4A4XA

Nek2-ede bound to cct248662
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
277
structure length
253
Chain Sequence
SRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSHRDLKPANVFLDGKQNVKLGDFGLVGTPYYMSPEQMNRNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of Potent and Selective Hybrid Inhibitors of the Mitotic Kinase Nek2: Structure-Activity Relationship, Structural Biology, and Cellular Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE NEK2
total genus 77
structure length 253
sequence length 277
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4a4xA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4a4xA01
4PP9A 5K0KA 3EIDA 3KKVA 4ZSGA 4ZJJA 4CQGA 3G6GA 4KKHA 3VQUA 5EHLA 1WBNA 3ZU7A 4ALUA 4DGMA 2Y4IB 3QTXA 1ZMWA 2WB8A 3KRLA 5IMEA 5JFXA 3CC6A 3B8QA 1ZRZA 3RINA 3W8QA 3Q9ZA 3ZLXA 1JQHA 4DC2A 3BV3A 3EFJA 4ZZMA 2F7EE 4C2WA 5GIPE 3W2RA 2C3KA 5JFWA 2JDSA 2VGPA 4W4VA 4DYMA 2GSFA 1IG1A 1JSVA 3AC1A 2ONLC 5J95A 4RX5A 1Q4LA 2QONA 3W33A 4I94A 3MSSA 2V7AA 4F6UA 2LGCA 2ZVAA 3DQWA 3GC9A 4NM3A 2XRUA 3Q5IA 4X2GA 2FH9A 3RAKA 4O0UA 3QU0A 1PKDA 3TUCA 3DQXA 3QA8A 4J8MA 4GVAA 4C36A 1Q8WA 3ORTA 4NTSA 3R83A 2QU6A 3LMIA 1YHWA 4PTCA 4AE9A 3I7BA 3GP0A 4FKPA 2J50A 5EM6A 4FVRA 4QMOA 4XG9A 4BDBA 4BL1A 1KSWA 4YGAA 5E90A 1M52A 4D4VA 3BHUA 4H1JA 2BPMA 3MV5A 3S3IA 4BYIA 4R1VA 3FLQA 4BDHA 4ZP5A 4B7TA 3GCPA 4R7IA 3G9LX 4TY1A 5LVPA 4ANMA 3DB8A 3OD6X 3POOA 4OBPA 2X81A 4KIOA 4AZTA 3TN8A 1OBGA 1PXNA 3EL7A 3ODYX 4FI1A 3WF9A 3BE9A 3MIYA 1Q97A 2WD1A 3Q5ZA 3LFQA 3NWWA 4FL3A 5AR8A 3AC3A 5KMLA 3FMDA 2C5OA 4IVCA 5EDPA 4AU8A 3KXZA 2RG6A 3R00A 3ZC5A 5HBEA 2BZIB 3HMOA 5IG1A 4D9TA 2W7XA 4U45A 1F0QA 5IQAA 1SNUA 3SXRA 4G3FA 3OT3A 4ASZA 2PYWA 4BWKA 1R0EA 3LMHA 2Z7SA 2WFYA 1WFCA 4LM5A 4C35A 5AUWA 3EN7A 2JDVA 3BCEA 3KY2A 3SOCA 4FSMA 4HNIA 4E6AA 3HRBA 1UKIA 2PVLA 1P4OA 1G3NA 4V05A 4EYMA 1F5QA 5IMXA 5JN2A 2YM7A 3QCSA 3BBTB 4IACA 3ITZA 2XNNA 5HOAA 2PVRA 2C1AA 3QF9A 4DN5A 2HK5A 2XK4A 4FUXA 4GMYA 1H24A 3V5WA 4O81A 1RW8A 3FLYA 4XV2A 3QWKA 5GNKA 5L6OA 3PLSA 2CKOA 3KF4A 1UKHA 2QR7A 4EHEA 3TUBA 4QNAA 2G01A 5ICPA 4C3PA 2AUHA 3L8SA 4K1BA 5TO8A 2BVAA 4N6YA 2IPXA 4Y5HA 5L2IA 4BR3A 1YOJA 3ZBFA 1IA9A 1ATPE 1DI8A 4MD7E 4AS0A 3KB7A 2E9VA 1Q3WA 5AP4A 1WAKA 4RZVA 1UNGA 4NTTA 5LARA 4RIXB 3JY0A 5HGIA 5IISA 3R8LA 4QMYA 1PXKA 2B55A 2ZV7A 4P5QA 4EHVA 4BWXA 4PNKA 4PDOA 4IJ9A 2ITTA 3WF7A 3U6IA 2KULA 2UZEA 5DT4A 4F4PA 3WARA 4FK6A 2WTJA 2RFNA 2R4BA 4TYGA 3R01A 4G3EA 4HYHA 3NZ0A 4I5MA 4DEIA 1OPJA 3Q4TA 2CN5A 3E63A 3ORLA 5FTGA 5E8UA 3OS3A 2YCRA 1JOWB 2JKOA 1H1WA 2J2IB 1OM1A 4LFIA 5CSXA 5FEQA 5HCYA 4EQCA 1OMWA 2J0JA 2I1MA 3MN3A 3PJ3A 4O38A 4RVKA 5HE2A 3ZHPC 1PY5A 2H6DA 4QO9A 3PY0A 3PRIA 3R22A 5CQUA 3LZBA 3GNIB 5ETIA 3DK6A 3LCSA 1Y91A 3PXKA 2XBJA 4WT6A 4YJUA 4FKTA 4QTDA 5HIEA 4GFMA 4IX6A 5A6NA 2PMIA 4L7SA 5GZ9A 4ZJVA 3QRUA 3KREA 3H0YA 1ZOHA 3LXLA 3AT3A 2WTKB 2G1TA 4X0MA 4F0FA 4ACMA 1O6YA 2CMWA 3DKOA 3DZQA 3K2LA 4AA5A 2DWBA 4DHFA 2GNFA 3HRCA 2OJIA 4JR7A 2XP2A 2B54A 2H8HA 5D11A 4M67A 4HCUA 4R7HA 4KBKA 4IAIA 3Q2JA 4EBVA 2ITYA 3NX8A 4CKIA 2YEXA 2O2UA 2VWUA 1TKIA 3KL8A 2VX3A 3FZRA 3UOJA 3VUTA 5KMOA 2RFEA 3A7GA 4WUNA 5K5XA 1GIIA 1FVTA 4G9RA 2X1NA 3NPCA 5IH6A 4BCPA 4NT4A 4RFMA 3H9RA 4NKSA 4A4XA 1NY3A 2PE0A 3AC4A 3KU2A 4TXCA 4F99A 3ZEPA 4C02A 2IVUA 4FTRA 3U8WA 4NM0A 2PUUA 4P4CA 3E7OA 5FTQA 4ITIA 4FIJA 4PUZA 2V55A 3DFAA 5AP7A 4O2ZA 5CYIA 2QG7A 4J7BA 4YURA 2RG5A 4FGBA 3WF8A 1QPEA 3VUHA 3WZUA 4R78A 5I4NA 2OZAA 3VUIA 5JZNA 3L9MA 1M2RA 4I0SA 4CCUA 3C4FA 3PSDA 4AXAA 2AC5A 2C69A 2Z60A 5KUPA 5M53A 3QD3A 2I0VA 5AEPA 3F5UA 1NA7A 1ZWSA 5F1ZA 5KE0A 5EYCA 1YOLA 3KRXA 4ACGA 4YJNA 4RZWA 2QHMA 4MF0A 4PL3A 1H07A 3W55A 4L9IA 3SA0A 2R7BA 3R7VA 5JGBA 5DYJA 3B2WA 4MBJA 3LFDA 4RVTA 4Z7HA 3RK5A 2JBOA 4ZEGA 3FMNA 3UJGA 5IA4A 5M51A 3PY1A 5EFQA 5IQDA 2XYNA 3IW5A 4I93A 5HIBA 3SRVB 3L8PA 3FXXA 2W96B 4X2JA 3SRVA 4CFMA 4XOZA 5C8KA 3CD8A 4YZCA 4LV8A 2CNUA 5HO6A 2O64A 3FLWA 4FG9A 3UG2A 4IAFA 4ZZNA 5JGDA 4KINA 1YWNA 4RX7A 4DEDA 3OW4A 3R1QA 4R8QA 2WOUA 3D15A 4WRSA 3UC3A 3U51A 1JKSA 1K3AA 1Y8YA 2RFSA 2UZLA 3ZZWA 1XH8A 5E4HA 4YZBA 4R7BA 3Q96A 2XNEA 4C2VA 3BIZA 4X21A 4YC3A 3JVRA 4OBQA 4E3CA 5ANEA 4BICA 4CV9A 2FUMA 1OIQA 2O3PA 3R30A 4ZIMA 2VGOA 4F09A 3F5PA 4JG6A 5ANOA 4GG7A 4E5BA 3BHVA 4KAOA 2PVFA 3UIMA 1FMKA 1WBOA 4TWNA 3Q3BA 3TNQB 2CGXA 4I6HA 5BVDA 4DTAA 5TF9A 3WBLA 1OVEA 4F9CA 2WELA 4HZRA 5D7AA 3NUNA 3AQVA 4USDA 5A3XA 2XIYA 3MGYA 1W7HA 5F9EA 2OJ9A 4PTEA 2YAKA 3QBNA 4QP2A 5CU3A 2JDRA 2IN6A 4QMTA 3ZOSA 2YM8A 3EQIA 4KB8A 3MTFA 4L52A 4BYJA 3WZKA 4YLLA 3V5PA 3QWJA 1AGWA 4EK3A 4XV3A 2BTSA 3V6RA 3PDTA 5IQCA 4C61A 2FA2A 3CGFA 3OZ6A 4G3GA 4I0TA 5G1XA 2YM4A 3KK9A 5ANGA 1ZY5A 4FNWA 2YCFA 5M55A 4FKWA 3WI6A 4QYEA 3RAIA 2VX0A 4AZSA 5CF5A 2BROA 2HWPA 4FSUA 4G6LA 4TWCA 3UVQA 4D5KA 5AV3A 2JBPA 4HCTA 5J5TA 4Y8DA 2GFSA 4UALA 2W1EA 5A4TA 4EZ7A 2PULA 2QNJA 4YP8A 2XK3A 3VJOA 4I41A 5IUHA 4CTCA 5ANKA 4O7ZA 3QYZA 3A2CA 2CKPA 2GHLA 5IQFA 3VUGA 5CEMA 4FEVA 1O6KA 2VWZA 3QKKA 4GW8A 1O9UA 4FKQA 4UWBA 2W5HA 5FRIA 2X8IA 2X6EA 4J53A 3KEXA 2BFXA 2OH4A 2PUIA 4MD9E 2SRCA 