4A4XA

Nek2-ede bound to cct248662
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
277
structure length
253
Chain Sequence
SRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSHRDLKPANVFLDGKQNVKLGDFGLVGTPYYMSPEQMNRNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE NEK2
publication title Design of Potent and Selective Hybrid Inhibitors of the Mitotic Kinase Nek2: Structure-Activity Relationship, Structural Biology, and Cellular Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 77
structure length 253
sequence length 277
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4a4xA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4a4xA01
2WTIA 3Q4UA 5DR9A 3DV3A 3W10A 3ZEPA 2HOGA 2XYNA 4YLJA 2YCRA 5FP6A 3FE3A 3VUTA 1QCFA 3COKA 3GC7A 1YDTE 3LVPA 3BV3A 4USFA 3QU0A 4O7WA 1U54A 3F5GA 2BIKB 2KULA 2KTYA 2R2PA 3QXOA 3FI3A 1CTPE 3GQLA 2E9OA 2VTJA 2XK7A 4RIXA 3ZBXA 3WI6A 2C6EA 2XZSA 4FSQA 3LPBA 4G31A 3ZDUA 3DKCA 4L43A 1XH9A 4FT7A 4ANQA 4CTBA 2HAKA 3JY9A 4W9WA 1M7NA 3ET7A 1OGUA 4ZTMA 1R78A 3PXQA 4BL1A 3VRYA 2VO3A 2PMNX 2BRMA 3I81A 5C9CA 4FIIA 5GZAA 1XBBA 2GHMA 3C51A 3O0GA 5E8UA 4BDFA 4J97A 3UNJA 4LM5A 3VHKA 2W7XA 1WFCA 2C6LA 1U4DA 1XQZA 3COMA 2ITWA 3G9NA 2ITPA 4YJPA 2GFSA 4HCTA 4BCKA 4FIHA 2OK1A 2W1IA 3DAJA 4Q5HA 3ZZWA 1WBNA 3KMWA 4AGUA 4KSQA 2QO9A 2QR8A 4GS6A 4GV1A 3Q32A 4IQ6A 4P90A 2OFVA 3GOKA 2WTCA 3OUKA 3VS5A 5JFXA 3ZUUA 3R8LA 5TE0A 2IJMA 2Y4IC 3DNEA 4WSQA 4IWOA 4L9IA 2ZYBA 4RIWA 3DFCB 5BVKA 3ATTA 3S4QA 3PPKA 4BKJA 3GVUA 4G3EA 3OT3A 2W1GA 3KGAA 3ORKA 4FG7A 1IG1A 4UMUA 3WZDA 1BMKA 2XUUA 2QLQA 1SNXA 3R8VA 1FINA 4UB7A 2G2FA 5LVLA 3HUCA 2QOKA 3A8WA 5AADA 5LVPA 2PWLA 4ZTLA 4WIHA 5CVGA 4E8AA 1M2PA 5A9UA 1OIQA 5DVRA 1EH4A 4U40A 2XYUA 4JDKA 4M7IA 4MTAA 3AD4A 2JKQA 2RGPA 3FDNA 4FVPA 2QG7A 5KMJA 4BIDA 2UVXA 1QPCA 3AMBA 5C03A 5L2SA 2C4GA 4XRLA 1BKXA 4FC0A 3WF6A 4B9DA 3KN5A 3I60A 1KSWA 5CXHA 2PUPA 1NVSA 4PX6A 3EFKA 4FTUA 4Q2AA 3QQFA 5E8WA 4QP7A 3BZ3A 1PMVA 3BHHA 4JT3A 3ZTXA 2ONLA 3DPKA 3FLNC 3GCUA 1R3CA 3NZ0A 4QMQA 4ZY4A 3SW7A 4XLIA 3UQGA 4BIEA 4YGAA 2X1NA 3KMMA 3LQ5A 3Q60A 3SV0A 3LLTA 3NX8A 4EH3A 3DLZA 3IS5A 4EH8A 1XHAA 3NNXA 5GHVA 4TYHB 4GMYA 3AC8A 3GU7A 2OFUA 4F7LA 3RBWA 4E4MA 3F2AA 3W55A 5L2IA 1FMKA 3TTIA 2OLCA 4CEGA 2WQEA 3NMUF 4CG9A 1Q61A 4QO9A 1YHWA 3JUHA 5JGBA 3UTOA 5AR3A 3FSKA 3BGPA 3HLLA 2BALA 4BZDA 4EL9A 5HO6A 3H3CA 5E92A 4NM7A 3FQHA 2V5QA 2C6TA 3A7HA 2J90A 3C0IA 3QUDA 3JXWA 3KXMA 5FXRA 4ZEGA 3CD8A 2O65A 5CU6A 4E4NA 3GU6A 3PUPA 3D2IA 1DAYA 3QQHA 4E5AX 4EQUA 5J1WA 1KV1A 3NR9A 4G3GA 4RRVA 4GFOA 3GU5A 5D10A 3R7EA 2PULA 5AFVA 2C3IB 3FLZA 3R9NA 1PXLA 2UW6A 1H8FA 4EOSA 4O2PA 4U9AA 3OWJA 3ZYAA 1IRKA 5J87A 3MI9A 1MP8A 4Y5HA 4ZAUA 5TOZA 4MX9A 2XK8A 3KRWA 4PMPA 4D2VA 3NYNA 3HP2A 5HNIX 3ORNA 5ITAA 5IZFA 3UPZA 2CN8A 3LE6A 3IPHA 4XP3A 4F9CA 3RK5A 3MVLA 1J7UA 4W8EA 4BCPA 3N4UA 2CNVA 3ETAA 2GNGA 5GJDA 2UZUE 2RFSA 4RIYA 2O64A 2C6KA 2LGCA 2X6EA 3G15A 4L53A 3R9RA 2PVMA 3CEKA 4I6FA 3JYAA 5KMLA 1KE8A 3CY3A 3QZGA 1M17A 3KCFA 2EU9A 4OTQA 4ZZNA 3BYSA 3B2TA 2C6OA 3R83A 2C1BA 4AGWA 3HMMA 1XR1A 2OGVA 3KKVA 4BKZA 1ZARA 1GOLA 3P78A 4Z3VA 2OU7A 4FTAA 2ZJWA 3ANQA 3PJ8A 3MB7A 2R0IA 4EOJA 4BI2A 1O6YA 3MESA 4JBQA 4R1YA 4C62A 5C26A 3NLBA 2Z7QA 3W32A 2ITYA 2O3PA 1E1XA 5B0XA 5HI2A 2VWUA 4FE2A 5IKWA 5BYLA 1H27A 2R3OA 4FKTA 4C58A 1J3HA 2R3QA 2JEDA 2R3KA 2ITNA 3Q5IA 3EIDA 3RALA 4O7LA 4O0TA 2PVYA 1KE7A 2J5EA 4IAYA 5CAUA 3RAKA 3S00A 2O8YA 4U7ZA 3O2MA 4BTFA 3R7IA 5ANDA 3R7VA 3UMWA 4FOCA 2QOHA 3SXSA 2IPXA 2I7QA 1ERKA 5AP3A 4JI9A 3F5UA 4I0SA 5D7VA 3OUNB 4X3FA 5DMZA 4DH8A 5I9ZA 4AZEA 4X21A 3ORLA 2VTTA 1YQJA 4P5QA 3BPRA 4JBPA 4O21A 4UALA 3R02A 2DUVA 4RSSA 4LGGA 3RVGA 3RNYA 3W2CA 3UNKA 4G6OA 2ZMCA 3OROA 3VC4A 3G33A 4CD0A 4IM2A 4BCIA 2JFMA 4C38A 2V22A 4F6WA 3F61A 2FA2A 3LQ8A 3GQIA 1OB3A 5FTGA 2CN5A 5CLPA 5AP1A 2XEYA 1PYXA 3P23A 2A1AB 3MTFA 3ZFMA 3EKKA 3K3IA 3K54A 4G3FA 3JVRA 3FLSA 3NUAA 4GKIA 4C33A 1IAJA 2X9EA 4ZP5A 4A9UA 1ATPE 5CZIA 5AR5A 4QP4A 3TCPA 5BVNA 4I92A 4ALVA 3EHAA 4RJ3A 2C6DA 4EK5A 4F1MA 3QBNA 5EK7A 2REIA 3LXPA 3EN9A 3HMIA 2BAKA 3TDWA 3DTCA 4QPSA 5IQHA 4DFLA 5GJGA 2CGWA 3ZHPC 5L6PA 1JVPP 3NYVA 4O0SA 3ZCLA 3MTLA 3EL8A 2QOBA 3MVJA 3EFLA 3QHRA 2VRXA 4FV9A 4LL0A 5JN2A 3ZXZA 4UMTA 5AM7A 5AR7A 1ZRZA 4IWPA 1ZZ2A 2PK9A 3CTHA 5CSWA 5L6OA 4ITHA 4DG3E 4JRNA 5HD7A 5HX8A 5FEEA 4WA9A 4G16A 4B8MA 4MQ1A 5F95A 3MGYA 4FEUA 2HCKA 5J95A 3KREA 1PY5A 3POOA 2IW9A 4HZRA 3W18A 5IA3A 4FSRA 2J50A 2VX3A 4HPUE 4BN1A 3R8UA 3PIXA 3FKLA 5HNBA 2YAKA 3QX2A 3R9OA 1GIJA 1BYGA 2OIQA 4FIJA 4HYUA 3PZEA 3TNIA 4NW6A 3UGCA 2CGVA 3SOCA 5CYIA 5CEPA 3QD0A 5CWZA 3VW8A 2R4BA 5LMKA 3K5VA 3R28A 1Y6BA 3RZFA 3IW5A 4NH1A 4HCUA 2QONA 1OL1A 3ZRKA 3OMVA 3UZTA 3IDPA 4NSTA 3PG3A 5B2KA 3LLAA 4O96A 3V8SA 4DEBA 5AAEA 5DYJA 3OS3A 3VUMA 3OW3A 4PPBA 2RSVA 4XG9A 2V0DA 1WVWA 3UZPA 2JKKA 2YJSA 1ZZLA 2OWBA 4NU1A 4Y73A 1YKRA 3ATSA 3UVRA 2WTKB 3VVHA 4NIFB 4U8ZA 3N4TA 5M08A 1VYZA 5HCYA 3PA3A 1OKWA 1CSNA 4DFYA 4E20A 3AGMA 3UQFA 3FZRA 4W4WA 4TWNA 4AWIA 4CQEA 5DG5A 5AP4A 4DFBA 5I3RA 4TYHA 3V8WA 4M69B 5DH3A 5CU3A 1Q8TA 3WZUA 1R0EA 2JIUA 3NEWA 