;  2OTJ A;  3CCQ T;  4FU6 A;  2DXT A;  4Y28 E;  3SWN C;  2QEX A;  1NZ9 A;  2DD4 A;  2CZ7 B;  2GQV A;  4KBM B;  5DM7 R;  3HHT B;  2M1H A;  3V8L A;  4JJN K;  3QYH B;  5GMK i;  2K3X A;  1VQN T;  2CYZ B;  2FHD A;  2K4Y A;  1VQ6 A;  2F5K A;  3KXT A;  4PJO C;  4QQ6 A;  3OYE A;  3QXE B;  3HRS A;  3I56 A;  2XIC A;  4M78 D;  1VQM T;  3EFS A;  2VGN A;  5A0D A;  3O8V A;  2PU9 B;  2Y4Y A;  4C8Q B;  5DLO A;  4BDZ A;  3CXC A;  4DQ2 A;  2X4Y A;  4BAC A;  2VXF A;  3M57 A;  3OBY A;  4DOV A;  1O75 A;  4KT0 E;  4XU2 A;  2R5A A;  2DZ9 A;  5C0M A;  4NL3 A;  1PSF A;  2X4W A;  4QQG A;  3UDC A;  3CME T;  2HAX A;  3QYG B;  3PT9 A;  3NTK A;  2FVU A;  3JB9 D;  4BI3 A;  3QII A;  3J80 E;  4J83 A;  3C4S A;  4JLI A;  4WF2 A;  5D6W A;  5GMK e;  3CCR T;  1YIJ A;  4XK8 E;  2DK3 A;  2RJD A;  1UGR B;  1H64 1;  2XKO C;  4XAX B;  3HPW A;  2LVM A;  4MDX A;  4HCC A;  2G3R A;  2X4J A;  5HK3 A;  4DA4 A;  2HNI A;  3OSS C;  2OTL T;  5FRN A;  3GNF B;  2E41 A;  3CCE T;  3HL8 A;  3Q1J A;  4M78 B;  5GAN 5;  3RES A;  3V7R A;  3G6E A;  3J81 E;  3C12 A;  4C92 D;  3GLX A;  3MP8 A;  2O4X B;  1IRE B;  1V29 B;  4OP0 A;  5GAN d;  2PVD B;  3A8L B;  2BKD N;  4E7I A;  2D6F A;  2O01 E;  2DXU A;  2EIF A;  2RHX A;  1N9S A;  3BFM A;  3QZ5 B;  5GAN h;  3CC7 A;  2QQA A;  1UGS B;  3P8H A;  4M7A D;  3M58 A;  4J6W A;  1Q82 C;  2VV5 A;  1U8R A;  4PJO D;  1D3B A;  3WVE B;  5I2S A;  3AHU A;  3M9Q A;  2QA4 A;  3L2Q A;  1VQL A;  4XTW A;  3JAM E;  1N6A A;  4R56 A;  3E1S A;  2RI5 A;  3EFR A;  3JRZ A;  2K57 A;  4BUG A;  3RMS A;  3CCL A;  4MDW A;  1BI0 A;  1OZ3 A;  4MZP A;  3SWN A;  2DZC A;  5GAN 8;  2XDD A;  3CPW A;  2OTJ T;  4M78 G;  4R55 A;  4E7J A;  3A5Z B;  3OYG A;  2AHJ B;  2QEX T;  3JCM c;  4NS5 A;  3KUF A;  5I21 A;  5J3B A;  5D6Y A;  2H3J A;  3DB3 A;  4QQD A;  4M78 E;  4RKU E;  3JCM d;  1VQ6 T;  1UEB A;  4OB0 B;  2RB6 A;  3LWI A;  4NL2 A;  1K8A U;  3SDZ A;  3CCM A;  3I56 T;  3JCM h;  2F5T X;  1Y07 A;  3HKS A;  3PMI A;  5CK9 A;  3JB9 G;  3CBP A;  4M7D F;  2LT4 A;  4PKC C;  1SSF A;  2DTO A;  3GNG A;  1GXI E;  5J26 A;  3C95 A;  4C5E A;  3ZBD A;  3CBO A;  3ASK A;  4JUV A;  3S3N A;  1HK9 A;  4XTZ A;  2NLU A;  2JTF A;  4ZGE B;  1BKB A;  4E47 A;  5CIU A;  4ZN3 A;  1WGS A;  3MEA A;  3OQ5 A;  2LCC A;  4X9D A;  2RHU A;  3CPF A;  1Q86 C;  4OB3 B;  4JRP A;  3FLG A;  2C06 A;  1YIJ T;  4C92 G;  1RI0 A;  2XID A;  2B8A A;  1Y71 A;  1VIE A;  1LJO A;  1WJQ A;  2EQJ A;  2RHI A;  3M59 A;  4M75 F;  5EG2 A;  4EMK B;  4C92 E;  1I5L A;  1UB4 A;  4M77 A;  1VQ9 A;  2Y4X A;  4C0Z A;  4IUR A;  4M7A G;  1UGP B;  3G6E T;  3QUI A;  3V7S A;  4PJO G;  3L2Z A;  1W4S A;  3OSV A;  2CZ1 B;  1W2B S;  5DLQ E;  1VQP A;  2R5M A;  1JJ2 S;  3OYF A;  2QQR A;  1KD1 C;  1QP3 A;  3R6O A;  3OW2 A;  4M7A E;  5KCH A;  4L59 A;  2PVO B;  4C0G A;  4PJO E;  3CC7 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...