2W4KA 1V1KA 2Z02A 4MXXA 2OLCA 5HG5A 2BKZA 3QRIA 5HKMA 5AJQA 3WE8A 1ZARA 3F82A 3R7OA 4FIEA 4WA9A 4PDSA 5L2SA 4LV5A 2R3GA 4AF3A 3VS2A 4X2KA 1FVRA 1CKJA 1OL1A 4CTBA 5LXMA 1OI9A 5ACBC 1ZYCA 1P5EA 5DG5A 2YISA 4LGGA 3W1FA 4FVQA 4XBRA 4FIIA 3IECA 4HVHA 3ZUUA 5AUXA 4RC3A 2OGVA 1P2AA 3EOCA 3HAVA 4M0YA 2XNMA 4O27B 2J5FA 2J7TA 3HRFA 3HDMA 5CVFA 2R2PA 2X39A 3G2FA 2RF9A 2OK1A 3P86A 4CXAA 5M44A 3DFCB 3HA8A 4IM2A 3FSKA 4J98A 2PZIA 4L45A 4QMVA 2YABA 1GNGA 4YJSA 3VWAA 4EKKA 3A4PA 4YSJA 4YHTA 3BEGA 3QD4A 3QTIA 4V01A 5C01A 3HEGA 3MWUA 2PVKA 4AACA 5E8XA 2H9VA 2UW8A 5HD7A 2BRGA 4Q9ZA 2R64A 4G1WA 2YITA 5IH4A 2RFDA 5CI6A 1YDRE 4F9YA 5ETFA 3K54A 3E8DA 4YTHA 4O7TA 1OUYA 5CF6A 3I5ZA 2OFVA 2R3RA 1XR1A 4IX3A 4YO4A 4IM0A 5KX8A 3LJ2A 3MVHA 4AGUA 3O96A 4IB5A 2WMQA 2GTNA 1SM2A 4BDFA 4DH1A 2VWBA 4V04A 4RWKA 4MXCA 5ANIA 3BYOA 5LOHA 4OT5A 2X9FA 3VBWA 3LFCA 4BCHA 1H27A 4RT7A 3UIUA 3VC4A 4F9AA 3C5IA 5CU2A 4C57A 1VZOA 4W4WA 3ZYAA 5C27A 2YN8A 1J1CA 2ZV9A 3CJFA 3F7ZA 2UZBA 4B8MA 4A4OA 5CEPA 5CU0A 1PXPA 4TNDA 3W16A 1BYGA 4F6WA 5J9LA 4APPA 3Q9YA 2BDJA 5D1JA 3GU4A 5FWKK 4A07A 3CGOA 2OXXA 3LCOA 4KIKA 4BTJA 1ZMVA 2PUPA 3EYGA 1F3MC 4FTCA 5M08A 2OW3A 2XB7A 3KRJA 4XHKB 2X7OA 4WIHA 1GZNA 3AT2A 3ZLWA 4BCJA 4BCQA 5AAGA 4WHZA 3LMGA 4DGOA 5CAVA 3AXWA 2WTVA 4CYIA 3HKOA 4DBXA 3BELA 3QZGA 2Y7JA 1TVOA 4UMQA 4XYFA 3TIZA 2Q0NA 2BRBA 3QQGA 2EU9A 4KWPA 3ZH8A 3GI3A 5JFVA 4EOIA 5JQ8A 4FKVA 3MPTA 3QKLA 3PLAE 2CNVA 2YM5A 4BBMA 1WCCA 2YWPA 4O0SA 5E8ZA 2PZ5A 3EN4A 4C62A 3FQSA 4FEWA 3RVGA 4GUBA 3FI2A 3JPVA 3Q6UA 4CMTA 4FIHA 5FDXA 4M14A 4DLIA 3IK3A 1G5SA 4HGLA 5ACKA 4OTFA 4TL0A 3VS4A 3T9TA 5A54A 2C3IB 2J0KA 4AGDA 2BR1A 3IW8A 3DBQA 1SYKA 4HW7A 4KKGA 4GRBA 5BNJA 1H1QA 3QX4A 3UQCA 4JL9A 4QP3A 1BUHA 4ZTSA 3E8NA 4L3PA 2WEVA 3PWYA 4IQ6A 1PXMA 2JKQA 4IIRA 3ULZA 4YTFA 2YERA 4KBCA 3SOAA 4D2TA 3DKCA 4BC6A 3WE4A 4D2SA 5HU3A 3TZ9A 4IZ7A 4HCVA 5EHOA 1CM8A 3QLFA 3I1AA 5AUZA 4CKJA 5J7BA 3EZVA 4DLJA 1CSNA 2IVVA 3KA0A 2G9XA 5HE1A 2X4ZA 3UO4A 3R6XA 4YMJA 3LCTA 5H8GA 5HO7A 4BTFA 1KWPA 5BVNA 2RL5A 3F88A 5KMJA 4JOAA 4KSQA 5AV2A 5H8BA 1CKIA 2I0YA 2XS0A 2R3PA 2R3IA 3F2RA 2WAJA 5LVLA 3ULIA 4I20A 4E26A 3H0ZA 4AWIA 4J8NA 2PE1A 4KA3A 1ZLTA 2WOTA 4IBMA 4PMMA 2UVYA 1UWHA 5IF1A 4MXOA 1DI9A 2YAAA 3CCNA 4HPUE 3D5XA 1PHKA 4K9YA 2QODA 5IU2A 4L46A 5A14A 4C4HA 2NNWB 2XEYA 4IJPA 4FTQA 3FZOA 2PZYA 1YQJA 3RAHA 4OT6A 3F61A 2GS2A 4TT7A 5BUJA 2W1DA 3G15A 4ALWA 1OPLA 1Z5MA 3NVMB 3C0HA 4WKQA 4D55A 3SAYA 1BI7A 3NYOA 4FNXA 4FV0A 2WTKC 5KHWA 1FBNA 4MWHA 3TKIA 3HV4A 3LOKA 5KZIA 4MX9A 5EQPA 1QL6A 3K5VA 3FLSA 3O23A 3QC4A 2ITPA 2J0LA 2OH0E 2OJJA 1H1RA 3DAKA 3GOPA 4G6OA 4MEDA 5EHYA 3IW7A 3ZDIA 4DG3E 4DFZE 4E4LA 3R73A 4ANNA 4EEVA 3NUXA 3QTWA 3ZSHA 1APME 3QA0A 1OIUA 4RX9A 2R3LA 4IZAA 1YWRA 4NM5A 1XBBA 4FKIA 4LOPA 1BX6A 3BKBA 3FY0A 2UZUE 4W8DA 2QOHA 4L6QA 4BZDA 2G2FA 2CJMA 4YNEA 3KXHA 1CMKE 3D83A 4G9CA 2WTIA 2BILB 3V8SA 4ZSJA 2WMBA 2Z8CA 4ZXTA 1R0PA 3JR1A 4FYOA 4YO6A 4H39A 3VN9A 3R71A 2YIRA 3Q9WA 4FV9A 5KKRC 3QGWA 3RBWA 2X2LA 4U0IA 1OPKA 3AD5A 4UZHA 1GJOA 3CTJA 4JBVA 4AN9A 4BCKA 3GOKA 3OOGA 4O22A 5IKWA 4F7LA 5CSPA 3LLTA 3P23A 2GCDA 5F94A 3V5TA 3OXIA 2VUWA 4Q9SA 3OTUA 3QTSA 4DINA 2E9PA 4A9YA 5LMBA 2ITWA 2Y4PA 3SG9A 2QU5A 3QTUA 3ATTA 2YHVA 4WG4A 5EW3A 2B53A 2YLFA 4XH6A 3TKHA 4PDPA 3GU7A 3S1HA 1RE8A 2QOLA 3AD6A 5HICA 3TNWA 3QUPA 4NU1A 4FG8A 4CFWA 4EZ3A 3TUDA 5IQHA 4JG8A 2GNGA 2DS1A 4MVFA 2V7OA 3RJCA 4JIAA 4E93A 2PPQA 3GXLA 3MTLA 3ALNA 4RJ7A 4MNEA 5HTCA 2XCHA 5GJGA 3JVSA 3FZTA 1YVJA 4M68A 4XNEA 4A9UA 2HZIA 4JX3A 4C3FA 3QHWA 5HQ0A 4BGQA 3BEAA 4FZ7A 3B8RA 3PZEA 4MBIA 2BZHB 4M8TA 5IZFA 3TKUA 3P5KA 3S00A 4M15A 4X3FA 3BYVA 4QYYA 5DWRA 2P2IA 4QRCA 3O51A 2J90A 3GT8A 3VHKA 4AE6A 1H26A 1XH4A 2F2CB 5C26A 3A8XA 2GPHA 4N70A 5FBOA 2XNGA 3VS1A 4YLJA 1XWSA 5JRSA 4NIFB 1PRYA 5KKRB 4GU6A 2VO0A 2WMVA 4M84A 3CS9A 4GYGA 5CQWA 3VAPA 4FZDB 4FSTA 5HO8A 4XUFA 3AC2A 2Y6MA 2ITXA 5E1SA 2HWOA 3DBCA 2OZOA 1L8TA 2C6EA 2BDWA 3NAYA 4QMSA 3V51A 4PMSA 4MXAA 2A4LA 3C13A 4H58A 1M7QA 4O21A 3EKKA 3W8LA 5JFSA 4N6ZA 3OY3A 4HGEA 3OTVA 3REPA 4ALVA 4PDYA 4FKUA 4B99A 3EFLA 3OROA 2YZAA 3FQEA 4KRDA 2XYUA 2JIUA 3HX4A 3WZJA 2WEIA 5CNNA 2WMSA 4UYAA 5EI8A 3IS5A 4R1YA 4C4EA 3LFEA 2O63A 2C5NA 3BE2A 4NYEA 3I6WA 3QKMA 1W8CA 2CDZA 4GT4A 5CX9A 5E8TA 2UUEA 4O0YA 4FTOA 1DAWA 4M7IA 4DGLC 2YLEA 3D9VA 3O8UA 4NW5A 4ZK5A 4BDCA 4I6BA 1NT2A 1NW1A 2GQSA 2VTLA 4FV6A 3DAJA 2BRMA 4GS6A 5EI2A 4O0VA 3TACA 2VD5A 4O96A 3FI4A 4GK4A 4AT4A 5KNJA 5M57A 3DV3A 4BDJA 3PJCA 4AFEA 4I1ZA 4RX8A 3QQJA 4CNHA 2XM9A 3DXNA 5GJFA 4JRVA 3LKMA 4ACDA 3PWDA 4HGSA 2WKMA 1JPAA 1PXIA 2CGVA 3FMMA 2JIIA 2OFUA 3GQLA 4BB4A 4DGNA 4IVAA 4Z9LA 3COHA 1KE9A 3TTJA 4QTEA 4Y83A 4YSMA 3SG8A 1H0VA 3F2NA 3TV6A 3ZC6A 4RWJA 5IPJA 3HNGA 5I3RA 3FMJA 4RIWA 4BIBA 3M11A 3FZ1A 3ORKA 1IA8A 4QMPA 2BIYA 5CANA 2XUUA 1A06A 2CNQA 3FJQE 3ZONA 3RHXA 4BKJA 4JQ7A 3HUCA 2JIVA 4HVDA 2BKKA 2VTPA 5AUVA 4XP3A 4FV8A 4KD1A 3PG3A 5DR2A 5EH0A 3T8OA 1KE5A 4CFFA 2QOCA 3HL7A 4KKEA 4R5SA 4O86A 3Q32A 2B9JA 4WNOA 3MVJA 3VS0A 2CHLA 5CXZA 3W32A 2W9FB 5E7RA 4EK5A 3DJ7A 4IADA 5EKNA 2BRHA 4I5CA 5K3YA 4EHZA 2C6MA 