2G9XA 2ETRA 3RGFA 3FI2A 4FUXA 2JGZA 3L8SA 4S31A 3R01A 5CEKA 2OJJA 3CPBA 1PXIA 1XH4A 4M68A 1Q97A 2JDVA 2CNQA 3A7IA 4NJ3A 2PE2A 5AP6A 4FT3A 1L8TA 4XV3A 5M53A 2WQMA 3H0ZA 3LFAA 5AV2A 3DU8A 4WT6A 5I5ZA 3DKFA 3NAYA 4FKPA 4RFMA 4AQCA 1H07A 2WAJA 1UWJA 1XH8A 1WVYA 2P33A 2W9FB 2XJ2A 3B2WA 3MH2A 3PXRA 4J7BA 5HIDA 4G9CA 3LAUA 1Y8GA 4RWLA 4G6LA 1URWA 4L3PA 4BRXA 5TF9A 3R7UA 3BLRA 4W9XA 2GS7A 4D1XA 2GQRA 1MRUA 3KVWA 3LCTA 1WBSA 3C4CA 3NPCA 3ZUTA 4O81A 1E9HA 5E4HA 3A7JA 1FVTA 5ETIA 4UZHA 4KKEA 2WMSA 5ANOA 4YO6A 2ERKA 5KZIA 4BCOA 4OGRA 4IWQA 4A9RA 2W1CA 5AR4A 2ONLC 4CYJA 4EK6A 3F2RA 5HCXA 4Y46A 4I4EA 2UZLA 5HZNA 2YWVA 1DI8A 3HAMA 1M2QA 5EOBA 1WBVA 2YERA 3QYZA 4EOOA 5GZ9A 4BI1A 3EN7A 3VS1A 3VS3A 2IVSA 4KBKA 4X6RA 2EWAA 3L8VA 4QP3A 4I21A 3VWAA 2JDTA 4U97A 3RCDA 4JG8A 4NFMA 4X2FA 5M07A 4LGDA 1OUKA 4CFVA 1H08A 3QWKA 4M84A 1W84A 4IB3A 4F9WA 2XH5A 2VX0A 5CASA 3OOMA 2W1HA 4ERWA 3R8ZA 4L7FA 4RZWA 1BL6A 2I0EA 2YM4A 5CT7A 5HOAA 3R00A 4KBCA 3ZS5A 2PE1A 3FPMA 5CANA 1U5QA 3QD2B 4AW0A 4CXAA 2GU8A 2OW3A 5I9XA 4XG7A 3RI1A 4ACGA 4GYGA 1BLXA 3RAWA 4BKYA 1K3AA 3SKCA 2ESMA 3C4XA 2HZ0A 4IX3A 3HMNA 4O0VA 2WD1A 4RX8A 5EYDA 3TUBA 4R78A 4DFUA 3BEAA 2F9GA 4P4CA 5EM5A 1O6KA 4QMUA 4JQ8A 4NEUA 4FT0A 3B8QA 2XF0A 4QMOA 5E7RA 4RQKA 2PZIA 3GC9A 3CLYA 4G1WA 4MWHA 5EH0A 3D5UA 3I5ZA 3QQLA 1UNLA 5BVWA 4EOQA 2Z7LA 4FNXA 4TW9A 5A54A 3R7OA 2EB2A 1X8BA 3QD4A 3ZMMA 4CMTA 2UV2A 4NTSA 5HBJA 4QMMA 3MV5A 4WUNA 4O7SA 2YJRA 3SXFA 5KMKA 3FZPA 5IQIA 2WNTA 3G5DA 4EKLA 4HVDA 1YOLA 3TZMA 4C8BA 4DFZE 3V5TA 3SAYA 2PZ5A 1FGIA 2BDWA 5DNRA 2PY3A 3H0YA 3OBGA 1H01A 3V5LA 4YU2A 5EM6A 3WYYA 3HL7A 1BI8A 2QOQA 1UV5A 2UW9A 3DB8A 4FG9A 2R3JA 2FSOX 3Q96A 4H58A 2WQBA 4I6HA 3VJNA 3ZBFA 4BHZA 3RPYA 1QPJA 5CSVA 4JAJA 5EFQA 1Z57A 4GIHA 1OIRA 2WMQA 5CEQA 5A4TA 2QOLA 3C9WA 4O91A 4S33A 1PYEA 3O51A 2QD9A 5AUYA 4F7JA 2OXXA 5ACBC 3FWQA 3FXZA 4H3BA 4XLVA 1UKIA 2XKFA 3EMGA 3MW1A 1UU7A 4L52A 1OKZA 5TO8A 4CMOA 3DXNA 3FLWA 4D0XA 3FZTA 3NDMA 1WAKA 3OF0A 3KQ7A 4X3FC 5DT4A 4HW7A 1UWHA 3P9JA 5IA2A 3MIAA 2QOIA 2J0JA 4CFMA 4CG8A 3L8XA 4IVBA 2BTRA 2IZRA 1L3RE 5HE1A 3HAVA 2PSQA 2ZM4A 4M97A 4O27B 3EN5A 3A8XA 5IF1A 4II5A 4GUBA 4C3FA 3CQWA 4XG3A 3ZSIA 2X2KA 1CKJA 4D5KA 4D1SA 2H8HA 3FL5A 5BX0A 4AW1A 1K2PA 4O6EA 2G2IA 4QMTA 3ZO1A 4AFEA 4ZSAA 1PKGA 3BU3A 4IIRA 3OD6X 2PVRA 3CKWA 2XVDA 5CU2A 4XUFA 5GZ8A 1JAMA 1WBWA 5A3XA 3FSFA 4OW8A 2X4ZA 4O22A 1UNGA 3MPAA 5JZNA 4AW5A 4FICA 3LMGA 5FGKA 3GP0A 3UIXA 3A7GA 4FZ7A 3UOKA 4DLIA 4IZ5A 2ETKA 4F70A 2BZIB 4NIFA 4WG3A 3PXYA 4M8TA 4IMYA 4NWMA 4DEEA 5E9EA 2ZVAA 3AT2A 4H1JA 4FTRA 4AZTA 3O17A 3Q04A 4GSBA 3OW4A 4UWCA 4ID7A 3COIA 3A7FA 4KA3A 3ENHA 4O7NA 2QLUA 3FC1X 3AXWA 4LUDA 3CGFA 4BIBA 2HXQA 4HGSA 4M69A 4U3ZA 5HD4A 5KHXA 2P2IA 2B54A 4ONAA 4OBPA 4P5ZA 1OPLA 2F7ZE 3COHA 4BYJA 3ZM9A 3KK9A 4MK0A 2Y9QA 5I9WA 3UIMA 4QT1A 5M4CA 4R8QA 2YM5A 2HW7A 3HKOA 3P4KA 4FV6A 5IEVA 4OTIA 3F7WA 3A2CA 3LXNA 4FTTA 2YLEA 1YI4A 3EH9A 5AUTA 4PRJA 2X6DA 3FMMA 4OTDA 4FNWA 1AQ1A 3EQPA 4UYNA 4X2NA 3L9PA 1ZMWA 3NS9A 3IW6A 4BTJA 3QL8A 4KWPA 5J5SA 3OCGA 3Q53A 2RFDA 3OBJA 2I0YA 4O1OA 5EG3A 4DFNA 1JQHA 5LMKC 3QWJA 2ITUA 4L45A 5DIAA 3BQRA 3UNZA 4XYFA 2PPQA 2FSTX 3R2BA 4RVKA 5IQBA 3DQXA 4E6QA 4PDSA 1B38A 3NUYA 4CNHA 2C5VA 3TZ9A 4IZAA 5CZHA 2VTOA 5L2QA 3H9FA 1WBTA 1WBOA 2CCHA 4IX4A 2CJMA 4DFXE 4FBXA 1P4OA 1STCE 5EHLA 2VWXA 4QQTA 4UXLA 2AYPA 3LXKA 1JBPE 4ANBA 4I0TA 4YO4A 3QD3A 2ITTA 3ZLXA 4L44A 1H1SA 3ORXA 3I4BA 3QTUA 4ACCA 2WHBA 5DRBA 4BC6A 4E6CA 1OBDA 2VTHA 4EOLA 4FSMA 1P14A 1UU9A 3Q52A 5AIKA 3TDVA 2FUMA 3KXXA 2A0CX 5C8NA 5L8KA 1YDRE 2ZB1A 4FOBA 5HG8A 3HA6A 4KD1A 3CGOA 2BRHA 4F0FA 2V55A 5HO7A 1ZOEA 5EW3A 4AN2A 5BVDA 4AA0A 4WSYA 4O7ZA 5LWMA 4I6QA 1LUFA 1BX6A 5ANGA 3NIEA 3TUDA 2VO6A 5EW9A 2CHLA 2JIVA 1FMOE 2W0JA 3R63A 2YIYA 2IW6A 3RWQA 4NM5A 3HECA 3LM5A 4FV3A 1FOTA 3OXTA 4E1ZA 2QCSA 5L6WL 4GL9A 3T9TA 4KRCA 4BGQA 4ZK5A 4DGOA 3DLSA 2F57A 4C2WA 2UZTA 4M12A 4PNKA 4DTAA 5HIBA 3BCEA 1S9IA 2F2UA 4FTLA 4I6BA 4ZJVA 5HVJA 3DK7A 5KMNA 2G15A 2QR7A 3OZ6A 3UO5A 2BZHB 2X2MA 4GIIA 4JR3A 4LRMA 4M15A 1J1CA 2PVLA 3MVHA 4U81A 3F9NA 2PVHA 1PXJA 3JY0A 5J9LA 3REPA 1OL7A 4RA5A 4FT9A 3CJGA 5IISA 2JKOA 3F3WA 3GENA 4KSPA 4A4OA 4UMRA 4FT5A 4HOKA 3SRVB 3TT0A 4KIPA 4I24A 3ZC5A 4BGGA 3DDPA 2QO7A 3QCXA 2YFXA 3LFDA 1XBAA 2YABA 3OC1A 4GJ2A 4ITJA 4HGLA 2VTRA 4S2ZA 1VYWA 5E8XA 3BU6A 4FKSA 2YHVA 4GJ3A 1H24A 1WCCA 4TN6A 4DH7A 4FL1A 2Z02A 5BUIA 3D2KA 1OI9A 3N4VA 3MS9A 1CKIA 2EXMA 2R3MA 2WTVA 2ZV8A 3PFQA 5DFPA 3TNQB 1ZYLA 4CMUA 3LFSA 3E62A 4PPAA 2BIYA 5ANIA 4QYHA 5ETFA 3R8MA 1OM1A 1TKIA 4GT5A 4YJQA 3VUDA 4DHFA 4JG7A 4QNAA 4RIOA 3QTRA 5KX8A 3SG8A 2R3IA 4PTGA 3RP9A 4AU8A 4ALUA 4GKHA 4GG5A 2EVAA 3U4WA 4C4HA 4GK2A 2B4SB 1RQQA 3HV3A 4E4LA 3NWWA 3GC8A 4JS8A 1JKKA 3UQCA 1G8AA 1UKHA 4LOPA 2A4LA 4EHGA 2P0CA 4KBAA 2WEIA 5CX9A 4CKJA 2XM9A 4QD6A 1M14A 3OOGA 2RF9A 2X2LA 5M56A 5A4CA 4F0GA 4ZS0A 4DT9A 4QPMA 3SHEA 2HZIA 4AX8A 2F7XE 4JX3A 4EK8A 5E90A 4F99A 5HLNA 3ORZA 2XMYA 4JG6A 1NVRA 3PYYA 4EI4A 2XM8A 3I7CA 1W98A 3QKLA 3LJ1A 3UO6A 1KOBA 1T45A 3E88A 3QZIA 2CNUA 2W1EA 2BR1A 4TXCA 5HG7A 4MQ2A 3ODZX 3AD5A 2WEVA 