4A56A

Crystal structure of the type 2 secretion system pilotin from klebsiella oxytoca
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
VSGQAQLEQLASVAAGARYLKNKCNRSDLPADEAINRAAINVGKKRGWANIDANLLSQRSAQLYQQLQQDSTPEATKCSQFNRQLAPFIDSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pilotin-Secretin Recognition in the Type II Secretion System of Klebsiella Oxytoca.
pubmed doi rcsb
source organism Klebsiella oxytoca
molecule tags Protein transport
molecule keywords PULLULANASE SECRETION PROTEIN PULS
total genus 37
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2011-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09691 T2SS_PulS_OutS Type II secretion system pilotin lipoprotein (PulS_OutS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1630 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4a56A00
4K0UA 3SOLA 3UTKA 4A56A
chains in the Genus database with same CATH superfamily
4CI1B 4V1Av 4WW0A 2V7JA 3AE5A 1FMVA 3HKBE 3PUXF 4I0UA 4NUUA 4QH1A 5FVKA 3EI0A 1NAFA 3A7MA 2XQ4A 4HN9A 1OXZA 4B6XA 3N2OA 3K8PC 4QX7B 3N2GE 2UXDT 4P0AA 2QA7A 3RYHE 3P8CD 1YKEB 2N2NA 5L2LA 4H9PC 2ZMAA 3JADA 4X5TA 2VQET 4DV3T 1YD8G 4HGAA 4JLEA 4O4LE 2NWBA 4H9RC 3MKDA 1J5WA 3ZN1B 4Q25A 2M6BA 4H63H 3UU8A 1SA0E 4X1KE 2YN6A 2LSKA 3C98B 2RA1A 4O8SA 4CN4A 3AEFA 2W63A 3BQKA 4UF0A 4K0KT 1MNDA 4DR5T 3SFDA 2F4VT 2IIUA 1WCRA 4ISTA 3I9YA 2NR4A 4ZS3A 1ZP0A 3WAJA 5HAXA 2R6GF 4F8HA 4YSYA 4ZI2C 4JI0T 3CVRA 3N9QA 2XQ3A 4U2YA 2XHEB 2JJ9A 3PUQA 2HPJA 2VL0A 4YLHA 3R6NA 4E7ZA 2ZM6T 4DR6T 1HF8A 3AAAB 4DR3T 2WMOA 1US7B 2ZM2A 3FXEB 5KMGP 4U7IA 2XQ9A 2SPCA 4DBRA 1E1HB 1NEKA 3PTRB 4IDPA 1YQ4A 4DV6T 4DV4T 2PJQA 3AXJA 4TV8E 4H63V 2JMKA 5LMUT 4JYAT 2BG9A 3HKEE 5HXRA 2WS3A 1IBLT 1M62A 3AEEA 2VURA 3JAEA 3PJAA 2C5JA 5AQJB 2BG9C 5L47A 5FVLA 3CQCB 3NWIA 4HEAA 3RRCA 2XY8B 5AFUL 3DJBA 4KP3C 1QLBA 1X9BA 2LRLA 5AQNB 2V5DA 1G8XA 3ZKRA 3ZYKA 2UU9T 1BR0A 4I4TE 2DI4A 2X9HA 2XQ5A 2NTXA 5JRCB 2WSSV 4EYUA 3AE8A 4TN7B 2LSYA 5DJQC 3N5LA 4EEBA 2IHR1 2L8KA 5ABGA 2KWHA 4NXNT 2BVMA 2YDQA 4YSZA 4JV5T 2V7KA 2UUAT 3EDVA 4YHJA 4HE8A 2WWVA 3CQXC 1S35A 4HFVA 4ZI3D 1T8BA 4UV9B 2A3DA 1YKHB 5HXEA 2CXFA 3JAFA 4CXXA 4DV5T 2G0UA 2CXLA 1BR2A 2Q9QC 3SS1A 3LDQB 1UUSA 2YDRA 4XAXB 5FY0A 3K1SA 5IYZE 1D1BA 3KDSE 1MMAA 4L5GA 5JDQA 1HNWT 2MTQA 3HKDE 4ILBA 5HCMA 2PTFA 2EHOB 2B76A 5TAOA 1UK5A 5KXJA 2A2FX 3K3OA 1NWMX 2V8SV 2ZM8A 4CI2B 3AA7B 3ZSTA 5IHYA 3NBXX 3KVBA 1ZV4X 2IW5B 3AVSA 3LK3B 2Q9QB 3A5XA 1CHUA 4OYKA 4K0UA 2CCQA 5HWYA 4YHHT 4X1IE 3H3AA 2Q9QA 3ZLIA 4C90A 5HWXA 1Y64B 4U33A 4LMLA 3N2KE 3PU3A 4HFHA 5AQMB 4E7SA 3LG7A 3ANWA 5LG3A 3CX6B 1HX1B 3C50A 2OA5A 3AAEB 5FY7A 1LKXA 4IE4A 1T98A 3KV5A 1T7SA 2XZEA 3W15B 4DR2T 5DABA 4WBNE 1QUUA 3N9MA 2HN1A 4DV7T 1BR4A 2JPFA 4OK0A 3ZMVB 4YSXA 3C64A 1HG5A 5LBMA 4AQFC 2ODVA 2Y48B 1KEYA 3GMIA 4JEHB 4L0RA 4GOUA 5LOVE 2WAUA 2X9YA 4TUYE 2NTYA 2K48A 1Y01A 3GN5B 3PUAA 1VRBA 4M1PA 1YXRA 2D2SA 2YINA 3M65A 4AKRB 3ZC0A 3FZHB 2E9XC 1SE7A 2JQ9A 2H89A 2WDRA 4UIGA 4UR9A 5HCJA 2D0UA 2BKNA 2DLRA 3P4QA 5DQVA 3CK6A 2Y6XA 2LSJA 2X0LB 3KBTA 2HN2A 4QXCB 4YTPA 1KNRA 1YQ3A 3OPCA 3O1HA 3UUBA 4JI4T 2E2AA 3AAIA 2XQAA 3S4UA 4EAHA 2FJDA 5IWAT 4UVCB 1OWAA 3HA4A 4BJMA 3C4WA 3ZJ2A 4X64T 1WYCA 4H9NC 4LFBT 5FL0A 1ZOYA 2JQHA 3GWHA 4IE7A 5EK3A 3VR8A 3UULA 3TLTA 4LF8T 2WCAA 3AEGA 3AE7A 2CA5A 5AQVB 3ZYLA 4ANJA 5L3GB 2VKJA 4AKGA 1HX8A 3TLUA 1FIOA 2VVNA 2WB5A 2BS2A 3PUZF 4ZOLE 3FZKB 1Z0PA 4IT4A 4WBOA 3ESLA 2XAQB 5AQRB 4AIUA 2KT9A 1U4QA 1MNEA 2VASA 1E7PA 3QB5A 1XNQT 3T1HT 3AEDA 4UXNB 4AKLA 2WZIA 5L4HA 5EK2A 3FBLA 1D0XA 1OEDE 4PK6A 4UVAB 3F31A 2FJAA 1H7CA 3UQ4A 3UU6A 5LHHB 4NIQA 3HL6A 2WU5A 3KV9A 3ZMTB 4P0BA 5CFBA 5H6QB 4EXTA 5FL1A 3LBXB 3WAKA 4X65T 2HHHT 2M67A 2WM9A 4U3CA 4UELA 4IGUA 1EZ3A 2XTLA 4ADZA 5L3DB 2LE8A 1WRDA 3O1JA 2Z6EA 4HFDA 5FMNA 1KNZA 1W0AA 2MBGA 3B57A 4EIWA 4DUYT 2UXXB 3Q5DA 3AE4A 2HH7A 1KFYA 1D0YA 2P9BA 2YEVC 3OJAA 3PJAJ 1KK7A 3RKGA 3RYCE 4A5XA 5JDGA 2LSGA 4IREA 3MA9A 2XM1A 2XQ6A 3Q5XA 3V5SA 3AEBA 4AI6A 2BZBA 2UUCT 4L9IA 2KNDA 5LA6E 2CXDA 2WDQA 4U31A 3R84B 4IDNA 3OTOT 5EK4A 2JIWA 1HNXT 2KXPB 4DV1T 2K24A 4ILCA 2BKOA 1XDPA 3ZMSB 4CQIA 4FJOA 4KMCA 4LFAT 4DR7T 3RGLA 3KVAA 1T72A 3ETUA 1MMNA 2UXNB 3ZCIA 3VKGA 2H7OA 3E0ZA 5FY1A 3N9OA 5HXCA 1KNPA 3TLWA 3QOFA 4GKKT 2PBIA 3Q2MA 2X51A 5BR8T 4IE5A 