4A56A

Crystal structure of the type 2 secretion system pilotin from klebsiella oxytoca
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
b'VSGQAQLEQLASVAAGARYLKNKCNRSDLPADEAINRAAINVGKKRGWANIDANLLSQRSAQLYQQLQQDSTPEATKCSQFNRQLAPFIDSLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PULLULANASE SECRETION PROTEIN PULS
publication title Pilotin-Secretin Recognition in the Type II Secretion System of Klebsiella Oxytoca.
pubmed doi rcsb
source organism Klebsiella oxytoca
molecule tags Protein transport
total genus 37
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2011-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09691 T2SS_PulS_OutS Type II secretion system pilotin lipoprotein (PulS_OutS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1630 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4a56A00
4K0UA 3UTKA 4A56A 3SOLA
chains in the Genus database with same CATH superfamily
3J9X1 1IJ6A 2DL1A 3ZMSB 3BQKA 4EEDA 4IREA 3AVSA 1W0AA 4AKGA 4AQFA 3PTRB 3QB5A 5HXRA 3VR8A 4CXYA 2CXLA 4UR9A 5JDLA 3Q9DA 3LK3B 3G06A 5CA0E 4YSXA 4OYKA 3H3AA 1EZ3A 2UUAT 4F6RC 4DMWA 2IUBA 4DBRA 5ABHA 2JMHA 2IHR1 1E1HB 5AQMB 1BR1A 1AJ3A 2JPFA 2WU5A 2Q9QC 3OTOT 5JDNA 4UEMA 4AXPA 5LGNB 4LFAT 3IEEA 5C3JA 5LJNA 4I55E 4LFCT 2X67A 2QVAA 3PU8A 3RIUA 4UVAB 4HWHA 4JI7T 5AQHB 2E8IA 1G8XA 5ABGA 4ASKA 3I1AA 2WSSV 3U3IA 3BQIA 4H9RC 4KMCA 1MIWA 2XAJB 3P4WA 2J4GA 4DR5T 3N9NA 1CHUA 3AEGA 3ONXA 2LKHA 1J1JA 5LMUT 4MBQA 3JCFA 2ZMAA 2V7MA 2LOSA 4UV8B 2LE8A 4EZ4A 3LJCA 5EK4A 2XM2A 4N78D 4TWHA 3AA1B 2WM9A 4HWIB 4JI3T 3N2GE 4HFBA 4HFDA 4PJLA 1KNPA 2XSBA 3O9XA 1T8BA 1X79A 4YT0A 4AQYT 1MIVA 3KBUA 2LEHA 4PW8A 4WBNE 5JDQA 2WP9A 2LRLA 4X1YE 2MYSA 5CFBA 2M6BA 3P8CD 4DR6T 1D1BA 4GOUA 3E0ZA 2XJ7A 5KXJA 5AQSB 5LGUB 2WB5A 2YU1A 5F5WA 3AEDA 1UCUA 2W00A 3PUGA 5JR9A 2HH7A 4QH4A 1VCSA 5FVLA 3L39A 1UUSA 3F2EA 3ZYMA 4X1KE 4UV9B 1OXZA 3FZHB 3PUYF 2I6HA 4A97A 3ZMUB 5IWAT 4H9SE 4AQGA 3AEEA 3EHZA 2XQ8A 4U2YA 3RC8A 2ZLYA 4PAGA 2YK0A 2N9DA 3MK7C 2A9UA 3HKBE 1US7B 4LMJA 3VKGA 2IW5B 3EDUA 2C5KT 2QA7A 4ISTA 4ZXLA 2KINB 3I0OA 3AE7A 3UU5A 2X0YA 5HWYA 3LFMA 4TWDA 5C2TA 3V5SA 3VHLA 4DR1T 1ZP0A 3SRZA 2Z6EA 2VKJA 3ZMVB 3A7MA 1NEKA 4MALA 1NWMX 2V7IA 3AECA 3RKGA 1HCIA 4UF0A 3KVAA 4HFCA 5L3FB 3C50A 5AQPB 5LA6E 4ILBA 4PJNA 4K0UA 4PFPA 4AI6A 3RC3A 2ZM8A 4L9IA 3ZC0A 3T8OA 1OEDA 4HWCA 2E9XA 1WR6A 4XAXB 4X64T 3MKDA 3Q5DA 5JDHA 1QUUA 3ZSSA 3Q5WA 2HN2A 4EEBA 4JI0T 2V1DB 4PFOA 5LB7B 3FBLA 5LBQB 5JRCA 1T98A 2UUBT 5LG4A 5LNKA 2BG9C 3J7Yq 1GQEA 3ANWB 3VR9A 2XZEA 1WCRA 5HXEA 5EK3A 3FZKB 3MJXA 2NWBA 3OBVE 4GIWA 4IDZA 3NVOA 5LP6E 4ZI7E 3N5LA 4HE8A 4MFRA 3RIAA 3ZN1B 2YU2A 3N9PA 4OFZA 4DV3T 2CWYA 2W66A 3P4PA 4M1PA 1WFDA 4IHJE 2OLTA 2N1GA 3ZKRA 2BS2A 4YSYA 4JI6T 2VQET 3HI2A 5IHYA 3AE5A 5FY7A 1D0XA 4CZZB 5HEOA 5CA1E 1FIOA 5ADXL 2VKOA 2LSIA 3RIFA 1SHZC 3AEAA 2H7VC 4YFSA 2YDQA 4AISA 4ZHQE 3C64A 4KX6A 1JNZA 2X9XA 3GWHA 2EHOD 4JLEA 2UU9T 3PUQA 4HKAA 2FJAA 1Y64B 3AE2A 4EB6E 1UX5A 5LOVE 4PNIA 4OK0A 1QSDA 2OA5A 1H7CA 3RRCA 5FXVA 3P7IA 3UUXB 2RP4A 5HWXA 1E2AA 5FMNA 1XWMA 3AVRA 4IDPA 3FZLB 2KSRA 4Q25A 5LBMA 3C4ZA 4U7IA 5AFUL 5LGTB 4HWFA 1N33T 3WI3A 3CQGB 1HNXT 2UXBT 4JUYA 4CI3B 4CI2B 5A1LA 2D9DA 2LLYA 3UUMA 4TV9E 3MA9A 1ZHCA 1J5WA 3RIUC 4OYJA 2RPAA 2EHOC 3OJAA 4ZEYA 2PJQA 4U33A 3FB2A 3RX6A 4B3RT 2SPCA 4YTNA 4CN4A 2I0MA 3FXDB 4A56A 4YTPA 4ZZBA 4U7YA 2XAHB 3F57A 1LVFA 4P0BA 5FVKA 4DMVA 3A8YC 2Q9QB 3B5MA 4JBWF 3AEBA 2I59A 2W61A 2YN6A 2NP9A 5AQIB 1HNWT 3ZMZB 3N2KE 1ZEEA 3UU4A 5JVDE 3AXJB 3C98B 3NRYA 2K3WA 4X62T 1WYCA 5H6QB 2FJEA 3ABVA 1SUMB 3FBZA 2GK9A 2BS4A 4QXBB 3TLVA 2KLQA 4MHCA 4AKIA 4COFA 5JDFA 3UFGA 2WY2A 1CUNA 4HFVA 1YQ3A 4DNDA 4L0RA 5AQUB 1UX4A 5BMVE 4O2BE 4UVBB 3C4WA 3P4RA 4IE0A 2BKNA 2MBGA 3QB5K 3SWHA 3PUZF 2QYWA 4AKRB 5AQVB 4KI0F 3FHNA 2NTXA 4JEHB 4ZZCA 2VQFT 3ZSTA 4HN9A 1HNZT 4I0UA 2JQ9A 4LMLA 4TWFA 2WCAA 2ZM6T 1VRBA 5EZYE 3N9OA 2AE9A 3E22E 5JDGA 4DV6T 4EZHA 3PUWF 1BR4A 3LG7A 1SE7A 3ZT6A 5LXTE 3A5XA 1IBLT 2XQAA 3Q5XA 2ZM0A 5FY1A 3EVYA 2BZBA 3WAJA 2XASB 2XAFB 3UQ7A 4QHOA 2MTQA 2IIUA 3N9MA 3ZEFB 2Y6XA 4ERRA 1BR2A 3AAAB 3ZYLA 3RQWA 4TNVA 5J1GA 5HEUA 1WLXA 3AAEB 3PJAA 3UTKA 2E2AA 2XY8B 3AAIA 2L3LA 2JQKA 3O1IA 2E5LT 2V6YB 2X51A 1UGOA 1OEDC 3DJBA 2WZIA 1YD8G 2CEAA 5HYAA 5AQGB 2XSAA 1G73A 3JC6C 3ZN0B 