4A4FA

Solution structure of spf30 tudor domain in complex with symmetrically dimethylated arginine
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
64
structure length
64
Chain Sequence
ASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SURVIVAL OF MOTOR NEURON-RELATED-SPLICING FACTOR 30
publication title Structural Basis for Dimethyl-Arginine Recognition by the Tudor Domains of Human Smn and Spf30 Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 10
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2011-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4a4fA00
3LH0A 3MP8A 3QBYA 3S3NA 3O8VA 2RI2A 2L8DA 2BIVA 2JTFA 1WJRA 3MEAA 1OYXA 5FRMA 4QQDA 4PLLA 3L2VA 2GFUA 3NTIA 2R58A 3GOXA 3S3OA 5C6SA 5J39A 2MWPA 2R5MA 3OYHA 3MEWA 3META 2X4WA 3NTKA 4B9WA 1WJQA 3PFSA 3FDRA 3MP6A 5FRNA 2L3RA 1MHNA 2MWOA 2EFIA 3NTHA 4IUQA 4EDUA 5M9OA 4B9XA 3OYNA 2PQWA 3E9FA 3SD4A 3OYDA 3S3MA 3OYIA 5J26A 3OS2A 1OZ3A 2XK0A 3FLGA 4BE0A 5C0MA 3OYEA 4C5GA 2RJFA 1RI0A 4BDZA 4RG2A 4IUTA 2DIQA 4IUUA 3PMIA 4BE2A 1WJSA 2RHXA 3LX7A 2LTOA 3OY9A 4A4FA 2EQKA 1OI1A 3DB3A 5KCHA 5D6YA 4IKFA 2YRVA 3P8DA 3MEVA 3OYCA 4FL6A 2X4XA 3OYBA 3FC3A 3PMTA 2EKOA 2HQXA 2RHIA 2RJEA 3M9QA 4QVZA 5KE2A 5KH6A 3OS1A 3OYLA 4QQ6A 3OA6A 2E5QA 3UWNA 2X4YA 3E9GA 2EQJA 4PL6A 4N4IA 5KCOA 3OYKA 4E7JA 2RO0A 4OVAA 2O4XA 3P8HA 3FEOA 3H6ZA 3ASKA 3OMCA 4Q5WA 2IG0A 2D9TA 3UT1A 2DAQA 5CIUA 4Z02A 2B8AA 5IAYA 3OYMA 4BDYA 4ZTJA 4II1A 3BDLA 3QKJA 4GY5A 4A4EA 3C4SA 4IURA 4BD3A 3LLRA 2G3RA 3OYJA 3MEUA 4E7IA 2GFAA 1KHCA 2FHDA 2NLUA 2X35A 4BE1A 2RJCA 4UC4A 2E6NA 2HQEA 5D6XA 4CRIA 2CKKA 4ZTFA 3Q1JA 1H3ZA 3L2RA 3OQ5A 3L2UA 2O4XB 2RHYA 4LD6A 3OYAA 3CEYA 2L89A 2RHUA 3F70A 1XNIA 2RI3A 3L42A 3MO8A 4C5IA 1OZ2A 4IUPA 3ZEHA 2RI5A 4N4GA 2BKDN 2K3YA 2DIGA 1WGSA 4E7LA 3KUFA 3OMGA 2LVMA 2QQRA 2WACA 2LDMA 2LRQA 2BUDA 2M16A 2RHZA 3MP1A 4FU6A 5KE3A 2JZ2A 1SSFA 4X34A 3OYFA 5FROA 3QIIA 2R57A 2F5KA 3QJ6A 1G5VA 1N27A 2QQSA 4QQGA 4A4GA 5D6WA 4QW2A 3H8ZA 4NS5A 2M1HA 5IN1A 4BACA 3EAEA 3LYIA 2RJDA 2XDPA 3OYGA 2VYTA 4A4HA 4C5EA 3LGFA 4E7HA 3L2QA 4L59A 3S6WA 2LCCA 4HCZA 4IUVA 4N4HA 3PNWC 4PLIA 2P0KA 2M0OA 2R5AA 3LGLA 2EQMA 2EQUA 4E7KA 3DB4A 3OB9A 3L2WA 3ME9A 2K3XA 3OS0A 2GF7A 4C5HA 3DLMA
chains in the Genus database with same CATH superfamily
3I56T 1WJRA 5KYYB 1KQ2A 3M4YA 5FU6B 1I81A 2DMOA 4J9DA 2YSQA 3S3OA 3OW2S 2RQTA 2EJGA 2ZAEA 2AKLA 4FT4A 1QVFS 2DXBA 3NGPA 1YI2Q 1VQPA 4DOWA 3BW1A 2XK0A 1M1KU 3CCEQ 4O5VA 3CCRT 3QUIA 4JRQA 3PMIA 1YJWA 3I55T 2KRNA 2DFUA 2OAWA 2EYWA 4M78D 3JCMg 1BCMA 1VQ8A 2YRVA 1JB0E 3MEVA 5A2QE 4BB7A 5GAOl 3M55A 2EJ9A 1W6XA 1QW1A 1VQKQ 1KD1R 2RQUA 2EW3A 1M9SA 2MF2A 2E41A 1YWOA 4M7AB 4HA8A 1YJNA 2ZCFB 4RKUE 2J6OA 3IQLA 1X6OA 1RL2A 1WHHA 4RUGA 1QCNA 1UG1A 1ZX6A 2KT1A 4IURA 4JJNK 2GFAA 4E7SA 4KULA 3EGUA 2E6NA 5A0GA 1UGSB 1QP3A 1X2KA 1PSFA 1F1BB 1VQ6Q 1YIJA 1ZBJA 1N8RC 1RAAB 2DZ9A 2LJ0A 1HJDA 1GRIA 1XTDA 5GMKj 4XU0A 2HKQB 4PKCC 5FU7C 1SHGA 4FU6A 3H41A 2K5LA 4FYYB 2LC4A 3JRZA 1AWXA 2V1RA 2ED1A 5GAMh 3QPHA 3THKA 1Q95G 3CCQT 2QXFA 3TCJA 1D1BA 3CC2T 2JMCA 2EGEA 4L59A 3PNWC 1YJ9A 1D3BA 4FIBA 1U1TA 4E7KA 2EKHA 4PJLA 3OS0A 2GF7A 4JZ3A 3M0TA 4KT0E 2C0OA 2BIVA 3QG1A 2GFUA 2JN0A 3VS4A 1UGQB 2P0PA 2ZGWA 1UGPB 1UHFA 2F5TX 8ATCB 1Y7XA 2DL7A 2VGNA 3OS5A 3CMET 5IHKA 4L5GA 3EFOB 2JVVA 1SRLA 4AFZC 4HCKA 2DD5A 3CCVQ 2DE0X 4XTZA 3AT1B 1Q7YC 3E2UA 5CCAA 2YWWA 4JDSA 1NEGA 3VS1A 1S1NA 3OYCA 4M4ZA 1UDLA 2LX9A 3U23A 1M1KR 1O75A 2EWNA 3VV0A 2EQJA 4M75B 2LQKA 1WQ7A 1Y07A 2MK5A 2BE7D 3PVQA 4BI8B 5GJVB 2O01E 2KROA 1IREB 3CCJA 3GPLA 2M0YA 1AT1B 5IXBA 4M7DE 3X25B 2E3IA 2KNBB 1UGRB 2RHUA 1YCYA 3VS7A 1M2VB 1OZ2A 3JV3A 2VB6A 1K8AU 1SG5A 1X27A 2FPEA 4C0GA 1G8XA 3CPWS 5KE3A 3CC7T 5HK0A 1B07A 5GMKh 1N27A 2L3SA 4XU2A 2DL5A 2DX1A 2XDPA 3VS5A 4PJOB 2CZ1B 4M7DF 4F7UB 1GFDA 2R5AA 2EQUA 3QDFA 1PC0A 4C8QB 4R55A 1KQSS 2VKNA 2QDLA 5LJ3e 3EG2A 2J05A 1C0MA 1GFCA 3O8VA 2QEXT 2QA4Q 2ZPBB 1I5OB 5J3BA 5LJ5j 2QG9B 1K76A 4ZGDB 3GNGA 2AHJB 3PFSA 4F17A 4HT8A 3DKMA 2AK5A 4ZN3A 1MV3A 3E9FA 3G71T 3CBPA 5I2SA 3VS2A 1JJ2S 1Q82U 1KC8C 3H9NA 4M7DG 4J9GA 1ZSZA 1Y57A 2FB7A 2ROLA 1NJIC 3V7CA 4J9CA 4A63B 4QVCA 1ZA2B 3H0IA 1OU9A 2QTXA 2K6DA 2KMTA 1VQ4Q 2DK3A 3EG9B 4N4IA 2FL7A 3I5RA 2JS0A 1C6VX 2JTEA 3ZL7C 2SEMA 2DNUA 4F04B 2DBKA 2K5FA 2B8AA 3HP9A 5LJ5f 2F2WA 2LCSA 4QT7A 5GAOp 4XTWA 1B3QA 4JRIA 2KGTA 3OYJA 3QYGB 3I56Q 3OYYA 3X26B 1QVGA 5GAMe 1AZEA 1UTIA 1XOVA 1HYOA 1YN8A 2KR3A 1SKUB 2CP6A 2RH2A 2COZA 1IXDA 3JCMP 2RQVA 3MO8A 4C5IA 1YHQA 2NWMA 3UA6A 3E19A 4N4GA 5HY6A 3G4ST 1YWPA 2DPPB 1SPKA 2JS2A 1KD1C 4DBRA 4FCYA 5DLQE 4JRPA 3OYFA 3CCUT 2W0ZA 1XJWB 3G7ZA 1OPKA 4LD9K 4RTTA 1BI3A 2E6ZA 3PVLA 4M7DC 1G5VA 2CZ7B 3J80E 2KXDA 1WLPB 2QAZA 2VYTA 3FIFA 1K8AR 1G3YA 4M75A 4M77B 1ZQ1A 4MDWA 1FXXA 2DBMA 3CCLA 4KGVB 1MMAA 4AG2C 3S3NA 2XG8D 1NYGA 4IIOA 4J6XA 1U1SA 3LH0A 1WI7A 2CUDA 4M78B 2RF0A 2HNIA 2EIFA 1BI0A 1PG5B 3V7SA 1R77A 2RB6A 3MEWA 1K73U 1W2BA 3KXTA 3OYNA 2PQWA 2XDDA 3OYIA 4JPBW 2BZ8A 2K4YA 3M54A 2IPOB 3X28B 1W70A 1WQWA 3CC4Q 5CKHA 1FYNA 3RNJA 4WCIA 1M90U 5A0DA 1BU1A 3UATA 5D6YA 3GNFB 1PD0A 1VQNT 1VQ6T 1YCSB 3OA6A 2GNCA 1Q82R 1VIFA 3SB2A 3UT1A 3CCQQ 1GCQC 3QWYA 4CI0C 3UDCA 3A8MB 3OYMA 1E7OA 3J7AF 1NZ9A 1WXBA 4GY5A 2JJ9A 3JCMd 5GANg 4AFQC 1UFFA 4LN2A 2HSPA 4N0AA 3DLLA 4FSSA 2V8JA 5GMKe 5GAN3 4BE1A 4J83A 3RKWA 1TWBA 4OMPA 1ZUKA 3C0CA 2CP0A 5KYUA 4XAXB 4C92E 1XNIA 1AZGB 1W2BP 4IUPA 2WACA 2FYKA 9ATCB 2E70A 2HCKA 3TQ7P 2R57A 1YITQ 3MKDA 1QP2A 1BIBA 4XTYA 1KQ1A 3GIBA 1RAGB 1H641 2ZPGB 1I8FA 2E10A 4PLIA 2KK4A 1KSWA 4C92F 4BY6B 3OB9A 4OB2B 2DYIA 2K3XA 2L3PA 2Z0WA 2HZYA 1Y0MA 1YI2A 2J7IA 4PLLA 5FWCA 2FPFA 2YRDA 1WA7A 3CCEA 2F1LA 4KUIA 2OTLT 1NE8A 2GTOA 3CD6Q 2AKKA 4FW1A 5CKEA 3R6NA 3CXCS 1VQKA 4IUTA 3OW2A 2K7AA 2HQHA 4ANJA 5KCHA 1K73R 3HFNA 1QVFA 1FMKA 4CC7A 2EQIA 2DZCA 1AVZC 3CC7Q 5LJ3j 2KDSA 3G6EQ 4JS5A 1M90R 2O88A 1JXOA 2HEQA 1BI1A 1MNEA 1QMCA 2PVGB 1NYFA 1OULA 3QYHB 4MZMA 3C4SA 1RLQC 1TG0A 2SRCA 4JUVA 3TU4K 4M7DD 2JOYA 1VQOA 1VOMA 2XD0A 3Q1JA 4EMKC 4JRKA 2Y90A 2L0AA 2QA4T 1D0XA 1X69A 4XTUA 4V2SA 3KUFA 1WNLA 5GAN5 1VQMT 3MP1A 3G71Q 1S72A 3JB9I 2LQNA 3OW2P 3KBGA 3WVDB 1I07A 2CZ6B 4BACA 4C92C 3QWXX 5LJ3f 1VIEA 1RLPC 2Y4XA 1QVFP 4IUVA 4RTXA 2GQVA 1D0YA 2COYA 2XI9A 2K2VA 3DLMA 3URGA 4JLGA 3QBYA 4D6WA 1D1AA 4RMOA 2VXFA 2RI2A 2L8DA 5GAMj 3TSWA 2RNAA 5GAN2 2EYZA 1VQ4T 4O6JA 3NTIA 1HD3A 3CCVA 3JB9F 2MWPA 3RDVA 3META 2E3HA 3MP6A 1R8OB 4IIMA 2OTJA 2J6FA 2LNHB 2DLPA 4EMKA 3OSVA 3CCMQ 5KYNA 1NBEB 1K8AC 1VQ5T 2RHXA 4DQ2A 4PJJA 5GAOn 5CO7A 1ZUYA 4GLMA 2IVWA 1Q86C 1RI9A 3G4SQ 4MMKA 2CT4A 5KE2A 2V1QA 2YDLA 2EPDA 3UWNA 3CCUQ 4BI3A 2M9UA 3L2ZA 4C92A 3V8LA 2YUNA 4XU3A 5CK9A 