3H37A 4A56A 4JEUB 5JDHA 3K3QC 4B3TT 4UVBB 1CUNA 2VL8A 3OBVE 1XDOA 3CX8B 4PFPA 3ZMUB 3P4PA 3RIUA 4DO0A 1IZNB 4P1NA 4ERRA 3RIFA 1UGOA 2J47A 2QVAA 5ABFA 4X66T 2N1GA 5L3EB 2JQKA 4CN6A 4IL4A 2LM2A 2V6XA 4HWDA 3EDUA 4XZCA 5ABFB 2E8IA 3AVRA 4ZZCA 1UCUA 2CBIA 2FBWA 2XQYA 4QXBB 5HXSA 4MLKA 1NENA 2WZHA 2NW8A 2VWAA 2NW7A 3AA0B 4AQGA 2ZM0A 3O9XA 2CMRA 4HFIA 1GQEA 1B7TA 2W00A 3AE6A 2DWKA 1S94A 2W62A 3E08A 3LSVA 3J9X1 3VHLA 4YT0A 3PE0A 5KX5E 3KINB 2IC9A 2V6YA 5LYJE 3EVYA 1UX5A 1IAPA 2J4GA 3NZQA 4LF6T 4NUVA 4HWFA 4B3ST 3VU7H 4UEMA 2LM9A 2ES0A 3ABVA 5LB7B 5J2TE 2D0TA 4I43B 4JI6T 4ZI7E 3QNUA 3QC9A 4HTEA 5ADXL 2C5KT 3NRXA 1WR0A 4H9QC 3VR9A 1HFAA 1U5PA 4ZZBA 5JR9C 2BKPA 2V7IA 3IHRA 3TLVA 2E5LT 1HR0T 3LJCA 3AA6B 4TX5A 2LT3A 3L3PA 4PJJA 5CB4E 4GYRA 4IHJE 3BQIA 2W67A 3FXDB 4I55E 3RF1A 4YJ3E 3AE1A 3X1DA 1OEDA 4GK5E 2LLYA 4MALA 3AE9A 2AXDS 1OEDB 5HXHA 5E0OA 3LFMA 5BMVE 1HCIA 3UUXB 5C3JA 5L3FB 4XBFB 3ONJA 3JCFA 3FZFB 4YTNA 4DUZT 4Z90A 2IAKA 5LNKA 3D0TA 3TKLB 2ZLYA 2YOEA 4G63A 4JI8T 1VOMA 2X0HA 5AQKB 3FHNA 3OYZA 3GA8A 4IDOA 2B1EA 4UV8B 4DV0T 4CN1A 1J5ET 3P4SA 4EZ4A 2DL1A 4CXYA 2I6HA 2X68A 3IBPA 4H9SE 4H9OC 5AQTB 3UT5E 2IDOB 1XMOT 2CHOA 3PUVF 2UUBT 2V5CA 2WWUA 3NVOA 4AKIA 1ZKEA 4ZI2D 4QX8B 4NXMT 3ANWB 2L3LA 3RHWA 4PW8A 3NRYA 3IF8B 4ZS2A 4DMVA 5JDLA 3WI3A 4G2AA 5C8YE 4QKNA 5F3JA 4N78D 2RPAA 2FJEA 4YTMA 1ZHCA 4TV9E 4Z8XA 4EZHA 2W2UA 1R8IA 2L9QA 1MIWA 2DHRA 2MOZA 4OYJA 3F57A 4C91A 1X79A 1MIYA 4OHFA 4CZZB 3KBUA 4QH5A 2D9DA 5LXTE 2DCFA 2C5IT 4LF9T 4PFOA 2XAJB 2KMFA 4X62T 1VCSA 2CWYA 3HR0A 4PJLA 2PFVA 4GK0E 3UUNA 4AXPA 4DMWA 1MMDA 2CPTA 3E22E 4PJMA 4BA9A 5C2TA 2NW9A 2E5VA 5CJ5A 2EHOA 4DNDA 2QGSA 1ZEEA 2BG9B 5LBQB 3H3MA 4U7YA 1IJ6A 1FJGT 1MIVA 5AQHB 3PUYF 4X20E 5JDFA 3UU4A 4JI7T 4ILAA 3AB3B 4PK5A 4ZEYA 4IE0A 2LOPA 3N9LA 5ETWA 4B3MT 4I50E 4DVDA 2LRKA 4WZXA 5JDNA 3P4WA 1E2AA 3U3IA 4O4HE 2N9DA 5HEUA 2BS4A 3RKOA 4EYYR 5F5WA 2W61A 3IA3A 3RC3A 3VKHA 3C51A 4EEDA 2QYWA 5AQFB 2PG8A 3C4ZA 5JRCA 4O4IE 3RRWA 2CHNA 2XASB 1G73A 2X9XA 3P50A 4COFA 4AQYT 5HYAA 3UFGA 4LF4T 5M4YA 5LMNT 1WYBA 1N32T 2OLTA 3P7IA 3QB5K 3FBZA 4IE6A 5LCYA 3RX6A 4CI3B 4JI3T 1DU2A 2I59A 2LEHA 2XM2A 4GKJT 4O2BE 4DR4T 3ZCJA 1QSDA 2WP9A 3F2EA 5FXZA 1VCTA 4UF0B 4JI2T 3RQUA 4O2AE 4PAGA 1FEWA 2WU2A 4HWCA 4LF5T 2CLYB 5LHIB 3SRZA 3JC6C 3ONXA 2AE9A 3CX7B 4JBWF 5AQSB 4GIWA 4FI5A 2ODUA 2WBLA 2X66A 3NKZA 2RP4A 2IMLA 5DQWA 5AQPB 2XAFB 3PV0F 5ABEA 3VRAA 3O4XE 4DIDB 2XPKA 2CEAA 3ZJ1A 2WQYA 1D1CA 2A72A 2VKHA 5L3CB 1J1JA 2EHOC 3HKCE 4KX6A 4U2ZA 5FKYA 4YFSA 5LGNB 1UX4A 4WNKA 5FYMA 5A1LA 2J62A 2JQQA 2OV9A 4LFCT 2D5UA 2VK9A 2X9WA 5CA0E 5JDMA 2ACXA 4YY3T 3T1YT 5AQQB 2K5BB 1W9RA 4J2CA 4HFEA 3DTOA 2V7MA 2VB6A 3LK2B 5F8PA 2XAHB 1XZYA 2JRKA 5HEOA 2W4XA 4A98A 2BVLA 3CQGB 5FXXA 1SUMB 3PURA 2DNXA 1V9DA 4KUMB 3UQ7A 2JMHA 2IC6A 2EHOD 1IBKT 4GYSA 2NOXA 1D1AA 3EABA 5LP6E 5GONE 4TZ4C 5JVDE 4DV2T 5IUXA 2V7LA 3L8RA 3ZYMA 2XSBA 3KV4A 4OX9T 4B3RT 3MACA 2XQ7A 1MMGA 2FJBA 1JNRA 1YW0A 2VKOA 1N34T 4LF7T 2CM0A 2CLYC 1IJ5A 3EHZA 3M3ZB 2FUPA 3AEAA 3PUSA 2CRBA 4ZI3C 4AQFA 5LG4A 3I1AA 4NPPA 4PNIA 5HEJA 5LJMA 1D0ZA 2BS3A 3BQLA 2KZ7B 5L4EA 2I0MA 3OYXA 2IUBA 2LKHA 5ABHA 4ISSA 4WYVA 1WR6A 3KV6A 3RYFE 3V5UA 3L39A 3I0QA 3PDYA 4BAYB 5LJNA 4DR1T 3CIRA 2YK0A 1HG2A 4ILUA 3SWHA 2GK9A 3UU5A 5LGUB 5J2UE 3PUGA 1SHZC 2ACZA 3OKQA 4AKHA 3AE2A 4IL9A 4LMJA 5AQUB 3SFEA 3UUMA 4X1YE 5FXWA 2Q9QD 2E9XD 2C0SA 1Z8UA 4LMKA 3AA1B 3UTKA 3ZMZB 3N9NA 3PUWF 3I9WA 5EZYE 3RPUA 4EOZB 1JNZA 3IEEA 3J7Yq 1XWMA 1OEDC 4BJNA 2XUEA 5HEHA 5HEGA 3ZN0B 2V6YB 4IDQA 2WMNA 3Q9DA 2H7VC 4CXWA 1I94T 3CKDA 3ONLC 3K3NA 1I6ZA 2BG9E 2CBJA 1O3XA 2LHNA 2CE7A 1N36T 4U74A 2LHRA 3N9PA 2KWIB 5JR9B 2KLQA 5J1GA 1AJ3A 4ASKA 3A8YC 2WDVA 4JUYA 3C4XA 2K3WA 3CWZB 3ETVA 2A9UA 4KBMB 5JR9A 4JI1T 4HWIB 2LSIA 2X67A 3I0OA 3B13A 3RYIE 4YJ2E 3AE3A 4TWFA 3RC8A 5AQGB 2W0GA 3MK7C 3MXZA 3CMLA 5CGMA 2BBJA 2YU1A 3GN5A 2MAWA 3JC6D 4U72A 3T8OA 2NP9A 4QH4A 5FP3A 4KI0F 3UFEA 4KHZF 4F6RC 4EB6E 2BDEA 4MFRA 2VKDA 4TNVA 3KFWX 1XMQT 2KINB 1WLXA 2YKSA 3OVUA 4QXHB 3U78A 3UU3A 5JTGA 3EAMA 5J0ZA 1BR1A 5FNVE 1XNRT 3QK6A 4AISA 2QRXA 4MBQA 4PJNA 3PU8A 3P4RA 3ZSSA 1LRZA 5AQIB 3Q5WA 2HPLA 1FMWA 4MHCA 3G06A 3RH3A 1W09A 3RLFF 4EGWA 1UURA 3VRBA 5JQGE 3ZC1A 3FZMB 4IIJE 4TNWA 4KHPT 3ZEFB 5FXVA 5AQOB 5AQLB 1KF6A 3LK42 3NZPA 3RIUC 3ZT7A 2VQFT 4TWHA 4O4JE 2WY2A 4TWDA 3TLSA 1HNZT 2LOSA 5CA1E 2CWOA 3MZKB 4QHOA 3ZT5A 2E9XA 2YDSA 2X0YA 3O1IA 3RIAA 2UXCT 3RQWA 1W0BA 2E9XB 2XSAA 3BK9A 5JREA 5LHGB 3FZLB 2H88A 4Z91A 3EUHA 4EV6A 3ZT6A 4ZHQE 5JH7E 4P09A 2VVSA 2XQ8A 5LGTB 3LBXA 4A97A 4ZXLA 2V1DB 4IDZA 4QWNB 4HFCA 5KDMC 4YXDA 2UXBT 1WFDA 5L3BB 2YU2A 4HKAA 2XAGB 3B5MA 3L09A 4JI5T 3DP7A 1LVFA 2W66A 1HTJF 1L0VA 4HWHA 3HI2A 3SOLA 4PK4A 2KSRA 2MYSA 5H6RB 2H3RA 3RI5A 3ZPOA 4DBQA 1M7KA 2J1DG 1IBMT 1N33T 2DWGA 2MPKA 2XJ7A 2BBHA 2LJLA 2V26A 3QUJA 3AECA 3Q5EA 2K9AA 2LKGA 3CPZA 1LVKA 3MJXA 2M6IA 2Y8DA 4OFZA 4HFBA 3FB2A 3AXJB 1HS7A