4IHPA 3FC2A 3IGGA 3P0MA 2GU8A 1OKYA 3D7TB 1AD5A 5AP0A 4PRJA 3COKA 5EKOA 3VF9A 4G17A 4YZDA 5AM7A 4NUSA 3QFVA 3UMWA 1IRKA 3W2OA 4D1SA 2VAGA 4L44A 3EFKA 3OXTA 4GCJA 3R1SA 3DBFA 5AR5A 2WMTA 4RFYA 3UOLA 2ZM1A 2XK7A 3PJ1A 3O7LB 4JJRA 4UYNA 3IW6A 4QPSA 2UW9A 2VTMA 5BYYA 3R8MA 3QTRA 4FOCA 3CTHA 3QRJA 3H4JA 3AGMA 3POZA 2VTQA 3HLLA 4BDIA 4M97A 3OVVA 3PA5A 4AZVA 4FSQA 5TOZA 3N4UA 5M09A 1MP8A 1JWHA 3HMMA 5IQEA 2W99B 1KE7A 1Q8TA 5E8SA 3FKLA 3HVCA 2ZB1A 1PXLA 3KVWA 4KRCA 4RIXA 2VO7A 2YDIA 4IZ5A 4N4SA 1U5QA 4BZNA 1GAGA 4O7YA 3NDMA 4IMYA 5C9CA 4ASXA 3GCQA 3UNKA 3ROCA 1TQIA 5EDQA 2WQBA 3UP2A 4Z3VA 3HZTA 2E2BA 3I0QA 4AA4A 4CGAA 3NW7A 3ZTXA 1STCE 3QXOA 3UO6A 3DGKA 5HTBA 3O8PA 3UVPA 4D1XA 3M42A 4FA2A 3BGZA 2W9ZB 3NYXA 3W18A 2O0UA 2UW6A 3C0GA 3EQGA 3PUPA 4RA5A 3F3TA 5CXHA 3KCFA 2JGZA 4I0RA 2ERKA 2W0JA 4I24A 4MK0A 1R3CA 4DFXE 2GMXA 1X8BA 1ZOEA 5LQFA 5DRDA 3EQCA 3I81A 3RWPA 3R8UA 4PL4A 3BYSA 4AT5A 3WF6A 4FC0A 3BLQA 3KRRA 5EG3A 2WIHA 3ORMA 3UPXA 5J79A 3ZXZA 4GG5A 1OKZA 2YDKA 5CU4A 3ATSA 2FSLX 3DA6A 2YZLA 4KNBA 3RM6A 3WYXA 2XK9A 3Q4ZA 3EN9A 3C4EA 3T9IA 3TV7A 2OF4A 2QCSA 5HCZA 4AG8A 5I9WA 4CLJA 1U5RA 2Z2WA 3ZRKA 5CEIA 2XKEA 5E92A 2PY3A 2W5AA 1DAYA 3FSFA 2PMLX 4FV5A 4H36A 4LI5A 2WHBA 4QTAA 1PYXA 1K2PA 3MDYA 4P2KA 1UWJA 4YHJA 5GHVA 2VTHA 3ACKA 1H28A 4JT3A 4EOQA 4TZRA 4O91A 3CQUA 3RPOA 4AOJA 4B8LA 4J96A 1WBTA 4LMNA 4BI1A 5IEYA 2FYSA 2BAJA 3EZRA 4XG7A 3I6UA 3R8PA 2JDOA 2QI8A 4QTBA 5DEYA 3THBA 3FI8A 4TN6A 2OXDA 1VYZA 4A06A 1PXJA 4ZTMA 1V0OA 2WTWA 4GH2A 3E3PA 1LUFA 5BMMA 4QMZA 4BI2A 5GINE 3GUBA 3A61A 2F2UA 2P33A 4MBLA 4S33A 3QTQA 3ZFXA 2PZRA 2OIDA 1SMHA 3MY0A 4YBJA 3V01A 4ZY4A 4BKZA 5L8LA 3V5QA 1OECA 4W4YA 4YNOA 5I9XA 3LCDA 3P7CA 4FG7A 4WBBB 2HW6A 2R3MA 5FXQA 3G90X 4LRMA 4CSVA 1YDTE 3C0IA 2OG8A 4HYSA 3CTQA 1M2PA 3R28A 4L68A 1OITA 1W83A 4R6VA 1B39A 1VEBA 4FT5A 3BU6A 3LXKA 5LVNA 1H01A 4OAVB 3WYYA 3SKCA 2OO8X 4IZYA 5AR4A 1NVSA 3IGOA 5T3QA 2VWYA 2VTNA 4Q5EA 4AFJA 5HESA 2HENA 2JFLA 4E20A 5IUGA 4KABA 2ZAZA 1WVYA 2ZDTA 3FMKA 4D2WA 3ZSGA 3DB6A 4ITHA 5AP5A 2HY81 4EKLA 4YHFA 3S95A 4JAJA 4AGCA 3QYWA 5HD4A 2PZPA 5LCJA 5LVMA 5CAQA 3RAWA 1BKXA 5GIOE 2IVTA 3NRMA 5DPVA 1FQ1B 4IAZA 3ZLYA 4EJNA 5EOBA 3MVMA 5J5SA 2ONLA 4C37A 5E91A 1FGIA 3DZOA 2VO6A 5JGAA 3HA6A 2R3NA 2LAVA 2EXCX 2WQNA 3FKNA 3ZMMA 4JIKA 5AR3A 4BIEA 5BMSA 2WXVA 4C7TA 4XP0A 4R3CA 5L2TA 3VBTA 1OBDA 5HX8A 4EOLA 1BLXA 4CQEA 4CRSA 4EORA 1YXSA 3TL8A 2JFMA 2G2IA 4QYHA 5HNGA 4UWYA 4DEAA 5FXRA 4DT9A 5KMNA 2J0IA 1QPDA 4X6RA 4C4JA 4X3FC 4WO5A 5HNBA 3IDBA 4U3YA 5CI7A 4YBKA 1YDSE 4LMUA 5J9ZA 4DA5A 2Z7QA 2NRUA 2Y6OA 4FNYA 3ZUVA 1LEZA 4M0ZA 2XMYA 4UWCA 3V8WA 4U7ZA 5E1EA 3UYSA 3VHEA 3UZRA 3PIZA 4X6QC 4YZMA 4IFGA 2CGWA 4DFNA 5K4JA 2QLUA 4UY9A 4O7LA 4M69B 3QQHA 1UU3A 4O7SA 3R21A 4XS2A 3CR0A 1YKRA 2IVSA 5IQIA 4QYFA 2UZVA 3UE4A 4HVSA 5EW8A 4YJTA 4TRLA 2ITNA 3QLGA 4PMTA 4W9XA 3LQ3A 3C4WA 4GV1A 4F1OA 3OWKA 3FE3A 3PRFA 2PHKA 3CLYA 4ENXA 2WQMA 3RP9A 4F7SA 1G8SA 4K33A 4AOTA 5A46A 2NO3A 1U46A 3RHKA 5A4QA 4BGHA 2VTIA 3KN6A 3KULB 5C4LA 4UN0C 4OBOA 3SX9A 4G34A 4O84A 2GNJA 5KZ0A 4AAAA 4D4SA 5L3AA 2BUJA 4X2FA 5BVKA 2XNPA 4IX4A 5CLPA 3NLBA 3LAUA 3PJ8A 4ANLA 1UVRA 1P4FA 3R0TA 1LP4A 2PVMA 3R7GA 4GT3A 4IH8A 4EK8A 5CSWA 1AQ1A 3R63A 1IAJA 2RSVA 1U54A 4DBNA 4DE4A 4EWHA 2NP8A 4JX7A 3GQIA 4HJOA 2QR8A 3U9NA 3AC8A 3ALOA 2CPKE 2XKFA 3MFUA 3T3UA 5TT7A 4O2PA 5IA2A 2B52A 4FKRA 2ITOA 3BU5A 3E8EA 1WVWA 1GZKA 4RIYB 5FD2A 2ZYBA 3UOHA 4FTAA 4EZ5A 3BYMA 5M4IA 3DXPA 1LR4A 1DS5A 5DI1A 5G6VA 4II5A 3E5AA 4DFBA 2R3JA 5FLFA 5CEKA 2BMCA 3JYAA 5ETAA 3UO5A 4PPAA 4R5YA 2FSOX 1Y8GA 4A9TA 3VS7A 4CZUA 5AADA 3UQGA 4IANA 4PF4A 1U59A 1ZXEA 3E8CA 4DCAA 4NCTC 3UNZA 5KBQA 4AN3A 4WBOA 5KHXA 4LRJA 3SV0A 4E8AA 5AA9A 3KXMA 1PMUA 3F5XA 4JBOA 5DFPA 4GJ2A 4JI9A 2UW5A 2R7IA 1L3RE 4FSWA 1HCKA 2BZKB 2P4IA 3E62A 2R3HA 1H1SA 4JDIA 4BTMA 3GC7A 4V0GB 2B9IA 3M2WA 3RALA 3MB6A 3UTOA 3RCDA 3K5UA 4FTUA 3FYJX 3DPKA 4I22A 3BQRA 2I0HA 5AP1A 3NUYA 2ITZA 5DR9A 2E9NA 3CXWA 3DKFA 3VULA 5C1QB 5M4UA 2BAQA 2BFYA 2WQOA 2CSNA 1JKKA 3CY3A 3LE6A 3LJ1A 3MBLA 1Q61A 3QZHA 3WZEA 5HCXA 5DLSA 3A7FA 3E3BX 3EJ1A 4IC7A 4FKSA 4OTQA 2X9EA 3ZM4A 3CY2A 5DVRA 2IW8A 5LWMA 3AD4A 4K18A 4CYJA 1CDKA 4F70A 4AZEA 2EVAA 1KOAA 3NUUA 3EQRA 5BVEA 1Q24A 4O1OA 5CS6A 5CZHA 5EM7A 4U9AA 3BGPA 1PXOA 3I60A 4XBUA 4O6EA 2JDTA 4LQMA 5EQYA 4ACHA 4F6SA 2W05A 5H2UA 3LQ5A 2QURA 2QOOA 2DQ7X 5LJJA 2PUNA 3CQEA 4ZJIA 3DBDA 3HDNA 3NW5A 1Q62A 4FSYA 4UB7A 2WO6A 4C4GA 4QPAA 4ZMFA 1ZYJA 4RSSA 3O50A 4UMUA 3WILA 2ZDUA 5DT3A 4FT3A 2E9UA 3RM7A 5T6KA 5AP6A 4FZAB 1CKPA 3VUKA 2PVJA 4EONA 3MH2A 3AT4A 4WNMA 4F63A 5TR6A 1YWVA 3QXPA 4MH7A 1RQQA 3COIA 2GHMA 4BGGA 1JSUA 4YJQA 4AW5A 5K5NA 3TZMA 4OTDA 1Q99A 1BL7A 4K11A 1REKA 4RGJA 4EH4A 4XLIA 5L8JA 3TDVA 3QZFA 4YJVA 1WVXA 4FTLA 4BCMA 4DH8A 2B9FA 2W1IA 2QOIA 3DAEA 4QOXA 4LUEA 4S34A 2ZB0A 5ANDA 4W4XA 1MRUA 2UZTA 5I9ZA 5TE0A 3EQBA 5HORA 1M2QA 3F2AA 2F57A 3KRWA 3QAME 2QLQA 2HIWA 4AZWA 2C68A 1Y6BA 3E93A 3LVPA 4Z16A 4BWPA 3U4WA 3PPKA 5DR6A 4QMUA 4Q5HA 5IDPA 3ZM9A 2EB3A 1Z9XA 3LFFA 3PSBA 4FUYA 2EXMA 2YM6A 1Z57A 4TYIA 4D1ZA 3ODZX 3I0OA 3I79A 