4A56A

Crystal structure of the type 2 secretion system pilotin from klebsiella oxytoca
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
b'VSGQAQLEQLASVAAGARYLKNKCNRSDLPADEAINRAAINVGKKRGWANIDANLLSQRSAQLYQQLQQDSTPEATKCSQFNRQLAPFIDSLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PULLULANASE SECRETION PROTEIN PULS
molecule tags Protein transport
source organism Klebsiella oxytoca
publication title Pilotin-Secretin Recognition in the Type II Secretion System of Klebsiella Oxytoca.
pubmed doi rcsb
total genus 37
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2011-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09691 T2SS_PulS_OutS Type II secretion system pilotin lipoprotein (PulS_OutS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1630 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4a56A00
4A56A 4K0UA 3SOLA 3UTKA
chains in the Genus database with same CATH superfamily
5LXTE 2H89A 4IDPA 2LM2A 1WRDA 2ACZA 3NRYA 5J0ZA 2KSRA 4A56A 3RPUA 2CE7A 2PTFA 3AE2A 3NZPA 2FJAA 3MK7C 4IE6A 2BZBA 2NWBA 3PDYA 3HKEE 4OK0A 3RRWA 3Q5EA 3BQKA 1J5WA 2D0UA 2HH7A 1VCSA 2BS4A 3GA8A 3KDSE 5JDHA 4O4LE 4LF9T 1BR0A 5DABA 2ODVA 5ABFB 3SS1A 4TZ4C 4DUYT 3AEFA 3ETUA 2KINB 5AQTB 3ZT7A 2BG9A 4CI2B 3RF1A 4CI3B 3GN5B 4TN7B 4DVDA 4AKIA 3RIFA 2E5LT 1FJGT 2ES0A 3FZLB 4UVAB 4IDZA 3RX6A 5LP6E 5GONE 2CLYB 4H9PC 1AJ3A 1XDOA 1MMNA 4IL4A 1HG2A 1MIYA 2NP9A 2W61A 2Y6XA 5IWAT 2KWHA 2VVSA 2IC6A 2WDRA 3ZCIA 1W9RA 5F5WA 4CZZB 3I0OA 4K0KT 3CKDA 5AQGB 4AKRB 5JDNA 2A9UA 2KT9A 4DR5T 4ZEYA 4ZI7E 3GMIA 3PU8A 4HWDA 4BJNA 4J2CA 3P4QA 1IZNB 4U7YA 2XQ6A 2JPFA 3O4XE 1UX5A 5HCJA 5AQUB 4CI1B 4HE8A 3AXJB 5IUXA 1W09A 5JR9A 2PBIA 4YY3T 4DIDB 3SFDA 3HKDE 5AQMB 3RRCA 4DMVA 4DR7T 5FL1A 2Z6EA 4GYSA 5LMUT 1BR2A 3AAEB 4TNWA 4DV3T 1HFAA 4JI1T 2PG8A 1MNEA 3VU7H 3CX6B 3E0ZA 3U78A 3ZLIA 4DBRA 2WS3A 4P1NA 1G73A 4XBFB 2X68A 1WR6A 