3LFFA 3TJDA 3EWHA 4JBVA 4B8LA 4E73A 3MY5A 4H1MA 5FLFA 3V5JA 3BGZA 2A2AA 3OT8A 5BVFA 3A60A 3KXHA 3BE2A 3I0QA 2GTMA 2C6MA 1OZ1A 5FXSA 1OPJA 2E9VA 5HNGA 5DT3A 3UJGA 5CU0A 4E6DA 3RPOA 4GVAA 4JQEA 4AT3A 2VWBA 4QMNA 2J5FA 4MH7A 4PMSA 4O0YA 4MNEB 3WBLA 4BBEA 2VNWA 4G5JA 3C13A 4PTCA 4Q9ZA 2GNHA 3D7TB 3BHUA 2C3JA 3KEXA 4C0TA 4YMJA 1ZWSA 2X7OA 3AC4A 3F66A 3KXNA 1Q24A 4RJ5A 4WHZA 5HBHA 3RM7A 3IDCA 5K5XA 2VTQA 4GU6A 4YC3A 4Z9LA 1F3MC 4HYIA 2CCIA 4FNZA 4RC3A 4YP8A 4NUSA 5FEQA 4EH2A 4C36A 3WE4A 3OCTA 4FTOA 3U6JA 4MF1A 5B2MA 5A14A 4UMQA 4I5HA 2WMVA 4W8DA 3LJ2A 2LAVA 3ZRMA 2YLFA 4G34A 2J0LA 5JQ8A 4AS0A 3U87A 5BUJA 1H25A 3QKMA 4K8AA 2X0GA 4HZSA 4QP6A 3ZOSA 4F9YA 5A4EA 5C4LA 4JR7A 4ACHA 2XKEA 4V01A 2W4JA 4FEXA 4BCGA 1RDQE 4CVAA 4CV9A 4CKIA 3QRJA 2WGJA 4GK4A 3F82A 2GSFA 4YLLA 3TN8A 2YM3A 3DS6A 1FBNA 3EFWA 4I1ZA 4X2KA 3CE3A 1H0WA 3DAKA 4J8NA 3KB7A 5EYCA 2OXYA 3EQHA 4FSNA 4IAKA 3LKMA 4BTMA 3EQFA 4AA5A 3OXIA 2OF2A 2PUNA 4X2GA 4AP7A 2C5OA 4FZAB 2WTKC 2PMOX 2XIKA 1KE6A 5AA8A 3AG9A 3UVQA 4FIGA 4FV5A 3V8TA 2PZYA 4C57A 2WMAA 5HLWA 4N4SA 2YACA 2QKRA 5CENA 3QCYA 4D2WA 4EKKA 3F69A 2UZBA 5AA9A 4Y83A 1URCA 5L2TA 3MH0A 3BHVA 3CTQA 3V6RA 2G1TA 2HIWA 4RVMA 3Q2MA 5KMMA 4LUEA 4LQMA 3EFJA 3WZJA 3UP7A 3L9MA 5FWKK 2XKDA 2O0UA 4LGHA 4H36A 4IW0A 3F3UA 4FI1A 2YN8A 3IW7A 3D83A 3E63A 4IAAA 3AC3A 2YCSA 4JOAA 4XP0A 5DBXA 4Y8DA 3DNDA 4Y5QA 2QOCA 4OT5A 3N9XA 3WF8A 3CPCA 5EKOA 5I0BA 4IACA 4V05A 4CZTA 4USEA 3FZOA 2VAGA 4YJNA 3DDQA 5M4FA 4NCTA 4U41A 5BMMA 3WE8A 4FTKA 2JAMA 1JKTA 3GFEA 2XK3A 4FSTA 5AV0A 3SX9A 3G90X 2WTWA 2WO6A 1B6CB 4TT7A 2ZDTA 2Y4PA 3MVMA 3Q3BA 3F5PA 1OECA 4TNBA 2H9VA 4G2FA 3IGGA 2IZUA 2OJFE 2IN6A 4ARKA 2B9IA 2W9ZB 5CI6A 4U80A 4EUUA 3PXFA 3FQEA 2C47A 2PVNA 3SRVA 4BDHA 4BCFA 4LYNA 4ITIA 5CU4A 4A4LA 4D2SA 4O6LA 3KFAA 4G3CA 4YJRA 1PKDA 4D4RA 3VJOA 4DEDA 5EI6A 1IASA 2FSMX 3BIZA 4U5JA 2I1MA 2XRUA 3TIZA 3FI8A 5I9VA 4CRSA 5H8BA 3Q6WA 5CY3A 5C01A 2XCKA 1S9JA 3ZU7A 2VTMA 4OTRA 4XEYA 3V04A 4L68A 3TWJA 3V5PA 3NCGA 1XO2B 5JQ5A 3U4UA 4ZZOA 4D2PA 3UMXA 2B53A 2E2BA 4TNDA 4QQ5A 3ZLSA 2WKMA 3NGAA 3KXGA 3OEZA 3DB6A 1CDKA 3QRKA 2R7IA 3ZSHA 5F20A 4DEAA 5BPYA 2X7FA 2EXCX 3E8NA 5CVHA 3BQCA 1H26A 3W2RA 5GJFA 1PXOA 4XV9A 3DGKA 5FTOA 3ZH8A 2VTNA 4KRDA 3TNPC 4IVCA 3EB0A 2C0OA 4S34A 3EYGA 5TT7A 5HQ0A 3F7ZA 4GH2A 2ZMDA 4GVJA 3VF9A 3VS7A 4BR3A 3DQWA 4WNPA 3BLQA 4D9UA 4EZ3A 3PTGA 4MXAA 5E8SA 4LV8A 1I44A 4UX9A 1SYKA 3BEGA 2UUEA 4HJOA 1KV2A 5AAGA 2VNYA 1M7QA 3QQGA 3G2FA 4AXAA 3FMJA 4QYFA 4EYMA 4KABA 4IDVA 4DLJA 2YIXA 2FYSA 5HE3A 1YXXA 4F6SA 1MRYA 2W5BA 2GNLA 4HCVA 3MPTA 5J5TA 2ERZE 2ZOQA 4IM0A 4MD9E 3WZKA 2X7GA 3TJCA 2ZB0A 2WELA 4IX5A 3VF8A 4AW2A 3KULB 4BBMA 4MXYA 2OXDA 3PZHA 3LCDA 3OTVA 2V62A 2HZ4A 3QGYA 3I1AA 5JK3A 4RWIA 2XEZA 1W83A 3HVCA 3W8LA 4FKRA 2JBOA 1NVQA 2EUFB 3AGLA 2CDZA 3R22A 4IM3A 2VX1A 3DAEA 1SNUA 5HBEA 3VBYA 3H9OA 4FEVA 4IZ7A 3VQHA 1G8SA 5L3AA 4C4EA 2Y6MA 4TYEA 3ZO3A 3MFSA 5AEPA 2XK9A 1JNKA 4FVRA 4J96A 4MNEA 4GU9A 1YWNA 4O7RA 4O38A 4YPSA 4DH1A 3EQGA 3LM0A 4O7VA 4E93A 4ZTHA 4N57A 1QL6A 2C3KA 5CAOA 4AGCA 1F0QA 5FBNC 3KVXA 3M11A 1ZMVA 4RVTA 5FBOA 1JSVA 3TZ8A 4XP2A 4A07A 4E5WA 1H1RA 4YURA 3OP5A 1SZMA 4WG4A 1WZYA 2WIHA 4IDTA 3RWPA 3TNHA 1Z5MA 2NPQA 4IHPA 3R0TA 4Q9SA 1Z9XA 5K4IA 4R7HA 4C37A 3CD3A 4FV4A 1PMEA 4ANLA 4FA2A 2CGUA 1YHSA 3MSSA 5E1EA 5FUTA 2RFEA 3C4EA 4USDA 4D4YA 2VTIA 3F6XA 3GOPA 3PP0A 4PPCA 2XBJA 3NCZA 2PZPA 3D14A 4GG7A 2VV9A 4ZSGA 4EC9A 3DZQA 3E8CA 5ANEA 1GZKA 3DOGA 4L6QA 4F4PA 4RQVA 4UN0C 1PMUA 5LQFA 3RHKA 4Z7GA 3LMHA 4FL3A 3D7ZA 4QPAA 2PMIA 5KO1A 4HVHA 3FZ1A 5AUXA 3MY0A 2WMRA 4C7TA 5AUWA 2AUHA 3AT4A 4PTEA 4L01A 1PJKA 2IZSA 2VTPA 4U42A 2AC5A 4JXFA 4ZJIA 2VZ6A 2OIDA 2CLXA 4GEOA 2W96B 3TNWA 3IKAA 2QU6A 3VRZA 4O7TA 3D4QA 3TXOA 4O86A 2I40A 2GS2A 4C4IA 4DTKA 3HMOA 5F4NA 4XBRA 3ZUVA 4DH5A 5IH6A 3ZZEA 4CKRA 3NUNA 2CSNA 4PY1A 3VW6A 3BHTA 3HDNA 4IB1A 3UC4A 4RX5A 4IEBA 4IX6A 2C1AA 4PL5A 4RLLA 4BCJA 4J53A 4S32A 5BNJA 3T8OA 4C2VA 3G6GA 5LVNA 3M1SA 4KKHA 5CVFA 4QMZA 4AUAA 5HTCA 5M4IA 5FG8A 4ASZA 4J1RA 2GMXA 3D0EA 2HY81 3HA8A 1NXKA 4YZ9A 2XNGA 3CSVA 3LCOA 4PL3A 3QZFA 3CCNA 5F1ZA 1Q8ZA 4FK3A 4O0XA 5IEXA 3U55A 3TV7A 3G6HA 3AD6A 1VEBA 2W99B 3FHIA 4HYSA 4IC8A 5AR2A 2ITQA 4EOMA 2WQOA 5T3QA 1PXNA 4CCUA 5JFWA 3LJ0A 1JWHA 3E5AA 3EKNA 3EQIA 2YIWA 5C4KA 1XH7A 2IWIA 2XNOA 4MXOA 2FVDA 4FNYA 3IW4A 1KOAA 3UPXA 4BDJA 4I41A 4NM0A 3O7LB 3G0FA 3NUPA 3VIDA 4KNBA 4QTDA 3PLAE 4K0YA 3E7VA 5GNKA 4AG8A 4ZY5A 4AE9A 4TYGA 5H8GA 4DC2A 2OJGA 4PP9A 5L4QA 3CTJA 4LFIA 4EH7A 3QZHA 5L8LA 3PLSA 2OICA 4L8MA 2HK5A 3HDMA 3O50A 4ZTNA 5BVOA 4BF2A 4HGEA 2HYYA 2AC3A 4EQCA 4CLIA 4L3JA 2R3HA 2X8DA 3RJCA 2WTJA 3WYXA 1VZOA 5KMIA 2C5YA 3CC6A 4YNEA 5EM8A 1LP4A 4WNOA 1WMKA 2F49A 3R8PA 1OIUA 3JS2A 3PWDA 3A62A 4IE9A 2NP8A 4RFZA 4LRJA 4JJRA 4MBJA 5K0KA 4ENYA 3PJ3A 3FMDA 4FK6A 5AIRA 4FVQA 1YW2A 3P86A 4C61A 2BDJA 4R3CA 4AF3A 3KY2A 2RG6A 1OVEA 4HVSA 1OUYA 5D11A 5KUPA 2J7TA 5C27A 4IVDA 3PA5A 4MKCA 4A7CA 5B7VA 1LR4A 2UZEA 2QODA 3GEQA 4XV1A 3RK7A 4HGTA 4N0SA 2ITOA 4I5MA 1E1VA 2QNJA 3RTPA 4BCQA 4DYMA 1M52A 5E8VA 1H4LA 4FTNA 4UWYA 5EDQA 3VS6A 2X81A 3Q9YA 