chains in the Genus database with same CATH topology
4CI1B 4V1Av 4WW0A 2V7JA 1FMVA 3HKBE 4NUUA 1NAFA 4HN9A 1OXZA 4B6XA 3N2OA 3K8PC 4QX7B 3N2GE 4P0AA 2QA7A 3RYHE 3P8CD 1YKEB 2N2NA 5L2LA 4H9PC 2ZMAA 1YD8G 4HGAA 4JLEA 4O4LE 2NWBA 4H9RC 3MKDA 3ZN1B 4H63H 1SA0E 4X1KE 2LSKA 3C98B 2RA1A 4O8SA 2W63A 3BQKA 4UF0A 1MNDA 4ISTA 3I9YA 4ZS3A 3WAJA 5HAXA 4ZI2C 3CVRA 3N9QA 2XHEB 2JJ9A 3PUQA 2HPJA 4YLHA 3R6NA 4E7ZA 1HF8A 3AAAB 2WMOA 1US7B 2ZM2A 3FXEB 5KMGP 2SPCA 4DBRA 1E1HB 3PTRB 2PJQA 4TV8E 4H63V 2JMKA 3HKEE 5HXRA 2C5JA 3CQCB 4HEAA 3RRCA 5AFUL 3DJBA 4KP3C 3ZYKA 1G8XA 1BR0A 4I4TE 2DI4A 2X9HA 2NTXA 5JRCB 2WSSV 4EYUA 5DJQC 4TN7B 2LSYA 3N5LA 2L8KA 2KWHA 2BVMA 2V7KA 3EDVA 4YHJA 4HE8A 3CQXC 1S35A 4HFVA 5HXEA 4UV9B 2A3DA 1YKHB 2CXFA 4CXXA 2G0UA 2CXLA 1BR2A 2Q9QC 3SS1A 5ADXL 5FY0A 5IYZE 4XAXB 5JDQA 1D1BA 3KDSE 1MMAA 4L5GA 2MTQA 3HKDE 2EHOB 5TAOA 2A2FX 3K3OA 1NWMX 2ZM8A 4CI2B 3AA7B 5IHYA 3NBXX 3KVBA 1ZV4X 2IW5B 3AVSA 3LK3B 2Q9QB 3A5XA 4OYKA 4K0UA 2CCQA 5HWYA 4X1IE 3H3AA 2Q9QA 3ZLIA 4C90A 5HWXA 1Y64B 3N2KE 3PU3A 4E7SA 3LG7A 3ANWA 3CX6B 3C50A 2OA5A 3AAEB 5FY7A 1LKXA 4IE4A 1T98A 3KV5A 3W15B 5DABA 4WBNE 1QUUA 3N9MA 1BR4A 2JPFA 4OK0A 3ZMVB 3C64A 1HG5A 5LBMA 4AQFC 2ODVA 2Y48B 3GMIA 4JEHB 4L0RA 4GOUA 5LOVE 2WAUA 2X9YA 4TUYE 2K48A 2NTYA 3GN5B 3PUAA 1VRBA 4M1PA 2D2SA 2YINA 3M65A 4AKRB 3ZC0A 2E9XC 4UIGA 2D0UA 2DLRA 5DQVA 2Y6XA 2LSJA 2X0LB 3KBTA 4QXCB 3O1HA 3AAIA 4EAHA 3S4UA 4UVCB 1OWAA 3HA4A 4BJMA 3C4WA 3ZJ2A 1WYCA 4H9NC 3GWHA 4IE7A 5EK3A 3UULA 3ZYLA 4ANJA 5L3GB 2CA5A 2VKJA 4AKGA 1HX8A 1FIOA 4ZOLE 4WBOA 1Z0PA 3ESLA 2XAQB 2KT9A 1U4QA 1MNEA 2VASA 4UXNB 4AKLA 5EK2A 3FBLA 1D0XA 4PK6A 4UVAB 3F31A 1H7CA 5LHHB 3HL6A 3KV9A 3ZMTB 4P0BA 5H6QB 4EXTA 3LBXB 3WAKA 2M67A 2WM9A 4UELA 4IGUA 1EZ3A 2XTLA 4ADZA 5L3DB 2LE8A 1WRDA 3O1JA 2Z6EA 5FMNA 1KNZA 2MBGA 3B57A 4EIWA 2UXXB 2HH7A 4ZI3D 1D0YA 2P9BA 2YEVC 3OJAA 3RYCE 1KK7A 5JDGA 2LSGA 3MA9A 3Q5XA 3V5SA 4AI6A 2BZBA 4L9IA 2KNDA 5LA6E 2CXDA 3R84B 5EK4A 2KXPB 2K24A 3ZMSB 4CQIA 4FJOA 4KMCA 3KVAA 3ETUA 1MMNA 2UXNB 3ZCIA 3VKGA 2H7OA 3E0ZA 5FY1A 3N9OA 5HXCA 2PBIA 3Q2MA 2X51A 4IE5A 3H37A 4A56A 4JEUB 5JDHA 3K3QC 4UVBB 1CUNA 2VL8A 3OBVE 3CX8B 4PFPA 3ZMUB 4DO0A 1IZNB 4ERRA 2N1GA 5L3EB 4XZCA 3EDUA 2E8IA 3AVRA 1UCUA 2XQYA 4QXBB 5HXSA 4MLKA 2NW8A 2VWAA 2NW7A 3AA0B 4AQGA 2ZM0A 3O9XA 2CMRA 1B7TA 2W00A 2DWKA 1S94A 2W62A 3E08A 3J9X1 3VHLA 5KX5E 3PE0A 3KINB 2IC9A 3EVYA 1UX5A 1IAPA 3NZQA 4NUVA 3VU7H 4UEMA 2LM9A 2ES0A 5J2TE 2D0TA 4I43B 4ZI7E 3QC9A 4HTEA 2C5KT 3NRXA 4H9QC 5JR9C 1HFAA 1U5PA 2V7IA 3IHRA 3LJCA 3AA6B 4TX5A 2LT3A 3L3PA 4PJJA 5CB4E 4GYRA 4IHJE 3BQIA 3FXDB 4I55E 4YJ3E 4GK5E 4MALA 5L3FB 5HXHA 5E0OA 3LFMA 5BMVE 1HCIA 3UUXB 4XBFB 2IAKA 5LNKA 3D0TA 3TKLB 2ZLYA 4G63A 1VOMA 3FHNA 3OYZA 3GA8A 2B1EA 4UV8B 4EZ4A 4CXYA 2X68A 3IBPA 4H9SE 4H9OC 3UT5E 2WWUA 4AKIA 1ZKEA 4ZI2D 4QX8B 3ANWB 2L3LA 4PW8A 3NRYA 3IF8B 4ZS2A 5JDLA 3WI3A 4G2AA 5C8YE 4QKNA 5F3JA 4N78D 1ZHCA 4TV9E 4Z8XA 4EZHA 2L9QA 1MIWA 2DHRA 2MOZA 4OYJA 3F57A 4C91A 1X79A 1MIYA 4OHFA 4CZZB 3KBUA 5LXTE 2DCFA 2C5IT 4PFOA 2XAJB 2KMFA 2CWYA 3HR0A 4PJLA 2PFVA 4GK0E 3UUNA 4AXPA 4DMWA 1MMDA 3E22E 4PJMA 4BA9A 2NW9A 2EHOA 4DNDA 2QGSA 1ZEEA 5LBQB 1IJ6A 1MIVA 4X20E 5JDFA 3AB3B 4PK5A 4IE0A 2LOPA 3N9LA 5ETWA 4I50E 4DVDA 5JDNA 3U3IA 4O4HE 2N9DA 3RKOA 4EYYR 3VKHA 2W61A 3RC3A 3C51A 5JRCA 2PG8A 3C4ZA 4O4IE 3RRWA 2XASB 1G73A 2X9XA 5HYAA 5M4YA 1WYBA 3P7IA 3FBZA 4IE6A 5LCYA 3RX6A 4CI3B 2I59A 2LEHA 4O2BE 3ZCJA 1QSDA 3F2EA 5FXZA 4UF0B 4O2AE 4PAGA 1FEWA 2CLYB 5LHIB 3SRZA 3JC6C 3ONXA 3CX7B 4GIWA 4FI5A 2ODUA 2WBLA 2X66A 2RP4A 5DQWA 2XAFB 3O4XE 2CEAA 3ZJ1A 2A72A 1D1CA 2VKHA 5L3CB 2EHOC 3HKCE 4YFSA 5LGNB 1UX4A 4WNKA 5FYMA 5A1LA 2JQQA 2D5UA 