4H9SE 5AQPB 4ZI2D 4Z8XA 1XNRT 4AXPA 4LFBT 3C51A 4IDOA 2BKOA 4QWNB 2IUBA 4YSYA 2X9XA 5HXHA 4UV9B 4EOZB 2MOZA 4GKJT 2YN6A 4WBOA 3R84B 4DR6T 2JQ9A 5FVLA 3EDUA 4UXNB 3UUMA 2N1GA 1N33T 2CHNA 1QUUA 1HF8A 3FBLA 2B1EA 1VCTA 2PFVA 1D1BA 3A5XA 3KV4A 5EK4A 3RHWA 4DMWA 4X20E 2XQAA 4KI0F 3AE9A 3LSVA 3UULA 4H9RC 3PTRB 3D0TA 4B6XA 5JDFA 4LF5T 5DQVA 3P7IA 3P8CD 4PK5A 1KEYA 4U2YA 2R6GF 4U74A 1T72A 2CA5A 2BG9E 4JBWF 4AQGA 3ZMZB 5AQNB 4X1YE 5HEJA 1I94T 4F6RC 1U4QA 3AE4A 5C3JA 4L5GA 3EVYA 2IIUA 3K3QC 3ZYKA 5L3DB 2XQ5A 2YU1A 3CMLA 4HFDA 5JDGA 4UVCB 5CGMA 4PJJA 5JQGE 5AQRB 4O4IE 3F31A 3GWHA 1XWMA 1Y64B 3AECA 3CX7B 1FMVA 5H6QB 4ANJA 3MACA 2NTYA 2OA5A 2V26A 2VL8A 1CUNA 3J7Yq 1BR1A 1X9BA 2X9YA 4HFBA 3R6NA 3UFEA 4UEMA 2WU5A 4EV6A 5J2UE 1FEWA 2W0GA 4DV4T 3N9LA 2N2NA 4JYAT 5EK2A 2I0MA 4GK0E 4JV5T 1KNPA 2XSAA 3LBXB 4DO0A 3CQCB 4PNIA 4YTMA 1Y01A 2AXDS 3AA6B 4HFIA 3PUVF 2BG9B 4H9QC 4HTEA 4I0UA 1OXZA 2YDSA 4QH5A 4PK4A 4U33A 1J1JA 2LHRA 4EGWA 1S35A 3ZYLA 3QUJA 2XAFB 2JQQA 3L3PA 2LSYA 4JI5T 4E7SA 1IBLT 4DNDA 1LKXA 4O4JE 2VWAA 2NTXA 2XQ4A 4I43B 1S94A 3P50A 4I55E 2M6IA 3X1DA 4B3MT 2PJQA 4EXTA 1WCRA 2WMOA 3PU3A 3QB5K 3VR8A 1ZV4X 3PUSA 4PK6A 2Q9QC 5AFUL 2WAUA 3C50A 5LHHB 2ZM0A 3LG7A 3VRBA 4NUUA 2J47A 3ONXA 1WLXA 4O4HE 5F3JA 4UV8B 2C5IT 2L3LA 3JAFA 3VHLA 4OFZA 5AQIB 4IIJE 2YOEA 3N2KE 4PJLA 3UU4A 4ZOLE 3UUXB 4WYVA 3PUWF 3I9WA 5ADXL 4JI3T 3MJXA 1R8IA 2XUEA 5JDMA 4GK5E 3ZJ2A 2X9WA 2CPTA 2HHHT 4JI7T 2CM0A 3AEAA 4H9NC 4U72A 5L4EA 4UR9A 2XQ9A 5KXJA 2IW5B 1XZYA 4UF0A 4LMJA 2I6HA 3Q2MA 2X67A 2K9AA 4ZS2A 5KX5E 4JI0T 2IMLA 4OYKA 3RLFF 1N36T 2BVMA 2LSKA 5TAOA 5HYAA 2WDQA 4IREA 4AKLA 3UUNA 3EI0A 5HEOA 4BAYB 5CA0E 5LHGB 4ISTA 3KBUA 4JI2T 4XAXB 4ZI2C 4DV6T 2L8KA 2LLYA 3FB2A 4DV0T 4O2BE 5JRCB 3VKHA 1BR4A 2H3RA 2UXCT 3HL6A 3RGLA 1IAPA 2YU2A 2LOPA 2FJDA 2XZEA 3BQLA 3V5UA 4EAHA 5HEUA 3AEBA 4BA9A 1CHUA 1E2AA 1KF6A 2C5JA 3ZN0B 3IHRA 