3OBJA 3OF0A 1PMNA 3KMMA 5AR2A 4YPDA 3TXOA 3V6SA 4FV4A 2UVZA 3VRZA 5AR7A 1NXKA 1GY3A 4NCTA 4U6RA 3O2MA 4F7NA 4EL9A 3V8TA 1GZOA 2C6KA 2HY0A 3HMPA 2V5QA 2VWIA 3LXPA 3CIKA 1CTPE 3KGAA 3R1YA 4RLKA 2ITVA 2GNIA 2ETMA 3EB0A 1I09A 2WPAA 2ZJWA 2BHHA 4MHAA 4HVGA 4PY1A 4GEOA 5CEOA 2YCSA 3FUPA 5CY3A 3GC0A 4NEUA 3FLNC 4WD5A 4ERKA 3L9NA 3VBYA 3HECA 1WBWA 4FT7A 5HIDA 5CZIA 4QD6A 2YIXA 3ROYA 3HGKA 5JMSA 2Z7RA 3NYVA 1UNLA 2P0CA 4Y5QA 2CCIA 4O1PA 3EN5A 4N0SA 2V0DA 4GSBA 2C6LA 3F5GA 3P4KA 4IWQA 5CVGA 4AW1A 3VRYA 5IEVA 1VJYA 3JXWA 3NAXA 4BCNA 4EH3A 4FX3A 1R39A 2X7GA 4FEXA 5CF8A 3R7YA 5EW9A 2WNTA 4TW9A 3EWHA 4YJPA 4XG6A 3RMFA 3ZDUA 3LHJA 4MF1A 5JK3A 3U6JA 2X7FA 4BRXA 4M66A 2YJSA 4YTIA 5J1VA 5D10A 1Y57A 3DJ6A 3QRKA 4UV0A 5AWMA 2R0UA 3MS9A 1LPUA 1OKVA 2UW0A 5FXSA 4ZLOA 5HU9A 3SXFA 4K2RA 3G9NA 3AGLA 4E7WA 4UMTA 3D0EA 4ID7A 5IA5A 2J51A 4QTCA 3EHAA 3BV2A 4EH7A 1T46A 2YDJA 4G3DA 4HNFA 2PVNA 3ZO1A 2WMWA 3S4QA 1YOMA 2HXLA 3HYHA 3TIYA 1M14A 4QMQA 2F49A 3SXSA 4AUAA 4FT9A 3KCKA 3OCTA 2Y4IC 3QD0A 3NMUF 2X2MA 1OL2A 3DTCA 3FZPA 5A9UA 4RJ5A 5ETCA 3PIXA 4FEQA 3FLZA 2YWVA 4Y46A 2H96A 3P7BA 3BWJA 3N9XA 1MRVA 3SW4A 3F3UA 3PVBA 4MCVA 2WIPA 4USEA 4IC8A 2XRWA 5AUYA 4CD0A 2KTYA 4XRLA 4TPTA 3RPSA 1J3HA 4FNZA 4FTJA 3GCUA 2WMAA 4JBQA 4XG4A 4IWPA 4EH5A 3WOWA 4I92A 2OIQA 1V0BA 2XKDA 3LPBA 3WIKA 4QP8A 5FM2A 3TI1A 3R7IA 2B1PA 4XEYA 4ZY6A 4ZMEA 4XG2A 3ZS5A 5K9IA 4G3CA 4PL5A 3QD2B 3NUPA 3R9DA 5TKDA 3VQHA 1YXVA 3A8WA 2BDFA 3BZ3A 1ZZLA 3HP2A 5GZ8A 4DG2E 1KE8A 3VJNA 3OP5A 1EH4A 2HZ4A 4YZ9A 4BDDA 4FK3A 4EQMA 3ID6C 2GNHA 1J1BA 4JRNA 3LFAA 1QPJA 4IEBA 4IWOA 4M69A 4CZYB 5FEDA 2FVDA 2HZNA 5EQEA 4AP7A 1QCFA 3QCQA 4G5JA 5DIAA 4D2RA 4ZZOA 3MJ1A 4J52A 2QOQA 4ZTNA 5L2QA 2AYPA 2QOBA 5LMAA 2GQRA 3A7IA 1GZ8A 2ACXA 3PG1A 4ZLZA 5BUEA 4Z55A 5E9EA 4MD8E 4FKLA 3OWLA 5FDPA 2GS7A 2WMXA 4AW2A 3FAAA 4B6LA 4D5HA 4E4XA 4C8BA 5HBJA 1H08A 2EXEA 3PP1A 3SD0A 1W0XC 3EL8A 4U3ZA 3SC1A 3U54A 2UW3A 1XHAA 2F7XE 1I44A 2PWLA 1RJBA 4QP6A 1UU7A 5IUIA 3IW4A 4FKJA 3EYHA 1JKLA 2WTCA 1Q8ZA 2XVDA 3DK7A 4JQEA 3KXXA 4GFGA 3G6HA 4J71A 4MQ2A 3TNHA 5E8WA 4BBEA 1IAHA 3IG7A 4JBPA 5C4KA 4JNWA 3IDCA 4IVDA 1YI4A 2DUVA 3BPRA 4JDHA 2OF2A 2ZMDA 4AX8A 3IPHA 3FI3A 3NCGA 3RK9A 2IWIA 4C4FA 2QC6A 5D9HA 4FTMA 3ZRLA 3BHHA 4APCA 2YM3A 3NCZA 2X8DA 2A1AB 3A7HA 5HE3A 3TZ7A 3VVHA 5LWNA 3GBZA 4ORKA 4QQ5A 4U42A 4ANQA 4LOOA 3V3VA 5A6OA 3C4CA 3SQQA 5E8VA 3V5JA 1RDQE 5HZNA 2JAMA 3QQLA 3CEKA 4I5HA 4B4LA 2Y0AA 4CFUA 5BQ0A 3VNTA 3ACJA 3FBVA 2VTTA 4RRVA 1MUOA 4H3QA 2XH5A 3TV4A 1REJA 1Y6AA 2WU7A 3BGQA 4RVLA 3F6XA 2XA4A 4I6FA 3CE3A 5FUTA 4GKHA 5L6WL 4WUAA 1YHVA 2BIKB 3LW0A 4OTPA 3EFWA 2WZJA 4ANOA 5F4NA 4B9DA 1PKGA 3GFEA 3G5DA 1J7LA 3MPMA 3GCVA 3BLRA 2VWWA 3F7WA 4I5PA 4YTCA 2A0CX 5HTIA 1JNKA 3PIYA 4DAWA 2WGJA 2ESMA 3VS5A 1URWA 3EQPA 3SGCA 3TT0A 3VS3A 4UXLA 1PMVA 1OGUA 3DJ5A 5HVJA 4PPCA 3TCPA 3PXFA 4OGRA 3ANQA 3UIBA 4HOKA 3OUNB 5DH3A 3HMIA 5H8EA 4WOVA 4V0GA 4C59A 1BMKA 4IFCA 5J87A 5BVFA 2BRNA 3BX5A 1PJKA 2GTMA 4S30A 4G2FA 4TYEA 4F65A 2JC6A 3TNPC 3HV3A 5I3OA 3RKBA 3V5LA 4E4MA 2YA9A 4YU2A 4CV8A 5BPYA 2NRYA 3HAMA 5AP3A 3WZDA 5HX6A 3ZO4A 3ZRMA 5DMZA 2C1BA 4X3JA 4RJ4A 5JKGA 5DA3A 3PA3A 3C9WA 3NIEA 3OHTA 5BX0A 4C34A 5LCKA 1KE6A 2QO7A 2VTSA 1ZYDA 2ZM3A 4TTHB 4D0XA 3VS6A 3EQFA 4FTIA 1B38A 2ZOQA 3PYYA 3R8VA 2C6TA 4D2PA 3OW3A 3R7UA 2W1ZA 5EYMA 2J6MA 2X6DA 4R77A 2W5BA 3VUDA 4BI0A 3EN6A 4EC8A 3ZFYA 3S2PA 3PXYA 2B4SB 2R3QA 2I0EA 2XJ2A 3RNIA 2IZRA 3R9RA 2X4FA 3GGFA 3HP5A 4HPTE 4YJOA 3ZO2A 4I21A 4RVMA 5J7HA 2XK8A 5HLNA 2PU8A 4ZS4A 4R3PA 2H34A 3ZBXA 4WNKA 4L3LA 4XV9A 5DHJA 4UMPA 4LL0A 3RI1A 3AC5A 4MWIA 5IQBA 1E9HA 4F7JA 2Q0BA 3MY5A 4K77A 2BZJA 3ANRA 3U9CA 5CNOA 4ACCA 5AA8A 4DFUA 5HLWA 3TZ8A 4W8EA 4E73A 2FSMX 5HVYA 4O7RA 4L01A 4MAOA 3NNUA 3D5VA 3ZLSA 5CWZA 4A7CA 4KUJA 4HZSA 2OKRA 3ORZA 2CCHA 4D9UA 3P9JA 3CJGA 1OIRA 4I6QA 2W17A 3FYKX 4JDKA 4ZS0A 4B0GA 1UA2A 3MFTA 4O0XA 3TG1A 1H1PA 4G31A 3R2YA 2HOGA 1SVHA 3L8VA 1XQZA 4U81A 4ZSEA 2IW9A 4BTKA 5B2MA 4FEUA 5AFVA 2JLDA 2R5TA 3PTGA 3HV5A 2VWXA 4S2ZA 2F4JA 3Q4CA 1UNHA 4KBAA 4LUDA 4E6DA 3SVVA 1G8AA 3AMBA 4FKOA 4W9WA 1B6CB 3QTZA 3WIGA 2UZDA 4AT3A 1XJDA 1YI3A 3FWQA 2ZV2A 3G0EA 2Y9QA 3FHIA 3Q04A 3GU5A 5HHWA 4BHNA 2VNYA 4YC6A 3TDWA 4BKYA 5A4CA 2XCKA 3ERKA 3H3CA 4NFNA 5L6PA 3DY7A 3K3IA 1M7NA 4ZSAA 4C33A 4PNIA 4OAUC 2J5EA 3E87A 5JQ5A 5KBRA 1XH7A 3D5WA 5ITAA 1H25A 2C5VA 4ZSLA 4TWOA 3O7LD 3VBXA 2BTRA 3ET7A 3F9NA 4FTTA 5ANJA 4O82A 1KOBA 5M07A 3OG7A 4IXPA 4EBWA 1OZ1A 2HELA 4CKRA 4U79A 2OICA 5JSMA 2F9GA 2XJ1A 1MQ4A 1LEWA 4C38A 5A4LA 1R78A 3H30A 5FP5A 4RMZA 3I7CA 3OWPA 5CEQA 1WBVA 3CKXA 3KULA 4O7WA 2G15A 4DTBA 1VYWA 3HV7A 4A4LA 3LXNA 3QCXA 4PV0A 4DH7A 4XG8A 3UGCA 3NS9A 3U55A 3F3WA 4EOOA 4ZTLA 3UBDA 2ZV8A 4GKIA 3LFSA 4S32A 4BDAA 4DH5A 4RIOA 4J99A 5JT2A 5GJDA 1JVPP 4LG4A 3F3ZA 2WMUA 4QNYA 4NK9A 3A99A 3D2IA 5AUTA 2E9OA 3C4XA 3LQ8A 3P7AA 3D14A 4RC2A 4QMXA 4GFOA 3MW1A 5H9BA 4RJ8A 3R9OA 3KC3A 3KFAA 4EUTA 3F66A 3PVGA 4TYHB 3BYUA 4OTWA 4RIYA 4ZTRA 3FMHA 3EKNA 4DTKA 2ITQA 3PXZA 2A19B 2VTJA 3A7JA 4U8ZA 4F1TA 2JAVA 4I4FA 4QPMA 5E8YA 4BCIA 3DLZA 5AX3A 2NPQA 4P7EA 2XK6A 4L7FA 