2D6FA 5LJ3h 3CBOA 5GAMf 3LH5A 4M7AE 1U06A 2O9VA 1FWZA 4EIKA 1PKSA 3REBB 2DXCA 1GXIE 4DBFA 4E7IA 1Y71A 4JS4A 1U8RA 2GCXA 1JRIA 2A36A 1N5ZA 4RTYA 1TOVA 2ZZDA 2A0FB 1VQ7A 2NUZA 1RAIB 1OX8A 1EZZB 4OMNA 2RI3A 2EYQA 4MZPA 3WVEB 2JW4A 2K3YA 3CCST 4M7AF 1Q82C 2LVMA 1PNJA 1ZUUA 2LRQA 3SWNB 2K2MA 1RAHB 4X34A 2NUPB 1G3WA 4A4GA 2M1HA 4R0KA 3EG1A 4Y28E 3CC4T 4OMLA 3CPWA 2L3QA 1VQNQ 2VXEA 1W1FA 3EH1A 3QDRB 1IGUA 4CC3A 4ZN1A 3EGXB 5CKFA 4OMQA 4BI4A 5KYXB 1I0CA 4C0DB 2JTFA 3VS0A 4XQ3A 1X6GA 4QQDA 1NEBA 3QJYA 3NPFA 2R58A 1JXMA 5I11A 1KQSA 2FZGB 4IUQA 3CMAQ 1HK9A 2DVEA 4RG2A 3A8GB 2DETA 2FZCB 4AMCA 1BCOA 1ZBXA 3TREA 2MI6A 1ZLMA 2CSQA 4XK8E 1ABOA 1WHMA 2DJZA 1U5SA 3FC3A 1ARKA 2RHIA 2DTHA 1JJ2A 1M3AA 2DL4A 3E9GA 2A3LA 4M75E 4A53A 3I56A 1PWTA 3C94A 4E7ZA 1RAFB 1YITT 5CIUA 1MMDA 4Z02A 5IAYA 4J9EA 3BDLA 4EPCA 5GMKi 2NUTA 5CKDA 3BFMA 2CDTA 3EHQA 3VJPA 2KXCA 1CSKA 4HVVA 5L8RE 3ZFJA 4CRIA 1WXUA 2ABLA 3JCMX 3A8LB 4M7AC 4KH0B 1K73C 3CCRA 2DXUA 4M75F 2JUFA 3QZ5B 3I55A 2OTLQ 1KQSP 1VQLQ 2VC8A 3OMGA 1JO8A 1KHIA 5KYYA 5GANd 1M90C 3QIIA 2VWFA 2F5KA 3V8KA 2KRMA 3M0UA 3CD6T 2LCLA 1FX7A 1LNXA 2KVQG 3D7SB 3VUZA 3L2QA 4PJOE 2RMOA 3LWHA 2YXYA 3C95A 2HAXA 2K5IA 1X01A 1ZSZC 4C8QE 2PUKB 4PFOA 3INZA 2QGGA 3RUXA 4FSXA 4M75G 1NPRA 2V26A 3L2VA 2CH4W 1Q86U 2GBQA 4J7IA 2PZ1A 4ME7A 2PUOB 3SFMA 3G6ET 2CT3A 5CR2A 2X4WA 3NTKA 1TU0B 2CP2A 1YJWQ 3E1SA 3EGDB 1IO6A 4JJBA 1VQ8Q 5J26A 1E6GA 1X43A 4M7AA 4F16A 3PE0A 3SWNA 3OY9A 1OI1A 2JNGA 1AOJA 2KEAA 4RCCA 3H0HA 3CCQA 5FW9A 4PFPA 3CC2A 2HQXA 1VQMQ 1ABQA 4M7DB 4XTVA 1YJNQ 4DBQA 4J9IA 2X4YA 1KIKA 2HBWA 3VS3A 2QYZA 3JCMW 1OX9A 2P84A 4Q5WA 2RPNA 1YP5A 5GAOq 4HCCA 3HTRA 2HL3A 3UPUA 3T9NA 4A4EA 1YIJQ 2FZKB 1QCFA 4M75C 2DA9A 1SHFA 3CMEA 5D6XA 4QKUA 2O4XB 1H8KA 1T0HA 1QWEA 2CP3A 4GBQA 1V1CA 1LCKA 3M4GA 1ZSGA 1B34B 4X9CA 2DRMA 1SSFA 2RN8A 5IXFA 1JU5C 3JB9D 1YJ9Q 2EGAA 2ESWA 1CKAA 3JCMc 5KYWB 1VQ5Q 1VYTA 4NS5A 3OYGA 1I4K1 4KH1B 1GL5A 3CCMT 2QGFB 2KYBA 2M0OA 2P4TA 2LMJA 3UA7A 2EBPA 2WSCE 3EFOA 4M77E 1WYXA 2D1XA 2ENMA 1KJWA 4HXJA 1B7TA 2MOXA 1ZA1B 2HKNA 2ZPEB 6AT1B 2Y4YA 3MPUB 2W10A 3OYHA 4MDXA 2KT8A 3QO3A 4EDUA 1AEYA 2HSEB 4XTXA 5M9OA 4QVDA 1IGQA 3S3MA 1NG2A 4M77F 1Q86R 3EFSA 3CC7A 2RM4A 1BYMA 4IUUA 3G6EA 2K57A 4N0AC 4NOYA 5GJWB 4FL6A 3CCSQ 2EKOA 1VUBA 2X9HA 1TSFA 3CXCA 2K3BA 1OV3A 2OJ2A 1VQ9T 2J6KA 2COWA 1QVGP 2D9TA 2QEXA 1M2VA 3TSZA 1G3TA 1VYVA 4LDWA 4OF1A 3I5SA 3NFCA 2LT1A 4J9BA 2VVKA 3LWIA 2X3XD 3LLRA 3QHSA 1I5LA 1D1CA 1NLOC 4KRTA 3G71A 4PJOA 1QVPA 4ZGJB 3QZ9B 3EGDA 2C0TA 2KRSA 4F7UA 4C8QA 1BIAA 2RHZA 1WHGA 2BZYA 3CMAT 2CREA 2DM1A 4BUGA 3GLXA 4Z89A 3JSCA 2DO3A 1QQJA 2LZ6B 3CXCP 4J8OA 4JLIA 2YRCA 3OSSC 4LUDA 1OU8A 3RMSA 2I2LA 3BDUA 1WHKA 1YFNA 3NHNA 7AT1B 2NYSA 2HL5C 5J39A 1Y96B 3VKIA 2AIRB 2A28A 4M77C 2MWOA 4FYVB 1KK7A 4EMHA 1WXTA 1G2BA 3EG9A 3KFVA 3SD4A 3G4SA 1EIFA 1TXQA 4A4KA 2DD4A 4BDZA 3JAME 3CCUA 1MMGA 4A4FA 1PHTA 3M0QA 3A98A 1BBZA 3SHWA 1UUEA 2X4XA 1QWFA 1T3SA 3SEMA 5I22A 4QVZA 5DY9A 2E5QA 4M75D 2QDYB 3O5ZA 1VQLT 4OVAA 1OOTA 2H3JA 3R6OA 2ROTA 3N5BB 1LJOA 2DAQA 4RTWA 1OQKA 1J3TA 5LJ5g 2YLBA 3HRTA 4BDYA 2B86A 2L5QA 3AHUA 4LXCA 4C92G 1Z9QA 1RUWA 4XU1A 1M1GA 2DF6A 4KUDK 2FHDA 2D8JA 2LNVA 4RG8A 4AG1C 3L2RA 1Z9ZA 4WF2A 4M77A 3GF5A 2X3WD 3F70A 2MYSA 1R0BG 2OX7A 2K9GA 2RI5A 1VQPT 2QQRA 2I0NA 2LDMA 3PGGA 2QQ9A 1VQNA 1VQ6A 2JZ2A 3MJXA 4M78A 5FROA 3VRZA 5HKCA 1YJWT 4QQGA 1BK2A 5IN1A 3CCLQ 2JTMA 3LYIA 2CP7A 1VQ8T 5DM7R 4DBHA 3HKSA 3S6WA 4HCZA 1KFZA 3JCMh 3A1PA 5HCKA 2XHCA 3J81E 3L2WA 3ME9A 1P92A 1V29B 1RAEB 1WZOA 1OYXA 1YJNT 1N9SA 1MGQA 4CC2A 1IZ6A 2R5MA 2QASA 2E1HA 3M0SA 2L2PA 2L3RA 1MHNA 2XMFA 1UGVA 1D3BB 1QKWA 2QTVA 3OS2A 4BE0A 3OYEA 2F2VA 2FG0A 1MNDA 1YIJT 2DIQA 2YUOA 2MAMA 3LX7A 4PJNA 2FEIA 4ORZA 1WHJA 1WIEA 2H3EB 2KY9A 2GQIA 2RJEA 3M9QA 3OS1A 4DEYA 4MMLA 3UF4A 1O9SA 4PL6A 3TEEA 3OYKA 3P8HA 1JEGA 4OB3B 1WHLA 1VYUA 2GGRA 2YUQA 1YJ9T 2DL3A 3M56A 4WTOB 2V8IA 3HSBA 3RIRA 5FLXE 2CS7A 1UHCA 5FU7B 4E47A 5I21A 1LPLA 2OTLA 1KG1A 1R0CB 2RK2A 4NL2A 1Y96A 3CQTA 1LVKA 4L6V5 1Q81U 3FJPA 3FJ5A 4PNOA 3OBWA 2BE9B 3REAB 2L89A 1M3CA 3JB9G 4RCBA 2AZSA 1WGSA 2DIGA 3M59A 1M5Q1 1PD1A 4ZGEB 5GAOr 2F2XA 2X51A 2ZPFB 4QW2A 1IRXA 2KAFA 2LJ1A 1TS9A 2E64A 1TTHB 3G1JA 4J7FA 4LDXA 4M77D 5GAN4 3LGLA 1OEBA 1W4SA 3PIOA 1A0NB 4RTZA 2HBPA 1H92A 3MP8A 1VQ9Q 1M3BA 2ED0A 2DYBA 1PRLC 2D0QB 3VRYA 3CCJT 2MMPA 4B9WA 5FRNA 4HCBA 1WJQA 3FDRA 1K9AA 2QA4A 2RQRA 4PFZA 1SEMA 3L1AA 1NM7A 3MCAB 2RK1A 4B9XA 1G83A 3JCMb 1LOJA 1VQMA 1K4US 4OMMA 2RJFA 2P0QA 2O9SA 3TVTA 2LQ8A 1TUDA 2QQBA 2A08A 2DKGA 4M7AG 3OYLA 2X4JA 3BE3A 1UJ0A 3ER0A 2VASA 1C1AA 1E6HA 3RKYA 1YNZA 2IG0A 4F14A 1X2QA 2YLCA 1ZSZB 1VQ4A 1VQOQ 5FU6C 4KBMB 5FWBA 5A0LA 3M0PA 4ELYC 2G3RA 4UC4A 5ECAA 4FM4B 1S72Q 3OQ5A 5GMKm 4LD6A 2PVOB 3V7RA 1VQ5A 4OB0B 3JCMe 4DEXA 4FYXB 2PU9B 3HHTB 3CPWP 4E7LA 2YUPA 1I1JA 1Q81R 1M27C 3CBMA 1K9MU 2QQSA 4RTUA 5LJ3g 3EAEA 3LGFA 4A54A 2MPXC 3RMQA 5D7UA 4P5NA 4C92D 3VS6A 2CSIA 2EAYA 2V8KA 2JXBA 4LUEA 3SWNC 1OPLA 2OTJQ 4JJCA 2KBTA 4DOVA 2AZVA 1K1ZA 2OI3A 3HRSA 5GANj 2E4HA 3PTAA 2EFIA 4X1VA 3CCSA 1JJ2P 5IT9E 4F7UE 2DTOA 5C0MA 1JBMA 4C0DC 1RI0A 4Y92A 2EQKA 1YHQT 3EFRA 3EG3A 3M58A 4LDVA 1VA7A 2D8HA 4IKFA 1VQPQ 3OYBA 2ATCB 3CC4A 1SRMA 2VUBA 4QQ6A 4OB1B 4X9DA 5IH2A 4E7JA 2RO0A 4PJOF 1D09B 3FEOA 3ASKA 3FB9A 3I9QA 3OMCA 4HVWA 2JM9A 4K11A 4F7UF 5GAMg 5I2MA 4J5YA 2CH4A 4DA4A 4C8QF 4ZTJA 3CCLT 1AWJA 1VQ7Q 2NUPA 5GANf 2JMAA 2QQAA 1PKTA 4Z88A 4HVUA 3VYGA 2O2OA 3PT9A 2HQEA 2CKKA 5LL6S 3OYAA 3CEYA 3EG0A 2LT4A 2G6FX 1AD5A 1GBQA 1V76A 4LNPA 3ULRB 4LDYA 3EGXA 5LJ5d 3C12A 2XDBA 4PJOG 2M16A 5KYXA 1HSQA 4E6RA 4JJDA 3H0FA 2BZXA 4F7UG 2EVRA 3SDZA 5D6WA 4C8QG 3LW5E 4A4HA 2E5KA 5CKBA 5KYUB 2DILA 1YITA 1UJYA 3ZBDA 1K9MR 4HKEA 1RACB 2AT1B 5CVIA 1JQQA 4C5HA 3PIPA 2DL8A 2E12A 2VGMA 1K0SA 5IHNA 1N9RA 1ACMB 1TH7A 2RA2A 5GAN8 4Y91A 4J6YA 1WDXA 2EJFA 1UECA 2HMAA 2CP5A 4JZ4A 3RESA 1T0JA 3OBYA 2F69A 5GANh 1BKBA 1N8RU 3OYDA 2EGCA 1CKBA 1IHVA 1G3SA 4FYWB 5GAN6 1WJSA 2FRYA 1NLPC 4OGCA 3CD6A 4D8DA 4M78E 3HL8A 8AT1B 4PJOC 2EYYA 2IIMA 3VUBA 2DEUA 3HRUA 1ZHIA 4C0ZA 1SSHA 5DLOA 4C8QC 3H6ZA 1AHJB 5L23A 3CPFA 4Z8AA 3FRNA 1QKXA 2LQWA 1RABB 4II1A 3WXMB 3CCRQ 3QSUA 4PK4A 3MEUA 4M78F 3I55Q 1YI2T 1SF9A 2FRWA 4KGZB 2KI7A 1EX4A 2X35A 4LE9A 2RJCA 3CCET 5AYFA 2DJQA 5EC7A 5GAOm 2PVDB 1U3OA 2RHYA 3L2UA 3CCJQ 4C0FA 1H3HA 2A37A 4M7AD 3ZEHA 2BKDN 1Q7YU 1X6BA 2QI2A 3I35A 2C06A 3BY7A 3QXEB 1VQKT 2ZPIB 1M8VA 4M77G 2RD1A 2PTKA 1NPPA 1M2OA 3H8ZA 4EMGA 2DERA 1TUCA 4HT9A 5LJ5h 1WPYA 2YT6A 4C5EA 4E7HA 2D0NA 2CUBA 4J9HA 2P0KA 4M78G 4GLKA 5CAIA 5CQXA 2FPDA 4NL3A 2E65A 5HK3A 4B6MA 3MEAA 2MIOA 2DTIA 4MZTA 3RKXA 5EG2A 2CGHA 5C6SA 1K0XA 2C0IA 5GAN7 