4ZJJA 1PMNA 4E26A 4XV2A 5IUGA 5HO8A 3QQKA 4WBOA 4QTCA 3R1SA 1GZ8A 1H1WA 2BZJA 2UZDA 4NCTC 5EYKA 3RKBA 4DEHA 3BU5A 4KB8A 5J7HA 3KF4A 3OEFX 1VJYA 4YJTA 4QMSA 3SOAA 3MN3A 4XOYA 3PWYA 2W1DA 4MXXA 4EK4A 5EHYA 2PU8A 4AOTA 2C69A 3FMNA 3QYWA 1OIYA 3EQRA 1QPDA 3PJCA 3JR1A 2GHGA 2QHMA 2BZKB 4DH3A 5TR6A 4DBXA 4D4VA 1HCKA 2BKKA 3OHTA 4DA5A 4ZSJA 1Q62A 4K6ZA 1Y8YA 4O84A 4BDKA 1YI6A 2YDKA 4R5YA 4DGNA 3LFNA 4GFGA 3HEGA 4M0ZA 4CLJA 2Z7SA 4RWKA 2BAQA 3KULA 4KAOA 5IUIA 5KMOA 2UVZA 3QGWA 4QNYA 3C50A 4BDGA 4CT1A 3GXLA 4M3QA 3PY3A 3QCSA 4H3QA 4RT7A 2QC6A 3FKOA 1O9UA 2HENA 3OFMA 2PUUA 3G0EA 3CBLA 3IOKA 5BVEA 4XBUA 4IH8A 1FGKA 3V6SA 3C0GA 3P1AA 5D7AA 5DT0A 2GFCA 2XS0A 3U8WA 1Q8WA 1SVEA 5CAQA 2C30A 3VUGA 3OWKA 5KBRA 2XIRA 3KRJA 1A06A 2BRGA 4BB4A 2Y7JA 3DJ6A 4A4XA 3FUPA 3F5XA 4ZS4A 4ASDA 3E3BX 3DXPA 3KC3A 4XNEA 4NFNA 3RM6A 4HYHA 4BVUA 3HRCA 2OG8A 4P7EA 3O96A 4ORKA 2FH9A 5A6NA 3BYVA 4IB0A 5AV3A 2IVUA 1V1KA 4MWIA 3T3UA 3FJQE 3UIBA 2UZVA 3SC1A 4AGDA 5JGAA 3MB6A 4LL5A 4DGGA 2GQSA 2Z8CA 4EOKA 5IQAA 2IVTA 1IR3A 2VU3A 2ZV9A 3ANRA 3NAXA 4FL2A 5AP7A 3PRIA 5HU3A 3SA0A 5E1SA 1GJOA 5IG1A 3PDTA 1SM2A 5AP0A 3FHRA 2UZNA 2J0MB 5CAVA 4GW8A 3WILA 3QUPA 4K18A 2PVKA 4I94A 4KIKB 5HICA 4GK3A 5AP5A 4MBIA 2W1ZA 5DOSA 1ZMUA 1DI9A 2JAVA 4DAWA 4DEIA 2JDSA 1ZOGA 4B7TA 2ACXA 3AT3A 5EQYA 3C5UA 3I5NA 5CT0A 3E64A 3M2WA 5HCZA 2QOOA 5CALA 1GZOA 2YZLA 2YEXA 3PSBA 4YTIA 3FAAA 1IA8A 3VBVA 3CQUA 3R30A 4FKQA 5D12A 3KCKA 5HGIA 3PY1A 2W17A 5T6KA 5H3QA 1GIIA 5HKMA 3MFRA 4QTEA 3B8RA 3PRFA 4A9YA 5JMSA 3C4ZA 4QMVA 4NYEA 3HX4A 4LMUA 1QPEA 2BVAA 3GNIB 3LXLA 3KU2A 2UW5A 1OBGA 3EZRA 1OL2A 2OH0E 4JDIA 3F2NA 4M67A 1CM8A 3TG1A 2IVVA 4MCVA 4FEQA 3LFQA 2OI4X 4G6NA 1OKYA 2W5AA 3Q6UA 1FPUA 3FYJX 4CCBA 4C35A 4U0IA 4D5HA 4J98A 3GGFA 3VN9A 4F7NA 3PPJA 5K4JA 2C5XA 4I22A 4FIFA 3ZDIA 2Q0NA 4NKSA 1V0OA 2G2HA 1YOJA 2Z2WA 3GT8A 4APCA 4C3RA 3R1YA 4RJ4A 2CKOA 2QI8A 3R6XA 5I9YA 3FMHA 4CV8A 4IADA 3L9NA 5LVOA 1SMHA 2W5HA 5FEDA 2YIRA 3WF9A 4C4FA 4U45A 4IAIA 4WOVA 5KZ0A 3TV6A 5E91A 4EH4A 4DCAA 2GS6A 3P7CA 1FVVA 3HNGA 3UP2A 1XH6A 2R64A 5HVKA 4PNIA 4YBKA 4FTCA 3IQ7A 5HTBA 4FSYA 5HX6A 5M57A 3GCSA 2W4OA 5AV4A 2H6DA 2R9SA 2PTKA 4TL0A 4CQGA 3UYSA 1ZLTA 5EHOA 3T9IA 4NZWB 2R3RA 4TYIA 1ZOHA 4QP2A 3AOXA 5ANKA 5EW8A 2QURA 3QX4A 4YHTA 3FPQA 4JNWA 4FV8A 2JDOA 2WZJA 4NK9A 5DHJA 4PDYA 4FR4A 4YC8A 3V3VA 4MAOA 1JSTA 3HUBA 3UBDA 4O7YA 3O71A 3OY3A 4FSUA 1JOWB 2BROA 5JH6A 4U44A 5H2UA 4E5BA 1KE5A 1MQBA 3EOCA 1BL7A 4FV2A 4AACA 4ANSA 4ZTRA 4JBOA 5D41A 3EQBA 4U3YA 1OKVA 1ZXEA 5AMNA 4BCNA 4KIQA 2DYLA 4XG8A 3R71A 1OMWA 1Y57A 4EHVA 2XNBA 3MWUA 2OZAB 4RBLA 1PXMA 3S95A 2E9NA 3I0OA 5FDPA 3FY0A 3M42A 3SLSA 2R3FA 2SRCA 4YZNA 4XOZA 2RL5A 3QTXA 3R2YA 4ZIMA 4YHFA 4AE6A 3A4PA 3HV6A 2YZAA 3NW5A 3UYTA 2ETMA 4XMOA 3RAHA 4ZLYA 5LOHA 2XJ1A 4YHJA 1YXUA 5JRQA 2PYWA 4WNKA 5A4QA 1A48A 2X8IA 4ZZMA 5J9YA 5CNOA 5HVYA 1ZY5A 1HCLA 4JQ7A 3QF9A 1KUTA 4R3RA 4BFMA 2O5KA 4L46A 1QMZA 4MYGA 4OBQA 4CYIA 3QA0A 3DBQA 3FKNA 4WRGA 2XIYA 4X6QC 3WOWA 4F0IA 5JFVA 2IG7A 3Q9ZA 4FKGA 4FKVA 4GRBA 5FM2A 4EHZA 5LMBA 4V0GB 2B52A 5AJQA 2WFYA 4XH6A 1NT2A 4BDBA 4WO5A 5IU2A 3EYHA 2X39A 3MH1A 4LI5A 5DE2A 2FGIA 3KRRA 4MD8E 5ICPA 2X9FA 3NVKI 1YDSE 3BHYA 2GPHA 4PP7A 3MY1A 2C3LA 4QYEA 1Q8UA 4GCJA 4EJNA 2IO6A 4M13A 3PJ2A 4UXQA 3OG7A 5AUUA 4NM3A 3LQ3A 2J2IB 4XX9A 4K2RA 5JEBA 3DJ5A 5CEIA 4CSVA 4K33A 2V7OA 5LARA 3HV7A 4WNMA 4RX7A 5BQ0A 3IGOA 3UOJA 4EJ7A 1YHVA 3DK6A 1GAGA 5AR8A 4OTFA 4DE4A 4Y85A 1FVRA 3UOHA 2OO8X 5CSXA 3ZONA 3SDJA 3VUIA 4W4YA 4X3FB 3VBTA 2C5NA 2JFLA 4TWPA 3P7BA 1OITA 4CRLA 3DK3A 1DM2A 2XK4A 3HGKA 3ROYA 3NRMA 3TEIA 4APPA 4BGHA 4L3LA 3TUCA 1IAHA 3DBFA 1Q99A 3ALOA 3E3PA 2R5TA 4DGLC 5BMSA 2JBPA 4K1BA 4IFCA 2XP2A 1V0PA 4QQCA 5DR2A 4YPDA 4F1TA 3W8QA 4Z55A 1J1BA 2B9JA 2WIPA 3RZBA 4NT4A 4BY9E 2YITA 4KIKA 3RAIA 4G3DA 1Q3WA 1P5EA 3P08A 4K77A 4RC4A 1KE9A 3GI3A 2GQGA 4K9YA 2YISA 3O23A 5CSHA 1O6LA 2JKMA 3PP1A 2YM6A 2FB8A 5J9ZA 4EK3A 5L8JA 4NJDA 3GU8A 2C0TA 3TL8A 3DBCA 4E7WA 4G17A 3CQEA 4R5SA 1H28A 3W1FA 4A9TA 3R1NA 2RG5A 3BKBA 2YM8A 4ZLOA 1RE8A 2E9UA 2JLDA 3SQQA 4AOIA 4EEVA 4F65A 2WOTA 5J7BA 2XNPA 4R6VA 4BZNA 3FXWA 3MIYA 3R73A 3BRBA 1ZYJA 4HNFA 4ZY6A 2YWPA 5J8IA 4YLKA 4PQNA 4JDJA 2OZOA 2GDOA 5HG5A 1JKSA 1BI7A 2WMBA 3IK3A 3D15A 4J71A 4AZVA 3QUEA 5A4LA 4QP1A 3CJFA 4JLCA 5JFSA 5M51A 1IA9A 5M06A 2BILB 3PE1A 4F9BA 3QRUA 2P4IA 4FF8A 3GUBA 2WTDA 2VUWA 2XIZA 5EOLA 2NRUA 4YJVA 4I3ZA 4MHAA 4AFJA 5AWMA 3LMIA 2DWBA 3O7LD 4FKJA 4PUZA 2PE0A 3ZLWA 5EI8A 5AM6A 3AMAA 5M44A 2XCHA 1PHKA 2Y0AA 3LFEA 4UZDA 3P5KA 3CY2A 3R7YA 5CXZA 3KF7A 3VBXA 4CZUA 4AN9A 5DLSA 3WZEA 4OUCA 1Q41A 4QYYA 3EL7A 4M14A 5ETAA 3C5IA 5IA1A 3A61A 3R1QA 3QKKA 3BYMA 1HOWA 4TTHB 1SVHA 4MD7E 2H96A 2CLQA 5EI2A 4IJ9A 1YXTA 4EYJA 3QLGA 1UA2A 5M4UA 1RJBA 5JGDA 3G51A 4A06A 2BDFA 3CP9A 5E8ZA 4FTIA 4IANA 1RW8A 2WMTA 3PIYA 5FP5A 3FZSA 4BDDA 1ZAOA 3PVGA 1PW2A 5CEMA 3ULZA 2R0UA 3E93A 1GIHA 3UC3A 4QMWA 1CKPA 4PV0A 3SVVA 4RJ6A 2BHHA 3NNWA 5E8YA 3AC5A 2C68A 1U59A 2WMUA 3E7OA 3G9LX 3ERKA 3PPZA 4XG4A 3UE4A 4BI0A 4O1PA 3QTZA 5KKRB 2CKEA 3TKIA 5TKDA 4FMQA 1XBCA 5F9EA 1APME 3VULA 3T3VA 