1Q3DA 3DK3A 4JR3A 2QKRA 3EQHA 5AMNA 1YRPA 4ASEA 5IEXA 3MY1A 3ORPA 4FL2A 5CT0A 5M4FA 2EB2A 3UPZA 4CMOA 5BUIA 3F69A 3I4BA 4QMWA 4F1MA 1XH6A 4I3ZA 5EM5A 4NJ3A 5DEWA 4D28A 3IQ7A 3O17A 4ZTQA 2PL0A 2I40A 3MFSA 4IE9A 4XMOA 2W06A 3C7QA 2A2AA 4OLIA 5JZJA 3C51A 3GU8A 3KVXA 2JEDA 3KF7A 3Q6WA 5EDRA 5BVOA 2X2KA 4E4NA 5LMKA 1OB3A 3DNDA 3A62A 4L53A 4OTIA 3FXZA 2PTKA 1IEPA 3QUDA 4H05A 4AGWA 4PPBA 3HUBA 2UW7A 4NIFA 3NEWA 2GHGA 1WZYA 3OWJA 3VO3A 2VO3A 4QP4A 4FVPA 3NIZA 3QQUA 4XLVA 2W1GA 4FV1A 3R02A 5EYKA 1J7UA 3TJDA 4DEGA 3RZBA 5FQDC 4MKCA 1QPCA 1V0PA 4BVUA 3A60A 3FY2A 5D7VA 1ZYSA 2UZWE 4MYGA 4RLLA 1WBSA 1WMKA 3QQFA 5B2LA 5HE0A 3HV6A 4E1ZA 2CLXA 3IO7A 4UX9A 4IDTA 4ZOGA 5AV4A 4ZLYA 4G6NA 2XF0A 4KS8A 3U6HA 1JBPE 3D7TA 3EMGA 4BF2A 1XBCA 2REIA 5AV0A 4CFNA 4E5WA 5AUUA 1ZMUA 3SHEA 4TKSA 5JEBA 3DTWA 5KMKA 4NZWB 4CG9A 3PFQA 3ENHA 4MNFA 4FSNA 5DE2A 2V62A 5KCVA 1URCA 5HG7A 3C50A 3LJ0A 4MQ1A 3ZO3A 2HW7A 4J1RA 4L8MA 2OZAB 3F3VA 4Q2AA 2F7ZE 2PSQA 4AOIA 5I9VA 1SVGA 2C6IA 2UV2A 1UU8A 4IW0A 2IZSA 4L42A 2I7QA 4IB3A 4TNBA 1U54B 4FYNA 4FMQA 2XJ0A 2QG5A 2Q83A 1JKTA 5CSVA 4AW0A 4D4YA 3NR9A 4AZFA 3MESA 1Q8UA 3FDNA 3M1SA 4E5AX 2W1FA 3QALE 3ZXTA 1SZMA 4G16A 3DU8A 4IX5A 4CT1A 1OL5A 5DOSA 4I23A 3NGAA 3KQ7A 4FSRA 4IAAA 3NSZA 4PTGA 3TEIA 3UG1A 2QOKA 3PJ2A 3Q9XA 5KO1A 5L4QA 1HCLA 3UQFA 5AIRA 3Q53A 3SDJA 3RTPA 3OEFX 1A48A 5HNIX 1H8FA 3H10A 3RGFA 1ZAOA 3AMAA 4KIQA 4BFMA 2IW6A 3E92A 4MTAA 1H0WA 4LOQA 2O65A 4OTGA 4F08A 4PP7A 4EHGA 4FICA 4H3PA 2IO6A 4M13A 4IVBA 4LL5A 2YFXA 2UZOA 2OSCA 1PYEA 4QQJA 1MRYA 3GEQA 3NUSA 5FP6A 2CN8A 4P5ZA 3IOKA 2YJRA 1BI8A 3DDQA 4XX9A 3EQDA 5CSHA 3Q52A 4HYUA 1FOTA 2BCJA 3P78A 2EUFB 2B0QA 3FZSA 4EUUA 4FSZA 4WSYA 4CG8A 4U41A 4LRKA 3BWFA 4Y85A 4Y95A 4KIKB 1SVEA 4XP2A 5FGKA 4EJ7A 1IR3A 4P90A 3ZZEA 4JXFA 3JUHA 3QHRA 3OC1A 2C0OA 4YC8A 3BI6A 2C4GA 4DITA 5BYZA 4USFA 2QHNA 5KMIA 2GDOA 2XIKA 1ZZ2A 3FPMA 5EI6A 4FODA 4X7QA 3RPVA 1ZYLA 3QL8A 4GU9A 4K8AA 4ASDA 3W10A 5K0XA 4ERWA 4UXQA 4FBXA 3JS2A 5DN3A 3CSVA 4EH2A 2W1CA 2OU7A 3CPBA 3E64A 1S9IA 3OY1A 4CRLA 4GK3A 3GU6A 3IKAA 4WSQA 3RPYA 4XOYA 3AOXA 5B2KA 2VV9A 4IWDA 3VF8A 4BCGA 4F9WA 4QMNA 1ZOGA 2I6LA 3VBVA 1ERKA 2XIRA 4GJ3A 5EK7A 5D12A 3Q2MA 3BU3A 3MH3A 4D0WA 5IA0A 1PW2A 4FOBA 3Q4UA 3P79A 2OJGA 3N4VA 4EOJA 5FTOA 5DNRA 4Z7GA 5HBHA 3DS6A 5CF4A 4RJ6A 2XZSA 4IM3A 5HVKA 3P08A 1OL6A 4FV7A 3FPQA 4E6CA 4RC4A 3O71A 3PE1A 4JLCA 1KV2A 2R3KA 4M12A 4WG3A 4CCBA 3ORIA 1U4DA 2QVSE 4O0WA 3U4UA 3GC8A 2GS6A 3MB7A 5I9UA 4EOSA 3FXWA 2ITUA 5BYLA 4AQCA 3DXQA 3FHRA 2QQ7A 3LCKA 5B0XA 3LFNA 4O0RA 4U97A 3OUKA 4ZTHA 4F0IA 3QC9A 1Q8YA 4M3QA 5B7VA 4NJDA 2C0TA 4DEEA 4S31A 4YJRA 2JITA 4CT2A 4XRJA 2J9MA 5F95A 5CASA 3R7EA 2EWAA 5CAUA 4IB1A 3TNIA 3QGYA 2IZUA 5M56A 2FSTX 2JKMA 4A9SA 4FV3A 1FGKA 5BVWA 3LM5A 3ZEWA 4FE2A 2J0MB 2X8EA 1J91A 2P3GX 2VTAA 4EH9A 3UIXA 5CVHA 4BBFA 4FGRA 2VZ6A 4RPVA 5KMMA 5LVOA 1H4LA 2C5YA 4EH8A 1WBPA 4FV2A 2VX1A 3Q60A 2ERZE 4RG0A 4FZFB 3OCSA 4OW8A 1XH9A 5M06A 1YXUA 2ETRA 4ITJA 4MXZA 2B7AA 4C4IA 3G0FA 3OOMA 3OBGA 3VW6A 1OUKA 4DFLA 1GIJA 3FC1X 3GB2A 3EH9A 4JDJA 3QUEA 4CEGA 2QO2A 3C5UA 2VTRA 4TYJA 2CGUA 2Y8OA 4AA0A 2YIYA 3KK8A 4C58A 3RNYA 4GVJA 3BBWA 4CZTA 4OUCA 4QP1A 4RQKA 1J7IA 3UVRA 3PXRA 5C03A 5FBNC 3C4ZA 2HCKA 3FV8A 4LGHA 5HLPA 5CAOA 4EH6A 1P14A 2XNOA 1XBAA 2YIWA 4BIDA 4DEBA 5I5ZA 4PMPA 4TWPA 4FT0A 3G33A 1PF8A 4FTNA 4YUQA 4NH1A 4RWIA 3B2TA 1JSTA 2W1HA 3NUAA 4U43A 4NKAA 4GL9A 4KS7A 4O7VA 3HMNA 4EK4A 4O0TA 3LFBA 3RWQA 1E1XA 4EWQA 4GIHA 2BAKA 3QQKA 2C30A 2HXQA 3DLSA 3E7VA 3GCSA 3GFWA 3RPRA 4X2NA 4QQCA 5EM8A 3CBLA 4X3FB 4JAIA 4R3RA 1YW2A 4WG5A 4RIWB 3DCVA 4EOKA 1R1WA 5CALA 3MH1A 3OT8A 3PY3A 5H3QA 4FKGA 4BCOA 3H9OA 2C5XA 3BHTA 2GFCA 4H1MA 4L67A 4NL0A 2PVYA 1KUTA 3LLAA 4L3JA 4YZNA 3COMA 2QD9A 4XCUA 2YIQA 3VUMA 4HYIA 4K0YA 4CVAA 2PMNX 5T68A 5IA3A 3CD3A 3MYGA 4DCEA 2PVHA 4RWLA 1ZY4A 4FIFA 3W2QA 4IAKA 2GQGA 3N51A 3SW7A 5JH6A 3DOGA 3D94A 3G51A 4BZOA 2HAKA 4DGGA 2BALA 2C47A 4FTKA 1ND4A 1M17A 4OTRA 2W4JA 1H00A 3QX2A 2P55A 3DBEA 2AC3A 3PPJA 3L9PA 4NSTA 4D58A 4NWMA 5C8MA 4QQTA 3MH0A 5I9YA 4EQUA 3FL4A 3OEZA 3MPAA 4BDKA 1UU9A 4FIGA 2B9HA 3FMEA 3MA3A 3OCBA 1OKWA 3LIJA 4BN1A 4EYJA 3UNJA 3NVKI 1PMEA 4LYNA 4GYIA 2FGIA 5DRBA 3SLSA 2CKQA 1DM2A 5EOLA 3OMVA 5AM6A 4DH3A 1UV5A 3DKGA 3E88A 2IJMA 3PSCA 4IDVA 4QP7A 1YHSA 1BL6A 4JQ8A 4ZY5A 3PA4A 4ENYA 5K4IA 3UZTA 3RK7A 2W4OA 5FG8A 1K9AA 5CT7A 5M4CA 1S9JA 2OWBA 2WTDA 4ZAUA 2UVXA 3DDPA 5AAEA 4D4RA 5HI2A 2R3FA 4DF3A 3C1XA 4QT1A 3NYNA 4RQVA 3RZFA 2XKCA 3OCGA 3UMXA 4BY9E 5IH5A 4QP9A 3FKOA 3NNXA 1XH5A 5DBXA 4WNPA 3MIAA 2C0IA 4E6QA 2VTOA 4J97A 3BLHA 3D2KA 3UZPA 5L2WA 2DYLA 1NVRA 3ZFMA 1YXTA 4DG0E 3TJCA 1JAMA 3TM0A 1W84A 4L00A 3CKWA 3ETAA 2A27A 3NW6A 2FO0A 5DT0A 3UODA 3ELJA 2C6DA 2C3JA 4NM7A 4RA4A 3H9FA 4KSPA 3PE2A 2UZNA 4TYHA 3CPCA 3IDPA 4GIIA 2R3OA 4N57A 1TQPA 4I4EA 1NVQA 4GK2A 5AAFA 4FF8A 3WF5A 2PE2A 3QRTA 2ZM4A 3VW8A 2R0IA 3PZHA 4ANSA 5J8IA 4HVIA 1Q41A 2XEZA 4L43A 3W2CA 3OFMA 2PMOX 2BHEA 2XIZA 3P1AA 5F20A 1GIHA 2GNLA 2OBJA 4ONAA 3ZSIA 4KIPA 2X0GA 2QKWB 2YACA 3MA6A 4U80A 2VNWA 3JY9A 4UEUA 1OIYA 4C3RA 4YPSA 3V04A 2YCQA 3PXQA 5GZAA 1VR2A 2CLQA 3L9LA 4RBLA 4EOMA 3KXGA 3UYTA 3II5A 4HGTA 2G2HA 3I5NA 3MJ2A 4YR8A 4K6ZA 3BHYA 2VU3A 4ANBA 4EK6A 3MI9A 4PX6A 2WQEA 3FEGA 1XO2B 4FZ6A 4UMRA 5JRQA 3GENA 2VWVA 3QZIA 1OL7A 5CENA 1O6LA 3TTIA 3PVUA 3UDBA 4NFMA 1T45A 3CQWA 3CP9A 1W98A 3R2BA 1QMZA 3VBQA 4Y72A 2C3LA 5CAPA 1KV1A 4CFVA 5HG8A 3BQCA 3R1NA 2IG7A 4BHZA 1Q5KA 4UZDA 4A9RA 5I0BA 2ETKA 3AG9A 3D5UA 3L1SA 4MXYA 3FMLA 3W2SA 4BDEA 4C0TA 2IZTA 3TWJA 3LM0A 4O7NA 3PVWA 2PK9A 2UW4A 2O5KA 4FR4A 2XM8A 3MFRA 3FL5A 3KXNA 5D41A 5CTPA 4XJ0A 4QYGA 4AN2A 3DT1A 5DGZA 4CMUA 2OI4X 4D2VA 2RKUA 4F0GA 1YXXA 2VRXA 4O6LA 2RIOA 4Y73A 4RJ3A 2XNBA 4PQNA 4JS8A 3ENMA 4EI4A 5L8KA 2HZ0A 1A9UA 3RCJA 3ZUTA 2C6OA 4PWNA 2V22A 3R8ZA 1MQBA 2R9SA 5AV1A 4F9BA 3S0OA 1XKKA 3AMYA 4DEHA 3R04A 2VN9A 2P2HA 3BRBA 4DT8A 3KMWA 1GOLA 3QCYA 4UBAA 5AP2A 3PPZA 4NW6A 4U40A 5CU6A 5HEZA 3IONA 4IB0A 3UP7A 2RGPA 4OR5A 4DFYA 3D4QA 3GVUA 4JVGA 5FM3A 5IQGA 5IDNA 2OJFE 5C8NA 3D7ZA 4J95A 4XG3A 3ZCLA 4F64A 1FVVA 4QMLA 5AX9A 2OIBA 5AIKA 5A4EA 3KMUA 4U5JA 4YLKA 4O83A 4XV1A 5J9YA 3U87A 2FB8A 3L8XA 3MVLA 2CKEA 4OTHA 2ZMCA 4MNEB 3O0GA 2HYYA 2Z7LA 3K3JA 1W82A 3A4OX 3ORXA 4G5PA 4GUEA 4CFXA 1FPUA 2O8YA 3O8TA 4CLIA 2XBAA 1FINA 4QMMA 4FL1A 3T3VA 1YI6A 3UC4A 3VIDA 4BDGA 5LMKC 1JLUE 2QO9A 4EC9A 3NNVA 3OXZA 1TQMA 2JKKA 3FQHA 5EYDA 1HOWA 3UOKA 1IASA 4LGDA 3IOPA 2OXYA 3W2PA 2QOFA 3DNEA 4JG7A 4RFZA 4ARKA 1SNXA 4BCFA 2XIXA 4H3BA 4EOPA 3N4TA 4IAYA 2WMRA 2WU6A 1E1VA 5FEEA 3R9HA 4WRGA 1FMOE 4GT5A 3PP0A 3R9NA 4U44A 3NNWA 3KN5A 3ORNA 5IA1A 2JD5A 5J1WA 5HG9A 2J4ZA
chains in the Genus database with same CATH superfamily
4PP9A 5K0KA 3EIDA 3KKVA 4ZSGA 4ZJJA 4CQGA 3G6GA 4KKHA 3VQUA 5EHLA 1WBNA 3ZU7A 4ALUA 4DGMA 2Y4IB 3QTXA 1ZMWA 2WB8A 3KRLA 5IMEA 5JFXA 3CC6A 3B8QA 1ZRZA 3RINA 3W8QA 3Q9ZA 3ZLXA 1JQHA 3AKLA 4DC2A 3BV3A 3EFJA 4ZZMA 2F7EE 4C2WA 5GIPE 3W2RA 2C3KA 5JFWA 2JDSA 2VGPA 4W4VA 4DYMA 2GSFA 1IG1A 1JSVA 3AC1A 2ONLC 5J95A 4RX5A 1Q4LA 2QONA 3W33A 4I94A 3MSSA 2V7AA 4F6UA 2LGCA 2ZVAA 3DQWA 3GC9A 4NM3A 2XRUA 3Q5IA 4X2GA 2FH9A 3RAKA 4O0UA 3QU0A 1PKDA 3TUCA 3DQXA 3QA8A 4J8MA 4GVAA 4C36A 1Q8WA 3ORTA 4NTSA 3R83A 2QU6A 3LMIA 1YHWA 4PTCA 4AE9A 3I7BA 3GP0A 4FKPA 2J50A 5EM6A 4FVRA 4QMOA 4XG9A 4BDBA 4BL1A 1KSWA 4YGAA 5E90A 1M52A 4D4VA 3BHUA 4H1JA 2BPMA 3MV5A 3S3IA 4BYIA 4R1VA 3FLQA 4BDHA 4ZP5A 4B7TA 3GCPA 4R7IA 3G9LX 4TY1A 5LVPA 4ANMA 3DB8A 3OD6X 3POOA 4OBPA 2X81A 4KIOA 4AZTA 3TN8A 1OBGA 1PXNA 3EL7A 3ODYX 4FI1A 3WF9A 3BE9A 3MIYA 1Q97A 2WD1A 3Q5ZA 3LFQA 3NWWA 4FL3A 5AR8A 3AC3A 4DHJA 5KMLA 3FMDA 2C5OA 4IVCA 5EDPA 4AU8A 3KXZA 2RG6A 3R00A 3ZC5A 5HBEA 2BZIB 3HMOA 5IG1A 4D9TA 2W7XA 4U45A 1F0QA 5IQAA 1SNUA 1W2DA 3SXRA 4G3FA 3W0OA 3OT3A 4ASZA 2PYWA 4BWKA 2ZFYA 1R0EA 3LMHA 2Z7SA 2WFYA 1WFCA 4LM5A 4C35A 5AUWA 3EN7A 2JDVA 3BCEA 2XAOA 3KY2A 3SOCA 4FSMA 4HNIA 4E6AA 3HRBA 1UKIA 2PVLA 1P4OA 1G3NA 4V05A 4EYMA 1F5QA 5IMXA 5JN2A 2YM7A 3QCSA 3BBTB 4IACA 3ITZA 2XNNA 5HOAA 2PVRA 2C1AA 3QF9A 4DN5A 2HK5A 2XK4A 4FUXA 4GMYA 1H24A 3V5WA 4O81A 1RW8A 3FLYA 4XV2A 3QWKA 5GNKA 5L6OA 3PLSA 2CKOA 3KF4A 1UKHA 2QR7A 4EHEA 3BL9A 3TUBA 4QNAA 2G01A 5ICPA 4C3PA 2AUHA 3L8SA 4K1BA 5TO8A 2BVAA 4N6YA 2IPXA 4Y5HA 5L2IA 4BR3A 1YOJA 3ZBFA 1IA9A 1ATPE 1DI8A 4MD7E 4AS0A 3KB7A 2E9VA 1Q3WA 5AP4A 3W0PA 1WAKA 4RZVA 1UNGA 4NTTA 5LARA 4RIXB 3JY0A 5HGIA 5IISA 3R8LA 4QMYA 1PXKA 2B55A 2ZV7A 4P5QA 4EHVA 4BWXA 4PNKA 4PDOA 4IJ9A 2ITTA 3WF7A 3U6IA 2KULA 2UZEA 5DT4A 4F4PA 3WARA 4FK6A 2WTJA 2RFNA 2R4BA 4O4CA 4TYGA 3R01A 4G3EA 4HYHA 3NZ0A 4I5MA 4DEIA 1OPJA 3Q4TA 2CN5A 3E63A 3ORLA 2XARA 5E8UA 5FTGA 3OS3A 2YCRA 1JOWB 2JKOA 1H1WA 2J2IB 1OM1A 4LFIA 5CSXA 5FEQA 5HCYA 4EQCA 1OMWA 2J0JA 2I1MA 3MN3A 3PJ3A 4O38A 4RVKA 5HE2A 3ZHPC 1PY5A 2H6DA 4QO9A 3PY0A 3PRIA 3R22A 5CQUA 3LZBA 3GNIB 3TYKA 5ETIA 3DK6A 3LCSA 1Y91A 3PXKA 2XBJA 4WT6A 4YJUA 4FKTA 4QTDA 5HIEA 4GFMA 4IX6A 5A6NA 2PMIA 4L7SA 5GZ9A 4ZJVA 3QRUA 3KREA 3H0YA 1ZOHA 3LXLA 3AT3A 2WTKB 2G1TA 4X0MA 4F0FA 4ACMA 1O6YA 2CMWA 3DKOA 3DZQA 3K2LA 4AA5A 2DWBA 4DHFA 2GNFA 3HRCA 2OJIA 4JR7A 2XP2A 2B54A 2H8HA 5D11A 4M67A 4HCUA 4R7HA 4KBKA 4IAIA 3Q2JA 4EBVA 2ITYA 3NX8A 4CKIA 2YEXA 2O2UA 2VWUA 1TKIA 3KL8A 2VX3A 3FZRA 3UOJA 3VUTA 5KMOA 2RFEA 3A7GA 4WUNA 5K5XA 1GIIA 1FVTA 4G9RA 2X1NA 3NPCA 5IH6A 4BCPA 4NT4A 4RFMA 3H9RA 4NKSA 4A4XA 1NY3A 2PE0A 3AC4A 3KU2A 4TXCA 4F99A 3ZEPA 4C02A 2IVUA 4FTRA 3U8WA 4NM0A 2PUUA 4P4CA 3E7OA 5FTQA 4ITIA 4FIJA 4PUZA 2V55A 3DFAA 5AP7A 4O2ZA 5CYIA 2QG7A 4J7BA 4YURA 2RG5A 4FGBA 3WF8A 1QPEA 3VUHA 3WZUA 4R78A 5I4NA 2OZAA 3VUIA 5JZNA 3L9MA 1M2RA 4I0SA 4CCUA 3C4FA 3PSDA 4AXAA 2AC5A 2C69A 2Z60A 5KUPA 5M53A 3QD3A 2I0VA 5AEPA 3F5UA 1NA7A 1ZWSA 5F1ZA 5KE0A 5EYCA 1YOLA 3KRXA 4ACGA 4YJNA 4RZWA 2QHMA 4MF0A 4PL3A 1H07A 3W55A 4L9IA 3SA0A 2R7BA 3R7VA 5JGBA 5DYJA 3B2WA 4MBJA 3LFDA 4RVTA 4Z7HA 3RK5A 2JBOA 4ZEGA 3FMNA 3UJGA 5IA4A 5M51A 3PY1A 5EFQA 5IQDA 2XYNA 3IW5A 4I93A 5HIBA 3SRVB 3L8PA 3FXXA 2W96B 4X2JA 3SRVA 4CFMA 4XOZA 5C8KA 3CD8A 4YZCA 4LV7A 4LV8A 2CNUA 5HO6A 2O64A 3FLWA 4FG9A 3UG2A 4IAFA 4ZZNA 5JGDA 4KINA 1YWNA 4RX7A 4DEDA 3OW4A 3R1QA 4R8QA 2WOUA 3D15A 4WRSA 3UC3A 3U51A 1JKSA 1K3AA 1Y8YA 2RFSA 