4M7DA 1Q81C 4OMFB 1DJ7B 4AT1B 1VQOT 3JCMV 1OZ3A 4VUBA 3FLGA 3CC2Q 2DVJA 1MV0B 1WX6A 2LTOA 4PJMA 2LP5A 3JCMQ 1PSEA 2WSFE 1N8RR 3PMTA 2CYZB 5GMKl 3CCMA 1S72T 2MCNA 5KH6A 2KSSA 3M57A 2CZ0B 1PCXA 4ELZC 3HPWA 2ZPHB 5KCOA 2O4XA 2YHTA 3RERA 4KGXB 4EMKB 1QVGS 1M30A 5CQYA 1M1KC 4M78C 4LDUA 1B34A 3CMEQ 2GTJA 2VV5A 3QKJA 1GCPA 4AFSC 4BD3A 3JCMf 2XKOC 1KHCA 1BB9A 2QK0A 5KYWA 2NLUA 2KQWA 4ZTFA 3CCVT 4C92B 2HDAA 2KYMA 3X20B 1FMWA 2WSEE 2OTJT 2DXTA 4RTVA 2KE9A 2XICA 1UEBA 1PRMC 3L42A 3RR6A 1FMVA 3EHRA 1KC8U 3MHXA 4FW2A 1QCOA 4ATOA 3GBQA 3JB9J 1GCQA 1PM3A 2J06A 1UB4A 1NJIU 3QJ6A 2P4RA 4CC4B 2OAUA 1EFNA 1YHQQ 2RQWA 1VQ9A 1Q7YR 4N4HA 2EQMA 4ZNXA 2K79A 5GANe 3A5ZB 3HFOA 1W2BS 4R56A 1UE9A 5FRMA 3VU3C 2FO0A 1M4ZA 3RBBB 2O31A 3GOXA 5LJ3d 2M51A 4AFUC 2FVUA 4PJOD 3NTHA 2JT4A 4TVRA 1N6AA 1XQHA 3P8BB 4D8KA 4OGEA 1AWWA 1VQ7T 5AT1B 1MMNA 2LJ3A 4C8QD 4C5GA 1TUGB 1KD1U 4BE2A 1MUZA 3NMZC 3CMAA 1AWOA 2DRKA 3DB3A 1BI2A 1K9MC 3P8DA 1WFWA 2QEXQ 1YBYA 2DEQA 2EYXA 1M1FA 2PNIA 4BY6C 2BTTA 3VYHB 2LX7A 2M02A 3X24B 2XIDA 3JCMJ 3JB9H 3M53A 1D0ZA 3M5AA 1H3ZA 2A7YA 5LJ5e 4OP0A 5IHIA 1IB8A 4ESRA 3EH2A 1X75C 5GAMd 3A8HB 3V8JA 1GBRA 1M8MA 4OMOA 2XU8A 4YTLA 3M0RA 1T3LA 2BUDA 4J6WA 1HXDA 2NUTB 1QLYA 3A8OB 2RJDA 1VQLA 1KC8R 1IHWA 2H8HA 4E2FB 4J9FA 2LCCA 2ECZA 3GP8A 1RADB 3DB4A 4FT2A 1NJIR 2JM8A 2HD0A
chains in the Genus database with same CATH topology
3I56T 1WJRA 4DOVA 1YI2A 1KQ2A 4PLLA 3M4YA 5FU6B 1I81A 2ZPEB 2Y4YA 3CCEA 3S3OA 3OW2S 3HRSA 5GANj 2EJGA 3OYHA 4MDXA 4KUIA 2OTLT 1NE8A 3PTAA 3QO3A 2EFIA 4FT4A 4EDUA 1QVFS 2DXBA 4XTXA 5M9OA 4QVDA 1VQPA 3CCSA 3S3MA 4DOWA 3BW1A 5IT9E 4F7UE 2XK0A 2DTOA 4M77F 5CKEA 5C0MA 1JBMA 4C0DC 3EFSA 1M1KU 4O5VA 3CCRT 3CXCS 1RI0A 3CC7A 2RM4A 3QUIA 4JRQA 4IUTA 1VQKA 3OW2A 4IUUA 3PMIA 1BYMA 1YJWA 3I55T 3G6EA 2EQKA 1YHQT 2K57A 3EFRA 3M58A 4N0AC 4LDVA 4M78D 3JCMg 5KCHA 3HFNA 1VQ8A 4IKFA 2YRVA 1JB0E 3MEVA 4NOYA 4FL6A 5A2QE 1QVFA 4BB7A 5GAOl 3M55A 3OYBA 2EKOA 1VUBA 3CC4A 2VUBA 2DZCA 4QQ6A 2EJ9A 1QW1A 4OB1B 3CXCA 4X9DA 5LJ3j 2KDSA 4E7JA 1VQ9T 1M9SA 2MF2A 2RO0A 4PJOF 4JS5A 3FEOA 3ASKA 3FB9A 3OMCA 2D9TA 2E41A 2QEXA 1BI1A 4M7AB 4F7UF 5GAMg 5I2MA 2PVGB 4J5YA 1G3TA 4HA8A 1YJNA 2ZCFB 4RKUE 4LDWA 4OF1A 3QYHB 4C8QF 4DA4A 4ZTJA 3NFCA 1X6OA 3CCLT 4MZMA 1RL2A 2LT1A 5GANf 3C4SA 4IURA 3LWIA 3LLRA 2QQAA 4JJNK 4JUVA 2GFAA 3QHSA 1I5LA 3TU4K 3VYGA 4M7DD 4KULA 2JOYA 3G71A 3PT9A 1VQOA 2E6NA 2HQEA 5A0GA 4PJOA 1QVPA 1UGSB 2CKKA 3Q1JA 1QP3A 5LL6S 4ZGJB 4EMKC 2XD0A 1PSFA 3QZ9B 4F7UA 4JRKA 2Y90A 3CEYA 3OYAA 1YIJA 2LT4A 2QA4T 1N8RC 2DZ9A 4C8QA 1XTDA 4LDYA 5GMKj 4XU0A 5LJ5d 4PKCC 4XTUA 4V2SA 3KUFA 3C12A 1BIAA 1WNLA 5FU7C 5GAN5 4PJOG 1VQMT 2M16A 3MP1A 4FU6A 2XDBA 2RHZA 2K5LA 1S72A 3JB9I 2LC4A 3JRZA 4F7UG 3KBGA 3SDZA 3WVDB 5GAMh 3CMAT 3QPHA 2CZ6B 5D6WA 4BACA 4C8QG 4C92C 5LJ3f 3LW5E 4BUGA 1VIEA 3GLXA 2QXFA 3TCJA 4A4HA 2Y4XA 5CKBA 3CCQT 3CC2T 4L59A 4IUVA 3PNWC 3JSCA 1YITA 2GQVA 1YJ9A 1D3BA 2DO3A 4FIBA 1U1TA 3ZBDA 4E7KA 2XI9A 2K2VA 4HKEA 5CVIA 3OS0A 2GF7A 4J8OA 4JLIA 4C5HA 3DLMA 3PIPA 3URGA 3OSSC 4JLGA 3QBYA 4D6WA 2E12A 4KT0E 3RMSA 2VGMA 2RI2A 2L8DA 2BIVA 2VXFA 5GAMj 4RMOA 1N9RA 2I2LA 3BDUA 1TH7A 2RA2A 3QG1A 4Y91A 5GAN8 5GAN2 1VQ4T 2GFUA 3NTIA 4O6JA 2JN0A 1UGQB 2P0PA 2ZGWA 1UGPB 1Y96B 2MWPA 4J6YA 3VKIA 5J39A 3CCVA 3JB9F 3META 2F5TX 4M77C 3MP6A 1R8OB 2EJFA 2MWOA 2OTJA 1Y7XA 3RESA 4EMHA 3OBYA 2F69A 2VGNA 3OS5A 1BKBA 5GANh 3SD4A 3OYDA 4L5GA 3G4SA 3CMET 1N8RU 1EIFA 2JVVA 4EMKA 3OSVA 1G3SA 4A4KA 2DD4A 2DD5A 5GAN6 4BDZA 3JAME 4XTZA 3CCUA 1WJSA 2RHXA 4DQ2A 1K8AC 1Q7YC 1VQ5T 4A4FA 5GAOn 4OGCA 5CO7A 3CD6A 5CCAA 4JDSA 2IVWA 4M78E 3HL8A 3OYCA 1Q86C 2X4XA 4PJOC 2LX9A 4MMKA 3VUBA 5KE2A 4QVZA 3HRUA 1ZHIA 1O75A 5DY9A 2EWNA 3VV0A 2E5QA 3UWNA 4C0ZA 2EQJA 4BI3A 2M9UA 3L2ZA 2QDYB 4M75B 4M75D 4C92A 2LQKA 1WQ7A 3V8LA 4C8QC 5DLOA 4OVAA 4XU3A 1VQLT 1Y07A 3H6ZA 2H3JA 5CK9A 3R6OA 1AHJB 3N5BB 2D6FA 1LJOA 3CPFA 5LJ3h 2DAQA 3CBOA 5GAMf 4M7AE 3FRNA 1FWZA 5LJ5g 4BI8B 2YLBA 3HRTA 4BDYA 2O01E 2DXCA 1IREB 2L5QA 4II1A 3WXMB 3CCJA 3AHUA 3GPLA 1GXIE 4C92G 3QSUA 4XU1A 1M1GA 4KUDK 4E7IA 3MEUA 4M78F 1YI2T 1Y71A 2FHDA 4JS4A 1U8RA 2GCXA 2X35A 1JRIA 2RJCA 2LNVA 4M7DE 4RG8A 3X25B 3CCET 5AYFA 2ZZDA 1VQ7A 3L2RA 5GAOm 2PVDB 3L2UA 2RHYA 4WF2A 4M77A 3GF5A 1UGRB 2RHUA 3F70A 1YCYA 4C0FA 2RI3A 2EYQA 4MZPA 3WVEB 4M7AD 1OZ2A 3ZEHA 2RI5A 1K8AU 2BKDN 2K3YA 3CCST 1VQPT 1Q7YU 4M7AF 1Q82C 2LVMA 2QQRA 2QI2A 4C0GA 3CPWS 2C06A 2LDMA 2LRQA 3SWNB 3PGGA 2QQ9A 1VQNA 5KE3A 1VQ6A 2JZ2A 3BY7A 3QXEB 4M78A 4X34A 5FROA 5HK0A 2ZPIB 5GMKh 1VQKT 3CC7T 1M8VA 4M77G 5HKCA 1YJWT 1G3WA 1N27A 2RD1A 4QQGA 4A4GA 1NPPA 3H8ZA 5IN1A 2M1HA 4EMGA 4HT9A 2JTMA 3LYIA 4XU2A 5LJ5h 1WPYA 2XDPA 1VQ8T 4PJOB 2CZ1B 4C5EA 5DM7R 4E7HA 3HKSA 3S6WA 4HCZA 4M7DF 4Y28E 3CC4T 2P0KA 4F7UB 3CPWA 2R5AA 2VXEA 4M78G 3JCMh 2EQUA 4GLKA 5CAIA 5CQXA 2XHCA 3J81E 3QDRB 4C8QB 3L2WA 3ME9A 4ZN1A 4R55A 1P92A 5CKFA 4NL3A 2E65A 1KQSS 1V29B 5HK3A 5LJ3e 4BI4A 3O8VA 2QEXT 4C0DB 2JTFA 2ZPBB 3MEAA 1OYXA 2DTIA 4MZTA 4XQ3A 4QQDA 5J3BA 5LJ5j 1YJNT 3QJYA 3RKXA 5EG2A 2CGHA 2R58A 1N9SA 4ZGDB 1MGQA 3GNGA 5C6SA 2AHJB 1IZ6A 2R5MA 5GAN7 4M7DA 2E1HA 3PFSA 2L3RA 1MHNA 1Q81C 4OMFB 4HT8A 3DKMA 4ZN3A 1KQSA 1DJ7B 4IUQA 1HK9A 1D3BB 2DVEA 3E9FA 3G71T 1VQOT 3CBPA 3JCMV 5I2SA 1OZ3A 4VUBA 3FLGA 3OS2A 3OYEA 4BE0A 1JJ2S 1Q82U 1KC8C 4RG2A 1YIJT 3A8GB 2DIQA 4M7DG 2MAMA 3LX7A 2LTOA 3JCMQ 1ZBXA 3TREA 2MI6A 1PSEA 2FB7A 2WSFE 2KY9A 4XK8E 2DJZA 1NJIC 3V7CA 3FC3A 3PMTA 2CYZB 4QVCA 5GMKl 3CCMA 1S72T 2RHIA 2RJEA 3M9QA 5KH6A 2DTHA 2KSSA 3M57A 3OS1A 2QTXA 4MMLA 2CZ0B 1JJ2A 2KMTA 1O9SA 3E9GA 2DK3A 4ELZC 2A3LA 4PL6A 3TEEA 3HPWA 2ZPHB 2FL7A 4N4IA 5KCOA 3OYKA 2O4XA 2YHTA 3P8HA 4M75E 4A53A 3RERA 4OB3B 3I56A 4EMKB 1QVGS 3C94A 5CQYA 1M1KC 1YITT 5CIUA 1YJ9T 2K5FA 3M56A 4M78C 4LDUA 1B34A 2B8AA 3HP9A 4Z02A 5IAYA 5LJ5f 2V8IA 3BDLA 2VV5A 4EPCA 3RIRA 3QKJA 4XTWA 5FLXE 2CS7A 5GMKi 5GAOp 3HSBA 5FU7B 4E47A 5I21A 2OTLA 4JRIA 4BD3A 5CKDA 3JCMf 1KG1A 3OYJA 2RK2A 2XKOC 3BFMA 3QYGB 1KHCA 1Y96A 4NL2A 3OYYA 2NLUA 2KQWA 3VJPA 3X26B 4L6V5 1Q81U 1QVGA 5GAMe 5L8RE 3FJPA 3ZFJA 4CRIA 4ZTFA 1XOVA 3JCMX 3CCVT 4C92B 3A8LB 4PNOA 4M7AC 3OBWA 1K73C 3X20B 3CCRA 2DXUA 2WSEE 2L89A 2RH2A 2OTJT 2DXTA 4M75F 2JUFA 2XICA 3JCMP 3JB9G 1UEBA 3L42A 3MO8A 3QZ5B 4C5IA 4RCBA 3I55A 1YHQA 3MHXA 1KC8U 4ATOA 3E19A 4N4GA 1WGSA 2DIGA 3M59A 5HY6A 3G4ST 2DPPB 2VC8A 3OMGA 3JB9J 1KD1C 1M5Q1 1KHIA 5DLQE 5GANd 1UB4A 3OYFA 4JRPA 1M90C 3QIIA 1NJIU 3V8KA 2F5KA 3CCUT 3QJ6A 3G7ZA 4M7DC 4LD9K 1G5VA 1BI3A 2E6ZA 4ZGEB 5GAOr 2OAUA 3CD6T 2CZ7B 4QW2A 2ZPFB 3J80E 2LCLA 2KAFA 1VQ9A 2VYTA 3FIFA 1FX7A 1LNXA 1G3YA 2E64A 2KVQG 4M75A 4J7FA 4N4HA 3VUZA 3L2QA 4PJOE 4LDXA 4M77D 4M77B 1ZQ1A 