3L8RA 4WNKA 5CJ5A 5LHIB 2LSJA 1DU2A 1OEDC 3E22E 3PUZF 4ZXLA 4UVBB 4ILCA 3W15B 3FZKB 3OJAA 4QXCB 1SA0E 4ADZA 4HWFA 4YSXA 2WZHA 4JI8T 5ABGA 5JTGA 3PUAA 2C0SA 3I1AA 1HS7A 3RC8A 2CMRA 3AAAB 2CHOA 2OV9A 3IA3A 3TLWA 2CBJA 3AB3B 4HEAA 4YT0A 4DV7T 2LKGA 2XY8B 4A98A 1QLBA 3AVRA 4LFAT 2CBIA 3UU3A 3ONLC 2N9DA 3NKZA 5FYMA 1YXRA 2LT3A 5LB7B 1OEDE 4JLEA 5FVKA 1O3XA 3DP7A 3RKGA 3JCFA 1UURA 1H7CA 4HWCA 4XZCA 4AQFA 4CN6A 5L3GB 1LVFA 2DHRA 2HN1A 2NW7A 2RPAA 2XM2A 3C4ZA 4WW0A 5AQKB 5IHYA 2W00A 3PUQA 3RYHE 3ZSSA 3BK9A 4KX6A 5FXVA 4DBQA 5ABEA 3KV5A 2Y48B 1D0XA 1D1CA 4IDQA 2LSGA 2AE9A 2CLYC 3AVSA 2SPCA 3NRXA 4TNVA 5JR9C 4QXBB 3AE5A 4MFRA 1JNRA 3UU5A 2D5UA 4KUMB 4M1PA 3OVUA 1KFYA 5FL0A 4CXXA 1NAFA 3DTOA 4G63A 3ZPOA 1U5PA 2E8IA 2XQYA 3I0QA 4GIWA 4L0RA 4LF8T 2E5VA 2VB6A 1YKEB 3JAEA 2MYSA 4IE4A 2DI4A 3A7MA 3MA9A 3RIUC 2E9XA 4ZZCA 3FZFB 3K8PC 5J2TE 2XAQB 3MKDA 5FNVE 5AQJB 2IDOB 1HNZT 1WYBA 2D0TA 2YK0A 2W2UA 2YINA 3Q9DA 2QYWA 2V7LA 4KP3C 2IC9A 3CX8B 3K1SA 3KBTA 2G0UA 3V5SA 2DWKA 3EDVA 2XAHB 2A72A 3AEEA 3ZYMA 4I4TE 4UIGA 1T8BA 2JJ9A 3K3NA 4X62T 5LMNT 2V7JA 3EAMA 1XDPA 3ZCJA 3JC6D 1NWMX 4IHJE 2XM1A 4NPPA 3ZMVB 4AKGA 4N78D 3K3OA 3VKGA 3EHZA 4V1Av 5LBMA 1HG5A 2M6BA 3AA0B 3TLVA 5JREA 5BR8T 3Q5XA 3S4UA 3N9QA 2VK9A 4K0UA 1I6ZA 4EYUA 4LF7T 3ZEFB 4LF6T 4CQIA 4HN9A 1QSDA 2M67A 4U3CA 4UF0B 3T1YT 3C98B 4CN1A 2UUBT 2ACXA 3IEEA 3OYZA 4GKKT 3ZKRA 2UXDT 3E08A 3CQXC 3H3MA 3UQ4A 1D0YA 4MLKA 5L3EB 2Q9QB 4QH1A 5LBQB 2NW9A 3O1IA 4DV5T 3PV0F 1XMQT 2DLRA 4HWIB 2KZ7B 3BQIA 3OBVE 2K5BB 3AEGA 3IBPA 1W0AA 4IL9A 2X0YA 3ANWA 3AA7B 3M3ZB 3RC3A 4YSZA 5HWXA 3SOLA 5JVDE 5JRCA 4EYYR 3FXEB 4PFPA 4JUYA 2JMHA 4AISA 4I50E 3FBZA 2K48A 2XQ8A 4TWFA 4QH4A 2UUAT 2ODUA 3ZC1A 1XMOT 2EHOB 4IDNA 1IJ6A 2VKOA 2X0HA 1YQ3A 4DR3T 4MALA 4LF4T 2VKDA 5IYZE 5FXXA 5HXRA 2UUCT 3Q5WA 5ABHA 3G06A 3F2EA 2JIWA 4QHOA 4AQFC 3QC9A 4NXNT 1ZHCA 3O1HA 4AQYT 1ZKEA 3RKOA 