4BA9A 4H9OC 5KMGP 5TAOA 5CGMA 3ZCIA 4NPPA 4O4JE 2JIWA 4E7SA 2XQ6A 2K5BB 4GKKT 4FJOA 4ILAA 3PUAA 3H37A 1JNRA 4ZS2A 3BK9A 3RRWA 3JAFA 1MMNA 3ANWA 3PU3A 4GK5E 3KV4A 3CX6B 3CVRA 2XQ3A 1XZYA 4P1NA 4EGWA 5EK2A 2CE7A 3TLSA 4H9PC 2BKPA 4PK6A 3ZMTB 5M4YA 4JI8T 2LSGA 3IBPA 4P09A 5L3EB 1KEYA 5AQLB 3KDSE 1T7SA 2BG9B 1N36T 2D0UA 3L09A 3FXEB 1XMQT 4HGAA 3AE6A 2WMNA 2ES0A 4QX8B 4NIQA 2YDSA 4CI1B 4YTMA 2NW8A 3D0TA 2J1DG 3MZKB 2H89A 1D1CA 1HF8A 4WNKA 4YJ3E 4QH1A 4JV5T 3Q2MA 1M62A 3IA3A 4YLHA 2LOPA 1I6ZA 2CLYC 1WYBA 5FXWA 3OYZA 5HXSA 2NW7A 4TX5A 1IBMT 4CXWA 5LJMA 2FUPA 4OX9T 3B57A 2XQYA 2W63A 2A72A 2FJDA 4QH5A 3RQUA 1KK7A 2XTLA 4DR7T 2UXNB 4WW0A 1XNQT 1MMGA 4HFIA 1S94A 3CWZB 2ODVA 1MNDA 2ODUA 5LHGB 3R84B 4EXTA 3GN5B 3KV6A 3CKDA 2VASA 3AA7B 3VU7H 3S4UA 2XQ4A 3L8RA 4CN1A 1MMDA 3FZFB 4IL4A 4EIWA 3I9WA 3HKEE 2KT9A 4BAYB 3EI0A 2CRBA 4HFEA 3RGLA 3P50A 1FJGT 2V8SV 4ILCA 3SOLA 4EYYR 3HA4A 4CXXA 2Q9QA 4EAHA 1I94T 4HTEA 2Y48B 3DTOA 1HX1B 3PJAJ 4QX7B 2E5VA 4IL9A 4ANJA 1LVKA 2EHOB 4QWNB 1OWAA 4DV4T 4Z91A 4U31A 3ONJA 3AXJA 1QLBA 3HKDE 2V7LA 2VURA 3M65A 3CQCB 4YSZA 4X5TA 5HEJA 4TUYE 2K9AA 2VL0A 2W0GA 2JQHA 4FI5A 2H3RA 3SS1A 3K3OA 2YDRA 2WDRA 2WDQA 1X9BA 2XQ5A 2X9WA 2LHNA 2CBJA 3AA6B 3PURA 2R6GF 2CXDA 5JH7E 2LSYA 3CQXC 2MOZA 4WBOA 5LHIB 3VKHA 3F31A 4H9QC 2QRXA 2W2UA 2X68A 5FY0A 4DUZT 1KNZA 4JI2T 3UULA 3UU6A 4DV7T 2NOXA 1FMVA 5FP3A 2CCQA 2VKDA 5IUXA 4DR3T 5AQKB 4NUVA 2UXCT 2B1EA 4U3CA 3UU8A 2H88A 2KMFA 1N34T 4H9NC 1UURA 4TZ4C 4WZXA 3IF8B 1KF6A 3TLWA 4AQFC 3M3ZB 5FNVE 3GMIA 4IE6A 5IYZE 2XAGB 3JADA 4I43B 1YW0A 2V7KA 5JQGE 3ESLA 4LF7T 4CQIA 3HL6A 4P0AA 2X9HA 2D2SA 4DV0T 3KVBA 4DV2T 1UK5A 2DHRA 3TLTA 2DNXA 5ABEA 2FBWA 2V5DA 2VWAA 3VRAA 1D0ZA 3RYCE 2V7JA 4Z90A 2C5IT 1U4QA 5DQWA 3LBXB 3N2OA 1NAFA 2VKHA 3C4XA 4EV6A 1WR0A 4K0KT 1B7TA 2UXXB 2LSJA 3QOFA 3RPUA 2K24A 3RF1A 5JTGA 3JAEA 3ZC1A 2X66A 5DABA 3K3QC 1OEDB 4UIGA 3N9LA 5FKYA 2LKGA 2X9YA 4Z8XA 1V9DA 5FXZA 3ZJ1A 2LSKA 2XQ9A 2CPTA 3OVUA 3SFDA 1W09A 5JRCB 2CXFA 4AKHA 4O4IE 3MXZA 2KZ7B 1MIYA 5HXHA 4JI4T 2KNDA 2PG8A 2CA5A 3H3MA 5FYMA 2BG9A 1MMAA 2YOEA 3VRBA 3UU3A 5JR9C 2RA1A 2NTYA 3RI5A 5ETWA 2WMOA 4ZI3D 3N9QA 4DR4T 1ZOYA 5KX5E 4A5XA 3RYFE 4DBQA 2YINA 1LKXA 5L3DB 5L3BB 3QC9A 2IC6A 4O2AE 1HFAA 3T1YT 2XQ7A 4LMKA 3KV5A 4EYUA 4B3TT 4IE5A 1WRDA 1O3XA 5AQNB 2E9XD 4HFHA 2JRKA 2VK9A 3CX7B 4IE4A 1YXRA 4IDQA 1W9RA 2BG9E 2L9QA 4JI1T 4JEUB 5LMNT 3JC6D 4YHJA 2VL8A 2UXDT 5L4EA 2XUEA 4ZI3C 1HG5A 2DCFA 4ZI2D 2A2FX 3NWIA 2CLYB 2G0UA 3GN5A 2LJLA 2N2NA 4QKNA 2PBIA 2F4VT 4LF5T 4PJJA 1KNRA 2VB6A 3ETVA 2AXDS 1MNEA 4I4TE 3V5UA 4A98A 5LG3A 3PUSA 5L3GB 4ILUA 1R8IA 2E9XC 2V5CA 3PV0F 2BS3A 2L8KA 4O4HE 2UUCT 2J62A 4DV1T 2JQQA 3PDYA 5FL0A 2WBLA 5AQRB 1XDOA 4XZCA 4IGUA 3WAKA 4YXDA 3GA8A 2BVLA 5J2TE 1FEWA 4IE7A 2XM1A 4BJNA 3AE9A 1NENA 2WZHA 3E08A 3O1HA 3LSVA 3QK6A 1N32T 4ZI2C 2EHOA 2LRKA 3CPZA 3PE0A 4H63V 3CK6A 5DQVA 4NXMT 2P9BA 3TKLB 3P4QA 1J5ET 5JREA 3HR0A 2PFVA 4F8HA 3UQ4A 1KFYA 3EABA 4O4LE 4I50E 2IMLA 3IHRA 3QUJA 4AIUA 5LCYA 4YY3T 1HS7A 2WWUA 3OKQA 1HR0T 1BR0A 4DUYT 2MPKA 4GKJT 3L3PA 3ETUA 2KXPB 3EAMA 5AQJB 4BJMA 1HX8A 5HEHA 5HCMA 1IZNB 2J47A 2KWHA 5L2LA 3RYHE 3UFEA 2JMKA 3W15B 4U72A 5ABFB 5J0ZA 2WU2A 3CX8B 3AEFA 4DIDB 4L5GA 4UVCB 4KUMB 2PTFA 1IAPA 2VVNA 2YKSA 3P4SA 2M6IA 2LM9A 3NKZA 5FL1A 3NZPA 3ZCJA 2IAKA 2IDOB 3OYXA 4ADZA 1T72A 4E7ZA 2QGSA 2BBHA 3C51A 3O1JA 2WQYA 1IBKT 4CN6A 4ZS3A 3CIRA 3AE8A 5HXCA 1ZKEA 2M67A 5L47A 4DV5T 3U78A 1XNRT 4WYVA 5HEGA 4IIJE 2CHOA 4X1IE 2DLRA 3I0QA 2CBIA 4B3MT 3K1SA 2DWGA 3AB3B 3LBXA 2CHNA 4B6XA 3RYIE 2W4XA 3RLFF 3LK2B 5AQQB 5LHHB 3UT5E 2BKOA 4OHFA 4YHHT 3DP7A 3TLUA 2VVSA 2WDVA 4TN7B 5GONE 1D1AA 4PJMA 3AA0B 3ONLC 3ZLIA 5AQTB 5HCJA 4LFBT 4C91A 5HAXA 2V6XA 2IC9A 5CJ5A 4X66T 4C90A 3K8PC 3HKCE 4YJ2E 2HN1A 3BQLA 4J2CA 4KBMB 4G63A 1OEDE 4X20E 3LDQB 4KHZF 4LF6T 4ISSA 3ZT7A 1W0BA 4QXCB 3ZT5A 3RKOA 1Y01A 1VCTA 2X0LB 5BR8T 1DU2A 3PUXF 5L3CB 5AQFB 4NXNT 3ZYKA 5JR9B 5C8YE 3KINB 2XHEB 3AE1A 5DJQC 4PK4A 2HHHT 5L4HA 3PUVF 1E7PA 3RH3A 5FXXA 5KDMC 4DO0A 3ZJ2A 1L0VA 1S35A 4TNWA 2ZM2A 3T1HT 3CMLA 4GYRA 4AKLA 5F3JA 2CWOA 2KWIB 2WS3A 3B13A 4B3ST 4KP3C 2HPJA 4LF4T 2V6YA 3I9YA 3NBXX 2CM0A 2W62A 3AE3A 2H7OA 2ACZA 2OV9A 1D0YA 1YKHB 3EUHA 4UF0B 3NZQA 3Q5EA 2CMRA 1Z8UA 4GYSA 4UELA 2K48A 5F8PA 3FZMB 4LF9T 2JJ9A 1SA0E 2FJBA 1YQ4A 5AQOB 2E9XB 1FMWA 2LM2A 2C0SA 3KBTA 3EDVA 2MAWA 2XAQB 2YEVC 4X65T 5CB4E 2W67A 2BBJA 3KFWX 2V26A 2WWVA 3X1DA 4H63H 1HG2A 2Y8DA 2DI4A 3K3NA 1ZV4X 4EOZB 4JYAT 3MACA 4XBFB 2NW9A 4TV8E 4HEAA 2HPLA 1LRZA 3AE4A 3QNUA 4IT4A 2LT3A 4NUUA 2XPKA 5J2UE 4O8SA 4DVDA 4MLKA 4V1Av 2A3DA 2WAUA 4IDOA 3R6NA 1IJ5A 4UXNB 2D5UA 5LYJE 4KHPT 4IDNA 1Z0PA 2X0HA 1XMOT 3SFEA 4LF8T 2DWKA 3NRXA 3LK42 4G2AA 5ABFA 4U2ZA 5JDMA 4JI5T 3RHWA 1U5PA 1YKEB 5H6RB 2LHRA 3ZPOA 2BVMA 4QXHB 2B76A 1VOMA 4HWDA 2D0TA 1HTJF 4U74A 4ZOLE 2Q9QD 2NR4A 3UUBA 2ACXA 3O4XE 3KV9A 2BDEA 4PK5A 3UUNA 4DR2T 1M7KA 2C5JA 1XDPA 4GK0E 3OPCA 5E0OA