5GAN4 3LWHA 3LGLA 4MDWA 1FXXA 2EQMA 1W4SA 3PIOA 3C95A 3CCLA 5GANe 2HAXA 2K5IA 1X01A 3A5ZB 3HFOA 3S3NA 2XG8D 4C8QE 4J6XA 2HBPA 1U1SA 2PUKB 3LH0A 4R56A 3INZA 1W2BS 3MP8A 3RUXA 4FSXA 5FRMA 4M78B 4M75G 2HNIA 1NPRA 2EIFA 3VU3C 1BI0A 3L2VA 2D0QB 1Q86U 1M4ZA 4J7IA 3CCJT 2MMPA 4ME7A 2PUOB 3SFMA 5LJ3d 3V7SA 5CR2A 3G6ET 3GOXA 2RB6A 3MEWA 4B9WA 2X4WA 3NTKA 4HCBA 1WJQA 5FRNA 3FDRA 2FVUA 2QA4A 4PJOD 1K73U 3NTHA 1W2BA 3E1SA 3KXTA 3L1AA 3OYNA 3MCAB 2RK1A 2PQWA 4TVRA 1N6AA 4B9XA 2XDDA 1XQHA 3P8BB 3JCMb 3OYIA 1LOJA 2K4YA 5J26A 1VQMA 3M54A 4OGEA 1VQ7T 3X28B 4M7AA 4C8QD 4C5GA 1WQWA 2RJFA 1KD1U 5CKHA 4BE2A 2P0QA 3SWNA 3OY9A 3CMAA 1M90U 1OI1A 2JNGA 5A0DA 4RCCA 3DB3A 2LQ8A 1BI2A 5D6YA 3P8DA 3CCQA 1K9MC 3CC2A 3GNFB 1VQNT 2HQXA 1VQ6T 2QQBA 1YBYA 2DEQA 2DKGA 4XTVA 4M7AG 4M7DB 3OYLA 3OA6A 2X4JA 3ER0A 1M1FA 2X4YA 3RKYA 1VIFA 3SB2A 3JCMW 4BY6C 4Q5WA 2IG0A 3UT1A 5GAOq 4HCCA 4CI0C 3UDCA 2YLCA 3A8MB 3OYMA 1VQ4A 3UPUA 3T9NA 1NZ9A 3J7AF 5FU6C 4GY5A 3JCMd 4A4EA 5GANg 3VYHB 4KBMB 5A0LA 3DLLA 4N0AA 3X24B 2XIDA 2G3RA 4ELYC 3JCMJ 3JB9H 2V8JA 3M53A 5GMKe 5GAN3 4M75C 3CMEA 4BE1A 4UC4A 4J83A 3M5AA 3RKWA 5D6XA 1H3ZA 2A7YA 5LJ5e 4OP0A 4FM4B 3OQ5A 2O4XB 4LD6A 5GMKm 2PVOB 4XAXB 4C92E 3V7RA 1VQ5A 1XNIA 1X75C 4OB0B 5GAMd 3JCMe 3A8HB 3V8JA 3M4GA 4IUPA 2PU9B 1B34B 3HHTB 2XU8A 4YTLA 4E7LA 4X9CA 2WACA 2FYKA 2BUDA 4J6WA 1HXDA 3CBMA 1SSFA 1K9MU 2E70A 2R57A 3JB9D 1QP2A 3A8OB 2QQSA 3JCMc 1BIBA 4XTYA 5LJ3g 4NS5A 1KQ1A 3GIBA 3EAEA 2RJDA 1VQLA 3OYGA 1I4K1 1H641 3LGFA 2ZPGB 4A54A 3RMQA 1I8FA 3CCMT 2LCCA 2E10A 4PLIA 4P5NA 4C92D 2M0OA 2P4TA 2EAYA 2KK4A 3GP8A 2WSCE 4M77E 4C92F 2V8KA 3DB4A 4FT2A 4BY6B 3OB9A 4OB2B 3SWNC 2K3XA 2HD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LH0 A;  3MP8 A;  3QBY A;  3S3N A;  3O8V A;  2RI2 A;  2L8D A;  2BIV A;  2JTF A;  1WJR A;  3MEA A;  1OYX A;  5FRM A;  4QQD A;  4PLL A;  3L2V A;  2GFU A;  3NTI A;  2R58 A;  3GOX A;  3S3O A;  5C6S A;  5J39 A;  2MWP A;  2R5M A;  3OYH A;  3MEW A;  3MET A;  2X4W A;  3NTK A;  4B9W A;  1WJQ A;  3PFS A;  3FDR A;  3MP6 A;  5FRN A;  2L3R A;  1MHN A;  2MWO A;  2EFI A;  3NTH A;  4IUQ A;  4EDU A;  5M9O A;  4B9X A;  3OYN A;  2PQW A;  3E9F A;  3SD4 A;  3OYD A;  3S3M A;  3OYI A;  5J26 A;  3OS2 A;  1OZ3 A;  2XK0 A;  3FLG A;  4BE0 A;  5C0M A;  3OYE A;  4C5G A;  2RJF A;  1RI0 A;  4BDZ A;  4RG2 A;  4IUT A;  2DIQ A;  4IUU A;  3PMI A;  4BE2 A;  1WJS A;  2RHX A;  3LX7 A;  2LTO A;  3OY9 A;  4A4F A;  2EQK A;  1OI1 A;  3DB3 A;  5KCH A;  5D6Y A;  4IKF A;  2YRV A;  3P8D A;  3MEV A;  3OYC A;  4FL6 A;  2X4X A;  3OYB A;  3FC3 A;  3PMT A;  2EKO A;  2HQX A;  2RHI A;  2RJE A;  3M9Q A;  4QVZ A;  5KE2 A;  5KH6 A;  3OS1 A;  3OYL A;  4QQ6 A;  3OA6 A;  2E5Q A;  3UWN A;  2X4Y A;  3E9G A;  2EQJ A;  4PL6 A;  4N4I A;  5KCO A;  3OYK A;  4E7J A;  2RO0 A;  4OVA A;  2O4X A;  3P8H A;  3FEO A;  3H6Z A;  3ASK A;  3OMC A;  4Q5W A;  2IG0 A;  2D9T A;  3UT1 A;  2DAQ A;  5CIU A;  4Z02 A;  2B8A A;  5IAY A;  3OYM A;  4BDY A;  4ZTJ A;  4II1 A;  3BDL A;  3QKJ A;  4GY5 A;  4A4E A;  3C4S A;  4IUR A;  4BD3 A;  3LLR A;  2G3R A;  3OYJ A;  3MEU A;  4E7I A;  2GFA A;  1KHC A;  2FHD A;  2NLU A;  2X35 A;  4BE1 A;  2RJC A;  4UC4 A;  2E6N A;  2HQE A;  5D6X A;  4CRI A;  2CKK A;  4ZTF A;  3Q1J A;  1H3Z A;  3L2R A;  3OQ5 A;  3L2U A;  2O4X B;  2RHY A;  4LD6 A;  3OYA A;  3CEY A;  2L89 A;  2RHU A;  3F70 A;  1XNI A;  2RI3 A;  3L42 A;  3MO8 A;  4C5I A;  1OZ2 A;  4IUP A;  3ZEH A;  2RI5 A;  4N4G A;  2BKD N;  2K3Y A;  2DIG A;  1WGS A;  4E7L A;  3KUF A;  3OMG A;  2LVM A;  2QQR A;  2WAC A;  2LDM A;  2LRQ A;  2BUD A;  2M16 A;  2RHZ A;  3MP1 A;  4FU6 A;  5KE3 A;  2JZ2 A;  1SSF A;  4X34 A;  3OYF A;  5FRO A;  3QII A;  2R57 A;  2F5K A;  3QJ6 A;  1G5V A;  1N27 A;  2QQS A;  4QQG A;  4A4G A;  5D6W A;  4QW2 A;  3H8Z A;  4NS5 A;  2M1H A;  5IN1 A;  4BAC A;  3EAE A;  3LYI A;  2RJD A;  2XDP A;  3OYG A;  2VYT A;  4A4H A;  4C5E A;  3LGF A;  4E7H A;  3L2Q A;  4L59 A;  3S6W A;  2LCC A;  4HCZ A;  4IUV A;  4N4H A;  3PNW C;  4PLI A;  2P0K A;  2M0O A;  2R5A A;  3LGL A;  2EQM A;  2EQU A;  4E7K A;  3DB4 A;  3OB9 A;  3L2W A;  3ME9 A;  2K3X A;  3OS0 A;  2GF7 A;  4C5H A;  3DLM A; 
#chains in the Genus database with same CATH topology
 3I56 T;  1WJR A;  5KYY B;  1KQ2 A;  3M4Y A;  5FU6 B;  1I81 A;  2DMO A;  4J9D A;  2YSQ A;  3S3O A;  3OW2 S;  2RQT A;  2EJG A;  2ZAE A;  2AKL A;  4FT4 A;  1QVF S;  2DXB A;  3NGP A;  1YI2 Q;  1VQP A;  4DOW A;  3BW1 A;  2XK0 A;  1M1K U;  3CCE Q;  4O5V A;  3CCR T;  3QUI A;  4JRQ A;  3PMI A;  1YJW A;  3I55 T;  2KRN A;  2DFU A;  2OAW A;  2EYW A;  4M78 D;  3JCM g;  1BCM A;  1VQ8 A;  2YRV A;  1JB0 E;  3MEV A;  5A2Q E;  4BB7 A;  5GAO l;  3M55 A;  2EJ9 A;  1W6X A;  1QW1 A;  1VQK Q;  1KD1 R;  2RQU A;  2EW3 A;  1M9S A;  2MF2 A;  2E41 A;  1YWO A;  4M7A B;  4HA8 A;  1YJN A;  2ZCF B;  4RKU E;  2J6O A;  3IQL A;  1X6O A;  1RL2 A;  1WHH A;  4RUG A;  1QCN A;  1UG1 A;  1ZX6 A;  2KT1 A;  4IUR A;  4JJN K;  2GFA A;  4E7S A;  4KUL A;  3EGU A;  2E6N A;  5A0G A;  1UGS B;  1QP3 A;  1X2K A;  1PSF A;  1F1B B;  1VQ6 Q;  1YIJ A;  1ZBJ A;  1N8R C;  1RAA B;  2DZ9 A;  2LJ0 A;  1HJD A;  1GRI A;  1XTD A;  5GMK j;  4XU0 A;  2HKQ B;  4PKC C;  5FU7 C;  1SHG A;  4FU6 A;  3H41 A;  2K5L A;  4FYY B;  2LC4 A;  3JRZ A;  1AWX A;  2V1R A;  2ED1 A;  5GAM h;  3QPH A;  3THK A;  1Q95 G;  3CCQ T;  2QXF A;  3TCJ A;  1D1B A;  3CC2 T;  2JMC A;  2EGE A;  4L59 A;  3PNW C;  1YJ9 A;  1D3B A;  4FIB A;  1U1T A;  4E7K A;  2EKH A;  4PJL A;  3OS0 A;  2GF7 A;  4JZ3 A;  3M0T A;  4KT0 E;  2C0O A;  2BIV A;  3QG1 A;  2GFU A;  2JN0 A;  3VS4 A;  1UGQ B;  2P0P A;  2ZGW A;  1UGP B;  1UHF A;  2F5T X;  8ATC B;  1Y7X A;  2DL7 A;  2VGN A;  3OS5 A;  3CME T;  5IHK A;  4L5G A;  3EFO B;  2JVV A;  1SRL A;  4AFZ C;  4HCK A;  2DD5 A;  3CCV Q;  2DE0 X;  4XTZ A;  3AT1 B;  1Q7Y C;  3E2U A;  5CCA A;  2YWW A;  4JDS A;  1NEG A;  3VS1 A;  1S1N A;  3OYC A;  4M4Z A;  1UDL A;  2LX9 A;  3U23 A;  1M1K R;  1O75 A;  2EWN A;  3VV0 A;  2EQJ A;  4M75 B;  2LQK A;  1WQ7 A;  1Y07 A;  2MK5 A;  2BE7 D;  3PVQ A;  4BI8 B;  5GJV B;  2O01 E;  2KRO A;  1IRE B;  3CCJ A;  3GPL A;  2M0Y A;  1AT1 B;  5IXB A;  4M7D E;  3X25 B;  2E3I A;  2KNB B;  1UGR B;  2RHU A;  1YCY A;  3VS7 A;  1M2V B;  1OZ2 A;  3JV3 A;  2VB6 A;  1K8A U;  1SG5 A;  1X27 A;  2FPE A;  4C0G A;  1G8X A;  3CPW S;  5KE3 A;  3CC7 T;  5HK0 A;  1B07 A;  5GMK h;  1N27 A;  2L3S A;  4XU2 A;  2DL5 A;  2DX1 A;  2XDP A;  3VS5 A;  4PJO B;  2CZ1 B;  4M7D F;  4F7U B;  1GFD A;  2R5A A;  2EQU A;  3QDF A;  1PC0 A;  4C8Q B;  4R55 A;  1KQS S;  2VKN A;  2QDL A;  5LJ3 e;  3EG2 A;  2J05 A;  1C0M A;  1GFC A;  3O8V A;  2QEX T;  2QA4 