3W2OA 2HY0A 2OZAA 2JDRA 3DT1A 4FIEA 4L42A 4UBAA 2VGOA 2VTSA 2YDJA 4AT5A 4HPTE 5K9IA 3VBQA 5GIPE 4I4FA 4YUQA 2PVJA 4EWQA 4PF4A 4DEGA 2XKCA 4TKSA 5EQPA 3ROCA 2R7BA 4G5PA 5BYZA 4BCHA 1F5QA 5JKGA 3RPVA 3QCQA 4BWKA 5EDPA 5CQUA 5IDPA 5K0XA 1R39A 1W8CA 2UZWE 3MJ2A 3D5WA 3FC2A 4EONA 4YSJA 3NUUA 4LOQA 1DS5A 4DGMA 2BCJA 2UW8A 4WD5A 4Y72A 2OIBA 5CI7A 4YZCA 3DXQA 1YVJA 3GB2A 1G3NA 3IECA 3QAME 4RG0A 2WQNA 4CFXA 1Y91A 1KWPA 3C4WA 3F3ZA 3LOKA 2O2UA 2R3GA 5ETCA 3BBTB 1OPKA 4C3PA 3V5QA 4F6UA 4OTHA 4ANNA 4DTBA 4MEDA 2VTAA 5DPVA 4ACMA 2VWVA 1NY3A 3ZLYA 4ALWA 1ZY4A 4BDAA 4BICA 3PE2A 4V0GA 5L2WA 4IWDA 3W2SA 4RPVA 5AAFA 2YCQA 4AZFA 1GZNA 4E4XA 2Q83A 3SG9A 3H9RA 3C0HA 4IBMA 1JPAA 4AN3A 1XJDA 3ZSGA 2ZV7A 1Q8YA 2PZRA 3FLYA 3Q4TA 4KKGA 2WU7A 3RPSA 3UG1A 4FSWA 2UZOA 4OTPA 5CQWA 5ANJA 5AUZA 5KE0A 3KN6A 1H1QA 3RMFA 3CXWA 3LCKA 3WIGA 4FKOA 5M09A 3K2LA 3OTUA 4ANMA 4CFUA 4FKUA 3E87A 3FV8A 3V51A 2OJ9A 4AAAA 5LWNA 5EYMA 3ITZA 4FEWA 2F7EE 3ORMA 4O0UA 4YC6A 5K3YA 5IUHA 5IPJA 3TKHA 1ND4A 3LFCA 4YTHA 3SXRA 5IQEA 3C7QA 4FYNA 4OBOA 1IEPA 4OTGA 5A6OA 3OY1A 2F4JA 2J0KA 3BE9A 5I4NA 4EBVA 2B55A 4CZYB 4F09A 2HW6A 3PA4A 2ZV2A 3LW0A 4H05A 4RZVA 3BYOA 3EQDA 3DTWA 4PDOA 2VWIA 2VWZA 3I6WA 3ZEWA 2BKZA 4J52A 3GCPA 5FD2A 2XJ0A 3D5VA 2J6MA 3P7AA 4F08A 2BRNA 4GFMA 3AC1A 4PMMA 2P55A 1T46A 4QMXA 3R21A 4P2KA 4TWOA 3ID6C 3QTIA 1UNHA 3PSCA 5AUVA 4I5CA 3QRIA 4PL4A 4EORA 2JC6A 3QC9A 4WKQA 4X0MA 3WF5A 3WIKA 3Q2JA 5IQDA 4EWHA 2PMLX 5D1JA 2Y4IB 3TM0A 4F63A 4OLIA 2WPAA 4EHEA 3DFAA 3QQJA 5HE2A 1TQPA 3HRBA 2ZDUA 4QQJA 4ZSLA 3D7TA 2UW4A 3EN4A 2WXVA 3SW4A 4D58A 2UW0A 2X8EA 5HHWA 3ZM4A 1W7HA 2V7AA 4IAFA 5FQDC 1W0XC 4BCMA 3TV4A 4IJPA 3L8PA 3FY2A 3ELJA 2QVSE 1JLUE 1GY3A 5IQCA 2E9PA 3CR0A 4I5PA 5IH4A 2Z7RA 5E8TA 4RFYA 4C59A 3NNVA 1MQ4A 4OT6A 4E6AA 4FTQA 3FMLA 5CF5A 4XHKB 3UZRA 3FYKX 3OXZA 4MNFA 4J95A 4XRJA 3IOPA 4OTWA 4LG4A 2BUJA 2OSCA 5JSMA 4KS8A 3S0OA 2RIOA 2WU6A 2YDIA 4YSMA 4B0GA 3ZFXA 3U51A 5CSPA 3ORTA 3PVWA 2FO0A 4I23A 3FLQA 3CS9A 4RLKA 4FG8A 4BBFA 3LHJA 2EXEA 2DS1A 3N51A 2NNWB 3KXZA 4N6YA 4CTCA 2P2HA 2HWPA 4B4LA 4EZ5A 4F64A 2DQ7X 3QALE 4QYGA 3MFUA 2BRBA 4D2RA 1TVOA 1A9UA 1WVXA 3RINA 3MH3A 1SVGA 5IDNA 3PSDA 4IZYA 4FV7A 3E8EA 3I79A 4FZDB 4IXPA 5HE0A 3THBA 2VTLA 4OR5A 4YTFA 1J7LA 5FRIA 4FZFB 4W4XA 5IA5A 4YNOA 4EBWA 2XIXA 3LFBA 4M66A 5C8MA 4FX3A 3DKGA 4OAVB 3O8PA 1REJA 2BMCA 4FZ6A 1WBPA 5G1XA 3WF7A 3ALNA 4V04A 3D94A 4EUTA 3R9HA 2RFNA 4EOPA 1PF8A 3K5UA 3OCSA 5C1QB 5CF6A 2XRWA 3ZRLA 3HV5A 3DA6A 4QMLA 3R04A 3S1HA 4MF0A 2QOFA 3QTQA 4QRCA 5CEOA 3NVMB 3IG7A 3PJ1A 4O83A 2OKRA 3BYUA 5M55A 2PUIA 2CPKE 4D2TA 3ZO2A 3FMKA 3LIJA 2NRYA 5DI1A 5HG9A 2ITXA 3VUKA 5IMXA 2HWOA 2ITVA 3PVUA 3I7BA 3MDYA 4I0RA 2CMWA 4JX7A 2J4ZA 5CF4A 4R7BA 4YZMA 3D9VA 4DCEA 4EC8A 2ZAZA 4H3PA 5BYYA 1R0PA 3ZC6A 3FBVA 4UWBA 3HYHA 4ZXTA 4KIOA 4FODA 4G9RA 3QTSA 2ITZA 3I6UA 5JT2A 5CS6A 4I20A 1YWVA 2PHKA 4WBBB 3DCVA 1B39A 1GNGA 3TKUA 3RHXA 3VO3A 3VQUA 5CNNA 4UV0A 3MA3A 5HU9A 4JVGA 4Z16A 5IQGA 1JKLA 3OWLA 3BGQA 3GBZA 4EQMA 4ZLZA 5IA4A 2YIQA 3Q9XA 2YCFA 3PXKA 3A99A 2W1FA 4AA4A 2Y6OA 3ZO4A 3VS2A 1K9AA 2XNEA 3W33A 3NYXA 3UDBA 3NSZA 4TYJA 3HV4A 5LXMA 2HELA 5K5NA 4IB5A 4GYIA 4UEUA 3ODYX 1MUOA 4BTKA 3QC4A 5AP2A 3FMEA 2NO3A 2UW3A 4AZSA 2A19B 1P2AA 3A4OX 4X3JA 4D9TA 2P3GX 3BWFA 3RK9A 4ZTQA 5HORA 3GCVA 4FKWA 4DF3A 4U79A 5HTIA 5KCVA 5C8KA 3U9NA 5CTPA 4DBNA 5T68A 2VO0A 1Q3DA 3D5XA 3MYGA 1PXKA 2WB8A 2JD5A 3VS0A 3WARA 4EZ7A 3CKXA 2H34A 2VWYA 2OF4A 3PY0A 5AV1A 3ACJA 3AQVA 2XK6A 4ANOA 2I6LA 2VN9A 4DG2E 4NL0A 3FQSA 4QP8A 2CKPA 3U6HA 3VBWA 4FUYA 3P0MA 1XWSA 4RMZA 4U43A 4AT4A 2GNJA 4YTCA 3K3JA 4O0WA 4RGJA 4QTAA 5IH5A 2B7AA 4PDPA 1AD5A 5GINE 1YWRA 5ACKA 4B6LA 3H4JA 4QMPA 2YA9A 3LZBA 4EOIA 4D4SA 4FKIA 2RKUA 5FXQA 2IW8A 3RCJA 3VNTA 4Z7HA 2UVYA 4X2JA 2G01A 2Y8OA 1VR2A 2BFXA 2WOUA 4ASEA 3C4FA 2I0HA 2Z60A 5LJJA 5LVMA 4BWPA 3BLHA 4H39A 4W4VA 3TZ7A 2GCDA 3ACKA 2QQ7A 3U9CA 3HP5A 4ASXA 3GFWA 2F2CB 4RC2A 3KA0A 5A46A 4BDIA 4F9AA 4FGRA 1YXVA 3SGCA 4TZRA 5DWRA 3NUXA 3DBDA 3HMPA 5HIEA 3EZVA 3HRFA 4JDHA 4YZBA 1Q4LA 4L67A 5IMEA 2GHLA 1W82A 3CIKA 4K11A 2B0QA 4DN5A 4XCUA 1ZYDA 2R3PA 4TY1A 3IW8A 5BUEA 2XBAA 4UY9A 3U54A 2CKQA 5H9BA 4PWNA 5DRDA 4UMPA 5LMAA 4LOOA 4Y95A 2X4FA 2QHNA 1U54B 2HZNA 3L9LA 4QTBA 4MXCA 4ERKA 4NW5A 4IFGA 3ORPA 4QP9A 4BYIA 5AX9A 2OJIA 3DY7A 4RIXB 4MVFA 2B1PA 3TI1A 2J0IA 3Q4ZA 4YJOA 4F1OA 4R7IA 3W2PA 3KRLA 4JL9A 4JRVA 4BZOA 1ZYCA 3OVVA 3EQCA 3R7GA 1LEWA 3EN6A 5F94A 4RJ7A 3FXXA 4C34A 1H0VA 2J51A 4HVIA 5J79A 1G5SA 3BI6A 1Y6AA 2W05A 4R77A 3KMUA 1ZYSA 5JZJA 3PXZA 4A9SA 5I9UA 3U6IA 3KL8A 3C1XA 3MPMA 1YI3A 3POZA 4N6ZA 5EQEA 5IQFA 3NYOA 4YZDA 1AGWA 3JVSA 1XKKA 4X7QA 4LV5A 1J7IA 3TIYA 4EH9A 2Q0BA 3QLFA 3QXPA 3QRTA 4L7SA 3UVPA 5KBQA 3LCSA 4HVGA 3II5A 3BELA 3O8UA 1I09A 2B9HA 1YRPA 2ZM1A 4WG5A 4XG6A 3S2PA 3UODA 5HESA 5GIOE 5G6VA 3E8DA 2WMWA 3QFVA 2ZM3A 1U5RA 3GU4A 3QQUA 4GUEA 4D0WA 1YOMA 2QU5A 3PIZA 5DN3A 2XNNA 3RNIA 1OL6A 2YM7A 4RIWB 4JAIA 4FKLA 4EH5A 3PVBA 2B9FA 2JITA 3GCQA 3VHEA 3QA8A 4E3CA 5CF8A 2XB7A 3NW7A 4ZTSA 3UO4A 4CFWA 5H8EA 3QTWA 4R1VA 1P4FA 4ZOGA 4DG0E 2VGPA 2BHEA 1REKA 1UVRA 