chains in the Genus database with same CATH topology
3J9X1 3M65A 3OJAA 3CQCB 3RYHE 1IJ6A 3UFEA 2PJQA 2JMKA 3FB2A 3ZMSB 3RX6A 3BQKA 4TUYE 2K9AA 2W0GA 4FI5A 2SPCA 2H3RA 3W15B 3SS1A 4U72A 3K3OA 3FXDB 4A56A 3AVSA 4AKGA 4AQFA 3CX8B 3PTRB 5HXRA 2XAHB 4L5GA 4CXYA 2CXLA 4UVCB 2X9WA 4KUMB 2LHNA 3Q9DA 3F57A 3LK3B 5JDLA 3AA6B 5CA0E 1LVFA 4P0BA 4OYKA 3H3AA 1EZ3A 3PURA 4DMVA 1IAPA 2CXDA 5JH7E 2Q9QB 2LSYA 3CQXC 4F6RC 4DMWA 4DBRA 2MOZA 4WBOA 2LM9A 5LHIB 2I59A 2JMHA 2W61A 1E1HB 3VKHA 3F31A 1BR1A 1AJ3A 3NZPA 2JPFA 2NP9A 4H9QC 2Q9QC 2X68A 3ZCJA 3ZMZB 2IAKA 5JDNA 3N2KE 3OYXA 4UEMA 5E0OA 5FY0A 1ZEEA 4ADZA 4E7ZA 1KNZA 4AXPA 5JVDE 5LGNB 2QGSA 3IEEA 3UULA 3C51A 2NOXA 1FMVA 5FP3A 5LJNA 2CCQA 4I55E 3O1JA 2VKDA 3C98B 3NRYA 2X67A 3PU8A 4UVAB 4ZS3A 1WYCA 5H6QB 5HXCA 1ZKEA 2M67A 4NUVA 2B1EA 2E8IA 1G8XA 4ASKA 3I1AA 2WSSV 3U3IA 3BQIA 3FBZA 3U78A 4H9RC 4KMCA 2GK9A 2KMFA 1MIWA 2XAJB 4IIJE 4QXBB 2KLQA 4H9NC 4MHCA 4AKIA 3N9NA 4X1IE 2DLRA 5JDFA 3I0QA 4TZ4C 3ONXA 3IF8B 1CUNA 4AQFC 4HFVA 5FNVE 3GMIA 4DNDA 4L0RA 2DWGA 3AB3B 3LBXA 4IE6A 5IYZE 4B6XA 2XAGB 4I43B 4MBQA 1UX4A 3RYIE 2ZMAA 4O2BE 4UVBB 5BMVE 1YW0A 2V7MA 3C4WA 2LOSA 4UV8B 2LE8A 2V7KA 4IE0A 4EZ4A 3LJCA 3LK2B 2MBGA 5EK4A 5LHHB 3SWHA 4N78D 3UT5E 5JQGE 3AA1B 4OHFA 3ESLA 2WM9A 4AKRB 3DP7A 3N2GE 3FHNA 2NTXA 3HL6A 4JEHB 4CQIA 4TN7B 4PJLA 5GONE 4HN9A 1D1AA 4P0AA 3O9XA 2X9HA 1X79A 2D2SA 1MIVA 4PJMA 3KBUA 1VRBA 2LEHA 3KVBA 3AA0B 4PW8A 4WBNE 5EZYE 5JDQA 3N9OA 2DHRA 3E22E 5JDGA 2DNXA 4X1YE 4EZHA 1BR4A 3ZLIA 3LG7A 2MYSA 5LXTE 3P8CD 3A5XA 2VWAA 1D1BA 3Q5XA 4C91A 4GOUA 1D0ZA 2ZM0A 5FY1A 2V7JA 3E0ZA 5HAXA 3RYCE 3EVYA 2C5IT 2BZBA 3WAJA 2IC9A 1U4QA 2XASB 5LGUB 2YU1A 1UCUA 5DQWA 2W00A 2XAFB 3LBXB 3PUGA 5JR9A 2HH7A 4QHOA 4C90A 3N2OA 2MTQA 1NAFA 3N9MA 3K8PC 3ZEFB 4ZI2C 2VKHA 2Y6XA 4ERRA 3HKCE 1BR2A 3AAAB 3ZYLA 3C4XA 4YJ2E 3F2EA 5J1GA 1B7TA 2UXXB 2LSJA 3ZYMA 4X1KE 3RPUA 2K24A 3BQLA 1WLXA 4J2CA 4UV9B 1OXZA 3AAEB 4KBMB 4G63A 3ZC1A 2X66A 5DABA 3K3QC 4UIGA 3N9LA 4X20E 3UTKA 3ZMUB 3AAIA 2X9YA 4H9SE 4AQGA 2L3LA 4Z8XA 1V9DA 3RC8A 3O1IA 5FXZA 2X51A 2ZLYA 3ZJ1A 2LSKA 4PAGA 3DJBA 4ISSA 2YK0A 2N9DA 3MK7C 3HKBE 3VKGA 1US7B 2IW5B 3EDUA 4QXCB 1YD8G 2QA7A 2C5KT 2CEAA 4ISTA 5JRCB 2KINB 2CXFA 3I0OA 4AKHA 5HYAA 3RKOA 5HWYA 2X0LB 3LFMA 4O4IE 3MXZA 1G73A 2KZ7B 3V5SA 3VHLA 3JC6C 5L3CB 3ZN0B 1MIYA 5HXHA 4BA9A 3ZYKA 3SRZA 5JR9B 2Z6EA 2KNDA 4H9OC 5KMGP 2PG8A 5C8YE 3KINB 2CA5A 2VKJA 5FYMA 2XHEB 5TAOA 3ZMVB 1MMAA 5DJQC 3ZCIA 4MALA 4PK4A 1NWMX 4O4JE 2V7IA 5JR9C 2RA1A 4E7SA 2K5BB 4FJOA 2NTYA 3PUAA 3RH3A 1HCIA 4UF0A 3H37A 5FXXA 5ETWA 2WMOA 4ZS2A 3BK9A 3RRWA 4ZI3D 3N9QA 3KVAA 1MMNA 3ANWA 3PU3A 4GK5E 5KX5E 3KV4A 5L3FB 5KDMC 3CX6B 3CVRA 3C50A 3RYFE 4DO0A 4DBQA 3ZJ2A 2YINA 1LKXA 5L3DB 5L3BB 3QC9A 5EK2A 5LA6E 1S35A 2CE7A 4PJNA 2IC6A 4K0UA 4O2AE 1HFAA 4PFPA 2ZM2A 3RC3A 4AI6A 2ZM8A 3CMLA 4GYRA 4AKLA 4L9IA 4H9PC 5F3JA 3KV5A 2CWOA 3ZC0A 2KWIB 3T8OA 4EYUA 4PK6A 3ZMTB 3B13A 2E9XA 5M4YA 4IE5A 1WRDA 1O3XA 1WR6A 4XAXB 3MKDA 2LSGA 3IBPA 5JDHA 4P09A 4KP3C 1QUUA 2HPJA 2E9XD 3Q5WA 5L3EB 2JRKA 2VK9A 3I9YA 3CX7B 4IE4A 3KDSE 2V1DB 4PFOA 3NBXX 2CM0A 2L9QA 2W62A 3FBLA 4JEUB 5LBQB 5JRCA 2D0UA 2H7OA 1T98A 3L09A 3FXEB 3JC6D 4YHJA 1D0YA 5LG4A 2VL8A 5LNKA 1YKHB 3EUHA 4HGAA 4UF0B 3NZQA 3J7Yq 2CMRA 2WMNA 2ES0A 3ANWB 4QX8B 4GYSA 2XUEA 4UELA 4ZI3C 1HG5A 2K48A 2DCFA 5HXEA 4ZI2D 5F8PA 5EK3A 2A2FX 4CI1B 3MJXA 2CLYB 2NWBA 2NW8A 3D0TA 3OBVE 4GIWA 2JJ9A 2G0UA 3GN5A 2J1DG 2LJLA 2N2NA 4IDZA 3MZKB 1SA0E 1D1CA 1HF8A 4QKNA 4WNKA 5LP6E 4YJ3E 2PBIA 3Q2MA 4PJJA 4ZI7E 4YLHA 2E9XB 1FMWA 2LOPA 2C0SA 2VB6A 3ETVA 3N5LA 2CLYC 1WYBA 4HE8A 4MFRA 3ZN1B 3KBTA 1MNEA 3EDVA 2XAQB 2YU2A 4I4TE 3V5UA 3N9PA 4OFZA 5FXWA 5CB4E 3PUSA 