3ZJ1A 2BVLA 2JQHA 3TLUA 3CVRA 2UXNB 1YW0A 4EB6E 3RYFE 4AKHA 1N32T 3C4XA 2WY2A 3P4RA 2MTQA 2F4VT 3LFMA 5AQFB 4KBMB 2NOXA 2YKSA 1HX1B 3I9YA 4X5TA 4IGUA 2KXPB 2WSSV 2NR4A 3UUBA 3N5LA 4F8HA 1HR0T 2CWOA 2K3WA 5H6RB 1SUMB 2FJBA 4YHJA 2X51A 2ZM6T 4QX7B 3N2GE 2YDRA 1UK5A 3QOFA 4B3ST 4ZS3A 3JC6C 4U7IA 5L3CB 2LM9A 3CK6A 2V6YA 4UELA 5LGUB 2C5KT 4EIWA 5LJMA 1MIWA 4DR4T 1NENA 3N9MA 4NXMT 1E1HB 1OEDA 3RQUA 1WYCA 2OLTA 2XAJB 3IF8B 3PUXF 3A8YC 2NW8A 2BKPA 3B13A 3C64A 2CXFA 3SWHA 2RP4A 4Q25A 4FI5A 5LGTB 1IBMT 1FIOA 4H63H 2W67A 1UUSA 5L3FB 4ZI3D 2DCFA 3KV9A 1ZEEA 3ZSTA 4HWHA 4JI4T 2WDVA 3OYXA 4MBQA 2VVNA 5AQLB 2LEHA 2DL1A 2JQKA 2KWIB 3AAIA 4ILAA 5F8PA 5A1LA 2EHOD 2VURA 4KHZF 5M4YA 3RYIE 5JR9B 2UXBT 3P4WA 5ABFA 3DJBA 3L09A 5AQVB 4PW8A 2XHEB 2WQYA 4AIUA 3TKLB 4HKAA 4TX5A 5J1GA 3EABA 3TLSA 5L3BB 2VASA 3GN5A 3NZQA 1MMGA 1VOMA 3QNUA 3L39A 3QB5A 1YD8G 3AE6A 5C8YE 4G2AA 4LMKA 1UX4A 2WP9A 2JRKA 4KMCA 4X1IE 3UFGA 2HPJA 3CIRA 3LK2B 2QA7A 3VR9A 2UU9T 5JDQA 4OX9T 4KHPT 1IBKT 5LOVE 1MMDA 4ZHQE 5L47A 2VL0A 4IT4A 4ASKA 4ERRA 2BS2A 2BG9C 5FP3A 2VQFT 1T7SA 1LVKA 4Z91A 3VRAA 4O8SA 5L2LA 4X64T 1UCUA 2V7KA 2LSIA 4NIQA 1SHZC 3AA1B 4PFOA 5FKYA 3OKQA 5FY7A 4ILBA 4MHCA 2FUPA 3N9OA 3KVBA 1ZP0A 1HNWT 3LBXA 3HR0A 4OHFA 5HEHA 5DQWA 1XNQT 4JEHB 2BS3A 2CXLA 4PJMA 4QKNA 3HI2A 3QK6A 4YLHA 3ZT5A 2W63A 3AE7A 5HAXA 5LYJE 3UQ7A 2KNDA 4X66T 5LNKA 4IE0A 1D0ZA 2Y8DA 4H9OC 3N2OA 4YJ3E 4EEDA 5KDMC 3ESLA 2RA1A 4HFHA 2ZM2A 5ETWA 1YQ4A 2V7IA 4P0AA 5FXWA 5HEGA 3MZKB 4CXYA 2ZM8A 3RIUA 1SE7A 2BDEA 2E9XC 1VRBA 3CQGB 2UXXB 3MXZA 2K24A 1WR0A 3PJAA 2IHR1 4LMLA 4TUYE 3ZMTB 4COFA 3ZMUB 5KMGP 4YHHT 3KFWX 3NVOA 3UT5E 1V9DA 2KLQA 2CEAA 2QVAA 3PE0A 5L4HA 1L0VA 3RI5A 1LRZA 4LFCT 2LHNA 2J4GA 4YFSA 2WCAA 3ETVA 2HPLA 5LG4A 4DV1T 1MMAA 2WWUA 4H63V 4L9IA 3HKCE 5HXSA 3SFEA 1EZ3A 2WZIA 1UGOA 2H7VC 2XSBA 3JADA 3Q5DA 2VQET 1FMWA 2W66A 4JI6T 5FMNA 3TLTA 4A97A 4WZXA 