2VK9A 2X9WA 5CA0E 5JDMA 2ACXA 2K5BB 4J2CA 3DTOA 2V7MA 2VB6A 3LK2B 5F8PA 2XAHB 5LYJE 2JRKA 2BVLA 3CQGB 5FXXA 3PURA 2DNXA 1V9DA 4KUMB 2JMHA 2IC6A 2EHOD 4GYSA 2NOXA 1D1AA 5LP6E 5GONE 4TZ4C 5JVDE 2V7LA 3ZYMA 3KV4A 3MACA 1MMGA 1YW0A 2VKOA 2CM0A 2CLYC 1IJ5A 4ZI3C 4AQFA 4DMVA 3PUSA 5LG4A 3I1AA 4PNIA 5LJMA 1D0ZA 3BQLA 2KZ7B 3OYXA 4ISSA 1WR6A 3KV6A 3RYFE 3V5UA 3I0QA 3PDYA 4BAYB 5LJNA 2YK0A 1HG2A 4ILUA 3SWHA 2GK9A 5LGUB 5J2UE 3PUGA 1SHZC 3OKQA 4AKHA 3UUMA 4X1YE 5FXWA 2Q9QD 2E9XD 2C0SA 3AA1B 3UTKA 3ZMZB 3N9NA 5EZYE 3I9WA 3RPUA 4EOZB 3IEEA 3J7Yq 4BJNA 2XUEA 3ZN0B 2WMNA 3Q9DA 2H7VC 4CXWA 3CKDA 3K3NA 1O3XA 2LHNA 2CE7A 4U74A 2LHRA 3N9PA 2KWIB 5JR9B 2KLQA 5J1GA 1AJ3A 4ASKA 4JUYA 3C4XA 5JR9A 3ETVA 3CWZB 4KBMB 2LSIA 2X67A 3I0OA 3B13A 3RYIE 4YJ2E 3RC8A 2W0GA 3MK7C 3MXZA 3CMLA 2YU1A 4U72A 3GN5A 3JC6D 3T8OA 2NP9A 5FP3A 3UFEA 4F6RC 4EB6E 2BDEA 4MFRA 2VKDA 3KFWX 2KINB 1WLXA 4QXHB 3U78A 1BR1A 5FNVE 3QK6A 4MBQA 4PJNA 3PU8A 1LRZA 3Q5WA 2HPLA 1FMWA 4MHCA 3RH3A 5JQGE 3ZC1A 4IIJE 3ZEFB 5FXVA 3NZPA 3LK42 4O4JE 2LOSA 5CA1E 2CWOA 3MZKB 4QHOA 2E9XA 3O1IA 2E9XB 3BK9A 5JREA 5LHGB 3EUHA 4ZHQE 5JH7E 5LGTB 4P09A 3LBXA 5KDMC 2V1DB 4IDZA 4QWNB 5L3BB 2YU2A 4HKAA 2XAGB 3L09A 3DP7A 1LVFA 1HTJF 3SOLA 3HI2A 4PK4A 2MYSA 5H6RB 2H3RA 3ZPOA 4DBQA 2J1DG 2DWGA 2LJLA 2V26A 3QUJA 2K9AA 3CPZA 1LVKA 3MJXA 2Y8DA 4OFZA 3FB2A 1HS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0U A;  3SOL A;  3UTK A;  4A56 A; 
#chains in the Genus database with same CATH topology
 4CI1 B;  4V1A v;  4WW0 A;  2V7J A;  3AE5 A;  1FMV A;  3HKB E;  3PUX F;  4I0U A;  4NUU A;  4QH1 A;  5FVK A;  3EI0 A;  1NAF A;  3A7M A;  2XQ4 A;  4HN9 A;  1OXZ A;  4B6X A;  3N2O A;  3K8P C;  4QX7 B;  3N2G E;  2UXD T;  4P0A A;  2QA7 A;  3RYH E;  3P8C D;  1YKE B;  2N2N A;  5L2L A;  4H9P C;  2ZMA A;  3JAD A;  4X5T A;  2VQE T;  4DV3 T;  1YD8 G;  4HGA A;  4JLE A;  4O4L E;  2NWB A;  4H9R C;  3MKD A;  1J5W A;  3ZN1 B;  4Q25 A;  2M6B A;  4H63 H;  3UU8 A;  1SA0 E;  4X1K E;  2YN6 A;  2LSK A;  3C98 B;  2RA1 A;  4O8S A;  4CN4 A;  3AEF A;  2W63 A;  3BQK A;  4UF0 A;  4K0K T;  1MND A;  4DR5 T;  3SFD A;  2F4V T;  2IIU A;  1WCR A;  4IST A;  3I9Y A;  2NR4 A;  4ZS3 A;  1ZP0 A;  3WAJ A;  5HAX A;  2R6G F;  4F8H A;  4YSY A;  4ZI2 C;  4JI0 T;  3CVR A;  3N9Q A;  2XQ3 A;  4U2Y A;  2XHE B;  2JJ9 A;  3PUQ A;  2HPJ A;  2VL0 A;  4YLH A;  3R6N A;  4E7Z A;  2ZM6 T;  4DR6 T;  1HF8 A;  3AAA B;  4DR3 T;  2WMO A;  1US7 B;  2ZM2 A;  3FXE B;  5KMG P;  4U7I A;  2XQ9 A;  2SPC A;  4DBR A;  1E1H B;  1NEK A;  3PTR B;  4IDP A;  1YQ4 A;  4DV6 T;  4DV4 T;  2PJQ A;  3AXJ A;  4TV8 E;  4H63 V;  2JMK A;  5LMU T;  4JYA T;  2BG9 A;  3HKE E;  5HXR A;  2WS3 A;  1IBL T;  1M62 A;  3AEE A;  2VUR A;  3JAE A;  3PJA A;  2C5J A;  5AQJ B;  2BG9 C;  5L47 A;  5FVL A;  3CQC B;  3NWI A;  4HEA A;  3RRC A;  2XY8 B;  5AFU L;  3DJB A;  4KP3 C;  1QLB A;  1X9B A;  2LRL A;  5AQN B;  2V5D A;  1G8X A;  3ZKR A;  3ZYK A;  2UU9 T;  1BR0 A;  4I4T E;  2DI4 A;  2X9H A;  2XQ5 A;  2NTX A;  5JRC B;  2WSS V;  4EYU A;  3AE8 A;  4TN7 B;  2LSY A;  5DJQ C;  3N5L A;  4EEB A;  2IHR 1;  2L8K A;  5ABG A;  2KWH A;  4NXN T;  2BVM A;  2YDQ A;  4YSZ A;  4JV5 T;  2V7K A;  2UUA T;  3EDV A;  4YHJ A;  4HE8 A;  2WWV A;  3CQX C;  1S35 A;  4HFV A;  4ZI3 D;  1T8B A;  4UV9 B;  2A3D A;  1YKH B;  5HXE A;  2CXF A;  3JAF A;  4CXX A;  4DV5 T;  2G0U A;  2CXL A;  1BR2 A;  2Q9Q C;  3SS1 A;  3LDQ B;  1UUS A;  2YDR A;  4XAX B;  5FY0 A;  3K1S A;  5IYZ E;  1D1B A;  3KDS E;  1MMA A;  4L5G A;  5JDQ A;  1HNW T;  2MTQ A;  3HKD E;  4ILB A;  5HCM A;  2PTF A;  2EHO B;  2B76 A;  5TAO A;  1UK5 A;  5KXJ A;  2A2F X;  3K3O A;  1NWM X;  2V8S V;  2ZM8 A;  4CI2 B;  3AA7 B;  3ZST A;  5IHY A;  3NBX X;  3KVB A;  1ZV4 X;  2IW5 B;  3AVS A;  3LK3 B;  2Q9Q B;  3A5X A;  1CHU A;  4OYK A;  4K0U A;  2CCQ A;  5HWY A;  4YHH T;  4X1I E;  3H3A A;  2Q9Q A;  3ZLI A;  4C90 A;  5HWX A;  1Y64 B;  4U33 A;  4LML A;  3N2K E;  3PU3 A;  4HFH A;  5AQM B;  4E7S A;  3LG7 A;  3ANW A;  5LG3 A;  3CX6 B;  1HX1 B;  3C50 A;  2OA5 A;  3AAE B;  5FY7 A;  1LKX A;  4IE4 A;  1T98 A;  3KV5 A;  1T7S A;  2XZE A;  3W15 B;  4DR2 T;  5DAB A;  4WBN E;  1QUU A;  3N9M A;  2HN1 A;  4DV7 T;  1BR4 A;  2JPF A;  4OK0 A;  3ZMV B;  4YSX A;  3C64 A;  1HG5 A;  5LBM A;  4AQF C;  2ODV A;  2Y48 