2UZLA 3ZZWA 1XH8A 5E4HA 4YZBA 4R7BA 3Q96A 2XNEA 4C2VA 3BIZA 4X21A 4YC3A 3JVRA 4OBQA 4E3CA 5ANEA 4BICA 4CV9A 2FUMA 1OIQA 2O3PA 3R30A 4ZIMA 2VGOA 4F09A 3F5PA 4JG6A 5ANOA 4GG7A 4E5BA 3BHVA 4KAOA 2PVFA 3UIMA 1FMKA 1WBOA 4TWNA 3Q3BA 3TNQB 2CGXA 4I6HA 5BVDA 4DTAA 5TF9A 3WBLA 1OVEA 4F9CA 2WELA 4HZRA 5D7AA 3NUNA 3AQVA 4USDA 5A3XA 2XIYA 3MGYA 1W7HA 5F9EA 2OJ9A 4PTEA 2YAKA 3QBNA 4QP2A 5CU3A 2JDRA 2IN6A 4QMTA 3ZOSA 2YM8A 3EQIA 4KB8A 3MTFA 4L52A 4BYJA 3WZKA 4YLLA 3V5PA 3QWJA 1AGWA 4EK3A 4XV3A 2BTSA 3V6RA 3PDTA 5IQCA 4C61A 2FA2A 3CGFA 3OZ6A 4G3GA 4I0TA 5G1XA 2YM4A 3KK9A 5ANGA 1ZY5A 4FNWA 2YCFA 5M55A 4FKWA 3WI6A 4QYEA 3RAIA 2VX0A 4AZSA 5M08A 5CF5A 2BROA 2HWPA 4FSUA 4G6LA 4TWCA 3UVQA 4D5KA 5AV3A 2JBPA 4HCTA 5J5TA 4Y8DA 2GFSA 4UALA 2W1EA 5A4TA 4EZ7A 2PULA 2QNJA 4YP8A 2XK3A 3VJOA 4I41A 5IUHA 4CTCA 5ANKA 4O7ZA 3QYZA 3A2CA 2CKPA 2GHLA 5IQFA 3VUGA 5CEMA 1TFFA 4FEVA 1O6KA 2VWZA 3QKKA 4GW8A 1O9UA 4FKQA 4UWBA 2W5HA 5FRIA 2X8IA 2X6EA 4J53A 3KEXA 2BFXA 2OH4A 2PUIA 4MD9E 2SRCA 2W4KA 1V1KA 2Z02A 4MXXA 2OLCA 5HG5A 2BKZA 3QRIA 5HKMA 5AJQA 3WE8A 1ZARA 3F82A 3R7OA 4FIEA 4WA9A 4PDSA 5L2SA 4LV5A 2R3GA 4AF3A 3VS2A 4X2KA 1FVRA 1CKJA 1OL1A 4CTBA 5LXMA 1OI9A 5ACBC 3W0RA 1ZYCA 1P5EA 5DG5A 2YISA 4LGGA 3W1FA 4FVQA 4XBRA 4FIIA 3IECA 4HVHA 3ZUUA 5AUXA 4RC3A 2XAMA 2OGVA 1P2AA 3EOCA 3HAVA 4M0YA 2XNMA 4O27B 2J5FA 2J7TA 3HRFA 3HDMA 5CVFA 2R2PA 2X39A 3G2FA 2RF9A 2OK1A 3P86A 4CXAA 5M44A 3DFCB 3HA8A 4IM2A 3FSKA 4J98A 2PZIA 4L45A 4QMVA 2YABA 1GNGA 4YJSA 3VWAA 4EKKA 3A4PA 4YSJA 4YHTA 3BEGA 3QD4A 3QTIA 4V01A 5C01A 3HEGA 3MWUA 2PVKA 4AACA 5E8XA 2H9VA 2UW8A 5HD7A 2BRGA 4Q9ZA 2R64A 4G1WA 2YITA 5IH4A 2RFDA 5CI6A 1YDRE 4F9YA 5ETFA 3K54A 3E8DA 4YTHA 4O7TA 1OUYA 5CF6A 3I5ZA 2OFVA 2R3RA 1XR1A 4IX3A 4YO4A 4IM0A 5KX8A 3LJ2A 3MVHA 4AGUA 3O96A 4IB5A 2WMQA 2GTNA 1SM2A 4BDFA 4DH1A 2VWBA 4I6LA 4MUQA 4V04A 4RWKA 4MXCA 5ANIA 3BYOA 5LOHA 4OT5A 2X9FA 3VBWA 3LFCA 4BCHA 1H27A 4RT7A 3UIUA 3VC4A 4F9AA 3C5IA 5CU2A 4C57A 1VZOA 4W4WA 3ZYAA 5C27A 2YN8A 1J1CA 2ZV9A 3CJFA 3F7ZA 2UZBA 4B8MA 4A4OA 5CEPA 5CU0A 1PXPA 4TNDA 3W16A 1BYGA 4F6WA 5J9LA 4APPA 3Q9YA 2BDJA 5D1JA 3GU4A 5FWKK 4A07A 3CGOA 2OXXA 3LCOA 4KIKA 4BTJA 1ZMVA 1G8KA 3EYGA 1F3MC 4FTCA 2PUPA 2OW3A 2XB7A 3KRJA 4XHKB 2X7OA 4WIHA 1GZNA 3AT2A 3ZLWA 4BCJA 4BCQA 5AAGA 4WHZA 3LMGA 4DGOA 5CAVA 3AXWA 2WTVA 4O4BB 4CYIA 3HKOA 4DBXA 3BELA 3QZGA 2Y7JA 1TVOA 4UMQA 4XYFA 3TIZA 2Q0NA 2BRBA 3QQGA 2EU9A 4KWPA 3ZH8A 3GI3A 5JFVA 4EOIA 5JQ8A 4FKVA 3MPTA 3QKLA 3PLAE 2CNVA 2YM5A 4BBMA 1WCCA 2YWPA 4O0SA 5E8ZA 2PZ5A 3EN4A 4C62A 3FQSA 4FEWA 3RVGA 4GUBA 3FI2A 3JPVA 3Q6UA 4CMTA 4FIHA 5FDXA 4M14A 4DLIA 3IK3A 1G5SA 4HGLA 5ACKA 4OTFA 4TL0A 3VS4A 3T9TA 5A54A 2C3IB 2J0KA 4AGDA 2BR1A 3IW8A 3DBQA 1SYKA 4HW7A 4KKGA 4GRBA 5BNJA 1H1QA 3QX4A 3UQCA 4JL9A 4QP3A 1BUHA 4ZTSA 3E8NA 4L3PA 2WEVA 3PWYA 4IQ6A 1PXMA 2JKQA 4IIRA 3ULZA 4YTFA 2YERA 4KBCA 3SOAA 4D2TA 3DKCA 4BC6A 3WE4A 4D2SA 5HU3A 3TZ9A 4IZ7A 4HCVA 5EHOA 1CM8A 3QLFA 3I1AA 5AUZA 4CKJA 5J7BA 3EZVA 4DLJA 1CSNA 2IVVA 3KA0A 2G9XA 5HE1A 2X4ZA 3UO4A 3R6XA 4YMJA 3LCTA 5H8GA 5HO7A 4BTFA 1KWPA 5BVNA 2RL5A 3F88A 5KMJA 4JOAA 4KSQA 5AV2A 5H8BA 1CKIA 2I0YA 2XS0A 2R3PA 2R3IA 3F2RA 2WAJA 5LVLA 3ULIA 4I20A 4E26A 3H0ZA 4AWIA 4J8NA 2PE1A 4KA3A 1ZLTA 2WOTA 4IBMA 4PMMA 2UVYA 1UWHA 5IF1A 4MXOA 1DI9A 2YAAA 3CCNA 4HPUE 3D5XA 1PHKA 4K9YA 2QODA 5IU2A 4L46A 5A14A 4C4HA 2NNWB 2XEYA 4IJPA 4FTQA 3FZOA 2PZYA 1YQJA 3RAHA 4OT6A 3F61A 2GS2A 4TT7A 5BUJA 2W1DA 3G15A 4ALWA 1OPLA 3BL7A 1Z5MA 3NVMB 4AXDA 3C0HA 4WKQA 4D55A 3SAYA 1BI7A 3NYOA 4FNXA 4FV0A 2WTKC 5KHWA 1FBNA 4MWHA 3TKIA 3HV4A 3LOKA 5KZIA 4MX9A 5EQPA 1QL6A 3K5VA 3FLSA 3O23A 3QC4A 2ITPA 2J0LA 2OH0E 2OJJA 1H1RA 3DAKA 3GOPA 4G6OA 4MEDA 5EHYA 3IW7A 3ZDIA 4DG3E 4DFZE 4E4LA 3R73A 4ANNA 4EEVA 3NUXA 3QTWA 3ZSHA 1APME 3QA0A 1OIUA 4RX9A 2R3LA 4IZAA 1YWRA 4NM5A 1XBBA 4FKIA 4LOPA 1BX6A 3BKBA 3FY0A 2UZUE 4W8DA 2QOHA 4L6QA 4BZDA 2G2FA 2CJMA 4YNEA 3KXHA 1CMKE 3D83A 4G9CA 2WTIA 2BILB 3V8SA 4ZSJA 2WMBA 2Z8CA 4ZXTA 1R0PA 3JR1A 4FYOA 4YO6A 4H39A 3VN9A 3R71A 2YIRA 3Q9WA 4FV9A 5KKRC 3QGWA 3RBWA 2X2LA 4U0IA 1OPKA 3AD5A 4UZHA 1GJOA 3CTJA 4JBVA 4AN9A 4BCKA 3GOKA 3OOGA 4O22A 5IKWA 4F7LA 5CSPA 3LLTA 3P23A 2GCDA 5F94A 3V5TA 3OXIA 2VUWA 4Q9SA 3OTUA 3QTSA 4DINA 2E9PA 4A9YA 5LMBA 2ITWA 2Y4PA 3SG9A 2QU5A 3QTUA 3ATTA 2YHVA 4WG4A 5EW3A 2B53A 2YLFA 4XH6A 3TKHA 4PDPA 3GU7A 3S1HA 1RE8A 2QOLA 3AD6A 5HICA 3TNWA 3QUPA 4NU1A 4FG8A 4CFWA 4EZ3A 3TUDA 5IQHA 4JG8A 2GNGA 2DS1A 4MVFA 2V7OA 3RJCA 4JIAA 4E93A 2PPQA 3GXLA 3MTLA 3ALNA 4RJ7A 4MNEA 5HTCA 2XCHA 5GJGA 3JVSA 3FZTA 1YVJA 4M68A 4XNEA 4A9UA 2HZIA 4JX3A 4C3FA 3QHWA 5HQ0A 4BGQA 3BEAA 4FZ7A 3B8RA 3PZEA 4MBIA 2BZHB 4M8TA 5IZFA 3TKUA 3P5KA 3S00A 4M15A 4X3FA 3BYVA 4QYYA 5DWRA 2P2IA 4QRCA 3O51A 2J90A 3GT8A 3VHKA 4AE6A 1H26A 1XH4A 2F2CB 5C26A 3A8XA 2GPHA 4N70A 5FBOA 2XNGA 3VS1A 4YLJA 1XWSA 5JRSA 4NIFB 1PRYA 5KKRB 4GU6A 2VO0A 2WMVA 4M84A 3CS9A 4GYGA 5CQWA 3VAPA 4FZDB 4FSTA 5HO8A 3PFYA 4XUFA 3AC2A 2Y6MA 2ITXA 5E1SA 2HWOA 3DBCA 2OZOA 1L8TA 2C6EA 2BDWA 3NAYA 4QMSA 3V51A 4PMSA 4MXAA 2A4LA 3C13A 4H58A 1M7QA 4O21A 3EKKA 3W8LA 5JFSA 