Q;  2ZPB B;  1I5O B;  5J3B A;  5LJ5 j;  2QG9 B;  1K76 A;  4ZGD B;  3GNG A;  2AHJ B;  3PFS A;  4F17 A;  4HT8 A;  3DKM A;  2AK5 A;  4ZN3 A;  1MV3 A;  3E9F A;  3G71 T;  3CBP A;  5I2S A;  3VS2 A;  1JJ2 S;  1Q82 U;  1KC8 C;  3H9N A;  4M7D G;  4J9G A;  1ZSZ A;  1Y57 A;  2FB7 A;  2ROL A;  1NJI C;  3V7C A;  4J9C A;  4A63 B;  4QVC A;  1ZA2 B;  3H0I A;  1OU9 A;  2QTX A;  2K6D A;  2KMT A;  1VQ4 Q;  2DK3 A;  3EG9 B;  4N4I A;  2FL7 A;  3I5R A;  2JS0 A;  1C6V X;  2JTE A;  3ZL7 C;  2SEM A;  2DNU A;  4F04 B;  2DBK A;  2K5F A;  2B8A A;  3HP9 A;  5LJ5 f;  2F2W A;  2LCS A;  4QT7 A;  5GAO p;  4XTW A;  1B3Q A;  4JRI A;  2KGT A;  3OYJ A;  3QYG B;  3I56 Q;  3OYY A;  3X26 B;  1QVG A;  5GAM e;  1AZE A;  1UTI A;  1XOV A;  1HYO A;  1YN8 A;  2KR3 A;  1SKU B;  2CP6 A;  2RH2 A;  2COZ A;  1IXD A;  3JCM P;  2RQV A;  3MO8 A;  4C5I A;  1YHQ A;  2NWM A;  3UA6 A;  3E19 A;  4N4G A;  5HY6 A;  3G4S T;  1YWP A;  2DPP B;  1SPK A;  2JS2 A;  1KD1 C;  4DBR A;  4FCY A;  5DLQ E;  4JRP A;  3OYF A;  3CCU T;  2W0Z A;  1XJW B;  3G7Z A;  1OPK A;  4LD9 K;  4RTT A;  1BI3 A;  2E6Z A;  3PVL A;  4M7D C;  1G5V A;  2CZ7 B;  3J80 E;  2KXD A;  1WLP B;  2QAZ A;  2VYT A;  3FIF A;  1K8A R;  1G3Y A;  4M75 A;  4M77 B;  1ZQ1 A;  4MDW A;  1FXX A;  2DBM A;  3CCL A;  4KGV B;  1MMA A;  4AG2 C;  3S3N A;  2XG8 D;  1NYG A;  4IIO A;  4J6X A;  1U1S A;  3LH0 A;  1WI7 A;  2CUD A;  4M78 B;  2RF0 A;  2HNI A;  2EIF A;  1BI0 A;  1PG5 B;  3V7S A;  1R77 A;  2RB6 A;  3MEW A;  1K73 U;  1W2B A;  3KXT A;  3OYN A;  2PQW A;  2XDD A;  3OYI A;  4JPB W;  2BZ8 A;  2K4Y A;  3M54 A;  2IPO B;  3X28 B;  1W70 A;  1WQW A;  3CC4 Q;  5CKH A;  1FYN A;  3RNJ A;  4WCI A;  1M90 U;  5A0D A;  1BU1 A;  3UAT A;  5D6Y A;  3GNF B;  1PD0 A;  1VQN T;  1VQ6 T;  1YCS B;  3OA6 A;  2GNC A;  1Q82 R;  1VIF A;  3SB2 A;  3UT1 A;  3CCQ Q;  1GCQ C;  3QWY A;  4CI0 C;  3UDC A;  3A8M B;  3OYM A;  1E7O A;  3J7A F;  1NZ9 A;  1WXB A;  4GY5 A;  2JJ9 A;  3JCM d;  5GAN g;  4AFQ C;  1UFF A;  4LN2 A;  2HSP A;  4N0A A;  3DLL A;  4FSS A;  2V8J A;  5GMK e;  5GAN 3;  4BE1 A;  4J83 A;  3RKW A;  1TWB A;  4OMP A;  1ZUK A;  3C0C A;  2CP0 A;  5KYU A;  4XAX B;  4C92 E;  1XNI A;  1AZG B;  1W2B P;  4IUP A;  2WAC A;  2FYK A;  9ATC B;  2E70 A;  2HCK A;  3TQ7 P;  2R57 A;  1YIT Q;  3MKD A;  1QP2 A;  1BIB A;  4XTY A;  1KQ1 A;  3GIB A;  1RAG B;  1H64 1;  2ZPG B;  1I8F A;  2E10 A;  4PLI A;  2KK4 A;  1KSW A;  4C92 F;  4BY6 B;  3OB9 A;  4OB2 B;  2DYI A;  2K3X A;  2L3P A;  2Z0W A;  2HZY A;  1Y0M A;  1YI2 A;  2J7I A;  4PLL A;  5FWC A;  2FPF A;  2YRD A;  1WA7 A;  3CCE A;  2F1L A;  4KUI A;  2OTL T;  1NE8 A;  2GTO A;  3CD6 Q;  2AKK A;  4FW1 A;  5CKE A;  3R6N A;  3CXC S;  1VQK A;  4IUT A;  3OW2 A;  2K7A A;  2HQH A;  4ANJ A;  5KCH A;  1K73 R;  3HFN A;  1QVF A;  1FMK A;  4CC7 A;  2EQI A;  2DZC A;  1AVZ C;  3CC7 Q;  5LJ3 j;  2KDS A;  3G6E Q;  4JS5 A;  1M90 R;  2O88 A;  1JXO A;  2HEQ A;  1BI1 A;  1MNE A;  1QMC A;  2PVG B;  1NYF A;  1OUL A;  3QYH B;  4MZM A;  3C4S A;  1RLQ C;  1TG0 A;  2SRC A;  4JUV A;  3TU4 K;  4M7D D;  2JOY A;  1VQO A;  1VOM A;  2XD0 A;  3Q1J A;  4EMK C;  4JRK A;  2Y90 A;  2L0A A;  2QA4 T;  1D0X A;  1X69 A;  4XTU A;  4V2S A;  3KUF A;  1WNL A;  5GAN 5;  1VQM T;  3MP1 A;  3G71 Q;  1S72 A;  3JB9 I;  2LQN A;  3OW2 P;  3KBG A;  3WVD B;  1I07 A;  2CZ6 B;  4BAC A;  4C92 C;  3QWX X;  5LJ3 f;  1VIE A;  1RLP C;  2Y4X A;  1QVF P;  4IUV A;  4RTX A;  2GQV A;  1D0Y A;  2COY A;  2XI9 A;  2K2V A;  3DLM A;  3URG A;  4JLG A;  3QBY A;  4D6W A;  1D1A A;  4RMO A;  2VXF A;  2RI2 A;  2L8D A;  5GAM j;  3TSW A;  2RNA A;  5GAN 2;  2EYZ A;  1VQ4 T;  4O6J A;  3NTI A;  1HD3 A;  3CCV A;  3JB9 F;  2MWP A;  3RDV A;  3MET A;  2E3H A;  3MP6 A;  1R8O B;  4IIM A;  2OTJ A;  2J6F A;  2LNH B;  2DLP A;  4EMK A;  3OSV A;  3CCM Q;  5KYN A;  1NBE B;  1K8A C;  1VQ5 T;  2RHX A;  4DQ2 A;  4PJJ A;  5GAO n;  5CO7 A;  1ZUY A;  4GLM A;  2IVW A;  1Q86 C;  1RI9 A;  3G4S Q;  4MMK A;  2CT4 A;  5KE2 A;  2V1Q A;  2YDL A;  2EPD A;  3UWN A;  3CCU Q;  4BI3 A;  2M9U A;  3L2Z A;  4C92 A;  3V8L A;  2YUN A;  4XU3 A;  5CK9 A;  2D6F A;  5LJ3 h;  3CBO A;  5GAM f;  3LH5 A;  4M7A E;  1U06 A;  2O9V A;  1FWZ A;  4EIK A;  1PKS A;  3REB B;  2DXC A;  1GXI E;  4DBF A;  4E7I A;  1Y71 A;  4JS4 A;  1U8R A;  2GCX A;  1JRI A;  2A36 A;  1N5Z A;  4RTY A;  1TOV A;  2ZZD A;  2A0F B;  1VQ7 A;  2NUZ A;  1RAI B;  1OX8 A;  1EZZ B;  4OMN A;  2RI3 A;  2EYQ A;  4MZP A;  3WVE B;  2JW4 A;  2K3Y A;  3CCS T;  4M7A F;  1Q82 C;  2LVM A;  1PNJ A;  1ZUU A;  2LRQ A;  3SWN B;  2K2M A;  1RAH B;  4X34 A;  2NUP B;  1G3W A;  4A4G A;  2M1H A;  4R0K A;  3EG1 A;  4Y28 E;  3CC4 T;  4OML A;  3CPW A;  2L3Q A;  1VQN Q;  2VXE A;  1W1F A;  3EH1 A;  3QDR B;  1IGU A;  4CC3 A;  4ZN1 A;  3EGX B;  5CKF A;  4OMQ A;  4BI4 A;  5KYX B;  1I0C A;  4C0D B;  2JTF A;  3VS0 A;  4XQ3 A;  1X6G A;  4QQD A;  1NEB A;  3QJY A;  3NPF A;  2R58 A;  1JXM A;  5I11 A;  1KQS A;  2FZG B;  4IUQ A;  3CMA Q;  1HK9 A;  2DVE A;  4RG2 A;  3A8G B;  2DET A;  2FZC B;  4AMC A;  1BCO A;  1ZBX A;  3TRE A;  2MI6 A;  1ZLM A;  2CSQ A;  4XK8 E;  1ABO A;  1WHM A;  2DJZ A;  1U5S A;  3FC3 A;  1ARK A;  2RHI A;  2DTH A;  1JJ2 A;  1M3A A;  2DL4 A;  3E9G A;  2A3L A;  4M75 E;  4A53 A;  3I56 A;  1PWT A;  3C94 A;  4E7Z A;  1RAF B;  1YIT T;  5CIU A;  1MMD A;  4Z02 A;  5IAY A;  4J9E A;  3BDL A;  4EPC A;  5GMK i;  2NUT A;  5CKD A;  3BFM A;  2CDT A;  3EHQ A;  3VJP A;  2KXC A;  1CSK A;  4HVV A;  5L8R E;  3ZFJ A;  4CRI A;  1WXU A;  2ABL A;  3JCM X;  3A8L B;  4M7A C;  4KH0 B;  1K73 C;  3CCR A;  2DXU A;  4M75 F;  2JUF A;  3QZ5 B;  3I55 A;  2OTL Q;  1KQS P;  1VQL Q;  2VC8 A;  3OMG A;  1JO8 A;  1KHI A;  5KYY A;  5GAN d;  1M90 C;  3QII A;  2VWF A;  2F5K A;  3V8K A;  2KRM A;  3M0U A;  3CD6 T;  2LCL A;  1FX7 A;  1LNX A;  2KVQ G;  3D7S B;  3VUZ A;  3L2Q A;  4PJO E;  2RMO A;  3LWH A;  2YXY A;  3C95 A;  2HAX A;  2K5I A;  1X01 A;  1ZSZ C;  4C8Q E;  2PUK B;  4PFO A;  3INZ A;  2QGG A;  3RUX A;  4FSX A;  4M75 G;  1NPR A;  2V26 A;  3L2V A;  2CH4 W;  1Q86 U;  2GBQ A;  4J7I A;  2PZ1 A;  4ME7 A;  2PUO B;  3SFM A;  3G6E T;  2CT3 A;  5CR2 A;  2X4W A;  3NTK A;  1TU0 B;  2CP2 A;  1YJW Q;  3E1S A;  3EGD B;  1IO6 A;  4JJB A;  1VQ8 Q;  5J26 A;  1E6G A;  1X43 A;  4M7A A;  4F16 A;  3PE0 A;  3SWN A;  3OY9 A;  1OI1 A;  2JNG A;  1AOJ A;  2KEA A;  4RCC A;  3H0H A;  3CCQ A;  5FW9 A;  4PFP A;  3CC2 A;  2HQX A;  1VQM Q;  1ABQ A;  4M7D B;  4XTV A;  1YJN Q;  4DBQ A;  4J9I A;  2X4Y A;  1KIK A;  2HBW A;  3VS3 A;  2QYZ A;  3JCM W;  1OX9 A;  2P84 A;  4Q5W A;  2RPN A;  1YP5 A;  5GAO q;  4HCC A;  3HTR A;  2HL3 A;  3UPU A;  3T9N A;  4A4E A;  1YIJ Q;  2FZK B;  1QCF A;  4M75 C;  2DA9 A;  1SHF A;  3CME A;  5D6X A;  4QKU A;  2O4X B;  1H8K A;  1T0H A;  1QWE A;  2CP3 A;  4GBQ A;  1V1C A;  1LCK A;  3M4G A;  1ZSG A;  1B34 B;  4X9C A;  2DRM A;  1SSF A;  2RN8 A;  5IXF A;  1JU5 C;  3JB9 D;  1YJ9 Q;  2EGA A;  2ESW A;  1CKA A;  3JCM c;  5KYW B;  1VQ5 Q;  1VYT A;  4NS5 A;  3OYG A;  1I4K 1;  4KH1 B;  1GL5 A;  3CCM T;  2QGF B;  2KYB A;  2M0O A;  2P4T A;  2LMJ A;  3UA7 A;  2EBP A;  2WSC E;  3EFO A;  4M77 E;  1WYX A;  2D1X A;  2ENM A;  1KJW A;  4HXJ A;  1B7T A;  2MOX A;  1ZA1 B;  2HKN A;  2ZPE B;  6AT1 B;  2Y4Y A;  3MPU B;  2W10 A;  3OYH A;  4MDX A;  2KT8 A;  3QO3 A;  4EDU A;  1AEY A;  2HSE B;  4XTX A;  5M9O A;  4QVD A;  1IGQ A;  3S3M A;  1NG2 A;  4M77 F;  1Q86 R;  3EFS A;  3CC7 A;  2RM4 A;  1BYM A;  4IUU A;  3G6E A;  2K57 A;  4N0A C;  4NOY A;  5GJW B;  4FL6 A;  3CCS Q;  2EKO A;  1VUB A;  2X9H A;  1TSF A;  3CXC A;  2K3B A;  1OV3 A;  2OJ2 A;  1VQ9 T;  2J6K A;  2COW A;  1QVG P;  2D9T A;  2QEX A;  1M2V A;  3TSZ A;  1G3T A;  1VYV A;  4LDW A;  4OF1 A;  3I5S A;  3NFC A;  2LT1 A;  4J9B A;  2VVK A;  3LWI A;  2X3X D;  3LLR A;  3QHS A;  1I5L A;  1D1C A;  1NLO C;  4KRT A;  3G71 A;  4PJO A;  1QVP A;  4ZGJ B;  3QZ9 B;  3EGD A;  2C0T A;  2KRS A;  4F7U A;  4C8Q A;  1BIA A;  2RHZ A;  1WHG A;  2BZY A;  3CMA T;  2CRE A;  2DM1 A;  4BUG A;  3GLX A;  4Z89 A;  3JSC A;  2DO3 A;  1QQJ A;  2LZ6 B;  3CXC P;  4J8O A;  4JLI A;  2YRC A;  3OSS C;  4LUD A;  1OU8 A;  3RMS A;  2I2L A;  3BDU A;  1WHK A;  1YFN A;  3NHN A;  7AT1 B;  2NYS A;  2HL5 C;  5J39 A;  1Y96 B;  3VKI A;  2AIR B;  2A28 A;  4M77 C;  2MWO A;  4FYV B;  1KK7 A;  4EMH A;  1WXT A;  1G2B A;  3EG9 A;  3KFV A;  3SD4 A;  3G4S A;  1EIF A;  1TXQ A;  4A4K A;  2DD4 A;  4BDZ A;  3JAM E;  3CCU A;  1MMG A;  4A4F A;  1PHT A;  3M0Q A;  3A98 A;  1BBZ A;  3SHW A;  1UUE A;  2X4X A;  1QWF A;  1T3S A;  3SEM A;  5I22 A;  4QVZ A;  5DY9 A;  2E5Q A;  4M75 D;  2QDY B;  3O5Z A;  1VQL T;  4OVA A;  1OOT A;  2H3J A;  3R6O A;  2ROT A;  3N5B B;  1LJO A;  2DAQ A;  4RTW A;  1OQK A;  1J3T A;  5LJ5 g;  2YLB A;  3HRT A;  4BDY A;  2B86 A;  2L5Q A;  3AHU A;  4LXC A;  4C92 G;  1Z9Q A;  1RUW A;  4XU1 A;  1M1G A;  2DF6 A;  4KUD K;  2FHD A;  2D8J A;  2LNV A;  4RG8 A;  4AG1 C;  3L2R A;  1Z9Z A;  4WF2 A;  4M77 A;  3GF5 A;  2X3W D;  3F70 A;  2MYS A;  1R0B G;  2OX7 A;  2K9G A;  2RI5 A;  1VQP T;  2QQR A;  2I0N A;  2LDM A;  3PGG A;  2QQ9 A;  1VQN A;  1VQ6 A;  2JZ2 A;  3MJX A;  4M78 A;  5FRO A;  3VRZ A;  5HKC A;  1YJW T;  4QQG A;  1BK2 A;  5IN1 A;  3CCL Q;  2JTM A;  3LYI A;  2CP7 A;  1VQ8 T;  5DM7 R;  4DBH A;  3HKS A;  3S6W A;  4HCZ A;  1KFZ A;  3JCM h;  3A1P A;  5HCK A;  2XHC A;  3J81 E;  3L2W A;  3ME9 A;  1P92 A;  1V29 B;  1RAE B;  1WZO A;  1OYX A;  1YJN T;  1N9S A;  1MGQ A;  4CC2 A;  1IZ6 A;  2R5M A;  2QAS A;  2E1H A;  3M0S A;  2L2P A;  2L3R A;  1MHN A;  2XMF A;  1UGV A;  1D3B B;  1QKW A;  2QTV A;  3OS2 A;  4BE0 A;  3OYE A;  2F2V A;  2FG0 A;  1MND A;  1YIJ T;  2DIQ A;  2YUO A;  2MAM A;  3LX7 A;  4PJN A;  2FEI A;  4ORZ A;  1WHJ A;  1WIE A;  2H3E B;  2KY9 A;  2GQI A;  2RJE A;  3M9Q A;  3OS1 A;  4DEY A;  4MML A;  3UF4 A;  1O9S A;  4PL6 A;  3TEE A;  3OYK A;  3P8H A;  1JEG A;  4OB3 B;  1WHL A;  1VYU A;  2GGR A;  2YUQ A;  1YJ9 T;  2DL3 A;  3M56 A;  4WTO B;  2V8I A;  3HSB A;  3RIR A;  5FLX E;  2CS7 A;  1UHC A;  5FU7 B;  4E47 A;  5I21 A;  1LPL A;  2OTL A;  1KG1 A;  1R0C B;  2RK2 A;  4NL2 A;  1Y96 A;  3CQT A;  1LVK A;  4L6V 5;  1Q81 U;  3FJP A;  3FJ5 A;  4PNO A;  3OBW A;  2BE9 B;  3REA B;  2L89 A;  1M3C A;  3JB9 G;  4RCB A;  2AZS A;  1WGS A;  2DIG A;  3M59 A;  1M5Q 1;  1PD1 A;  4ZGE B;  5GAO r;  2F2X A;  2X51 A;  2ZPF B;  4QW2 A;  1IRX A;  2KAF A;  2LJ1 A;  1TS9 A;  2E64 A;  1TTH B;  3G1J A;  4J7F A;  4LDX A;  4M77 D;  5GAN 4;  3LGL A;  1OEB A;  1W4S A;  3PIO A;  1A0N B;  4RTZ A;  2HBP A;  1H92 A;  3MP8 A;  1VQ9 Q;  1M3B A;  2ED0 A;  2DYB A;  1PRL C;  2D0Q B;  3VRY A;  3CCJ T;  2MMP A;  4B9W A;  5FRN A;  4HCB A;  1WJQ A;  3FDR A;  1K9A A;  2QA4 A;  2RQR A;  4PFZ A;  1SEM A;  3L1A A;  1NM7 A;  3MCA B;  2RK1 A;  4B9X A;  1G83 A;  3JCM b;  1LOJ A;  1VQM A;  1K4U S;  4OMM A;  2RJF A;  2P0Q A;  2O9S A;  3TVT A;  2LQ8 A;  1TUD A;  2QQB A;  2A08 A;  2DKG A;  4M7A G;  3OYL A;  2X4J A;  3BE3 A;  1UJ0 A;  3ER0 A;  2VAS A;  1C1A A;  1E6H A;  3RKY A;  1YNZ A;  2IG0 A;  4F14 A;  1X2Q A;  2YLC A;  1ZSZ B;  1VQ4 A;  1VQO Q;  5FU6 C;  4KBM B;  5FWB A;  5A0L A;  3M0P A;  4ELY C;  2G3R A;  4UC4 A;  5ECA A;  4FM4 B;  1S72 Q;  3OQ5 A;  5GMK m;  4LD6 A;  2PVO B;  3V7R A;  1VQ5 A;  4OB0 B;  3JCM e;  4DEX A;  4FYX B;  2PU9 B;  3HHT B;  3CPW P;  4E7L A;  2YUP A;  1I1J A;  1Q81 R;  1M27 C;  3CBM A;  1K9M U;  2QQS A;  4RTU A;  5LJ3 g;  3EAE A;  3LGF A;  4A54 A;  2MPX C;  3RMQ A;  5D7U A;  4P5N A;  4C92 D;  3VS6 A;  2CSI A;  2EAY A;  2V8K A;  2JXB A;  4LUE A;  3SWN C;  1OPL A;  2OTJ Q;  4JJC A;  2KBT A;  4DOV A;  2AZV A;  1K1Z A;  2OI3 A;  3HRS A;  5GAN j;  2E4H A;  3PTA A;  2EFI A;  4X1V A;  3CCS A;  1JJ2 P;  5IT9 E;  4F7U E;  2DTO A;  5C0M A;  1JBM A;  4C0D C;  1RI0 A;  4Y92 A;  2EQK A;  1YHQ T;  3EFR A;  3EG3 A;  3M58 A;  4LDV A;  1VA7 A;  2D8H A;  4IKF A;  1VQP Q;  3OYB A;  2ATC B;  3CC4 A;  1SRM A;  2VUB A;  4QQ6 A;  4OB1 B;  4X9D A;  5IH2 A;  4E7J A;  2RO0 A;  4PJO F;  1D09 B;  3FEO A;  3ASK A;  3FB9 A;  3I9Q A;  3OMC A;  4HVW A;  2JM9 A;  4K11 A;  4F7U F;  5GAM g;  5I2M A;  4J5Y A;  2CH4 A;  4DA4 A;  4C8Q F;  4ZTJ A;  3CCL T;  1AWJ A;  1VQ7 Q;  2NUP A;  5GAN f;  2JMA A;  2QQA A;  1PKT A;  4Z88 A;  4HVU A;  3VYG A;  2O2O A;  3PT9 A;  2HQE A;  2CKK A;  5LL6 S;  3OYA A;  3CEY A;  3EG0 A;  2LT4 A;  2G6F X;  1AD5 A;  1GBQ A;  1V76 A;  4LNP A;  3ULR B;  4LDY A;  3EGX A;  5LJ5 d;  3C12 A;  2XDB A;  4PJO G;  2M16 A;  5KYX A;  1HSQ A;  4E6R A;  4JJD A;  3H0F A;  2BZX A;  4F7U G;  2EVR A;  3SDZ A;  5D6W A;  4C8Q G;  3LW5 E;  4A4H A;  2E5K A;  5CKB A;  5KYU B;  2DIL A;  1YIT A;  1UJY A;  3ZBD A;  1K9M R;  4HKE A;  1RAC B;  2AT1 B;  5CVI A;  1JQQ A;  4C5H A;  3PIP A;  2DL8 A;  2E12 A;  2VGM A;  1K0S A;  5IHN A;  1N9R A;  1ACM B;  1TH7 A;  2RA2 A;  5GAN 8;  4Y91 A;  4J6Y A;  1WDX A;  2EJF A;  1UEC A;  2HMA A;  2CP5 A;  4JZ4 A;  3RES A;  1T0J A;  3OBY A;  2F69 A;  5GAN h;  1BKB A;  1N8R U;  3OYD A;  2EGC A;  1CKB A;  1IHV A;  1G3S A;  4FYW B;  5GAN 6;  1WJS A;  2FRY A;  1NLP C;  4OGC A;  3CD6 A;  4D8D A;  4M78 E;  3HL8 A;  8AT1 B;  4PJO C;  2EYY A;  2IIM A;  3VUB A;  2DEU A;  3HRU A;  1ZHI A;  4C0Z A;  1SSH A;  5DLO A;  4C8Q C;  3H6Z A;  1AHJ B;  5L23 A;  3CPF A;  4Z8A A;  3FRN A;  1QKX A;  2LQW A;  1RAB B;  