2CWYA 3KFWX 3OYZA 5HXSA 4M1PA 2V26A 4ILUA 2E9XC 5L3GB 4IHJE 2NW7A 2N1GA 4TX5A 4H63H 4CXWA 2L8KA 4O4HE 1HG2A 2Y8DA 5LJMA 2DI4A 3HI2A 2JQQA 3K3NA 1ZV4X 3PDYA 2WBLA 3B57A 5IHYA 4EOZB 2XQYA 4XBFB 3MACA 2W63A 2NW9A 2A72A 4TV8E 4HEAA 5FY7A 2HPLA 4XZCA 4IGUA 3WAKA 3GA8A 1LRZA 2BVLA 1D0XA 4CZZB 5CA1E 1FIOA 5J2TE 1FEWA 4IE7A 4BJNA 5ADXL 1KK7A 2XTLA 2UXNB 4WW0A 2LT3A 2VKOA 1MMGA 2LSIA 3E08A 3O1HA 1S94A 3CWZB 4NUUA 1SHZC 2ODVA 1MNDA 2H7VC 2ODUA 4YFSA 5LHGB 5J2UE 3QK6A 3R84B 4O8SA 4DVDA 4EXTA 3GN5B 2EHOA 4MLKA 4V1Av 3CPZA 3PE0A 3KV6A 3C64A 2A3DA 4H63V 4ZHQE 3CKDA 2WAUA 5DQVA 3R6NA 1IJ5A 2VASA 2P9BA 2X9XA 3AA7B 3GWHA 4UXNB 3TKLB 2D5UA 5LYJE 2EHOD 4JLEA 3VU7H 3S4UA 5JREA 3PUQA 1Z0PA 3HR0A 2PFVA 4HKAA 1Y64B 4EB6E 1UX5A 4O4LE 4I50E 5LOVE 4PNIA 1MMDA 4EIWA 3IHRA 4OK0A 1QSDA 3QUJA 2OA5A 3I9WA 1H7CA 3RRCA 2DWKA 3HKEE 5FXVA 3NRXA 3P7IA 2KT9A 3LK42 3UUXB 2RP4A 4G2AA 4BAYB 5HWXA 5JDMA 5FMNA 1U5PA 5LCYA 3AVRA 1YKEB 5H6RB 3SOLA 4EYYR 1HS7A 2LHRA 2WWUA 3OKQA 1BR0A 5LBMA 3C4ZA 3HA4A 3ZPOA 4CXXA 2BVMA 2Q9QA 4EAHA 4QXHB 5AFUL 3L3PA 1VOMA 3ETUA 4HTEA 5LGTB 2Y48B 3DTOA 2KXPB 4QX7B 2D0TA 1HTJF 4U74A 4ZOLE 3WI3A 2Q9QD 3CQGB 4JUYA 4BJMA 4ANJA 1LVKA 2EHOB 1HX8A 2ACXA 3O4XE 3KV9A 4QWNB 2BDEA 4PK5A 4CI3B 1OWAA 4CI2B 3UUNA 5A1LA 3UUMA 4TV9E 2C5JA 3MA9A 1ZHCA 4GK0E 1IZNB 4OYJA 2EHOC 2KWHA 3HKDE 2YEVC 2V7LA 5L2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0U A;  3UTK A;  4A56 A;  3SOL A; 
#chains in the Genus database with same CATH topology
 3J9X 1;  1IJ6 A;  2DL1 A;  3ZMS B;  3BQK A;  4EED A;  4IRE A;  3AVS A;  1W0A A;  4AKG A;  4AQF A;  3PTR B;  3QB5 A;  5HXR A;  3VR8 A;  4CXY A;  2CXL A;  4UR9 A;  5JDL A;  3Q9D A;  3LK3 B;  3G06 A;  5CA0 E;  4YSX A;  4OYK A;  3H3A A;  1EZ3 A;  2UUA T;  4F6R C;  4DMW A;  2IUB A;  4DBR A;  5ABH A;  2JMH A;  2IHR 1;  1E1H B;  5AQM B;  1BR1 A;  1AJ3 A;  2JPF A;  2WU5 A;  2Q9Q C;  3OTO T;  5JDN A;  4UEM A;  4AXP A;  5LGN B;  4LFA T;  3IEE A;  5C3J A;  5LJN A;  4I55 E;  4LFC T;  2X67 A;  2QVA A;  3PU8 A;  3RIU A;  4UVA B;  4HWH A;  4JI7 T;  5AQH B;  2E8I A;  1G8X A;  5ABG A;  4ASK A;  3I1A A;  2WSS V;  3U3I A;  3BQI A;  4H9R C;  4KMC A;  1MIW A;  2XAJ B;  3P4W A;  2J4G A;  4DR5 T;  3N9N A;  1CHU A;  3AEG A;  3ONX A;  2LKH A;  1J1J A;  5LMU T;  4MBQ A;  3JCF A;  2ZMA A;  2V7M A;  2LOS A;  4UV8 B;  2LE8 A;  4EZ4 A;  3LJC A;  5EK4 A;  2XM2 A;  4N78 D;  4TWH A;  3AA1 B;  2WM9 A;  4HWI B;  4JI3 T;  3N2G E;  4HFB A;  4HFD A;  4PJL A;  1KNP A;  2XSB A;  3O9X A;  1T8B A;  1X79 A;  4YT0 A;  4AQY T;  1MIV A;  3KBU A;  2LEH A;  4PW8 A;  4WBN E;  5JDQ A;  2WP9 A;  2LRL A;  4X1Y E;  2MYS A;  5CFB A;  2M6B A;  3P8C D;  4DR6 T;  1D1B A;  4GOU A;  3E0Z A;  2XJ7 A;  5KXJ A;  5AQS B;  5LGU B;  2WB5 A;  2YU1 A;  5F5W A;  3AED A;  1UCU A;  2W00 A;  3PUG A;  5JR9 A;  2HH7 A;  4QH4 A;  1VCS A;  5FVL A;  3L39 A;  1UUS A;  3F2E A;  3ZYM A;  4X1K E;  4UV9 B;  1OXZ A;  3FZH B;  3PUY F;  2I6H A;  4A97 A;  3ZMU B;  5IWA T;  4H9S E;  4AQG A;  3AEE A;  3EHZ A;  2XQ8 A;  4U2Y A;  3RC8 A;  2ZLY A;  4PAG A;  2YK0 A;  2N9D A;  3MK7 C;  2A9U A;  3HKB E;  1US7 B;  4LMJ A;  3VKG A;  2IW5 B;  3EDU A;  2C5K T;  2QA7 A;  4IST A;  4ZXL A;  2KIN B;  3I0O A;  3AE7 A;  3UU5 A;  2X0Y A;  5HWY A;  3LFM A;  4TWD A;  5C2T A;  3V5S A;  3VHL A;  4DR1 T;  1ZP0 A;  3SRZ A;  2Z6E A;  2VKJ A;  3ZMV B;  3A7M A;  1NEK A;  4MAL A;  1NWM X;  2V7I A;  3AEC A;  3RKG A;  1HCI A;  4UF0 A;  3KVA A;  4HFC A;  5L3F B;  3C50 A;  5AQP B;  5LA6 E;  4ILB A;  4PJN A;  4K0U A;  4PFP A;  4AI6 A;  3RC3 A;  2ZM8 A;  4L9I A;  3ZC0 A;  3T8O A;  1OED A;  4HWC A;  2E9X A;  1WR6 A;  4XAX B;  4X64 T;  3MKD A;  3Q5D A;  5JDH A;  1QUU A;  3ZSS A;  3Q5W A;  2HN2 A;  4EEB A;  4JI0 T;  2V1D B;  4PFO A;  5LB7 B;  3FBL A;  5LBQ B;  5JRC A;  1T98 A;  2UUB T;  5LG4 A;  5LNK A;  2BG9 C;  3J7Y q;  1GQE A;  3ANW B;  3VR9 A;  2XZE A;  1WCR A;  5HXE A;  5EK3 A;  3FZK B;  3MJX A;  2NWB A;  3OBV E;  4GIW A;  4IDZ A;  3NVO A;  5LP6 E;  4ZI7 E;  3N5L A;  4HE8 A;  4MFR A;  3RIA A;  3ZN1 B;  2YU2 A;  3N9P A;  4OFZ A;  4DV3 T;  2CWY A;  2W66 A;  3P4P A;  4M1P A;  1WFD A;  4IHJ E;  2OLT A;  2N1G A;  3ZKR A;  2BS2 A;  4YSY A;  4JI6 T;  2VQE T;  3HI2 A;  5IHY A;  3AE5 A;  5FY7 A;  1D0X A;  4CZZ B;  5HEO A;  5CA1 