B;  1KEY A;  3GMI A;  4JEH B;  4L0R A;  4GOU A;  5LOV E;  2WAU A;  2X9Y A;  4TUY E;  2NTY A;  2K48 A;  1Y01 A;  3GN5 B;  3PUA A;  1VRB A;  4M1P A;  1YXR A;  2D2S A;  2YIN A;  3M65 A;  4AKR B;  3ZC0 A;  3FZH B;  2E9X C;  1SE7 A;  2JQ9 A;  2H89 A;  2WDR A;  4UIG A;  4UR9 A;  5HCJ A;  2D0U A;  2BKN A;  2DLR A;  3P4Q A;  5DQV A;  3CK6 A;  2Y6X A;  2LSJ A;  2X0L B;  3KBT A;  2HN2 A;  4QXC B;  4YTP A;  1KNR A;  1YQ3 A;  3OPC A;  3O1H A;  3UUB A;  4JI4 T;  2E2A A;  3AAI A;  2XQA A;  3S4U A;  4EAH A;  2FJD A;  5IWA T;  4UVC B;  1OWA A;  3HA4 A;  4BJM A;  3C4W A;  3ZJ2 A;  4X64 T;  1WYC A;  4H9N C;  4LFB T;  5FL0 A;  1ZOY A;  2JQH A;  3GWH A;  4IE7 A;  5EK3 A;  3VR8 A;  3UUL A;  3TLT A;  4LF8 T;  2WCA A;  3AEG A;  3AE7 A;  2CA5 A;  5AQV B;  3ZYL A;  4ANJ A;  5L3G B;  2VKJ A;  4AKG A;  1HX8 A;  3TLU A;  1FIO A;  2VVN A;  2WB5 A;  2BS2 A;  3PUZ F;  4ZOL E;  3FZK B;  1Z0P A;  4IT4 A;  4WBO A;  3ESL A;  2XAQ B;  5AQR B;  4AIU A;  2KT9 A;  1U4Q A;  1MNE A;  2VAS A;  1E7P A;  3QB5 A;  1XNQ T;  3T1H T;  3AED A;  4UXN B;  4AKL A;  2WZI A;  5L4H A;  5EK2 A;  3FBL A;  1D0X A;  1OED E;  4PK6 A;  4UVA B;  3F31 A;  2FJA A;  1H7C A;  3UQ4 A;  3UU6 A;  5LHH B;  4NIQ A;  3HL6 A;  2WU5 A;  3KV9 A;  3ZMT B;  4P0B A;  5CFB A;  5H6Q B;  4EXT A;  5FL1 A;  3LBX B;  3WAK A;  4X65 T;  2HHH T;  2M67 A;  2WM9 A;  4U3C A;  4UEL A;  4IGU A;  1EZ3 A;  2XTL A;  4ADZ A;  5L3D B;  2LE8 A;  1WRD A;  3O1J A;  2Z6E A;  4HFD A;  5FMN A;  1KNZ A;  1W0A A;  2MBG A;  3B57 A;  4EIW A;  4DUY T;  2UXX B;  3Q5D A;  3AE4 A;  2HH7 A;  1KFY A;  1D0Y A;  2P9B A;  2YEV C;  3OJA A;  3PJA J;  1KK7 A;  3RKG A;  3RYC E;  4A5X A;  5JDG A;  2LSG A;  4IRE A;  3MA9 A;  2XM1 A;  2XQ6 A;  3Q5X A;  3V5S A;  3AEB A;  4AI6 A;  2BZB A;  2UUC T;  4L9I A;  2KND A;  5LA6 E;  2CXD A;  2WDQ A;  4U31 A;  3R84 B;  4IDN A;  3OTO T;  5EK4 A;  2JIW A;  1HNX T;  2KXP B;  4DV1 T;  2K24 A;  4ILC A;  2BKO A;  1XDP A;  3ZMS B;  4CQI A;  4FJO A;  4KMC A;  4LFA T;  4DR7 T;  3RGL A;  3KVA A;  1T72 A;  3ETU A;  1MMN A;  2UXN B;  3ZCI A;  3VKG A;  2H7O A;  3E0Z A;  5FY1 A;  3N9O A;  5HXC A;  1KNP A;  3TLW A;  3QOF A;  4GKK T;  2PBI A;  3Q2M A;  2X51 A;  5BR8 T;  4IE5 A;  3H37 A;  4A56 A;  4JEU B;  5JDH A;  3K3Q C;  4B3T T;  4UVB B;  1CUN A;  2VL8 A;  3OBV E;  1XDO A;  3CX8 B;  4PFP A;  3ZMU B;  3P4P A;  3RIU A;  4DO0 A;  1IZN B;  4P1N A;  4ERR A;  3RIF A;  1UGO A;  2J47 A;  2QVA A;  5ABF A;  4X66 T;  2N1G A;  5L3E B;  2JQK A;  4CN6 A;  4IL4 A;  2LM2 A;  2V6X A;  4HWD A;  3EDU A;  4XZC A;  5ABF B;  2E8I A;  3AVR A;  4ZZC A;  1UCU A;  2CBI A;  2FBW A;  2XQY A;  4QXB B;  5HXS A;  4MLK A;  1NEN A;  2WZH A;  2NW8 A;  2VWA A;  2NW7 A;  3AA0 B;  4AQG A;  2ZM0 A;  3O9X A;  2CMR A;  4HFI A;  1GQE A;  1B7T A;  2W00 A;  3AE6 A;  2DWK A;  1S94 A;  2W62 A;  3E08 A;  3LSV A;  3J9X 1;  3VHL A;  4YT0 A;  3PE0 A;  5KX5 E;  3KIN B;  2IC9 A;  2V6Y A;  5LYJ E;  3EVY A;  1UX5 A;  1IAP A;  2J4G A;  3NZQ A;  4LF6 T;  4NUV A;  4HWF A;  4B3S T;  3VU7 H;  4UEM A;  2LM9 A;  2ES0 A;  3ABV A;  5LB7 B;  5J2T E;  2D0T A;  4I43 B;  4JI6 T;  4ZI7 E;  3QNU A;  3QC9 A;  4HTE A;  5ADX L;  2C5K T;  3NRX A;  1WR0 A;  4H9Q C;  3VR9 A;  1HFA A;  1U5P A;  4ZZB A;  5JR9 C;  2BKP A;  2V7I A;  3IHR A;  3TLV A;  2E5L T;  1HR0 T;  3LJC A;  3AA6 B;  4TX5 A;  2LT3 A;  3L3P A;  4PJJ A;  5CB4 E;  4GYR A;  4IHJ E;  3BQI A;  2W67 A;  3FXD B;  4I55 E;  3RF1 A;  4YJ3 E;  3AE1 A;  3X1D A;  1OED A;  4GK5 E;  2LLY A;  4MAL A;  3AE9 A;  2AXD S;  1OED B;  5HXH A;  5E0O A;  3LFM A;  5BMV E;  1HCI A;  3UUX B;  5C3J A;  5L3F B;  4XBF B;  3ONJ A;  3JCF A;  3FZF B;  4YTN A;  4DUZ T;  4Z90 A;  2IAK A;  5LNK A;  3D0T A;  3TKL B;  2ZLY A;  2YOE A;  4G63 A;  4JI8 T;  1VOM A;  2X0H A;  5AQK B;  3FHN A;  3OYZ A;  3GA8 A;  4IDO A;  2B1E A;  4UV8 B;  4DV0 T;  4CN1 A;  1J5E T;  3P4S A;  4EZ4 A;  2DL1 A;  4CXY A;  2I6H A;  2X68 A;  3IBP A;  4H9S E;  4H9O C;  5AQT B;  3UT5 E;  2IDO B;  1XMO T;  2CHO A;  3PUV F;  2UUB T;  2V5C A;  2WWU A;  3NVO A;  4AKI A;  1ZKE A;  4ZI2 D;  4QX8 B;  4NXM T;  3ANW B;  2L3L A;  3RHW A;  4PW8 A;  3NRY A;  3IF8 B;  4ZS2 A;  4DMV A;  5JDL A;  3WI3 A;  4G2A A;  5C8Y E;  4QKN A;  5F3J A;  4N78 D;  2RPA A;  2FJE A;  4YTM A;  1ZHC A;  4TV9 E;  4Z8X