2QG5A 2PVFA 3IDBA 4FGBA 4RVLA 4BWXA 4ZMFA 5DGZA 1OL5A 5FM3A 2VWWA 3UOLA 4BDCA 4N70A 4QOXA 3VS4A 2UW7A 4I93A 4XS2A 3TACA 2BTSA 2GNFA 2R3LA 4NTTA 5LCKA 4TPTA 4CFFA 4CFNA 1U46A 2CGXA 3QHWA 4RA4A 2I0VA 2J9MA 5D9HA 3JPVA 2PL0A 3KRXA 4F7SA 3P79A 4O2ZA 2W06A 5B2LA 2O63A 3IONA 4FV1A 2QKWB 1MRVA 4S30A 3Q9WA 1JSUA 1J91A 4DINA 4JIAA 4AZWA 1XH5A 3UG2A 3KK8A 3FL4A 2BPMA 1H1PA 4FV0A 4B99A 4BHNA 3DJ7A 1Q5KA 4YBJA 2VO7A 1LPUA 3MA6A 4TRLA 4D55A 4AOJA 2XNMA 3O8TA 4UYAA 5DR6A 3SD0A 4LMNA 4C4JA 4OAUC 3F3VA 4YJUA 4IAZA 5LCJA 3MJ1A 4LRKA 1CMKE 3L1SA 4C02A 3E92A 2FSLX 3NNUA 3BBWA 2R3NA 3R9DA 5KNJA 4MXZA 3VUHA 5JRSA 2YAAA 5I3OA 4IVAA 3MBLA 4WRSA 4KINA 4C4GA 4RJ8A 4BDEA 4JIKA 3V01A 2C6IA 5IEYA 2A27A 1PRYA 4CT2A 5HLPA 4O82A 4YJSA 4M0YA 2BFYA 4EH6A 3GC0A 1UU8A 2XA4A 1M2RA 4ZSEA 5KKRC 4FTJA 4RWJA 3F88A 2OBJA 4NKAA 3F3TA 3ULIA 3MFTA 3VAPA 2OH4A 4O0RA 1TQMA 3PG1A 5FDXA 5J1VA 4D28A 4FSZA 5EDRA 3S3IA 1R1WA 4R3PA 5DA3A 3Q5ZA 3NW6A 4Q5EA 5HEZA 5CAPA 1YXSA 1NA7A 3NUSA 4PMTA 2HXLA 3EJ1A 3ENMA 4RIYB 3V5WA 4D1ZA 2GNIA 4TWCA 3BV2A 4XJ0A 2BAJA 2QO2A 4FTMA 1DAWA 2W4KA 4ZMEA 4DITA 4L00A 2VD5A 3BWJA 4QMYA 3OWPA 4GT4A 4RX9A 3ZXTA 3IO7A 3AC2A 3OCBA 3UIUA 4KUJA 3BX5A 4KS7A 4MBLA 5FTQA 5AX3A 5IA0A 3H10A 4J8MA 2EB3A 3AMYA 1UU3A 3TTJA 4GT3A 4ENXA 4IC7A 5KHWA 3FI4A 4XG2A 3NIZA 2GTNA 4J99A 3H30A 4FYOA 1H00A 3ORIA 4ACDA 3FEGA 4CGAA 1TQIA 2C0IA 3DZOA 2JIIA 4YR8A 3RPRA 4HNIA 2IZTA 2WMXA 3ZFYA 1PXPA 1FQ1B 1V0BA 1LEZA 3W16A 4DT8A 3DBEA 3Q4CA 3DKOA 5DEWA 1BUHA 5EKNA 5EM7A 4WUAA 1NW1A 3W2QA 5DEYA 4U6RA 3HZTA
chains in the Genus database with same CATH superfamily
2XANA 2WTIA 3Q4UA 5DR9A 3DV3A 3W10A 3ZEPA 2HOGA 2XYNA 4YLJA 2YCRA 5FP6A 3FE3A 3VUTA 1QCFA 3COKA 3GC7A 1YDTE 3LVPA 3BV3A 4USFA 3QU0A 4O7WA 1U54A 3F5GA 2BIKB 2KULA 4O4EA 2KTYA 2R2PA 3QXOA 2AQXA 1CTPE 3FI3A 3GQLA 2E9OA 2VTJA 2XK7A 4RIXA 3ZBXA 3WI6A 2C6EA 2XZSA 4FSQA 3LPBA 4G31A 3ZDUA 3DKCA 4L43A 1XH9A 4FT7A 4ANQA 3NFGB 4CTBA 2HAKA 3JY9A 4W9WA 1M7NA 3ET7A 1OGUA 4O4FA 4ZTMA 1R78A 3PXQA 4BL1A 3VRYA 2VO3A 3AKKA 2PMNX 2BRMA 3I81A 5C9CA 4FIIA 5GZAA 1XBBA 2GHMA 3C51A 3O0GA 5E8UA 4BDFA 4J97A 3UNJA 4LM5A 3VHKA 2W7XA 1WFCA 2C6LA 1U4DA 1XQZA 3COMA 2ITWA 3G9NA 2ITPA 4YJPA 2GFSA 4HCTA 4BCKA 4FIHA 2OK1A 2W1IA 3DAJA 4Q5HA 3ZZWA 1WBNA 3KMWA 4AGUA 4KSQA 2QO9A 2QR8A 4GS6A 4GV1A 3Q32A 4IQ6A 4P90A 2OFVA 3GOKA 2WTCA 3OUKA 3VS5A 5JFXA 3ZUUA 3R8LA 5TE0A 2IJMA 2Y4IC 3DNEA 4WSQA 4IWOA 4L9IA 2ZYBA 4RIWA 3DFCB 5BVKA 3ATTA 3S4QA 3PPKA 4BKJA 3GVUA 4G3EA 3OT3A 2W1GA 3KGAA 3ORKA 4FG7A 1IG1A 4UMUA 3WZDA 1BMKA 2XUUA 2QLQA 1SNXA 3R8VA 1FINA 4UB7A 2G2FA 5LVLA 3HUCA 2QOKA 3A8WA 5AADA 5LVPA 2PWLA 4ZTLA 4WIHA 5CVGA 4E8AA 1M2PA 5A9UA 1OIQA 5DVRA 1EH4A 4U40A 2XYUA 4JDKA 4M7IA 4MTAA 3AD4A 2JKQA 2RGPA 3FDNA 4FVPA 2QG7A 5KMJA 4BIDA 2UVXA 1QPCA 3AMBA 5C03A 5L2SA 2C4GA 4XRLA 1BKXA 4FC0A 3WF6A 4B9DA 3KN5A 3I60A 1KSWA 5CXHA 2PUPA 1NVSA 4PX6A 3EFKA 4FTUA 4Q2AA 3QQFA 5E8WA 4QP7A 3BZ3A 1PMVA 3BHHA 4JT3A 3ZTXA 2ONLA 3DPKA 3FLNC 3GCUA 1R3CA 3NZ0A 4QMQA 4ZY4A 3SW7A 4XLIA 3UQGA 4BIEA 4YGAA 2X1NA 3KMMA 3LQ5A 3Q60A 3SV0A 3LLTA 3NX8A 4EH3A 3DLZA 3IS5A 4EH8A 1XHAA 3NNXA 5GHVA 4TYHB 4GMYA 3AC8A 3GU7A 2OFUA 4F7LA 3RBWA 4E4MA 3F2AA 3W55A 5L2IA 1FMKA 3TTIA 2OLCA 4CEGA 2WQEA 3NMUF 4CG9A 1Q61A 4QO9A 1YHWA 3JUHA 5JGBA 3UTOA 5AR3A 3FSKA 3BGPA 3HLLA 2BALA 4BZDA 4EL9A 5HO6A 3H3CA 5E92A 4NM7A 3FQHA 2V5QA 2C6TA 3A7HA 2J90A 3C0IA 3QUDA 3JXWA 3KXMA 5FXRA 4ZEGA 3CD8A 2O65A 5CU6A 4E4NA 3GU6A 3PUPA 3D2IA 1DAYA 3QQHA 4E5AX 4EQUA 5J1WA 1KV1A 3NR9A 4G3GA 4RRVA 4GFOA 3GU5A 1TZDA 5D10A 3R7EA 2PULA 5AFVA 2C3IB 3FLZA 3R9NA 1PXLA 2UW6A 1H8FA 4EOSA 4O2PA 4U9AA 3OWJA 3ZYAA 1IRKA 5J87A 3MI9A 1MP8A 4Y5HA 4ZAUA 5TOZA 4MX9A 2XK8A 3KRWA 4PMPA 4D2VA 3NYNA 3HP2A 5HNIX 3ORNA 5ITAA 5IZFA 3UPZA 2CN8A 3LE6A 3IPHA 4XP3A 4F9CA 3RK5A 3MVLA 1J7UA 4W8EA 4BCPA 3N4UA 2CNVA 3ETAA 2GNGA 5GJDA 2UZUE 2RFSA 4RIYA 2O64A 2C6KA 2LGCA 2X6EA 3G15A 4L53A 3R9RA 2PVMA 3CEKA 4I6FA 4AQKA 3JYAA 5KMLA 1KE8A 3CY3A 3QZGA 1M17A 3KCFA 2EU9A 4OTQA 4ZZNA 3BYSA 3B2TA 2C6OA 3R83A 2C1BA 4AGWA 3HMMA 1XR1A 2OGVA 3KKVA 4BKZA 1ZARA 1GOLA 3P78A 4Z3VA 2OU7A 4FTAA 2ZJWA 3ANQA 3PJ8A 3MB7A 2R0IA 4EOJA 4BI2A 1O6YA 3MESA 4JBQA 4R1YA 4C62A 5C26A 3NLBA 2Z7QA 3W32A 2ITYA 2O3PA 1E1XA 5B0XA 5HI2A 2VWUA 4FE2A 5IKWA 5BYLA 1H27A 2R3OA 4FKTA 4C58A 1J3HA 2R3QA 2JEDA 2R3KA 2ITNA 3Q5IA 3EIDA 3RALA 4O7LA 4O0TA 2PVYA 1KE7A 2J5EA 4IAYA 5CAUA 3RAKA 3S00A 2O8YA 4U7ZA 4AXFA 3O2MA 4BTFA 3R7IA 5ANDA 3R7VA 3UMWA 4FOCA 2QOHA 3SXSA 2IPXA 2I7QA 1ERKA 5AP3A 4JI9A 3F5UA 3ML1A 4I0SA 5D7VA 3OUNB 4X3FA 5DMZA 4DH8A 5I9ZA 4AZEA 4X21A 3ORLA 2VTTA 1YQJA 4P5QA 3BPRA 4JBPA 4O21A 4UALA 3R02A 2DUVA 4RSSA 4LGGA 3RVGA 3RNYA 3W2CA 3UNKA 4G6OA 2ZMCA 3OROA 3VC4A 3G33A 4CD0A 4IM2A 4BCIA 2JFMA 4C38A 2V22A 2AEGA 4F6WA 3F61A 2FA2A 3LQ8A 3GQIA 1OB3A 5FTGA 2CN5A 5CLPA 5AP1A 2XEYA 1PYXA 3P23A 2A1AB 3MTFA 3ZFMA 3EKKA 3K3IA 3K54A 4G3FA 3JVRA 3FLSA 3NUAA 4GKIA 4C33A 1IAJA 2X9EA 4ZP5A 4A9UA 4DHJA 1ATPE 5CZIA 5AR5A 4QP4A 3TCPA 5BVNA 4I92A 4AXDA 4ALVA 3EHAA 4RJ3A 2C6DA 4EK5A 4F1MA 3QBNA 5EK7A 2REIA 3LXPA 3EN9A 3HMIA 2BAKA 3TDWA 3DTCA 