4II1 A;  3WXM B;  3CCR Q;  3QSU A;  4PK4 A;  3MEU A;  4M78 F;  3I55 Q;  1YI2 T;  1SF9 A;  2FRW A;  4KGZ B;  2KI7 A;  1EX4 A;  2X35 A;  4LE9 A;  2RJC A;  3CCE T;  5AYF A;  2DJQ A;  5EC7 A;  5GAO m;  2PVD B;  1U3O A;  2RHY A;  3L2U A;  3CCJ Q;  4C0F A;  1H3H A;  2A37 A;  4M7A D;  3ZEH A;  2BKD N;  1Q7Y U;  1X6B A;  2QI2 A;  3I35 A;  2C06 A;  3BY7 A;  3QXE B;  1VQK T;  2ZPI B;  1M8V A;  4M77 G;  2RD1 A;  2PTK A;  1NPP A;  1M2O A;  3H8Z A;  4EMG A;  2DER A;  1TUC A;  4HT9 A;  5LJ5 h;  1WPY A;  2YT6 A;  4C5E A;  4E7H A;  2D0N A;  2CUB A;  4J9H A;  2P0K A;  4M78 G;  4GLK A;  5CAI A;  5CQX A;  2FPD A;  4NL3 A;  2E65 A;  5HK3 A;  4B6M A;  3MEA A;  2MIO A;  2DTI A;  4MZT A;  3RKX A;  5EG2 A;  2CGH A;  5C6S A;  1K0X A;  2C0I A;  5GAN 7;  4M7D A;  1Q81 C;  4OMF B;  1DJ7 B;  4AT1 B;  1VQO T;  3JCM V;  1OZ3 A;  4VUB A;  3FLG A;  3CC2 Q;  2DVJ A;  1MV0 B;  1WX6 A;  2LTO A;  4PJM A;  2LP5 A;  3JCM Q;  1PSE A;  2WSF E;  1N8R R;  3PMT A;  2CYZ B;  5GMK l;  3CCM A;  1S72 T;  2MCN A;  5KH6 A;  2KSS A;  3M57 A;  2CZ0 B;  1PCX A;  4ELZ C;  3HPW A;  2ZPH B;  5KCO A;  2O4X A;  2YHT A;  3RER A;  4KGX B;  4EMK B;  1QVG S;  1M30 A;  5CQY A;  1M1K C;  4M78 C;  4LDU A;  1B34 A;  3CME Q;  2GTJ A;  2VV5 A;  3QKJ A;  1GCP A;  4AFS C;  4BD3 A;  3JCM f;  2XKO C;  1KHC A;  1BB9 A;  2QK0 A;  5KYW A;  2NLU A;  2KQW A;  4ZTF A;  3CCV T;  4C92 B;  2HDA A;  2KYM A;  3X20 B;  1FMW A;  2WSE E;  2OTJ T;  2DXT A;  4RTV A;  2KE9 A;  2XIC A;  1UEB A;  1PRM C;  3L42 A;  3RR6 A;  1FMV A;  3EHR A;  1KC8 U;  3MHX A;  4FW2 A;  1QCO A;  4ATO A;  3GBQ A;  3JB9 J;  1GCQ A;  1PM3 A;  2J06 A;  1UB4 A;  1NJI U;  3QJ6 A;  2P4R A;  4CC4 B;  2OAU A;  1EFN A;  1YHQ Q;  2RQW A;  1VQ9 A;  1Q7Y R;  4N4H A;  2EQM A;  4ZNX A;  2K79 A;  5GAN e;  3A5Z B;  3HFO A;  1W2B S;  4R56 A;  1UE9 A;  5FRM A;  3VU3 C;  2FO0 A;  1M4Z A;  3RBB B;  2O31 A;  3GOX A;  5LJ3 d;  2M51 A;  4AFU C;  2FVU A;  4PJO D;  3NTH A;  2JT4 A;  4TVR A;  1N6A A;  1XQH A;  3P8B B;  4D8K A;  4OGE A;  1AWW A;  1VQ7 T;  5AT1 B;  1MMN A;  2LJ3 A;  4C8Q D;  4C5G A;  1TUG B;  1KD1 U;  4BE2 A;  1MUZ A;  3NMZ C;  3CMA A;  1AWO A;  2DRK A;  3DB3 A;  1BI2 A;  1K9M C;  3P8D A;  1WFW A;  2QEX Q;  1YBY A;  2DEQ A;  2EYX A;  1M1F A;  2PNI A;  4BY6 C;  2BTT A;  3VYH B;  2LX7 A;  2M02 A;  3X24 B;  2XID A;  3JCM J;  3JB9 H;  3M53 A;  1D0Z A;  3M5A A;  1H3Z A;  2A7Y A;  5LJ5 e;  4OP0 A;  5IHI A;  1IB8 A;  4ESR A;  3EH2 A;  1X75 C;  5GAM d;  3A8H B;  3V8J A;  1GBR A;  1M8M A;  4OMO A;  2XU8 A;  4YTL A;  3M0R A;  1T3L A;  2BUD A;  4J6W A;  1HXD A;  2NUT B;  1QLY A;  3A8O B;  2RJD A;  1VQL A;  1KC8 R;  1IHW A;  2H8H A;  4E2F B;  4J9F A;  2LCC A;  2ECZ A;  3GP8 A;  1RAD B;  3DB4 A;  4FT2 A;  1NJI R;  2JM8 A;  2HD0 A; 
#chains in the Genus database with same CATH homology
 3I56 T;  1WJR A;  4DOV A;  1YI2 A;  1KQ2 A;  4PLL A;  3M4Y A;  5FU6 B;  1I81 A;  2ZPE B;  2Y4Y A;  3CCE A;  3S3O A;  3OW2 S;  3HRS A;  5GAN j;  2EJG A;  3OYH A;  4MDX A;  4KUI A;  2OTL T;  1NE8 A;  3PTA A;  3QO3 A;  2EFI A;  4FT4 A;  4EDU A;  1QVF S;  2DXB A;  4XTX A;  5M9O A;  4QVD A;  1VQP A;  3CCS A;  3S3M A;  4DOW A;  3BW1 A;  5IT9 E;  4F7U E;  2XK0 A;  2DTO A;  4M77 F;  5CKE A;  5C0M A;  1JBM A;  4C0D C;  3EFS A;  1M1K U;  4O5V A;  3CCR T;  3CXC S;  1RI0 A;  3CC7 A;  2RM4 A;  3QUI A;  4JRQ A;  4IUT A;  1VQK A;  3OW2 A;  4IUU A;  3PMI A;  1BYM A;  1YJW A;  3I55 T;  3G6E A;  2EQK A;  1YHQ T;  2K57 A;  3EFR A;  3M58 A;  4N0A C;  4LDV A;  4M78 D;  3JCM g;  5KCH A;  3HFN A;  1VQ8 A;  4IKF A;  2YRV A;  1JB0 E;  3MEV A;  4NOY A;  4FL6 A;  5A2Q E;  1QVF A;  4BB7 A;  5GAO l;  3M55 A;  3OYB A;  2EKO A;  1VUB A;  3CC4 A;  2VUB A;  2DZC A;  4QQ6 A;  2EJ9 A;  1QW1 A;  4OB1 B;  3CXC A;  4X9D A;  5LJ3 j;  2KDS A;  4E7J A;  1VQ9 T;  1M9S A;  2MF2 A;  2RO0 A;  4PJO F;  4JS5 A;  3FEO A;  3ASK A;  3FB9 A;  3OMC A;  2D9T A;  2E41 A;  2QEX A;  1BI1 A;  4M7A B;  4F7U F;  5GAM g;  5I2M A;  2PVG B;  4J5Y A;  1G3T A;  4HA8 A;  1YJN A;  2ZCF B;  4RKU E;  4LDW A;  4OF1 A;  3QYH B;  4C8Q F;  4DA4 A;  4ZTJ A;  3NFC A;  1X6O A;  3CCL T;  4MZM A;  1RL2 A;  2LT1 A;  5GAN f;  3C4S A;  4IUR A;  3LWI A;  3LLR A;  2QQA A;  4JJN K;  4JUV A;  2GFA A;  3QHS A;  1I5L A;  3TU4 K;  3VYG A;  4M7D D;  4KUL A;  2JOY A;  3G71 A;  3PT9 A;  1VQO A;  2E6N A;  2HQE A;  5A0G A;  4PJO A;  1QVP A;  1UGS B;  2CKK A;  3Q1J A;  1QP3 A;  5LL6 S;  4ZGJ B;  4EMK C;  2XD0 A;  1PSF A;  3QZ9 B;  4F7U A;  4JRK A;  2Y90 A;  3CEY A;  3OYA A;  1YIJ A;  2LT4 A;  2QA4 T;  1N8R C;  2DZ9 A;  4C8Q A;  1XTD A;  4LDY A;  5GMK j;  4XU0 A;  5LJ5 d;  4PKC C;  4XTU A;  4V2S A;  3KUF A;  3C12 A;  1BIA A;  1WNL A;  5FU7 C;  5GAN 5;  4PJO G;  1VQM T;  2M16 A;  3MP1 A;  4FU6 A;  2XDB A;  2RHZ A;  2K5L A;  1S72 A;  3JB9 I;  2LC4 A;  3JRZ A;  4F7U G;  3KBG A;  3SDZ A;  3WVD B;  5GAM h;  3CMA T;  3QPH A;  2CZ6 B;  5D6W A;  4BAC A;  4C8Q G;  4C92 C;  5LJ3 f;  3LW5 E;  4BUG A;  1VIE A;  3GLX A;  2QXF A;  3TCJ A;  4A4H A;  2Y4X A;  5CKB A;  3CCQ T;  3CC2 T;  4L59 A;  4IUV A;  3PNW C;  3JSC A;  1YIT A;  2GQV A;  1YJ9 A;  1D3B A;  2DO3 A;  4FIB A;  1U1T A;  3ZBD A;  4E7K A;  2XI9 A;  2K2V A;  4HKE A;  5CVI A;  3OS0 A;  2GF7 A;  4J8O A;  4JLI A;  4C5H A;  3DLM A;  3PIP A;  3URG A;  3OSS C;  4JLG A;  3QBY A;  4D6W A;  2E12 A;  4KT0 E;  3RMS A;  2VGM A;  2RI2 A;  2L8D A;  2BIV A;  2VXF A;  5GAM j;  4RMO A;  1N9R A;  2I2L A;  3BDU A;  1TH7 A;  2RA2 A;  3QG1 A;  4Y91 A;  5GAN 8;  5GAN 2;  1VQ4 T;  2GFU A;  3NTI A;  4O6J A;  2JN0 A;  1UGQ B;  2P0P A;  2ZGW A;  1UGP B;  1Y96 B;  2MWP A;  4J6Y A;  3VKI A;  5J39 A;  3CCV A;  3JB9 F;  3MET A;  2F5T X;  4M77 C;  3MP6 A;  1R8O B;  2EJF A;  2MWO A;  2OTJ A;  1Y7X A;  3RES A;  4EMH A;  3OBY A;  2F69 A;  2VGN A;  3OS5 A;  1BKB A;  5GAN h;  3SD4 A;  3OYD A;  4L5G A;  3G4S A;  3CME T;  1N8R U;  1EIF A;  2JVV A;  4EMK A;  3OSV A;  1G3S A;  4A4K A;  2DD4 A;  2DD5 A;  5GAN 6;  4BDZ A;  3JAM E;  4XTZ A;  3CCU A;  1WJS A;  2RHX A;  4DQ2 A;  1K8A C;  1Q7Y C;  1VQ5 T;  4A4F A;  5GAO n;  4OGC A;  5CO7 A;  3CD6 A;  5CCA A;  4JDS A;  2IVW A;  4M78 E;  3HL8 A;  3OYC A;  1Q86 C;  2X4X A;  4PJO C;  2LX9 A;  4MMK A;  3VUB A;  5KE2 A;  4QVZ A;  3HRU A;  1ZHI A;  1O75 A;  5DY9 A;  2EWN A;  3VV0 A;  2E5Q A;  3UWN A;  4C0Z A;  2EQJ A;  4BI3 A;  2M9U A;  3L2Z A;  2QDY B;  4M75 B;  4M75 D;  4C92 A;  2LQK A;  1WQ7 A;  3V8L A;  4C8Q C;  5DLO A;  4OVA A;  4XU3 A;  1VQL T;  1Y07 A;  3H6Z A;  2H3J A;  5CK9 A;  3R6O A;  1AHJ B;  3N5B B;  2D6F A;  1LJO A;  3CPF A;  5LJ3 h;  2DAQ A;  3CBO A;  5GAM f;  4M7A E;  3FRN A;  