A;  4EZH A;  2W2U A;  1R8I A;  2L9Q A;  1MIW A;  2DHR A;  2MOZ A;  4OYJ A;  3F57 A;  4C91 A;  1X79 A;  1MIY A;  4OHF A;  4CZZ B;  3KBU A;  4QH5 A;  2D9D A;  5LXT E;  2DCF A;  2C5I T;  4LF9 T;  4PFO A;  2XAJ B;  2KMF A;  4X62 T;  1VCS A;  2CWY A;  3HR0 A;  4PJL A;  2PFV A;  4GK0 E;  3UUN A;  4AXP A;  4DMW A;  1MMD A;  2CPT A;  3E22 E;  4PJM A;  4BA9 A;  5C2T A;  2NW9 A;  2E5V A;  5CJ5 A;  2EHO A;  4DND A;  2QGS A;  1ZEE A;  2BG9 B;  5LBQ B;  3H3M A;  4U7Y A;  1IJ6 A;  1FJG T;  1MIV A;  5AQH B;  3PUY F;  4X20 E;  5JDF A;  3UU4 A;  4JI7 T;  4ILA A;  3AB3 B;  4PK5 A;  4ZEY A;  4IE0 A;  2LOP A;  3N9L A;  5ETW A;  4B3M T;  4I50 E;  4DVD A;  2LRK A;  4WZX A;  5JDN A;  3P4W A;  1E2A A;  3U3I A;  4O4H E;  2N9D A;  5HEU A;  2BS4 A;  3RKO A;  4EYY R;  5F5W A;  2W61 A;  3IA3 A;  3RC3 A;  3VKH A;  3C51 A;  4EED A;  2QYW A;  5AQF B;  2PG8 A;  3C4Z A;  5JRC A;  4O4I E;  3RRW A;  2CHN A;  2XAS B;  1G73 A;  2X9X A;  3P50 A;  4COF A;  4AQY T;  5HYA A;  3UFG A;  4LF4 T;  5M4Y A;  5LMN T;  1WYB A;  1N32 T;  2OLT A;  3P7I A;  3QB5 K;  3FBZ A;  4IE6 A;  5LCY A;  3RX6 A;  4CI3 B;  4JI3 T;  1DU2 A;  2I59 A;  2LEH A;  2XM2 A;  4GKJ T;  4O2B E;  4DR4 T;  3ZCJ A;  1QSD A;  2WP9 A;  3F2E A;  5FXZ A;  1VCT A;  4UF0 B;  4JI2 T;  3RQU A;  4O2A E;  4PAG A;  1FEW A;  2WU2 A;  4HWC A;  4LF5 T;  2CLY B;  5LHI B;  3SRZ A;  3JC6 C;  3ONX A;  2AE9 A;  3CX7 B;  4JBW F;  5AQS B;  4GIW A;  4FI5 A;  2ODU A;  2WBL A;  2X66 A;  3NKZ A;  2RP4 A;  2IML A;  5DQW A;  5AQP B;  2XAF B;  3PV0 F;  5ABE A;  3VRA A;  3O4X E;  4DID B;  2XPK A;  2CEA A;  3ZJ1 A;  2WQY A;  1D1C A;  2A72 A;  2VKH A;  5L3C B;  1J1J A;  2EHO C;  3HKC E;  4KX6 A;  4U2Z A;  5FKY A;  4YFS A;  5LGN B;  1UX4 A;  4WNK A;  5FYM A;  5A1L A;  2J62 A;  2JQQ A;  2OV9 A;  4LFC T;  2D5U A;  2VK9 A;  2X9W A;  5CA0 E;  5JDM A;  2ACX A;  4YY3 T;  3T1Y T;  5AQQ B;  2K5B B;  1W9R A;  4J2C A;  4HFE A;  3DTO A;  2V7M A;  2VB6 A;  3LK2 B;  5F8P A;  2XAH B;  1XZY A;  2JRK A;  5HEO A;  2W4X A;  4A98 A;  2BVL A;  3CQG B;  5FXX A;  1SUM B;  3PUR A;  2DNX A;  1V9D A;  4KUM B;  3UQ7 A;  2JMH A;  2IC6 A;  2EHO D;  1IBK T;  4GYS A;  2NOX A;  1D1A A;  3EAB A;  5LP6 E;  5GON E;  4TZ4 C;  5JVD E;  4DV2 T;  5IUX A;  2V7L A;  3L8R A;  3ZYM A;  2XSB A;  3KV4 A;  4OX9 T;  4B3R T;  3MAC A;  2XQ7 A;  1MMG A;  2FJB A;  1JNR A;  1YW0 A;  2VKO A;  1N34 T;  4LF7 T;  2CM0 A;  2CLY C;  1IJ5 A;  3EHZ A;  3M3Z B;  2FUP A;  3AEA A;  3PUS A;  2CRB A;  4ZI3 C;  4AQF A;  5LG4 A;  3I1A A;  4NPP A;  4PNI A;  5HEJ A;  5LJM A;  1D0Z A;  2BS3 A;  3BQL A;  2KZ7 B;  5L4E A;  2I0M A;  3OYX A;  2IUB A;  2LKH A;  5ABH A;  4ISS A;  4WYV A;  1WR6 A;  3KV6 A;  3RYF E;  3V5U A;  3L39 A;  3I0Q A;  3PDY A;  4BAY B;  5LJN A;  4DR1 T;  3CIR A;  2YK0 A;  1HG2 A;  4ILU A;  3SWH A;  2GK9 A;  3UU5 A;  5LGU B;  5J2U E;  3PUG A;  1SHZ C;  2ACZ A;  3OKQ A;  4AKH A;  3AE2 A;  4IL9 A;  4LMJ A;  5AQU B;  3SFE A;  3UUM A;  4X1Y E;  5FXW A;  2Q9Q D;  2E9X D;  2C0S A;  1Z8U A;  4LMK A;  3AA1 B;  3UTK A;  3ZMZ B;  3N9N A;  3PUW F;  3I9W A;  5EZY E;  3RPU A;  4EOZ B;  1JNZ A;  3IEE A;  3J7Y q;  1XWM A;  1OED C;  4BJN A;  2XUE A;  5HEH A;  5HEG A;  3ZN0 B;  2V6Y B;  4IDQ A;  2WMN A;  3Q9D A;  2H7V C;  4CXW A;  1I94 T;  3CKD A;  3ONL C;  3K3N A;  1I6Z A;  2BG9 E;  2CBJ A;  1O3X A;  2LHN A;  2CE7 A;  1N36 T;  4U74 A;  2LHR A;  3N9P A;  2KWI B;  5JR9 B;  2KLQ A;  5J1G A;  1AJ3 A;  4ASK A;  3A8Y C;  2WDV A;  4JUY A;  3C4X A;  2K3W A;  3CWZ B;  3ETV A;  2A9U A;  4KBM B;  5JR9 A;  4JI1 T;  4HWI B;  2LSI A;  2X67 A;  3I0O A;  3B13 A;  3RYI E;  4YJ2 E;  3AE3 A;  4TWF A;  3RC8 A;  5AQG B;  2W0G A;  3MK7 C;  3MXZ A;  3CML A;  5CGM A;  2BBJ A;  2YU1 A;  3GN5 A;  2MAW A;  3JC6 D;  4U72 A;  3T8O A;  2NP9 A;  4QH4 A;  5FP3 A;  4KI0 F;  3UFE A;  4KHZ F;  4F6R C;  4EB6 E;  2BDE A;  4MFR A;  2VKD A;  4TNV A;  3KFW X;  1XMQ T;  2KIN B;  1WLX A;  2YKS A;  3OVU A;  4QXH B;  3U78 A;  3UU3 A;  5JTG A;  3EAM A;  5J0Z A;  1BR1 A;  5FNV E;  1XNR T;  3QK6 A;  4AIS A;  2QRX A;  4MBQ A;  4PJN A;  3PU8 A;  3P4R A;  3ZSS A;  1LRZ A;  5AQI B;  3Q5W A;  2HPL A;  1FMW A;  4MHC A;  3G06 A;  3RH3 A;  1W09 A;  3RLF F;  4EGW A;  1UUR A;  3VRB A;  5JQG E;  3ZC1 A;  3FZM B;  4IIJ E;  4TNW A;  4KHP T;  3ZEF