4QPSA 5IQHA 4DFLA 5GJGA 2CGWA 3ZHPC 5L6PA 1JVPP 3NYVA 4O0SA 3ZCLA 3TMOA 3MTLA 3EL8A 2QOBA 3MVJA 3EFLA 3QHRA 2VRXA 4FV9A 4LL0A 5JN2A 3ZXZA 4UMTA 5AM7A 5AR7A 1ZRZA 4IWPA 1ZZ2A 2PK9A 3CTHA 5CSWA 5L6OA 4ITHA 4DG3E 4JRNA 5HD7A 5HX8A 5FEEA 4WA9A 4G16A 4B8MA 4MQ1A 5F95A 3MGYA 4FEUA 2HCKA 5J95A 3KREA 1PY5A 3POOA 2IW9A 4HZRA 3W18A 5IA3A 4FSRA 2J50A 2VX3A 4HPUE 4BN1A 3R8UA 3PIXA 3FKLA 5HNBA 2YAKA 3QX2A 3R9OA 1GIJA 1BYGA 2OIQA 4FIJA 4HYUA 3PZEA 3TNIA 4NW6A 3UGCA 2CGVA 4F78A 3SOCA 5CYIA 5CEPA 3QD0A 5CWZA 3VW8A 2R4BA 5LMKA 3K5VA 3R28A 1Y6BA 3RZFA 3IW5A 4NH1A 4HCUA 2QONA 1OL1A 3ZRKA 3OMVA 3UZTA 3IDPA 4NSTA 3PG3A 5B2KA 3LLAA 4O96A 3V8SA 4DEBA 5AAEA 5DYJA 3OS3A 3VUMA 3OW3A 4PPBA 2RSVA 4XG9A 2V0DA 1ST0A 1WVWA 3UZPA 2JKKA 2YJSA 1ZZLA 2OWBA 4NU1A 4Y73A 1YKRA 3ATSA 3UVRA 2WTKB 3VVHA 4NIFB 4U8ZA 3N4TA 5M08A 1VYZA 5HCYA 3PA3A 1OKWA 1CSNA 4DFYA 4E20A 3AGMA 3UQFA 2XALA 3FZRA 4W4WA 4TWNA 4AWIA 4CQEA 5DG5A 5AP4A 4DFBA 5I3RA 4TYHA 3V8WA 4M69B 5DH3A 5CU3A 1Q8TA 3WZUA 1R0EA 2JIUA 3NEWA 2G9XA 2ETRA 3RGFA 3FI2A 4FUXA 2JGZA 3L8SA 4S31A 3R01A 5CEKA 2OJJA 3CPBA 1PXIA 1XH4A 4M68A 1Q97A 2JDVA 2CNQA 3A7IA 4NJ3A 2PE2A 5AP6A 4FT3A 1L8TA 4XV3A 5M53A 2WQMA 3H0ZA 3LFAA 5AV2A 3DU8A 4WT6A 5I5ZA 3DKFA 3NAYA 4FKPA 4RFMA 4AQCA 1H07A 2WAJA 1UWJA 1XH8A 1WVYA 2P33A 2W9FB 2XJ2A 3B2WA 3MH2A 3PXRA 4J7BA 5HIDA 4G9CA 3LAUA 1Y8GA 4RWLA 4G6LA 1URWA 4L3PA 4BRXA 5TF9A 3R7UA 3BLRA 3VONA 4W9XA 2GS7A 4D1XA 2GQRA 1MRUA 3KVWA 3LCTA 1WBSA 3C4CA 3NPCA 3ZUTA 4O81A 1E9HA 4QDVA 3A7JA 5E4HA 1FVTA 5ETIA 4UZHA 4KKEA 2WMSA 5ANOA 4YO6A 2ERKA 5KZIA 4BCOA 4OGRA 4IWQA 4A9RA 2W1CA 5AR4A 2ONLC 4CYJA 4EK6A 3F2RA 5HCXA 4Y46A 4I4EA 2UZLA 5HZNA 2YWVA 1DI8A 3HAMA 1M2QA 5EOBA 1WBVA 2YERA 3QYZA 4EOOA 5GZ9A 4BI1A 3EN7A 3VS1A 3VS3A 2IVSA 4KBKA 4X6RA 2EWAA 3L8VA 4QP3A 4I21A 3VWAA 2JDTA 4U97A 3RCDA 4JG8A 4NFMA 3PFYA 4X2FA 5M07A 4LGDA 1OUKA 4CFVA 1H08A 3QWKA 4M84A 1W84A 4IB3A 4F9WA 2XH5A 2VX0A 5CASA 3OOMA 2W1HA 4ERWA 3R8ZA 3UDZA 4L7FA 4RZWA 1BL6A 2I0EA 2YM4A 5CT7A 5HOAA 3R00A 4JMQA 4KBCA 3ZS5A 2PE1A 3FPMA 3BL7A 5CANA 1U5QA 3QD2B 4AW0A 4CXAA 2GU8A 2OW3A 5I9XA 4XG7A 3RI1A 4ACGA 4GYGA 1BLXA 3RAWA 4BKYA 1K3AA 3SKCA 2ESMA 3C4XA 2HZ0A 4IX3A 3HMNA 4O0VA 2WD1A 4RX8A 5EYDA 3TUBA 4R78A 4DFUA 3BEAA 2F9GA 4P4CA 5EM5A 1O6KA 4QMUA 4JQ8A 4NEUA 4FT0A 3B8QA 2XF0A 4QMOA 5E7RA 4RQKA 2PZIA 3GC9A 3CLYA 4G1WA 4MWHA 5EH0A 3D5UA 3I5ZA 3QQLA 1UNLA 5BVWA 4EOQA 2Z7LA 4FNXA 4TW9A 5A54A 3W0OA 3R7OA 2EB2A 1X8BA 3QD4A 3ZMMA 4CMTA 2UV2A 4NTSA 5HBJA 3W0NA 4QMMA 3MV5A 4WUNA 4O7SA 2YJRA 2IEWA 3SXFA 3FZPA 5KMKA 5IQIA 2WNTA 3G5DA 4EKLA 4HVDA 1YOLA 3TZMA 4C8BA 4DFZE 3V5TA 3SAYA 2PZ5A 1FGIA 2BDWA 5DNRA 2PY3A 3H0YA 3OBGA 1H01A 3V5LA 4YU2A 5EM6A 3WYYA 3HL7A 1BI8A 2QOQA 1UV5A 2UW9A 3DB8A 4FG9A 2R3JA 2FSOX 3Q96A 4H58A 2WQBA 4I6HA 3VJNA 3ZBFA 4BHZA 3RPYA 1QPJA 4LV7A 5CSVA 4JAJA 5EFQA 1Z57A 4GIHA 1OIRA 2WMQA 5CEQA 5A4TA 2QOLA 3C9WA 4O91A 4S33A 1PYEA 3O51A 2QD9A 5AUYA 4F7JA 2OXXA 5ACBC 3FWQA 3FXZA 4H3BA 4XLVA 1UKIA 2XKFA 3EMGA 3MW1A 1UU7A 4L52A 1OKZA 5TO8A 4CMOA 3DXNA 3FLWA 4D0XA 3FZTA 3NDMA 1WAKA 3OF0A 3KQ7A 4X3FC 5DT4A 4HW7A 1UWHA 3P9JA 5IA2A 3MIAA 2QOIA 2J0JA 4CFMA 4FJVA 4CG8A 3L8XA 4IVBA 2BTRA 2IZRA 1L3RE 5HE1A 3HAVA 2PSQA 2ZM4A 4M97A 4O27B 3EN5A 3A8XA 5IF1A 4II5A 4GUBA 4C3FA 3CQWA 4XG3A 3ZSIA 2X2KA 1CKJA 4D5KA 4D1SA 2H8HA 3FL5A 5BX0A 4AW1A 1K2PA 4O6EA 2G2IA 4QMTA 3ZO1A 4AFEA 4ZSAA 1PKGA 3BU3A 4IIRA 3OD6X 2PVRA 3CKWA 2XVDA 5CU2A 4XUFA 5GZ8A 1JAMA 1WBWA 5A3XA 3FSFA 4OW8A 2X4ZA 4O22A 1UNGA 3MPAA 5JZNA 4AW5A 4FICA 3LMGA 5FGKA 3GP0A 3UIXA 3A7GA 4FZ7A 3UOKA 4DLIA 4IZ5A 2ETKA 4F70A 2BZIB 4NIFA 4WG3A 3PXYA 4M8TA 4IMYA 4NWMA 4DEEA 5E9EA 2ZVAA 3AT2A 4H1JA 4FTRA 4AZTA 3O17A 3Q04A 4GSBA 3OW4A 4UWCA 4ID7A 3COIA 3A7FA 4KA3A 3ENHA 4O7NA 2QLUA 3FC1X 3AXWA 4LUDA 3CGFA 4BIBA 2HXQA 4HGSA 4M69A 4U3ZA 5HD4A 5KHXA 2P2IA 2B54A 4ONAA 4OBPA 4P5ZA 1OPLA 2F7ZE 3COHA 4BYJA 3ZM9A 3KK9A 4MK0A 2Y9QA 5I9WA 3UIMA 4QT1A 5M4CA 4R8QA 2YM5A 2HW7A 3HKOA 3P4KA 4FV6A 5IEVA 4OTIA 3F7WA 3A2CA 3LXNA 4FTTA 2YLEA 1YI4A 3EH9A 5AUTA 4PRJA 2X6DA 3FMMA 4OTDA 4FNWA 1AQ1A 3EQPA 4UYNA 4X2NA 3L9PA 3UDSA 1ZMWA 3NS9A 3IW6A 4BTJA 3QL8A 4KWPA 5J5SA 3OCGA 3Q53A 2RFDA 3OBJA 2I0YA 4O1OA 5EG3A 4DFNA 1JQHA 5LMKC 3QWJA 2ITUA 4L45A 5DIAA 3BQRA 3UNZA 4XYFA 2PPQA 2FSTX 3R2BA 4RVKA 5IQBA 3DQXA 4E6QA 4PDSA 1B38A 3NUYA 4CNHA 2C5VA 3TZ9A 4IZAA 5CZHA 2VTOA 5L2QA 3H9FA 3AKJA 1WBTA 1WBOA 2CCHA 4IX4A 2CJMA 4DFXE 4FBXA 1P4OA 1STCE 5EHLA 2VWXA 4QQTA 4UXLA 2AYPA 3LXKA 1JBPE 4ANBA 4I0TA 4YO4A 3QD3A 2ITTA 3ZLXA 4L44A 1H1SA 3ORXA 3I4BA 3QTUA 4ACCA 2WHBA 5DRBA 4BC6A 4E6CA 1OBDA 2VTHA 4EOLA 4FSMA 1P14A 1UU9A 3Q52A 5AIKA 3TDVA 2FUMA 3KXXA 2A0CX 5C8NA 5L8KA 1YDRE 2ZB1A 4FOBA 5HG8A 3HA6A 4KD1A 3CGOA 2BRHA 4F0FA 2V55A 5HO7A 1ZOEA 5EW3A 4AN2A 5BVDA 4AA0A 4WSYA 4O7ZA 5LWMA 4I6QA 1LUFA 1BX6A 5ANGA 3NIEA 3TUDA 2VO6A 5EW9A 2CHLA 2JIVA 2XAMA 1FMOE 2W0JA 3R63A 2YIYA 2IW6A 3RWQA 4NM5A 3HECA 3LM5A 4FV3A 1FOTA 3OXTA 4E1ZA 2QCSA 5L6WL 4GL9A 3T9TA 4KRCA 4BGQA 4ZK5A 4DGOA 3DLSA 2F57A 4C2WA 2UZTA 4M12A 4PNKA 4DTAA 5HIBA 3BCEA 1S9IA 2F2UA 4FTLA 4I6BA 4ZJVA 5HVJA 3DK7A 