2D9DA 3UU6A 3ZN1B 4WBNE 4QXHB 2J62A 2A2FX 3FZHB 1KNZA 1ZOYA 1OEDB 3ABVA 3LJCA 3NBXX 3UTKA 4BJMA 2VKJA 4DUZT 2P9BA 4IE5A 1JNZA 1YKHB 2LJLA 2LKHA 2GK9A 2V6YB 2WBLA 3O1JA 3LDQB 3PUYF 4U2ZA 5EK3A 5E0OA 2WWVA 4EZ4A 4TWDA 2XQ3A 1M62A 2QGSA 2V8SV 1KK7A 2LOSA 2X66A 2D2SA 2V5CA 2A3DA 3B57A 1M7KA 3FHNA 5CB4E 4NUVA 3U3IA 1HCIA 2MPKA 2CRBA 3EUHA 2E2AA 5AQSB 4C91A 2Q9QA 3O9XA 2MBGA 4FJOA 2WB5A 3CPZA 2WM9A 2LRKA 1E7PA 2XPKA 4ILUA 4TV9E 5C2TA 3OPCA 5CFBA 5LJNA 3KINB 4EZHA 4DR1T 1MNDA 2BBJA 3KVAA 4EEBA 4PJNA 1J5ET 3N9PA 2ZLYA 3H37A 4C90A 5AQQB 1T98A 4IE7A 3RQWA 3ONJA 4YJ2E 4AI6A 2L9QA 5HXEA 2CXDA 2ZMAA 1B7TA 2XAGB 4X1KE 3UU8A 1W0BA 2DWGA 3AE3A 3ZT6A 4CXWA 3WAJA 3P4SA 3PURA 2X9HA 2W4XA 4P0BA 3PUGA 2YDQA 4O2AE 4JEUB 4HGAA 4QX8B 2MAWA 5AQHB 5EZYE 5HXCA 4ZZBA 5JDLA 1N34T 1KNRA 2XQ7A 2Q9QD 4HFCA 5FY1A 2V7MA 3SRZA 4YTNA 2V1DB 2LE8A 3LK3B 4TWHA 2EHOA 2I59A 2V5DA 2IAKA 2X0LB 2YEVC 3PJAJ 2W62A 4X65T 3AEDA 3OTOT 1NEKA 1D1AA 2BKNA 5AQOB 2LRLA 1HNXT 2KMFA 1US7B 2V6XA 1Z0PA 2DNXA 2WU2A 1HX8A 2E9XB 2J1DG 1HTJF 3HA4A 4HFEA 4TV8E 5LA6E 5FY0A 4A5XA 1WFDA 4CN4A 3F57A 2H88A 3C4WA 1GQEA 3AE1A 2CWYA 3ANWB 3RH3A 4HFVA 3FZMB 2H7OA 3HKBE 3RYCE 4E7ZA 3WAKA 2BBHA 2E9XD 3NWIA 5CA1E 4GOUA 3CWZB 3LK42 4GYRA 5HWYA 4OYJA 2XJ7A 4YTPA 5LG3A 3T1HT 4ISSA 2VKHA 4P09A 5BMVE 5JH7E 3ZC0A 5FXZA 4YXDA 3FXDB 3KV6A 2XTLA 5LGNB 4B3RT 3RIAA 3J9X1 2FBWA 4PAGA 1OWAA 5HCMA 3B5MA 2QRXA 3H3AA 2B76A 3N9NA 2JMKA 1G8XA 2CCQA 3ZMSB 4B3TT 1X79A 1IJ5A 4ZI3C 1Z8UA 2FJEA 5DJQC 4Z90A 3WI3A 2XASB 3M65A 3T8OA 4U31A 3AXJA 2WMNA 3AE8A 4DV2T 1MIVA 2HN2A 2EHOC 4DR2T 3P4PA 5LCYA
chains in the Genus database with same CATH topology