E;  1FIO A;  5ADX L;  2VKO A;  2LSI A;  3RIF A;  1SHZ C;  3AEA A;  2H7V C;  4YFS A;  2YDQ A;  4AIS A;  4ZHQ E;  3C64 A;  4KX6 A;  1JNZ A;  2X9X A;  3GWH A;  2EHO D;  4JLE A;  2UU9 T;  3PUQ A;  4HKA A;  2FJA A;  1Y64 B;  3AE2 A;  4EB6 E;  1UX5 A;  5LOV E;  4PNI A;  4OK0 A;  1QSD A;  2OA5 A;  1H7C A;  3RRC A;  5FXV A;  3P7I A;  3UUX B;  2RP4 A;  5HWX A;  1E2A A;  5FMN A;  1XWM A;  3AVR A;  4IDP A;  3FZL B;  2KSR A;  4Q25 A;  5LBM A;  3C4Z A;  4U7I A;  5AFU L;  5LGT B;  4HWF A;  1N33 T;  3WI3 A;  3CQG B;  1HNX T;  2UXB T;  4JUY A;  4CI3 B;  4CI2 B;  5A1L A;  2D9D A;  2LLY A;  3UUM A;  4TV9 E;  3MA9 A;  1ZHC A;  1J5W A;  3RIU C;  4OYJ A;  2RPA A;  2EHO C;  3OJA A;  4ZEY A;  2PJQ A;  4U33 A;  3FB2 A;  3RX6 A;  4B3R T;  2SPC A;  4YTN A;  4CN4 A;  2I0M A;  3FXD B;  4A56 A;  4YTP A;  4ZZB A;  4U7Y A;  2XAH B;  3F57 A;  1LVF A;  4P0B A;  5FVK A;  4DMV A;  3A8Y C;  2Q9Q B;  3B5M A;  4JBW F;  3AEB A;  2I59 A;  2W61 A;  2YN6 A;  2NP9 A;  5AQI B;  1HNW T;  3ZMZ B;  3N2K E;  1ZEE A;  3UU4 A;  5JVD E;  3AXJ B;  3C98 B;  3NRY A;  2K3W A;  4X62 T;  1WYC A;  5H6Q B;  2FJE A;  3ABV A;  1SUM B;  3FBZ A;  2GK9 A;  2BS4 A;  4QXB B;  3TLV A;  2KLQ A;  4MHC A;  4AKI A;  4COF A;  5JDF A;  3UFG A;  2WY2 A;  1CUN A;  4HFV A;  1YQ3 A;  4DND A;  4L0R A;  5AQU B;  1UX4 A;  5BMV E;  4O2B E;  4UVB B;  3C4W A;  3P4R A;  4IE0 A;  2BKN A;  2MBG A;  3QB5 K;  3SWH A;  3PUZ F;  2QYW A;  4AKR B;  5AQV B;  4KI0 F;  3FHN A;  2NTX A;  4JEH B;  4ZZC A;  2VQF T;  3ZST A;  4HN9 A;  1HNZ T;  4I0U A;  2JQ9 A;  4LML A;  4TWF A;  2WCA A;  2ZM6 T;  1VRB A;  5EZY E;  3N9O A;  2AE9 A;  3E22 E;  5JDG A;  4DV6 T;  4EZH A;  3PUW F;  1BR4 A;  3LG7 A;  1SE7 A;  3ZT6 A;  5LXT E;  3A5X A;  1IBL T;  2XQA A;  3Q5X A;  2ZM0 A;  5FY1 A;  3EVY A;  2BZB A;  3WAJ A;  2XAS B;  2XAF B;  3UQ7 A;  4QHO A;  2MTQ A;  2IIU A;  3N9M A;  3ZEF B;  2Y6X A;  4ERR A;  1BR2 A;  3AAA B;  3ZYL A;  3RQW A;  4TNV A;  5J1G A;  5HEU A;  1WLX A;  3AAE B;  3PJA A;  3UTK A;  2E2A A;  2XY8 B;  3AAI A;  2L3L A;  2JQK A;  3O1I A;  2E5L T;  2V6Y B;  2X51 A;  1UGO A;  1OED C;  3DJB A;  2WZI A;  1YD8 G;  2CEA A;  5HYA A;  5AQG B;  2XSA A;  1G73 A;  3JC6 C;  3ZN0 B;  4BA9 A;  4H9O C;  5KMG P;  5TAO A;  5CGM A;  3ZCI A;  4NPP A;  4O4J E;  2JIW A;  4E7S A;  2XQ6 A;  2K5B B;  4GKK T;  4FJO A;  4ILA A;  3PUA A;  3H37 A;  1JNR A;  4ZS2 A;  3BK9 A;  3RRW A;  3JAF A;  1MMN A;  3ANW A;  3PU3 A;  4GK5 E;  3KV4 A;  3CX6 B;  3CVR A;  2XQ3 A;  1XZY A;  4P1N A;  4EGW A;  5EK2 A;  2CE7 A;  3TLS A;  4H9P C;  2BKP A;  4PK6 A;  3ZMT B;  5M4Y A;  4JI8 T;  2LSG A;  3IBP A;  4P09 A;  5L3E B;  1KEY A;  5AQL B;  3KDS E;  1T7S A;  2BG9 B;  1N36 T;  2D0U A;  3L09 A;  3FXE B;  1XMQ T;  4HGA A;  3AE6 A;  2WMN A;  2ES0 A;  4QX8 B;  4NIQ A;  2YDS A;  4CI1 B;  4YTM A;  2NW8 A;  3D0T A;  2J1D G;  3MZK B;  2H89 A;  1D1C A;  1HF8 A;  4WNK A;  4YJ3 E;  4QH1 A;  4JV5 T;  3Q2M A;  1M62 A;  3IA3 A;  4YLH A;  2LOP A;  1I6Z A;  2CLY C;  1WYB A;  5FXW A;  3OYZ A;  5HXS A;  2NW7 A;  4TX5 A;  1IBM T;  4CXW A;  5LJM A;  2FUP A;  4OX9 T;  3B57 A;  2XQY A;  2W63 A;  2A72 A;  2FJD A;  4QH5 A;  3RQU A;  1KK7 A;  2XTL A;  4DR7 T;  2UXN B;  4WW0 A;  1XNQ T;  1MMG A;  4HFI A;  1S94 A;  3CWZ B;  2ODV A;  1MND A;  2ODU A;  5LHG B;  3R84 B;  4EXT A;  3GN5 B;  3KV6 A;  3CKD A;  2VAS A;  3AA7 B;  3VU7 H;  3S4U A;  2XQ4 A;  3L8R A;  4CN1 A;  1MMD A;  3FZF B;  4IL4 A;  4EIW A;  3I9W A;  3HKE E;  2KT9 A;  4BAY B;  3EI0 A;  2CRB A;  4HFE A;  3RGL A;  3P50 A;  1FJG T;  2V8S V;  4ILC A;  3SOL A;  4EYY R;  3HA4 A;  4CXX A;  2Q9Q A;  4EAH A;  1I94 T;  4HTE A;  2Y48 B;  3DTO A;  1HX1 B;  3PJA J;  4QX7 B;  2E5V A;  4IL9 A;  4ANJ A;  1LVK A;  2EHO B;  4QWN B;  1OWA A;  4DV4 T;  4Z91 A;  4U31 A;  3ONJ A;  3AXJ A;  1QLB A;  3HKD E;  2V7L A;  2VUR A;  3M65 A;  3CQC B;  4YSZ A;  4X5T A;  5HEJ A;  4TUY E;  2K9A A;  2VL0 A;  2W0G A;  2JQH A;  4FI5 A;  2H3R A;  3SS1 A;  3K3O A;  2YDR A;  2WDR A;  2WDQ A;  1X9B A;  2XQ5 A;  2X9W A;  2LHN A;  2CBJ A;  3AA6 B;  3PUR A;  2R6G F;  2CXD A;  5JH7 E;  2LSY A;  3CQX C;  2MOZ A;  4WBO A;  5LHI B;  3VKH A;  3F31 A;  4H9Q C;  2QRX A;  2W2U A;  2X68 A;  5FY0 A;  4DUZ T;  1KNZ A;  4JI2 T;  3UUL A;  3UU6 A;  4DV7 T;  2NOX A;  1FMV A;  5FP3 