1FWZ A;  5LJ5 g;  4BI8 B;  2YLB A;  3HRT A;  4BDY A;  2O01 E;  2DXC A;  1IRE B;  2L5Q A;  4II1 A;  3WXM B;  3CCJ A;  3AHU A;  3GPL A;  1GXI E;  4C92 G;  3QSU A;  4XU1 A;  1M1G A;  4KUD K;  4E7I A;  3MEU A;  4M78 F;  1YI2 T;  1Y71 A;  2FHD A;  4JS4 A;  1U8R A;  2GCX A;  2X35 A;  1JRI A;  2RJC A;  2LNV A;  4M7D E;  4RG8 A;  3X25 B;  3CCE T;  5AYF A;  2ZZD A;  1VQ7 A;  3L2R A;  5GAO m;  2PVD B;  3L2U A;  2RHY A;  4WF2 A;  4M77 A;  3GF5 A;  1UGR B;  2RHU A;  3F70 A;  1YCY A;  4C0F A;  2RI3 A;  2EYQ A;  4MZP A;  3WVE B;  4M7A D;  1OZ2 A;  3ZEH A;  2RI5 A;  1K8A U;  2BKD N;  2K3Y A;  3CCS T;  1VQP T;  1Q7Y U;  4M7A F;  1Q82 C;  2LVM A;  2QQR A;  2QI2 A;  4C0G A;  3CPW S;  2C06 A;  2LDM A;  2LRQ A;  3SWN B;  3PGG A;  2QQ9 A;  1VQN A;  5KE3 A;  1VQ6 A;  2JZ2 A;  3BY7 A;  3QXE B;  4M78 A;  4X34 A;  5FRO A;  5HK0 A;  2ZPI B;  5GMK h;  1VQK T;  3CC7 T;  1M8V A;  4M77 G;  5HKC A;  1YJW T;  1G3W A;  1N27 A;  2RD1 A;  4QQG A;  4A4G A;  1NPP A;  3H8Z A;  5IN1 A;  2M1H A;  4EMG A;  4HT9 A;  2JTM A;  3LYI A;  4XU2 A;  5LJ5 h;  1WPY A;  2XDP A;  1VQ8 T;  4PJO B;  2CZ1 B;  4C5E A;  5DM7 R;  4E7H A;  3HKS A;  3S6W A;  4HCZ A;  4M7D F;  4Y28 E;  3CC4 T;  2P0K A;  4F7U B;  3CPW A;  2R5A A;  2VXE A;  4M78 G;  3JCM h;  2EQU A;  4GLK A;  5CAI A;  5CQX A;  2XHC A;  3J81 E;  3QDR B;  4C8Q B;  3L2W A;  3ME9 A;  4ZN1 A;  4R55 A;  1P92 A;  5CKF A;  4NL3 A;  2E65 A;  1KQS S;  1V29 B;  5HK3 A;  5LJ3 e;  4BI4 A;  3O8V A;  2QEX T;  4C0D B;  2JTF A;  2ZPB B;  3MEA A;  1OYX A;  2DTI A;  4MZT A;  4XQ3 A;  4QQD A;  5J3B A;  5LJ5 j;  1YJN T;  3QJY A;  3RKX A;  5EG2 A;  2CGH A;  2R58 A;  1N9S A;  4ZGD B;  1MGQ A;  3GNG A;  5C6S A;  2AHJ B;  1IZ6 A;  2R5M A;  5GAN 7;  4M7D A;  2E1H A;  3PFS A;  2L3R A;  1MHN A;  1Q81 C;  4OMF B;  4HT8 A;  3DKM A;  4ZN3 A;  1KQS A;  1DJ7 B;  4IUQ A;  1HK9 A;  1D3B B;  2DVE A;  3E9F A;  3G71 T;  1VQO T;  3CBP A;  3JCM V;  5I2S A;  1OZ3 A;  4VUB A;  3FLG A;  3OS2 A;  3OYE A;  4BE0 A;  1JJ2 S;  1Q82 U;  1KC8 C;  4RG2 A;  1YIJ T;  3A8G B;  2DIQ A;  4M7D G;  2MAM A;  3LX7 A;  2LTO A;  3JCM Q;  1ZBX A;  3TRE A;  2MI6 A;  1PSE A;  2FB7 A;  2WSF E;  2KY9 A;  4XK8 E;  2DJZ A;  1NJI C;  3V7C A;  3FC3 A;  3PMT A;  2CYZ B;  4QVC A;  5GMK l;  3CCM A;  1S72 T;  2RHI A;  2RJE A;  3M9Q A;  5KH6 A;  2DTH A;  2KSS A;  3M57 A;  3OS1 A;  2QTX A;  4MML A;  2CZ0 B;  1JJ2 A;  2KMT A;  1O9S A;  3E9G A;  2DK3 A;  4ELZ C;  2A3L A;  4PL6 A;  3TEE A;  3HPW A;  2ZPH B;  2FL7 A;  4N4I A;  5KCO A;  3OYK A;  2O4X A;  2YHT A;  3P8H A;  4M75 E;  4A53 A;  3RER A;  4OB3 B;  3I56 A;  4EMK B;  1QVG S;  3C94 A;  5CQY A;  1M1K C;  1YIT T;  5CIU A;  1YJ9 T;  2K5F A;  3M56 A;  4M78 C;  4LDU A;  1B34 A;  2B8A A;  3HP9 A;  4Z02 A;  5IAY A;  5LJ5 f;  2V8I A;  3BDL A;  2VV5 A;  4EPC A;  3RIR A;  3QKJ A;  4XTW A;  5FLX E;  2CS7 A;  5GMK i;  5GAO p;  3HSB A;  5FU7 B;  4E47 A;  5I21 A;  2OTL A;  4JRI A;  4BD3 A;  5CKD A;  3JCM f;  1KG1 A;  3OYJ A;  2RK2 A;  2XKO C;  3BFM A;  3QYG B;  1KHC A;  1Y96 A;  4NL2 A;  3OYY A;  2NLU A;  2KQW A;  3VJP A;  3X26 B;  4L6V 5;  1Q81 U;  1QVG A;  5GAM e;  5L8R E;  3FJP A;  3ZFJ A;  4CRI A;  4ZTF A;  1XOV A;  3JCM X;  3CCV T;  4C92 B;  3A8L B;  4PNO A;  4M7A C;  3OBW A;  1K73 C;  3X20 B;  3CCR A;  2DXU A;  2WSE E;  2L89 A;  2RH2 A;  2OTJ T;  2DXT A;  4M75 F;  2JUF A;  2XIC A;  3JCM P;  3JB9 G;  1UEB A;  3L42 A;  3MO8 A;  3QZ5 B;  4C5I A;  4RCB A;  3I55 A;  1YHQ A;  3MHX A;  1KC8 U;  4ATO A;  3E19 A;  4N4G A;  1WGS A;  2DIG A;  3M59 A;  5HY6 A;  3G4S T;  2DPP B;  2VC8 A;  3OMG A;  3JB9 J;  1KD1 C;  1M5Q 1;  1KHI A;  5DLQ E;  5GAN d;  1UB4 A;  3OYF A;  4JRP A;  1M90 C;  3QII A;  1NJI U;  3V8K A;  2F5K A;  3CCU T;  3QJ6 A;  3G7Z A;  4M7D C;  4LD9 K;  1G5V A;  1BI3 A;  2E6Z A;  4ZGE B;  5GAO r;  2OAU A;  3CD6 T;  2CZ7 B;  4QW2 A;  2ZPF B;  3J80 E;  2LCL A;  2KAF A;  1VQ9 A;  2VYT A;  3FIF A;  1FX7 A;  1LNX A;  1G3Y A;  2E64 A;  2KVQ G;  4M75 A;  4J7F A;  4N4H A;  3VUZ A;  3L2Q A;  4PJO E;  4LDX A;  4M77 D;  4M77 B;  1ZQ1 A;  5GAN 4;  3LWH A;  3LGL A;  4MDW A;  1FXX A;  2EQM A;  1W4S A;  3PIO A;  3C95 A;  3CCL A;  5GAN e;  2HAX A;  2K5I A;  1X01 A;  3A5Z B;  3HFO A;  3S3N A;  2XG8 D;  4C8Q E;  4J6X A;  2HBP A;  1U1S A;  2PUK B;  3LH0 A;  4R56 A;  3INZ A;  1W2B S;  3MP8 A;  3RUX A;  4FSX A;  5FRM A;  4M78 B;  4M75 G;  2HNI A;  1NPR A;  2EIF A;  3VU3 C;  1BI0 A;  3L2V A;  2D0Q B;  1Q86 U;  1M4Z A;  4J7I A;  3CCJ T;  2MMP A;  4ME7 A;  2PUO B;  3SFM A;  5LJ3 d;  3V7S A;  5CR2 A;  3G6E T;  3GOX A;  2RB6 A;  3MEW A;  4B9W A;  2X4W A;  3NTK A;  4HCB A;  1WJQ A;  5FRN A;  3FDR A;  2FVU A;  2QA4 A;  4PJO D;  1K73 U;  3NTH A;  1W2B A;  3E1S A;  3KXT A;  3L1A A;  3OYN A;  3MCA B;  2RK1 A;  2PQW A;  4TVR A;  1N6A A;  4B9X A;  2XDD A;  1XQH A;  3P8B B;  3JCM b;  3OYI A;  1LOJ A;  2K4Y A;  5J26 A;  1VQM A;  3M54 A;  4OGE A;  1VQ7 T;  3X28 B;  4M7A A;  4C8Q D;  4C5G A;  1WQW A;  2RJF A;  1KD1 U;  5CKH A;  4BE2 A;  2P0Q A;  3SWN A;  3OY9 A;  3CMA A;  1M90 U;  1OI1 A;  2JNG A;  5A0D A;  4RCC A;  3DB3 A;  2LQ8 A;  1BI2 A;  5D6Y A;  3P8D A;  3CCQ A;  1K9M C;  3CC2 A;  3GNF B;  1VQN T;  2HQX A;  1VQ6 T;  2QQB A;  1YBY A;  2DEQ A;  2DKG A;  4XTV A;  4M7A G;  4M7D B;  3OYL A;  3OA6 A;  2X4J A;  3ER0 A;  1M1F A;  2X4Y A;  3RKY A;  1VIF A;  3SB2 A;  3JCM W;  4BY6 C;  4Q5W A;  2IG0 A;  3UT1 A;  5GAO q;  4HCC A;  4CI0 C;  3UDC A;  2YLC A;  3A8M B;  3OYM A;  1VQ4 A;  3UPU A;  3T9N A;  1NZ9 A;  3J7A F;  5FU6 C;  4GY5 A;  3JCM d;  4A4E A;  5GAN g;  3VYH B;  4KBM B;  5A0L A;  3DLL A;  4N0A A;  3X24 B;  2XID A;  2G3R A;  4ELY C;  3JCM J;  3JB9 H;  2V8J A;  3M53 A;  5GMK e;  5GAN 3;  4M75 C;  3CME A;  4BE1 A;  4UC4 A;  4J83 A;  3M5A A;  3RKW A;  5D6X A;  1H3Z A;  2A7Y A;  5LJ5 e;  4OP0 A;  4FM4 B;  3OQ5 A;  2O4X B;  4LD6 A;  5GMK m;  2PVO B;  4XAX B;  4C92 E;  3V7R A;  1VQ5 A;  1XNI A;  1X75 C;  4OB0 B;  5GAM d;  3JCM e;  3A8H B;  3V8J A;  3M4G A;  4IUP A;  2PU9 B;  1B34 B;  3HHT B;  2XU8 A;  4YTL A;  4E7L A;  4X9C A;  2WAC A;  2FYK A;  2BUD A;  4J6W A;  1HXD A;  3CBM A;  1SSF A;  1K9M U;  2E70 A;  2R57 A;  3JB9 D;  1QP2 A;  3A8O B;  2QQS A;  3JCM c;  1BIB A;  4XTY A;  5LJ3 g;  4NS5 A;  1KQ1 A;  3GIB A;  3EAE A;  2RJD A;  1VQL A;  3OYG A;  1I4K 1;  1H64 1;  3LGF A;  2ZPG B;  4A54 A;  3RMQ A;  1I8F A;  3CCM T;  2LCC A;  2E10 A;  4PLI A;  4P5N A;  4C92 D;  2M0O A;  2P4T A;  2EAY A;  2KK4 A;  3GP8 A;  2WSC E;  4M77 E;  4C92 F;  2V8K A;  3DB4 A;  4FT2 A;  4BY6 B;  3OB9 A;  4OB2 B;  3SWN C;  2K3X A;  2HD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...