5LXTE 1WRDA 3NRYA 4A56A 3RPUA 2CE7A 3NZPA 3MK7C 4IE6A 2BZBA 2NWBA 3PDYA 3HKEE 4OK0A 3RRWA 5JDHA 3BQKA 2D0UA 3VKGA 2HH7A 3GA8A 3KDSE 4O4LE 1BR0A 5DABA 2ODVA 3SS1A 4TZ4C 3ETUA 2KINB 4CI2B 4CI3B 3GN5B 4TN7B 4DVDA 4AKIA 2ES0A 4UVAB 4IDZA 3RX6A 5LP6E 5GONE 2CLYB 4H9PC 1AJ3A 1MMNA 1HG2A 1MIYA 2NP9A 2W61A 2Y6XA 2KWHA 2IC6A 3ZCIA 4CZZB 3I0OA 3CKDA 4AKRB 5JDNA 2KT9A 4ZI7E 3GMIA 3PU8A 4BJNA 4J2CA 1IZNB 2JPFA 3O4XE 1UX5A 4CI1B 4HE8A 5JR9A 2PBIA 3HKDE 3RRCA 4DMVA 2Z6EA 4GYSA 1BR2A 3AAEB 1HFAA 2PG8A 1MNEA 3VU7H 3CX6B 3E0ZA 3U78A 3ZLIA 4DBRA 1G73A 4XBFB 2X68A 1WR6A 4H9SE 4ZI2D 4Z8XA 4AXPA 3C51A 4QWNB 2X9XA 5HXHA 4UV9B 4EOZB 2MOZA 4WBOA 3R84B 3EDUA 4UXNB 2N1GA 3FBLA 1QUUA 1HF8A 2B1EA 2PFVA 1D1BA 3A5XA 3KV4A 5EK4A 4DMWA 4X20E 3UULA 4H9RC 3PTRB 3D0TA 4B6XA 5JDFA 5DQVA 3P7IA 3P8CD 4PK5A 4U74A 2CA5A 4AQGA 3ZMZB 4X1YE 1U4QA 4L5GA 3EVYA 3K3QC 3ZYKA 5L3DB 2YU1A 3CMLA 5JDGA 5JQGE 4UVCB 4PJJA 5H6QB 4O4IE 3F31A 3GWHA 4ANJA 1Y64B 3CX7B 1FMVA 3MACA 2NTYA 2OA5A 2V26A 2VL8A 1CUNA 3J7Yq 1BR1A 2X9YA 3R6NA 4UEMA 1FEWA 2W0GA 3N9LA 2N2NA 5EK2A 4GK0E 3LBXB 4DO0A 3CQCB 4PNIA 3AA6B 3RYCE 4HTEA 4H9QC 4PK4A 1OXZA 2LHRA 1S35A 3ZYLA 3QUJA 2XAFB 2JQQA 3L3PA 2LSYA 4E7SA 4DNDA 1LKXA 4O4JE 2VWAA 2NTXA 4I43B 1S94A 4I55E 2PJQA 4EXTA 2WMOA 3PU3A 1ZV4X 3PUSA 4PK6A 2Q9QC 5AFUL 2WAUA 3C50A 5LHHB 2ZM0A 3LG7A 4NUUA 3ONXA 1WLXA 4O4HE 5F3JA 4UV8B 2C5IT 2L3LA 3VHLA 4OFZA 4IIJE 3N2KE 4PJLA 5ADXL 4ZOLE 3UUXB 3I9WA 3MJXA 2XUEA 5JDMA 4GK5E 3ZJ2A 2X9WA 2CM0A 4U72A 4H9NC 2IW5B 4UF0A 3Q2MA 2X67A 2K9AA 4ZS2A 5KX5E 4OYKA 2BVMA 2LSKA 5TAOA 5HYAA 4AKLA 3UUNA 4BAYB 5LHGB 5CA0E 4ISTA 3KBUA 4XAXB 4ZI2C 2L8KA 3FB2A 4O2BE 5JRCB 3VKHA 1BR4A 2H3RA 3HL6A 1IAPA 2YU2A 2LOPA 3BQLA 4EAHA 3V5UA 4BA9A 5LHIB 2C5JA 3ZN0B 3IHRA 4WNKA 2LSJA 3E22E 4UVBB 3W15B 3OJAA 4QXCB 4ADZA 1SA0E 3PUAA 2C0SA 3I1AA 1HS7A 3RC8A 2CMRA 3AAAB 3AB3B 4HEAA 3AVRA 2N9DA 5FYMA 2LT3A 4JLEA 1O3XA 3DP7A 4XZCA 1H7CA 4AQFA 5L3GB 1LVFA 2DHRA 2NW7A 4WW0A 3C4ZA 3UFEA 4CXWA 5IHYA 2W00A 3PUQA 3RYHE 3BK9A 5FXVA 4DBQA 3KV5A 2Y48B 1D0XA 1D1CA 2LSGA 2CLYC 3AVSA 2SPCA 3NRXA 5JR9C 4QXBB 4MFRA 2D5UA 4KUMB 4M1PA 4CXXA 5J2UE 1NAFA 