A;  2CCQ A;  2VKD A;  5IUX A;  4DR3 T;  5AQK B;  4NUV A;  2UXC T;  2B1E A;  4U3C A;  3UU8 A;  2H88 A;  2KMF A;  1N34 T;  4H9N C;  1UUR A;  4TZ4 C;  4WZX A;  3IF8 B;  1KF6 A;  3TLW A;  4AQF C;  3M3Z B;  5FNV E;  3GMI A;  4IE6 A;  5IYZ E;  2XAG B;  3JAD A;  4I43 B;  1YW0 A;  2V7K A;  5JQG E;  3ESL A;  4LF7 T;  4CQI A;  3HL6 A;  4P0A A;  2X9H A;  2D2S A;  4DV0 T;  3KVB A;  4DV2 T;  1UK5 A;  2DHR A;  3TLT A;  2DNX A;  5ABE A;  2FBW A;  2V5D A;  2VWA A;  3VRA A;  1D0Z A;  3RYC E;  2V7J A;  4Z90 A;  2C5I T;  1U4Q A;  5DQW A;  3LBX B;  3N2O A;  1NAF A;  2VKH A;  3C4X A;  4EV6 A;  1WR0 A;  4K0K T;  1B7T A;  2UXX B;  2LSJ A;  3QOF A;  3RPU A;  2K24 A;  3RF1 A;  5JTG A;  3JAE A;  3ZC1 A;  2X66 A;  5DAB A;  3K3Q C;  1OED B;  4UIG A;  3N9L A;  5FKY A;  2LKG A;  2X9Y A;  4Z8X A;  1V9D A;  5FXZ A;  3ZJ1 A;  2LSK A;  2XQ9 A;  2CPT A;  3OVU A;  3SFD A;  1W09 A;  5JRC B;  2CXF A;  4AKH A;  4O4I E;  3MXZ A;  2KZ7 B;  1MIY A;  5HXH A;  4JI4 T;  2KND A;  2PG8 A;  2CA5 A;  3H3M A;  5FYM A;  2BG9 A;  1MMA A;  2YOE A;  3VRB A;  3UU3 A;  5JR9 C;  2RA1 A;  2NTY A;  3RI5 A;  5ETW A;  2WMO A;  4ZI3 D;  3N9Q A;  4DR4 T;  1ZOY A;  5KX5 E;  4A5X A;  3RYF E;  4DBQ A;  2YIN A;  1LKX A;  5L3D B;  5L3B B;  3QC9 A;  2IC6 A;  4O2A E;  1HFA A;  3T1Y T;  2XQ7 A;  4LMK A;  3KV5 A;  4EYU A;  4B3T T;  4IE5 A;  1WRD A;  1O3X A;  5AQN B;  2E9X D;  4HFH A;  2JRK A;  2VK9 A;  3CX7 B;  4IE4 A;  1YXR A;  4IDQ A;  1W9R A;  2BG9 E;  2L9Q A;  4JI1 T;  4JEU B;  5LMN T;  3JC6 D;  4YHJ A;  2VL8 A;  2UXD T;  5L4E A;  2XUE A;  4ZI3 C;  1HG5 A;  2DCF A;  4ZI2 D;  2A2F X;  3NWI A;  2CLY B;  2G0U A;  3GN5 A;  2LJL A;  2N2N A;  4QKN A;  2PBI A;  2F4V T;  4LF5 T;  4PJJ A;  1KNR A;  2VB6 A;  3ETV A;  2AXD S;  1MNE A;  4I4T E;  3V5U A;  4A98 A;  5LG3 A;  3PUS A;  5L3G B;  4ILU A;  1R8I A;  2E9X C;  2V5C A;  3PV0 F;  2BS3 A;  2L8K A;  4O4H E;  2UUC T;  2J62 A;  4DV1 T;  2JQQ A;  3PDY A;  5FL0 A;  2WBL A;  5AQR B;  1XDO A;  4XZC A;  4IGU A;  3WAK A;  4YXD A;  3GA8 A;  2BVL A;  5J2T E;  1FEW A;  4IE7 A;  2XM1 A;  4BJN A;  3AE9 A;  1NEN A;  2WZH A;  3E08 A;  3O1H A;  3LSV A;  3QK6 A;  1N32 T;  4ZI2 C;  2EHO A;  2LRK A;  3CPZ A;  3PE0 A;  4H63 V;  3CK6 A;  5DQV A;  4NXM T;  2P9B A;  3TKL B;  3P4Q A;  1J5E T;  5JRE A;  3HR0 A;  2PFV A;  4F8H A;  3UQ4 A;  1KFY A;  3EAB A;  4O4L E;  4I50 E;  2IML A;  3IHR A;  3QUJ A;  4AIU A;  5LCY A;  4YY3 T;  1HS7 A;  2WWU A;  3OKQ A;  1HR0 T;  1BR0 A;  4DUY T;  2MPK A;  4GKJ T;  3L3P A;  3ETU A;  2KXP B;  3EAM A;  5AQJ B;  4BJM A;  1HX8 A;  5HEH A;  5HCM A;  1IZN B;  2J47 A;  2KWH A;  5L2L A;  3RYH E;  3UFE A;  2JMK A;  3W15 B;  4U72 A;  5ABF B;  5J0Z A;  2WU2 A;  3CX8 B;  3AEF A;  4DID B;  4L5G A;  4UVC B;  4KUM B;  2PTF A;  1IAP A;  2VVN A;  2YKS A;  3P4S A;  2M6I A;  2LM9 A;  3NKZ A;  5FL1 A;  3NZP A;  3ZCJ A;  2IAK A;  2IDO B;  3OYX A;  4ADZ A;  1T72 A;  4E7Z A;  2QGS A;  2BBH A;  3C51 A;  3O1J A;  2WQY A;  1IBK T;  4CN6 A;  4ZS3 A;  3CIR A;  3AE8 A;  5HXC A;  1ZKE A;  2M67 A;  5L47 A;  4DV5 T;  3U78 A;  1XNR T;  4WYV A;  5HEG A;  4IIJ E;  2CHO A;  4X1I E;  2DLR A;  3I0Q A;  2CBI A;  4B3M T;  3K1S A;  2DWG A;  3AB3 B;  3LBX A;  2CHN A;  4B6X A;  3RYI E;  2W4X A;  3RLF F;  3LK2 B;  5AQQ B;  5LHH B;  3UT5 E;  2BKO A;  4OHF A;  4YHH T;  3DP7 A;  3TLU A;  2VVS A;  2WDV A;  4TN7 B;  5GON E;  1D1A A;  4PJM A;  3AA0 B;  3ONL C;  3ZLI A;  5AQT B;  5HCJ A;  4LFB T;  4C91 A;  5HAX A;  2V6X A;  2IC9 A;  5CJ5 A;  4X66 T;  4C90 A;  3K8P C;  3HKC E;  4YJ2 E;  2HN1 A;  3BQL A;  4J2C A;  4KBM B;  4G63 A;  1OED E;  4X20 E;  3LDQ B;  4KHZ F;  4LF6 T;  4ISS A;  3ZT7 A;  1W0B A;  4QXC B;  3ZT5 A;  3RKO A;  1Y01 A;  1VCT A;  2X0L B;  5BR8 T;  1DU2 A;  3PUX F;  5L3C B;  5AQF B;  4NXN T;  3ZYK A;  5JR9 B;  5C8Y E;  3KIN B;  2XHE B;  3AE1 A;  5DJQ C;  4PK4 A;  2HHH T;  5L4H A;  3PUV F;  1E7P A;  3RH3 A;  5FXX A;  5KDM C;  4DO0 A;  3ZJ2 A;  1L0V A;  1S35 A;  4TNW A;  2ZM2 A;  3T1H T;  3CML A;  4GYR A;  4AKL A;  5F3J A;  2CWO A;  2KWI B;  2WS3 A;  3B13 A;  4B3S T;  4KP3 C;  2HPJ A;  4LF4 T;  2V6Y A;  3I9Y A;  3NBX X;  2CM0 A;  2W62 A;  3AE3 A;  2H7O A;  2ACZ A;  2OV9 A;  1D0Y A;  1YKH B;  3EUH A;  4UF0 B;  3NZQ A;  3Q5E A;  2CMR A;  1Z8U A;  4GYS A;  4UEL A;  2K48 