B;  5FXV A;  5AQO B;  5AQL B;  1KF6 A;  3LK4 2;  3NZP A;  3RIU C;  3ZT7 A;  2VQF T;  4TWH A;  4O4J E;  2WY2 A;  4TWD A;  3TLS A;  1HNZ T;  2LOS A;  5CA1 E;  2CWO A;  3MZK B;  4QHO A;  3ZT5 A;  2E9X A;  2YDS A;  2X0Y A;  3O1I A;  3RIA A;  2UXC T;  3RQW A;  1W0B A;  2E9X B;  2XSA A;  3BK9 A;  5JRE A;  5LHG B;  3FZL B;  2H88 A;  4Z91 A;  3EUH A;  4EV6 A;  3ZT6 A;  4ZHQ E;  5JH7 E;  4P09 A;  2VVS A;  2XQ8 A;  5LGT B;  3LBX A;  4A97 A;  4ZXL A;  2V1D B;  4IDZ A;  4QWN B;  4HFC A;  5KDM C;  4YXD A;  2UXB T;  1WFD A;  5L3B B;  2YU2 A;  4HKA A;  2XAG B;  3B5M A;  3L09 A;  4JI5 T;  3DP7 A;  1LVF A;  2W66 A;  1HTJ F;  1L0V A;  4HWH A;  3HI2 A;  3SOL A;  4PK4 A;  2KSR A;  2MYS A;  5H6R B;  2H3R A;  3RI5 A;  3ZPO A;  4DBQ A;  1M7K A;  2J1D G;  1IBM T;  1N33 T;  2DWG A;  2MPK A;  2XJ7 A;  2BBH A;  2LJL A;  2V26 A;  3QUJ A;  3AEC A;  3Q5E A;  2K9A A;  2LKG A;  3CPZ A;  1LVK A;  3MJX A;  2M6I A;  2Y8D A;  4OFZ A;  4HFB A;  3FB2 A;  3AXJ B;  1HS7 A; 
#chains in the Genus database with same CATH homology
 4CI1 B;  4V1A v;  4WW0 A;  2V7J A;  1FMV A;  3HKB E;  4NUU A;  1NAF A;  4HN9 A;  1OXZ A;  4B6X A;  3N2O A;  3K8P C;  4QX7 B;  3N2G E;  4P0A A;  2QA7 A;  3RYH E;  3P8C D;  1YKE B;  2N2N A;  5L2L A;  4H9P C;  2ZMA A;  1YD8 G;  4HGA A;  4JLE A;  4O4L E;  2NWB A;  4H9R C;  3MKD A;  3ZN1 B;  4H63 H;  1SA0 E;  4X1K E;  2LSK A;  3C98 B;  2RA1 A;  4O8S A;  2W63 A;  3BQK A;  4UF0 A;  1MND A;  4IST A;  3I9Y A;  4ZS3 A;  3WAJ A;  5HAX A;  4ZI2 C;  3CVR A;  3N9Q A;  2XHE B;  2JJ9 A;  3PUQ A;  2HPJ A;  4YLH A;  3R6N A;  4E7Z A;  1HF8 A;  3AAA B;  2WMO A;  1US7 B;  2ZM2 A;  3FXE B;  5KMG P;  2SPC A;  4DBR A;  1E1H B;  3PTR B;  2PJQ A;  4TV8 E;  4H63 V;  2JMK A;  3HKE E;  5HXR A;  2C5J A;  3CQC B;  4HEA A;  3RRC A;  5AFU L;  3DJB A;  4KP3 C;  3ZYK A;  1G8X A;  1BR0 A;  4I4T E;  2DI4 A;  2X9H A;  2NTX A;  5JRC B;  2WSS V;  4EYU A;  5DJQ C;  4TN7 B;  2LSY A;  3N5L A;  2L8K A;  2KWH A;  2BVM A;  2V7K A;  3EDV A;  4YHJ A;  4HE8 A;  3CQX C;  1S35 A;  4HFV A;  5HXE A;  4UV9 B;  2A3D A;  1YKH B;  2CXF A;  4CXX A;  2G0U A;  2CXL A;  1BR2 A;  2Q9Q C;  3SS1 A;  5ADX L;  5FY0 A;  5IYZ E;  4XAX B;  5JDQ A;  1D1B A;  3KDS E;  1MMA A;  4L5G A;  2MTQ A;  3HKD E;  2EHO B;  5TAO A;  2A2F X;  3K3O A;  1NWM X;  2ZM8 A;  4CI2 B;  3AA7 B;  5IHY A;  3NBX X;  3KVB A;  1ZV4 X;  2IW5 B;  3AVS A;  3LK3 B;  2Q9Q B;  3A5X A;  4OYK A;  4K0U A;  2CCQ A;  5HWY A;  4X1I E;  3H3A A;  2Q9Q A;  3ZLI A;  4C90 A;  5HWX A;  1Y64 B;  3N2K E;  3PU3 A;  4E7S A;  3LG7 A;  3ANW A;  3CX6 B;  3C50 A;  2OA5 A;  3AAE B;  5FY7 A;  1LKX A;  4IE4 A;  1T98 A;  3KV5 A;  3W15 B;  5DAB A;  4WBN E;  1QUU A;  3N9M A;  1BR4 A;  2JPF A;  4OK0 A;  3ZMV B;  3C64 A;  1HG5 A;  5LBM A;  4AQF C;  2ODV A;  2Y48 B;  3GMI A;  4JEH B;  4L0R A;  4GOU A;  5LOV E;  2WAU A;  2X9Y A;  4TUY E;  2K48 A;  2NTY A;  3GN5 B;  3PUA A;  1VRB A;  4M1P A;  2D2S A;  2YIN A;  3M65 A;  4AKR B;  3ZC0 A;  2E9X C;  4UIG A;  2D0U A;  2DLR A;  5DQV A;  2Y6X A;  2LSJ A;  2X0L B;  3KBT A;  4QXC B;  3O1H A;  3AAI A;  4EAH A;  3S4U A;  4UVC B;  1OWA A;  3HA4 A;  4BJM A;  3C4W A;  3ZJ2 A;  1WYC A;  4H9N C;  3GWH A;  4IE7 A;  5EK3 A;  3UUL A;  3ZYL A;  4ANJ A;  5L3G B;  2CA5 A;  2VKJ A;  4AKG A;  1HX8 A;  1FIO A;  4ZOL E;  4WBO A;  1Z0P A;  3ESL A;  2XAQ B;  2KT9 A;  1U4Q A;  1MNE A;  2VAS A;  4UXN B;  4AKL A;  5EK2 A;  3FBL A;  1D0X A;  4PK6 A;  4UVA B;  3F31 A;  1H7C A;  5LHH B;  3HL6 A;  3KV9 A;  3ZMT B;  4P0B A;  5H6Q B;  4EXT A;  3LBX B;  3WAK A;  2M67 A;  2WM9 A;  4UEL A;  4IGU A;  1EZ3 A;  2XTL A;  4ADZ A;  5L3D B;  2LE8 A;  1WRD A;  3O1J A;  2Z6E A;  5FMN A;  1KNZ A;  2MBG A;  3B57 A;  4EIW A;  2UXX B;  2HH7 A;  4ZI3 D;  1D0Y A;  2P9B A;  2YEV C;  3OJA A;  3RYC E;  1KK7 A;  5JDG A;  2LSG A;  3MA9 A;  3Q5X A;  3V5S A;  4AI6 A;  2BZB A;  4L9I A;  2KND A;  5LA6 E;  2CXD A;  3R84 B;  5EK4 A;  2KXP B;  2K24 A;  3ZMS B;  4CQI A;  4FJO A;  4KMC A;  3KVA A;  3ETU A;  1MMN A;  2UXN B;  3ZCI A;  3VKG A;  2H7O A;  3E0Z A;  5FY1 A;  3N9O A;  5HXC A;  2PBI A;  3Q2M A;  2X51 A;  4IE5 A;  3H37 A;  4A56 A;  4JEU B;  5JDH A;  3K3Q C;  4UVB B;  1CUN A;  2VL8 A;  3OBV E;  3CX8 B;  4PFP A;  3ZMU B;  4DO0 A;  1IZN B;  4ERR A;  2N1G A;  5L3E B;  4XZC