4N6ZA 3OY3A 4HGEA 3OTVA 3REPA 4ALVA 4PDYA 4FKUA 4B99A 3EFLA 3OROA 2YZAA 3FQEA 4KRDA 2XYUA 2JIUA 3HX4A 3WZJA 2WEIA 5CNNA 2WMSA 4UYAA 5EI8A 3IS5A 4R1YA 4C4EA 3LFEA 2O63A 2C5NA 3BE2A 4NYEA 3I6WA 3QKMA 1W8CA 2CDZA 4GT4A 5CX9A 5E8TA 2UUEA 4O0YA 4FTOA 1DAWA 4M7IA 4DGLC 2YLEA 3D9VA 3O8UA 4NW5A 4ZK5A 4BDCA 4I6BA 1NT2A 1NW1A 2GQSA 2VTLA 4FV6A 3DAJA 2BRMA 4GS6A 5EI2A 4O0VA 3TACA 2VD5A 4O96A 3FI4A 4GK4A 4AT4A 5KNJA 5M57A 4AQKA 3DV3A 4QEBA 4BDJA 3PJCA 4AFEA 4I1ZA 4RX8A 3QQJA 4CNHA 3W0SA 2XM9A 3DXNA 5GJFA 4JRVA 3LKMA 4ACDA 3PWDA 4HGSA 2WKMA 1JPAA 1PXIA 2CGVA 3FMMA 2JIIA 2OFUA 3GQLA 4BB4A 4DGNA 1W2CA 4IVAA 4Z9LA 3COHA 1KE9A 3TTJA 4QTEA 4Y83A 4YSMA 3SG8A 1H0VA 3F2NA 3TV6A 3ZC6A 4RWJA 5IPJA 3HNGA 5I3RA 3FMJA 4RIWA 4BIBA 3M11A 3FZ1A 3ORKA 1IA8A 4QMPA 2BIYA 5CANA 2XUUA 1A06A 2CNQA 3FJQE 3ZONA 3RHXA 3O5AA 4BKJA 4JQ7A 3HUCA 2JIVA 4HVDA 2BKKA 2VTPA 5AUVA 4XP3A 4FV8A 4KD1A 3PG3A 5DR2A 5EH0A 3T8OA 1KE5A 4CFFA 2QOCA 3HL7A 4KKEA 4R5SA 4O86A 3Q32A 2B9JA 4WNOA 3MVJA 3VS0A 2CHLA 5CXZA 3W32A 2W9FB 5E7RA 4EK5A 3DJ7A 4IADA 5EKNA 2BRHA 4I5CA 5K3YA 4EHZA 2C6MA 4IHPA 3FC2A 3IGGA 3P0MA 2GU8A 1OKYA 3D7TB 1AD5A 5AP0A 4PRJA 3COKA 5EKOA 3VF9A 4G17A 4YZDA 5AM7A 4NUSA 3QFVA 3UMWA 1IRKA 3W2OA 4D1SA 3UDTA 2VAGA 4L44A 3EFKA 3OXTA 4GCJA 3R1SA 3DBFA 5AR5A 2WMTA 4RFYA 3UOLA 2ZM1A 2XK7A 3PJ1A 3O7LB 4JJRA 4UYNA 3IW6A 4QPSA 2UW9A 2VTMA 5BYYA 3R8MA 3QTRA 4FOCA 3CTHA 3QRJA 3H4JA 3AGMA 3POZA 2VTQA 3HLLA 4BDIA 4M97A 3OVVA 3PA5A 4AZVA 4FSQA 5TOZA 3N4UA 5M09A 1MP8A 1JWHA 3HMMA 5IQEA 2W99B 1KE7A 1Q8TA 5E8SA 3FKLA 3HVCA 2ZB1A 1PXLA 3KVWA 4KRCA 4RIXA 2VO7A 2YDIA 4IZ5A 4N4SA 1U5QA 4BZNA 1GAGA 4O7YA 3NDMA 4IMYA 5C9CA 4ASXA 3GCQA 3UNKA 3ROCA 1TQIA 5EDQA 2WQBA 3UP2A 4Z3VA 3HZTA 2E2BA 3I0QA 4AA4A 4CGAA 3NW7A 3ZTXA 1STCE 3QXOA 3UO6A 3DGKA 5HTBA 3O8PA 3UVPA 4D1XA 3M42A 4FA2A 3BGZA 2W9ZB 3NYXA 3W18A 2O0UA 2UW6A 3C0GA 3EQGA 3PUPA 4RA5A 3F3TA 5CXHA 3KCFA 2JGZA 4I0RA 2ERKA 2W0JA 4I24A 4MK0A 1R3CA 4DFXE 2GMXA 1X8BA 1ZOEA 5LQFA 5DRDA 3EQCA 3I81A 3RWPA 3R8UA 4PL4A 3BYSA 4AT5A 3WF6A 4FC0A 3BLQA 3KRRA 5EG3A 2WIHA 3ORMA 3UPXA 5J79A 3ZXZA 4GG5A 1OKZA 2YDKA 5CU4A 3ATSA 2FSLX 3DA6A 2YZLA 4KNBA 3RM6A 3WYXA 2XK9A 3Q4ZA 3EN9A 3C4EA 3T9IA 3TV7A 2OF4A 2QCSA 5HCZA 4AG8A 5I9WA 4CLJA 1U5RA 2Z2WA 3ZRKA 5CEIA 2XKEA 5E92A 2PY3A 2W5AA 1DAYA 3FSFA 2PMLX 4FV5A 4H36A 4LI5A 2WHBA 4QTAA 1PYXA 1K2PA 3MDYA 4P2KA 1UWJA 4YHJA 5GHVA 2VTHA 3ACKA 1H28A 4JT3A 4EOQA 4TZRA 4O91A 3CQUA 3RPOA 4AOJA 4B8LA 4J96A 1WBTA 4LMNA 4BI1A 5IEYA 2FYSA 2BAJA 3EZRA 4XG7A 3I6UA 3R8PA 2JDOA 2QI8A 4QTBA 5DEYA 3THBA 3FI8A 4TN6A 2OXDA 1VYZA 4A06A 1PXJA 4ZTMA 1V0OA 2WTWA 4GH2A 3E3PA 1LUFA 5BMMA 4QMZA 4BI2A 5GINE 3GUBA 3A61A 2F2UA 2P33A 4MBLA 4S33A 3QTQA 3ZFXA 2PZRA 2IEWA 2OIDA 1SMHA 3MY0A 4YBJA 3V01A 4ZY4A 4BKZA 5L8LA 3V5QA 1OECA 4W4YA 4YNOA 5I9XA 3LCDA 3P7CA 4FG7A 4WBBB 2HW6A 2R3MA 5FXQA 3G90X 4LRMA 4CSVA 1YDTE 3C0IA 2OG8A 4HYSA 3CTQA 1M2PA 3R28A 4L68A 1OITA 1W83A 4R6VA 1B39A 1VEBA 4FT5A 3BU6A 3LXKA 5LVNA 1H01A 4OAVB 3WYYA 3SKCA 2OO8X 4IZYA 5AR4A 1NVSA 3IGOA 5T3QA 2VWYA 2VTNA 4Q5EA 4AFJA 5HESA 2HENA 3UDSA 2JFLA 4E20A 5IUGA 4KABA 2ZAZA 1WVYA 2ZDTA 3FMKA 4D2WA 3ZSGA 3DB6A 4ITHA 5AP5A 2HY81 4EKLA 4YHFA 3S95A 4JAJA 4AGCA 3QYWA 5HD4A 2PZPA 5LCJA 5LVMA 5CAQA 3RAWA 1BKXA 5GIOE 2IVTA 3NRMA 5DPVA 1FQ1B 4IAZA 3ZLYA 4EJNA 5EOBA 3MVMA 5J5SA 2ONLA 4C37A 5E91A 1FGIA 3DZOA 2VO6A 5JGAA 3HA6A 2R3NA 2LAVA 2EXCX 2WQNA 3FKNA 3ZMMA 4JIKA 5AR3A 4BIEA 5BMSA 2WXVA 4C7TA 4XP0A 4R3CA 5L2TA 3VBTA 1OBDA 5HX8A 4EOLA 1BLXA 4CQEA 4CRSA 4EORA 1YXSA 3TL8A 2JFMA 2G2IA 4QYHA 2A98A 5HNGA 4UWYA 4DEAA 5FXRA 4DT9A 5KMNA 2J0IA 1QPDA 4X6RA 4C4JA 4X3FC 4WO5A 5HNBA 3IDBA 4U3YA 5CI7A 4YBKA 1YDSE 4LMUA 5J9ZA 4DA5A 2Z7QA 2NRUA 2Y6OA 4FNYA 3ZUVA 1LEZA 4M0ZA 1TZDA 2XMYA 4UWCA 3V8WA 4U7ZA 5E1EA 3UYSA 3VHEA 3UZRA 3PIZA 4X6QC 4YZMA 4IFGA 2CGWA 4DFNA 5K4JA 2QLUA 4UY9A 4O7LA 4M69B 3QQHA 1UU3A 4O7SA 3R21A 4XS2A 3CR0A 1YKRA 2IVSA 5IQIA 4QYFA 2UZVA 3UE4A 4HVSA 5EW8A 4YJTA 4TRLA 2ITNA 3QLGA 4PMTA 4W9XA 3LQ3A 3C4WA 4GV1A 4F1OA 3OWKA 3FE3A 3PRFA 2PHKA 3CLYA 4ENXA 2WQMA 3RP9A 4F7SA 1G8SA 4K33A 4AOTA 5A46A 2NO3A 4FJVA 1U46A 3RHKA 5A4QA 4BGHA 2VTIA 3KN6A 3KULB 5C4LA 4UN0C 4OBOA 3SX9A 4G34A 4O84A 2GNJA 5KZ0A 4AAAA 4D4SA 5L3AA 2BUJA 4X2FA 5BVKA 2XNPA 4IX4A 5CLPA 3NLBA 3LAUA 3PJ8A 4ANLA 1UVRA 1P4FA 3R0TA 1LP4A 2PVMA 3R7GA 4GT3A 4IH8A 4EK8A 5CSWA 1AQ1A 3R63A 1IAJA 2RSVA 1U54A 4DBNA 4DE4A 4EWHA 2NP8A 4JX7A 3GQIA 4HJOA 2QR8A 3U9NA 3AC8A 3ALOA 2CPKE 2XKFA 3MFUA 3T3UA 5TT7A 4O2PA 5IA2A 2B52A 4FKRA 2ITOA 3BU5A 3E8EA 1WVWA 1GZKA 4RIYB 5FD2A 2ZYBA 3UOHA 4FTAA 4EZ5A 3BYMA 5M4IA 3DXPA 1LR4A 1DS5A 5DI1A 5G6VA 4II5A 3E5AA 4DFBA 2R3JA 5FLFA 5CEKA 2BMCA 3JYAA 5ETAA 3UO5A 4PPAA 4R5YA 2FSOX 1Y8GA 4A9TA 3VS7A 4CZUA 5AADA 3UQGA 4IANA 3W0NA 4PF4A 1U59A 1ZXEA 3E8CA 4DCAA 4NCTC 3UNZA 5KBQA 2AQXA 4AN3A 4WBOA 5KHXA 4LRJA 3SV0A 4E8AA 5AA9A 3KXMA 1PMUA 3F5XA 4JBOA 5DFPA 4GJ2A 4JI9A 2UW5A 2R7IA 1L3RE 4FSWA 1HCKA 2BZKB 2P4IA 3E62A 2R3HA 1H1SA 4JDIA 4BTMA 3GC7A 4V0GB 2B9IA 3M2WA 3RALA 3MB6A 3UTOA 3RCDA 3K5UA 4FTUA 3FYJX 3DPKA 4I22A 3BQRA 2I0HA 5AP1A 3NUYA