5KMNA 2G15A 2QR7A 3OZ6A 3UO5A 2BZHB 2X2MA 4GIIA 4JR3A 4LRMA 4M15A 1J1CA 2PVLA 3MVHA 4U81A 3F9NA 2PVHA 1PXJA 3JY0A 5J9LA 3REPA 1OL7A 4RA5A 4FT9A 3CJGA 5IISA 2JKOA 3F3WA 3GENA 4KSPA 4A4OA 4UMRA 4FT5A 4HOKA 3SRVB 3TT0A 4KIPA 4I24A 3ZC5A 4BGGA 3DDPA 2QO7A 3QCXA 2YFXA 3LFDA 1XBAA 2YABA 3OC1A 4GJ2A 4ITJA 4HGLA 5BV3A 2VTRA 4S2ZA 1VYWA 5E8XA 3BU6A 4FKSA 2YHVA 4GJ3A 1H24A 1WCCA 4TN6A 4DH7A 4FL1A 2Z02A 5BUIA 3D2KA 1OI9A 3N4VA 3MS9A 1CKIA 2EXMA 2R3MA 2WTVA 2ZV8A 3PFQA 5DFPA 3TNQB 1ZYLA 4CMUA 3LFSA 3E62A 4PPAA 2BIYA 5ANIA 4QYHA 5ETFA 3R8MA 1OM1A 1TKIA 4GT5A 4YJQA 3VUDA 4DHFA 4JG7A 4QNAA 4RIOA 3QTRA 5KX8A 3SG8A 2R3IA 4PTGA 3RP9A 4AU8A 1XMMA 4ALUA 4GKHA 4GG5A 2EVAA 3U4WA 4C4HA 4GK2A 2B4SB 1RQQA 3HV3A 4E4LA 3NWWA 3GC8A 4JS8A 1JKKA 3UQCA 1G8AA 3BLAA 1UKHA 4LOPA 2A4LA 4EHGA 2P0CA 4KBAA 2WEIA 5CX9A 4CKJA 2XM9A 4QD6A 1M14A 3OOGA 2RF9A 2X2LA 5M56A 5A4CA 4F0GA 4ZS0A 4DT9A 4QPMA 3SHEA 2HZIA 4AX8A 2F7XE 4JX3A 4EK8A 5E90A 4F99A 5HLNA 3ORZA 2XMYA 4JG6A 1NVRA 3PYYA 4EI4A 2XM8A 3I7CA 1W98A 3QKLA 3LJ1A 3UO6A 1KOBA 1T45A 3E88A 3QZIA 2CNUA 2W1EA 2BR1A 4TXCA 5HG7A 4MQ2A 2XAOA 3ODZX 3AD5A 2WEVA 3LFFA 3TJDA 3EWHA 4JBVA 4B8LA 4E73A 3MY5A 4H1MA 5FLFA 3V5JA 1G8KA 3BGZA 2A2AA 3OT8A 5BVFA 3A60A 3KXHA 3BE2A 3I0QA 4DHIB 2GTMA 2C6MA 1OZ1A 5FXSA 4O4CA 1OPJA 2E9VA 5HNGA 5DT3A 3UJGA 5CU0A 4E6DA 3RPOA 4GVAA 4JQEA 4AT3A 2VWBA 4QMNA 2J5FA 4MH7A 4PMSA 4O0YA 4MNEB 3WBLA 4BBEA 2VNWA 4G5JA 3C13A 4PTCA 4Q9ZA 2GNHA 3D7TB 3BHUA 2C3JA 3KEXA 4C0TA 4YMJA 1ZWSA 2X7OA 3AC4A 3F66A 3KXNA 1Q24A 4RJ5A 4WHZA 5HBHA 3RM7A 3IDCA 5K5XA 2VTQA 4GU6A 4YC3A 4Z9LA 1F3MC 4HYIA 2CCIA 4FNZA 4RC3A 4YP8A 4NUSA 5FEQA 4BJJB 4EH2A 4C36A 3WE4A 3OCTA 4FTOA 3U6JA 4MF1A 5B2MA 5A14A 4UMQA 4I5HA 2WMVA 4W8DA 3LJ2A 2LAVA 3ZRMA 2YLFA 4G34A 2J0LA 5JQ8A 4AS0A 3U87A 5BUJA 1H25A 3QKMA 4K8AA 2X0GA 4HZSA 4QP6A 3ZOSA 4F9YA 5A4EA 5C4LA 4JR7A 4ACHA 2XKEA 4V01A 2W4JA 4FEXA 4BCGA 1RDQE 4CVAA 3PUFC 4CV9A 4CKIA 3QRJA 2WGJA 4GK4A 3F82A 2GSFA 4YLLA 3TN8A 2YM3A 3DS6A 1FBNA 3EFWA 4I1ZA 4X2KA 3CE3A 1H0WA 3DAKA 4J8NA 3KB7A 5EYCA 2OXYA 3EQHA 2NYAA 4FSNA 4IAKA 3LKMA 4BTMA 3EQFA 4AA5A 3OXIA 2OF2A 2PUNA 4X2GA 4AP7A 2C5OA 4FZAB 2WTKC 2PMOX 2XIKA 1KE6A 5AA8A 3AG9A 3UVQA 4FIGA 4FV5A 3V8TA 2PZYA 4C57A 2WMAA 5HLWA 4N4SA 2YACA 2QKRA 5CENA 3QCYA 4D2WA 4EKKA 3F69A 2UZBA 5AA9A 4Y83A 1URCA 5L2TA 3MH0A 3BHVA 3CTQA 3V6RA 2G1TA 2HIWA 4RVMA 3Q2MA 5KMMA 4LUEA 4LQMA 3EFJA 3WZJA 3UP7A 3L9MA 5FWKK 2XKDA 2O0UA 4LGHA 4H36A 4IW0A 3F3UA 4FI1A 2YN8A 3IW7A 3D83A 3E63A 4IAAA 3UDTA 3AC3A 2YCSA 4JOAA 4XP0A 5DBXA 4Y8DA 3DNDA 4Y5QA 2QOCA 4OT5A 3N9XA 3WF8A 3CPCA 5EKOA 5I0BA 4IACA 4V05A 4CZTA 4USEA 3FZOA 2VAGA 4YJNA 3DDQA 5M4FA 4NCTA 4U41A 5BMMA 3WE8A 4FTKA 2JAMA 1JKTA 3GFEA 2XK3A 4FSTA 5AV0A 3SX9A 3G90X 2WTWA 2WO6A 1B6CB 4TT7A 2ZDTA 2Y4PA 3MVMA 3Q3BA 3F5PA 1OECA 4TNBA 2H9VA 4G2FA 3IGGA 2IZUA 2OJFE 2IN6A 4ARKA 2B9IA 2W9ZB 5CI6A 4U80A 4EUUA 3PXFA 3FQEA 2C47A 2PVNA 3SRVA 4BDHA 4BCFA 4LYNA 4ITIA 5CU4A 4A4LA 4D2SA 4O6LA 3KFAA 4G3CA 4YJRA 1PKDA 4D4RA 3VJOA 4DEDA 5EI6A 1IASA 2FSMX 3BIZA 4U5JA 2I1MA 2XRUA 3TIZA 3FI8A 5I9VA 4CRSA 5H8BA 3Q6WA 5CY3A 5C01A 2XCKA 1S9JA 3ZU7A 2VTMA 4OTRA 4XEYA 3V04A 4L68A 3TWJA 3V5PA 3NCGA 1XO2B 5JQ5A 3U4UA 4ZZOA 4D2PA 3UMXA 2B53A 2E2BA 4TNDA 4QQ5A 3ZLSA 2WKMA 3NGAA 3KXGA 1VLRA 3OEZA 3DB6A 1CDKA 3QRKA 2R7IA 3ZSHA 5F20A 4DEAA 5BPYA 2X7FA 2EXCX 3E8NA 5CVHA 3BQCA 1H26A 3W2RA 5GJFA 1PXOA 4XV9A 3DGKA 5FTOA 3ZH8A 2VTNA 4KRDA 3TNPC 4IVCA 3EB0A 2C0OA 4S34A 3EYGA 5TT7A 5HQ0A 3F7ZA 4GH2A 2ZMDA 4GVJA 3VF9A 3VS7A 4BR3A 3DQWA 4WNPA 3BLQA 4D9UA 4EZ3A 3PTGA 4MXAA 5E8SA 4LV8A 1I44A 4UX9A 1SYKA 3BEGA 2UUEA 4HJOA 1KV2A 5AAGA 2VNYA 1M7QA 3QQGA 3G2FA 4AXAA 3FMJA 4QYFA 4EYMA 4KABA 4IDVA 4DLJA 2YIXA 2FYSA 5HE3A 1YXXA 4F6SA 1MRYA 2W5BA 2GNLA 4HCVA 3MPTA 5J5TA 2ERZE 2ZOQA 4IM0A 4MD9E 3WZKA 2X7GA 3TJCA 2ZB0A 2WELA 4IX5A 3VF8A 4AW2A 3KULB 4BBMA 4MXYA 2OXDA 3PZHA 3LCDA 3OTVA 2V62A 2HZ4A 3QGYA 3I1AA 5JK3A 4RWIA 2XEZA 1W83A 3HVCA 3W8LA 4FKRA 2JBOA 1NVQA 2EUFB 3AGLA 2CDZA 3R22A 4IM3A 2VX1A 3DAEA 1SNUA 5HBEA 3VBYA 3H9OA 4FEVA 4IZ7A 3VQHA 1G8SA 5L3AA 4C4EA 2Y6MA 4TYEA 3ZO3A 3MFSA 5AEPA 2XK9A 1JNKA 4FVRA 4J96A 4MNEA 4GU9A 1YWNA 4O7RA 4O38A 4YPSA 4AXCA 4DH1A 3EQGA 3LM0A 4O7VA 4E93A 4ZTHA 4N57A 1QL6A 2C3KA 5CAOA 4AGCA 1F0QA 5FBNC 3KVXA 3M11A 1ZMVA 4RVTA 5FBOA 1JSVA 3TZ8A 4XP2A 4A07A 4E5WA 1H1RA 4YURA 3OP5A 1SZMA 4WG4A 1WZYA 4BJJA 2WIHA 4IDTA 3RWPA 3TNHA 1TFFA 1Z5MA 2NPQA 4IHPA 3R0TA 4Q9SA 1Z9XA 5K4IA 4R7HA 4C37A 3CD3A 4FV4A 1PMEA 4ANLA 4FA2A 2CGUA 1YHSA 3MSSA 5E1EA 5FUTA 2RFEA 3C4EA 4USDA 4D4YA 2VTIA 3F6XA 3GOPA 3PP0A 4PPCA 2XBJA 3NCZA 2PZPA 3D14A 4GG7A 2VV9A 4ZSGA 4EC9A 3DZQA 3E8CA 5ANEA 1GZKA 3DOGA 4L6QA 4F4PA 4RQVA 4UN0C 1PMUA 5LQFA 3RHKA 4Z7GA 3LMHA 4FL3A 3D7ZA 4QPAA 2PMIA 5KO1A 4HVHA 3FZ1A 5AUXA 3MY0A 2WMRA 4C7TA 5AUWA 2AUHA 3AT4A 4PTEA 4L01A 1PJKA 2IZSA 2VTPA 4U42A 2AC5A 4JXFA 4ZJIA 2VZ6A 2OIDA 2CLXA 4GEOA 2W96B 3TNWA 3IKAA 2QU6A 3VRZA 4O7TA 3D4QA 3TXOA 4O86A 2I40A 2GS2A 4C4IA 4DTKA 3HMOA 5F4NA 4XBRA 3ZUVA 4DH5A 5IH6A 3ZZEA 4CKRA 3NUNA 2CSNA 4PY1A 3VW6A 3BHTA 3HDNA 4IB1A 3UC4A 4RX5A 4IEBA