A;  5F8P A;  3FZM B;  4LF9 T;  2JJ9 A;  1SA0 E;  2FJB A;  1YQ4 A;  5AQO B;  2E9X B;  1FMW A;  2LM2 A;  2C0S A;  3KBT A;  3EDV A;  2MAW A;  2XAQ B;  2YEV C;  4X65 T;  5CB4 E;  2W67 A;  2BBJ A;  3KFW X;  2V26 A;  2WWV A;  3X1D A;  4H63 H;  1HG2 A;  2Y8D A;  2DI4 A;  3K3N A;  1ZV4 X;  4EOZ B;  4JYA T;  3MAC A;  4XBF B;  2NW9 A;  4TV8 E;  4HEA A;  2HPL A;  1LRZ A;  3AE4 A;  3QNU A;  4IT4 A;  2LT3 A;  4NUU A;  2XPK A;  5J2U E;  4O8S A;  4DVD A;  4MLK A;  4V1A v;  2A3D A;  2WAU A;  4IDO A;  3R6N A;  1IJ5 A;  4UXN B;  2D5U A;  5LYJ E;  4KHP T;  4IDN A;  1Z0P A;  2X0H A;  1XMO T;  3SFE A;  4LF8 T;  2DWK A;  3NRX A;  3LK4 2;  4G2A A;  5ABF A;  4U2Z A;  5JDM A;  4JI5 T;  3RHW A;  1U5P A;  1YKE B;  5H6R B;  2LHR A;  3ZPO A;  2BVM A;  4QXH B;  2B76 A;  1VOM A;  4HWD A;  2D0T A;  1HTJ F;  4U74 A;  4ZOL E;  2Q9Q D;  2NR4 A;  3UUB A;  2ACX A;  3O4X E;  3KV9 A;  2BDE A;  4PK5 A;  3UUN A;  4DR2 T;  1M7K A;  2C5J A;  1XDP A;  4GK0 E;  3OPC A;  5E0O A; 
#chains in the Genus database with same CATH homology
 3J9X 1;  3M65 A;  3OJA A;  3CQC B;  3RYH E;  1IJ6 A;  3UFE A;  2PJQ A;  2JMK A;  3FB2 A;  3ZMS B;  3RX6 A;  3BQK A;  4TUY E;  2K9A A;  2W0G A;  4FI5 A;  2SPC A;  2H3R A;  3W15 B;  3SS1 A;  4U72 A;  3K3O A;  3FXD B;  4A56 A;  3AVS A;  4AKG A;  4AQF A;  3CX8 B;  3PTR B;  5HXR A;  2XAH B;  4L5G A;  4CXY A;  2CXL A;  4UVC B;  2X9W A;  4KUM B;  2LHN A;  3Q9D A;  3F57 A;  3LK3 B;  5JDL A;  3AA6 B;  5CA0 E;  1LVF A;  4P0B A;  4OYK A;  3H3A A;  1EZ3 A;  3PUR A;  4DMV A;  1IAP A;  2CXD A;  5JH7 E;  2Q9Q B;  2LSY A;  3CQX C;  4F6R C;  4DMW A;  4DBR A;  2MOZ A;  4WBO A;  2LM9 A;  5LHI B;  2I59 A;  2JMH A;  2W61 A;  1E1H B;  3VKH A;  3F31 A;  1BR1 A;  1AJ3 A;  3NZP A;  2JPF A;  2NP9 A;  4H9Q C;  2Q9Q C;  2X68 A;  3ZCJ A;  3ZMZ B;  2IAK A;  5JDN A;  3N2K E;  3OYX A;  4UEM A;  5E0O A;  5FY0 A;  1ZEE A;  4ADZ A;  4E7Z A;  1KNZ A;  4AXP A;  5JVD E;  5LGN B;  2QGS A;  3IEE A;  3UUL A;  3C51 A;  2NOX A;  1FMV A;  5FP3 A;  5LJN A;  2CCQ A;  4I55 E;  3O1J A;  2VKD A;  3C98 B;  3NRY A;  2X67 A;  3PU8 A;  4UVA B;  4ZS3 A;  1WYC A;  5H6Q B;  5HXC A;  1ZKE A;  2M67 A;  4NUV A;  2B1E A;  2E8I A;  1G8X A;  4ASK A;  3I1A A;  2WSS V;  3U3I A;  3BQI A;  3FBZ A;  3U78 A;  4H9R C;  4KMC A;  2GK9 A;  2KMF A;  1MIW A;  2XAJ B;  4IIJ E;  4QXB B;  2KLQ A;  4H9N C;  4MHC A;  4AKI A;  3N9N A;  4X1I E;  2DLR A;  5JDF A;  3I0Q A;  4TZ4 C;  3ONX A;  3IF8 B;  1CUN A;  4AQF C;  4HFV A;  5FNV E;  3GMI A;  4DND A;  4L0R A;  2DWG A;  3AB3 B;  3LBX A;  4IE6 A;  5IYZ E;  4B6X A;  2XAG B;  4I43 B;  4MBQ A;  1UX4 A;  3RYI E;  2ZMA A;  4O2B E;  4UVB B;  5BMV E;  1YW0 A;  2V7M A;  3C4W A;  2LOS A;  4UV8 B;  2LE8 A;  2V7K A;  4IE0 A;  4EZ4 A;  3LJC A;  3LK2 B;  2MBG A;  5EK4 A;  5LHH B;  3SWH A;  4N78 D;  3UT5 E;  5JQG E;  3AA1 B;  4OHF A;  3ESL A;  2WM9 A;  4AKR B;  3DP7 A;  3N2G E;  3FHN A;  2NTX A;  3HL6 A;  4JEH B;  4CQI A;  4TN7 B;  4PJL A;  5GON E;  4HN9 A;  1D1A A;  4P0A A;  3O9X A;  2X9H A;  1X79 A;  2D2S A;  1MIV A;  4PJM A;  3KBU A;  1VRB A;  2LEH A;  3KVB A;  3AA0 B;  4PW8 A;  4WBN E;  5EZY E;  5JDQ A;  3N9O A;  2DHR A;  3E22 E;  5JDG A;  2DNX A;  4X1Y E;  4EZH A;  1BR4 A;  3ZLI A;  3LG7 A;  2MYS A;  5LXT E;  3P8C D;  3A5X A;  2VWA A;  1D1B A;  3Q5X A;  4C91 A;  4GOU A;  1D0Z A;  2ZM0 A;  5FY1 A;  2V7J A;  3E0Z A;  5HAX A;  3RYC E;  3EVY A;  2C5I T;  2BZB A;  3WAJ A;  2IC9 A;  1U4Q A;  2XAS B;  5LGU B;  2YU1 A;  1UCU A;  5DQW A;  2W00 A;  2XAF B;  3LBX B;  3PUG A;  5JR9 A;  2HH7 A;  4QHO A;  4C90 A;  3N2O A;  2MTQ A;  1NAF A;  3N9M A;  3K8P C;  3ZEF B;  4ZI2 C;  2VKH A;  2Y6X A;  4ERR A;  3HKC E;  1BR2 A;  3AAA B;  3ZYL A;  3C4X A;  4YJ2 E;  3F2E A;  5J1G A;  1B7T A;  2UXX B;  2LSJ A;  3ZYM A;  4X1K E;  3RPU A;  2K24 A;  3BQL A;  1WLX A;  4J2C A;  4UV9 B;  1OXZ A;  3AAE B;  4KBM B;  4G63 A;  3ZC1 A;  2X66 A;  5DAB A;  3K3Q C;  4UIG A;  3N9L A;  4X20 E;  3UTK A;  3ZMU B;  3AAI A;  2X9Y A;  4H9S E;  4AQG A;  2L3L A;  4Z8X A;  1V9D A;  3RC8 A;  3O1I A;  5FXZ A;  2X51 A;  2ZLY A;  3ZJ1 A;  2LSK A;  4PAG A;  3DJB A;  4ISS A;  2YK0 A;  2N9D A;  3MK7 C;  3HKB E;  3VKG A;  1US7 B;  2IW5 B;  3EDU A;  4QXC B;  1YD8 G;  2QA7 A;  2C5K T;  2CEA A;  4IST A;  5JRC B;  2KIN B;  2CXF