3DTOA 4G63A 3ZPOA 1U5PA 2E8IA 2XQYA 3I0QA 4GIWA 4L0RA 4F6RC 2VB6A 1YKEB 2MYSA 4IE4A 2DI4A 3MA9A 2E9XA 5J2TE 3K8PC 2XAQB 3MKDA 5FNVE 1WYBA 2D0TA 2YK0A 2YINA 3Q9DA 2V7LA 4KP3C 2IC9A 3CX8B 3KBTA 3V5SA 2G0UA 2DWKA 3EDVA 2XAHB 2A72A 3ZYMA 4I4TE 4UIGA 2JJ9A 3K3NA 2V7JA 3ZCJA 3JC6D 1NWMX 4IHJE 3ZMVB 4AKGA 4N78D 3K3OA 4V1Av 5LBMA 1HG5A 3AA0B 5JREA 3Q5XA 3S4UA 3N9QA 2VK9A 4K0UA 4EYUA 3ZEFB 4HN9A 1QSDA 2M67A 4UF0B 3C98B 2ACXA 3IEEA 3OYZA 3E08A 3CQXC 1D0YA 4MLKA 5L3EB 2Q9QB 5LBQB 2NW9A 3O1IA 2DLRA 2KZ7B 3BQIA 3OBVE 2K5BB 3IBPA 3ANWA 3AA7B 3RC3A 5HWXA 3SOLA 5JVDE 5JRCA 4EYYR 3FXEB 4PFPA 4JUYA 2JMHA 4I50E 3FBZA 2K48A 2ODUA 3ZC1A 2EHOB 1IJ6A 2VKOA 4MALA 2VKDA 5IYZE 5FXXA 5HXRA 3Q5WA 3F2EA 4AQFC 4QHOA 3QC9A 1ZHCA 3O1HA 1ZKEA 3RKOA 3ZJ1A 2BVLA 3CVRA 2UXNB 1YW0A 4EB6E 3RYFE 4AKHA 3C4XA 2MTQA 3LFMA 4KBMB 2NOXA 3I9YA 4IGUA 2KXPB 2WSSV 3N5LA 2CWOA 5H6RB 4YHJA 2X51A 4QX7B 3N2GE 4ZS3A 3JC6C 5L3CB 2LM9A 4UELA 5LGUB 2C5KT 4EIWA 5LJMA 1MIWA 3N9MA 1E1HB 1WYCA 3IF8B 2XAJB 3UUMA 2NW8A 3C64A 3B13A 3SWHA 2CXFA 2RP4A 5LGTB 4FI5A 1FIOA 4H63H 5L3FB 4ZI3D 2DCFA 3KV9A 1ZEEA 3OYXA 4MBQA 5A1LA 5F8PA 2LEHA 2KWIB 3AAIA 5M4YA 2EHOD 3RYIE 5JR9B 3DJBA 3L09A 4PW8A 2XHEB 3TKLB 4HKAA 4TX5A 5J1GA 5L3BB 2VASA 3GN5A 3NZQA 1MMGA 1VOMA 1YD8G 5C8YE 4G2AA 1UX4A 2JRKA 4KMCA 4X1IE 2HPJA 3LK2B 2QA7A 5JDQA 5LOVE 1MMDA 4ZHQE 4ASKA 4ERRA 5FP3A 1LVKA 4O8SA 5L2LA 1UCUA 2V7KA 2LSIA 1SHZC 3AA1B 4PFOA 3OKQA 5FY7A 4MHCA 3N9OA 3KVBA 3LBXA 3HR0A 4OHFA 5DQWA 4JEHB 4YLHA 2CXLA 4PJMA 4QKNA 3HI2A 3QK6A 4CQIA 2W63A 5HAXA 5LYJE 2KNDA 5LNKA 4IE0A 2Y8DA 1D0ZA 4H9OC 3N2OA 4YJ3E 5KDMC 3ESLA 2RA1A 2ZM2A 5ETWA 4P0AA 2V7IA 5FXWA 4CXYA 3MZKB 2ZM8A 2BDEA 2E9XC 1VRBA 3CQGB 2UXXB 3MXZA 2K24A 3ZMTB 4TUYE 3ZMUB 5KMGP 3KFWX 3UT5E 1V9DA 2KLQA 2CEAA 3PE0A 1LRZA 2LHNA 4YFSA 3ETVA 2HPLA 5LG4A 1MMAA 2WWUA 4H63V 4L9IA 3HKCE 5HXSA 1EZ3A 2H7VC 1FMWA 5FMNA 3ZN1B 4WBNE 