A;  3EDU A;  2E8I A;  3AVR A;  1UCU A;  2XQY A;  4QXB B;  5HXS A;  4MLK A;  2NW8 A;  2VWA A;  2NW7 A;  3AA0 B;  4AQG A;  2ZM0 A;  3O9X A;  2CMR A;  1B7T A;  2W00 A;  2DWK A;  1S94 A;  2W62 A;  3E08 A;  3J9X 1;  3VHL A;  5KX5 E;  3PE0 A;  3KIN B;  2IC9 A;  3EVY A;  1UX5 A;  1IAP A;  3NZQ A;  4NUV A;  3VU7 H;  4UEM A;  2LM9 A;  2ES0 A;  5J2T E;  2D0T A;  4I43 B;  4ZI7 E;  3QC9 A;  4HTE A;  2C5K T;  3NRX A;  4H9Q C;  5JR9 C;  1HFA A;  1U5P A;  2V7I A;  3IHR A;  3LJC A;  3AA6 B;  4TX5 A;  2LT3 A;  3L3P A;  4PJJ A;  5CB4 E;  4GYR A;  4IHJ E;  3BQI A;  3FXD B;  4I55 E;  4YJ3 E;  4GK5 E;  4MAL A;  5L3F B;  5HXH A;  5E0O A;  3LFM A;  5BMV E;  1HCI A;  3UUX B;  4XBF B;  2IAK A;  5LNK A;  3D0T A;  3TKL B;  2ZLY A;  4G63 A;  1VOM A;  3FHN A;  3OYZ A;  3GA8 A;  2B1E A;  4UV8 B;  4EZ4 A;  4CXY A;  2X68 A;  3IBP A;  4H9S E;  4H9O C;  3UT5 E;  2WWU A;  4AKI A;  1ZKE A;  4ZI2 D;  4QX8 B;  3ANW B;  2L3L A;  4PW8 A;  3NRY A;  3IF8 B;  4ZS2 A;  5JDL A;  3WI3 A;  4G2A A;  5C8Y E;  4QKN A;  5F3J A;  4N78 D;  1ZHC A;  4TV9 E;  4Z8X A;  4EZH A;  2L9Q A;  1MIW A;  2DHR A;  2MOZ A;  4OYJ A;  3F57 A;  4C91 A;  1X79 A;  1MIY A;  4OHF A;  4CZZ B;  3KBU A;  5LXT E;  2DCF A;  2C5I T;  4PFO A;  2XAJ B;  2KMF A;  2CWY A;  3HR0 A;  4PJL A;  2PFV A;  4GK0 E;  3UUN A;  4AXP A;  4DMW A;  1MMD A;  3E22 E;  4PJM A;  4BA9 A;  2NW9 A;  2EHO A;  4DND A;  2QGS A;  1ZEE A;  5LBQ B;  1IJ6 A;  1MIV A;  4X20 E;  5JDF A;  3AB3 B;  4PK5 A;  4IE0 A;  2LOP A;  3N9L A;  5ETW A;  4I50 E;  4DVD A;  5JDN A;  3U3I A;  4O4H E;  2N9D A;  3RKO A;  4EYY R;  3VKH A;  2W61 A;  3RC3 A;  3C51 A;  5JRC A;  2PG8 A;  3C4Z A;  4O4I E;  3RRW A;  2XAS B;  1G73 A;  2X9X A;  5HYA A;  5M4Y A;  1WYB A;  3P7I A;  3FBZ A;  4IE6 A;  5LCY A;  3RX6 A;  4CI3 B;  2I59 A;  2LEH A;  4O2B E;  3ZCJ A;  1QSD A;  3F2E A;  5FXZ A;  4UF0 B;  4O2A E;  4PAG A;  1FEW A;  2CLY B;  5LHI B;  3SRZ A;  3JC6 C;  3ONX A;  3CX7 B;  4GIW A;  4FI5 A;  2ODU A;  2WBL A;  2X66 A;  2RP4 A;  5DQW A;  2XAF B;  3O4X E;  2CEA A;  3ZJ1 A;  2A72 A;  1D1C A;  2VKH A;  5L3C B;  2EHO C;  3HKC E;  4YFS A;  5LGN B;  1UX4 A;  4WNK A;  5FYM A;  5A1L A;  2JQQ A;  2D5U A;  2VK9 A;  2X9W A;  5CA0 E;  5JDM A;  2ACX A;  2K5B B;  4J2C A;  3DTO A;  2V7M A;  2VB6 A;  3LK2 B;  5F8P A;  2XAH B;  5LYJ E;  2JRK A;  2BVL A;  3CQG B;  5FXX A;  3PUR A;  2DNX A;  1V9D A;  4KUM B;  2JMH A;  2IC6 A;  2EHO D;  4GYS A;  2NOX A;  1D1A A;  5LP6 E;  5GON E;  4TZ4 C;  5JVD E;  2V7L A;  3ZYM A;  3KV4 A;  3MAC A;  1MMG A;  1YW0 A;  2VKO A;  2CM0 A;  2CLY C;  1IJ5 A;  4ZI3 C;  4AQF A;  4DMV A;  3PUS A;  5LG4 A;  3I1A A;  4PNI A;  5LJM A;  1D0Z A;  3BQL A;  2KZ7 B;  3OYX A;  4ISS A;  1WR6 A;  3KV6 A;  3RYF E;  3V5U A;  3I0Q A;  3PDY A;  4BAY B;  5LJN A;  2YK0 A;  1HG2 A;  4ILU A;  3SWH A;  2GK9 A;  5LGU B;  5J2U E;  3PUG A;  1SHZ C;  3OKQ A;  4AKH A;  3UUM A;  4X1Y E;  5FXW A;  2Q9Q D;  2E9X D;  2C0S A;  3AA1 B;  3UTK A;  3ZMZ B;  3N9N A;  5EZY E;  3I9W A;  3RPU A;  4EOZ B;  3IEE A;  3J7Y q;  4BJN A;  2XUE A;  3ZN0 B;  2WMN A;  3Q9D A;  2H7V C;  4CXW A;  3CKD A;  3K3N A;  1O3X A;  2LHN A;  2CE7 A;  4U74 A;  2LHR A;  3N9P A;  2KWI B;  5JR9 B;  2KLQ A;  5J1G A;  1AJ3 A;  4ASK A;  4JUY A;  3C4X A;  5JR9 A;  3ETV A;  3CWZ B;  4KBM B;  2LSI A;  2X67 A;  3I0O A;  3B13 A;  3RYI E;  4YJ2 E;  3RC8 A;  2W0G A;  3MK7 C;  3MXZ A;  3CML A;  2YU1 A;  4U72 A;  3GN5 A;  3JC6 D;  3T8O A;  2NP9 A;  5FP3 A;  3UFE A;  4F6R C;  4EB6 E;  2BDE A;  4MFR A;  2VKD A;  3KFW X;  2KIN B;  1WLX A;  4QXH B;  3U78 A;  1BR1 A;  5FNV E;  3QK6 A;  4MBQ A;  4PJN A;  3PU8 A;  1LRZ A;  3Q5W A;  2HPL A;  1FMW A;  4MHC A;  3RH3 A;  5JQG E;  3ZC1 A;  4IIJ E;  3ZEF B;  5FXV A;  3NZP A;  3LK4 2;  4O4J E;  2LOS A;  5CA1 E;  2CWO A;  3MZK B;  4QHO A;  2E9X A;  3O1I A;  2E9X B;  3BK9 A;  5JRE A;  5LHG B;  3EUH A;  4ZHQ E;  5JH7 E;  5LGT B;  4P09 A;  3LBX A;  5KDM C;  2V1D B;  4IDZ A;  4QWN B;  5L3B B;  2YU2 A;  4HKA A;  2XAG B;  3L09 A;  3DP7 A;  1LVF A;  1HTJ F;  3SOL A;  3HI2 A;  4PK4 A;  2MYS A;  5H6R B;  2H3R A;  3ZPO A;  4DBQ A;  2J1D G;  2DWG A;  2LJL A;  2V26 A;  3QUJ A;  2K9A A;  3CPZ A;  1LVK A;  3MJX A;  2Y8D A;  4OFZ A;  3FB2 A;  1HS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...