A;  3I0O A;  4AKH A;  5HYA A;  3RKO A;  5HWY A;  2X0L B;  3LFM A;  4O4I E;  3MXZ A;  1G73 A;  2KZ7 B;  3V5S A;  3VHL A;  3JC6 C;  5L3C B;  3ZN0 B;  1MIY A;  5HXH A;  4BA9 A;  3ZYK A;  3SRZ A;  5JR9 B;  2Z6E A;  2KND A;  4H9O C;  5KMG P;  2PG8 A;  5C8Y E;  3KIN B;  2CA5 A;  2VKJ A;  5FYM A;  2XHE B;  5TAO A;  3ZMV B;  1MMA A;  5DJQ C;  3ZCI A;  4MAL A;  4PK4 A;  1NWM X;  4O4J E;  2V7I A;  5JR9 C;  2RA1 A;  4E7S A;  2K5B B;  4FJO A;  2NTY A;  3PUA A;  3RH3 A;  1HCI A;  4UF0 A;  3H37 A;  5FXX A;  5ETW A;  2WMO A;  4ZS2 A;  3BK9 A;  3RRW A;  4ZI3 D;  3N9Q A;  3KVA A;  1MMN A;  3ANW A;  3PU3 A;  4GK5 E;  5KX5 E;  3KV4 A;  5L3F B;  5KDM C;  3CX6 B;  3CVR A;  3C50 A;  3RYF E;  4DO0 A;  4DBQ A;  3ZJ2 A;  2YIN A;  1LKX A;  5L3D B;  5L3B B;  3QC9 A;  5EK2 A;  5LA6 E;  1S35 A;  2CE7 A;  4PJN A;  2IC6 A;  4K0U A;  4O2A E;  1HFA A;  4PFP A;  2ZM2 A;  3RC3 A;  4AI6 A;  2ZM8 A;  3CML A;  4GYR A;  4AKL A;  4L9I A;  4H9P C;  5F3J A;  3KV5 A;  2CWO A;  3ZC0 A;  2KWI B;  3T8O A;  4EYU A;  4PK6 A;  3ZMT B;  3B13 A;  2E9X A;  5M4Y A;  4IE5 A;  1WRD A;  1O3X A;  1WR6 A;  4XAX B;  3MKD A;  2LSG A;  3IBP A;  5JDH A;  4P09 A;  4KP3 C;  1QUU A;  2HPJ A;  2E9X D;  3Q5W A;  5L3E B;  2JRK A;  2VK9 A;  3I9Y A;  3CX7 B;  4IE4 A;  3KDS E;  2V1D B;  4PFO A;  3NBX X;  2CM0 A;  2L9Q A;  2W62 A;  3FBL A;  4JEU B;  5LBQ B;  5JRC A;  2D0U A;  2H7O A;  1T98 A;  3L09 A;  3FXE B;  3JC6 D;  4YHJ A;  1D0Y A;  5LG4 A;  2VL8 A;  5LNK A;  1YKH B;  3EUH A;  4HGA A;  4UF0 B;  3NZQ A;  3J7Y q;  2CMR A;  2WMN A;  2ES0 A;  3ANW B;  4QX8 B;  4GYS A;  2XUE A;  4UEL A;  4ZI3 C;  1HG5 A;  2K48 A;  2DCF A;  5HXE A;  4ZI2 D;  5F8P A;  5EK3 A;  2A2F X;  4CI1 B;  3MJX A;  2CLY B;  2NWB A;  2NW8 A;  3D0T A;  3OBV E;  4GIW A;  2JJ9 A;  2G0U A;  3GN5 A;  2J1D G;  2LJL A;  2N2N A;  4IDZ A;  3MZK B;  1SA0 E;  1D1C A;  1HF8 A;  4QKN A;  4WNK A;  5LP6 E;  4YJ3 E;  2PBI A;  3Q2M A;  4PJJ A;  4ZI7 E;  4YLH A;  2E9X B;  1FMW A;  2LOP A;  2C0S A;  2VB6 A;  3ETV A;  3N5L A;  2CLY C;  1WYB A;  4HE8 A;  4MFR A;  3ZN1 B;  3KBT A;  1MNE A;  3EDV A;  2XAQ B;  2YU2 A;  4I4T E;  3V5U A;  3N9P A;  4OFZ A;  5FXW A;  5CB4 E;  3PUS A;  2CWY A;  3KFW X;  3OYZ A;  5HXS A;  4M1P A;  2V26 A;  4ILU A;  2E9X C;  5L3G B;  4IHJ E;  2NW7 A;  2N1G A;  4TX5 A;  4H63 H;  4CXW A;  2L8K A;  4O4H E;  1HG2 A;  2Y8D A;  5LJM A;  2DI4 A;  3HI2 A;  2JQQ A;  3K3N A;  1ZV4 X;  3PDY A;  2WBL A;  3B57 A;  5IHY A;  4EOZ B;  2XQY A;  4XBF B;  3MAC A;  2W63 A;  2NW9 A;  2A72 A;  4TV8 E;  4HEA A;  5FY7 A;  2HPL A;  4XZC A;  4IGU A;  3WAK A;  3GA8 A;  1LRZ A;  2BVL A;  1D0X A;  4CZZ B;  5CA1 E;  1FIO A;  5J2T E;  1FEW A;  4IE7 A;  4BJN A;  5ADX L;  1KK7 A;  2XTL A;  2UXN B;  4WW0 A;  2LT3 A;  2VKO A;  1MMG A;  2LSI A;  3E08 A;  3O1H A;  1S94 A;  3CWZ B;  4NUU A;  1SHZ C;  2ODV A;  1MND A;  2H7V C;  2ODU A;  4YFS A;  5LHG B;  5J2U E;  3QK6 A;  3R84 B;  4O8S A;  4DVD A;  4EXT A;  3GN5 B;  2EHO A;  4MLK A;  4V1A v;  3CPZ A;  3PE0 A;  3KV6 A;  3C64 A;  2A3D A;  4H63 V;  4ZHQ E;  3CKD A;  2WAU A;  5DQV A;  3R6N A;  1IJ5 A;  2VAS A;  2P9B A;  2X9X A;  3AA7 B;  3GWH A;  4UXN B;  3TKL B;  2D5U A;  5LYJ E;  2EHO D;  4JLE A;  3VU7 H;  3S4U A;  5JRE A;  3PUQ A;  1Z0P A;  3HR0 A;  2PFV A;  4HKA A;  1Y64 B;  4EB6 E;  1UX5 A;  4O4L E;  4I50 E;  5LOV E;  4PNI A;  1MMD A;  4EIW A;  3IHR A;  4OK0 A;  1QSD A;  3QUJ A;  2OA5 A;  3I9W A;  1H7C A;  3RRC A;  2DWK A;  3HKE E;  5FXV A;  3NRX A;  3P7I A;  2KT9 A;  3LK4 2;  3UUX B;  2RP4 A;  4G2A A;  4BAY B;  5HWX A;  5JDM A;  5FMN A;  1U5P A;  5LCY A;  3AVR A;  1YKE B;  5H6R B;  3SOL A;  4EYY R;  1HS7 A;  2LHR A;  2WWU A;  3OKQ A;  1BR0 A;  5LBM A;  3C4Z A;  3HA4 A;  3ZPO A;  4CXX A;  2BVM A;  2Q9Q A;  4EAH A;  4QXH B;  5AFU L;  3L3P A;  1VOM A;  3ETU A;  4HTE A;  5LGT B;  2Y48 B;  3DTO A;  2KXP B;  4QX7 B;  2D0T A;  1HTJ F;  4U74 A;  4ZOL E;  3WI3 A;  2Q9Q D;  3CQG B;  4JUY A;  4BJM A;  4ANJ A;  1LVK A;  2EHO B;  1HX8 A;  2ACX A;  3O4X E;  3KV9 A;  4QWN B;  2BDE A;  4PK5 A;  4CI3 B;  1OWA A;  4CI2 B;  3UUN A;  5A1L A;  3UUM A;  4TV9 E;  2C5J A;  3MA9 A;  1ZHC A;  4GK0 E;  1IZN B;  4OYJ A;  2EHO C;  2KWH A;  3HKD E;  2YEV C;  2V7L A;  5L2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...