1KNZA 4QXHB 2A2FX 3LJCA 3NBXX 3UTKA 4BJMA 2VKJA 2P9BA 4IE5A 1YKHB 2LJLA 2WBLA 2GK9A 3O1JA 5EK3A 5E0OA 4EZ4A 2QGSA 1KK7A 2LOSA 2X66A 2D2SA 5CB4E 2A3DA 3B57A 3FHNA 3U3IA 4NUVA 1HCIA 3EUHA 4C91A 3O9XA 2Q9QA 2MBGA 4FJOA 3CPZA 4ILUA 2WM9A 4TV9E 5LJNA 3KINB 4EZHA 1MNDA 3KVAA 4PJNA 3N9PA 2ZLYA 3H37A 4C90A 1T98A 4IE7A 4AI6A 4YJ2E 2L9QA 5HXEA 2CXDA 2ZMAA 1B7TA 2XAGB 4X1KE 2DWGA 3WAJA 3PURA 2X9HA 4P0BA 3PUGA 4O2AE 4JEUB 4HGAA 4QX8B 5EZYE 5HXCA 5JDLA 2Q9QD 3SRZA 5FY1A 2V7MA 2V1DB 2LE8A 3LK3B 2EHOA 2I59A 2IAKA 2X0LB 2YEVC 2W62A 1D1AA 2KMFA 1Z0PA 1US7B 2DNXA 5LA6E 3HA4A 1HX8A 2E9XB 1HTJF 2J1DG 4TV8E 5FY0A 3F57A 3C4WA 2CWYA 3ANWB 3RH3A 4HFVA 2H7OA 3HKBE 4E7ZA 3WAKA 2E9XD 5CA1E 4GOUA 3CWZB 3LK42 4GYRA 5HWYA 4OYJA 4ISSA 2VKHA 4P09A 5BMVE 5JH7E 3ZC0A 5FXZA 5LGNB 3FXDB 3KV6A 2XTLA 3J9X1 4PAGA 1OWAA 3H3AA 3N9NA 3ZMSB 2JMKA 1G8XA 2CCQA 1X79A 1IJ5A 4ZI3C 5DJQC 3WI3A 2XASB 3M65A 3T8OA 2WMNA 1MIVA 2EHOC 5LCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A56 A;  4K0U A;  3SOL A;  3UTK A; 
#chains in the Genus database with same CATH topology
 5LXT E;  2H89 A;  4IDP A;  2LM2 A;  1WRD A;  2ACZ A;  3NRY A;  5J0Z A;  2KSR A;  4A56 A;  3RPU A;  2CE7 A;  2PTF A;  3AE2 A;  3NZP A;  2FJA A;  3MK7 C;  4IE6 A;  2BZB A;  2NWB A;  3PDY A;  3HKE E;  4OK0 A;  3RRW A;  3Q5E A;  3BQK A;  1J5W A;  2D0U A;  2HH7 A;  1VCS A;  2BS4 A;  3GA8 A;  3KDS E;  5JDH A;  4O4L E;  4LF9 T;  1BR0 A;  5DAB A;  2ODV A;  5ABF B;  3SS1 A;  4TZ4 C;  4DUY T;  3AEF A;  3ETU A;  2KIN B;  5AQT B;  3ZT7 A;  2BG9 A;  4CI2 B;  3RF1 A;  4CI3 B;  3GN5 B;  4TN7 B;  4DVD A;  4AKI A;  3RIF A;  2E5L T;  1FJG T;  2ES0 A;  3FZL B;  4UVA B;  4IDZ A;  3RX6 A;  5LP6 E;  5GON E;  2CLY B;  4H9P C;  1AJ3 A;  1XDO A;  1MMN A;  4IL4 A;  1HG2 A;  1MIY A;  2NP9 A;  2W61 A;  2Y6X A;  5IWA T;  2KWH A;  2VVS A;  2IC6 A;  2WDR A;  3ZCI A;  1W9R A;  5F5W A;  4CZZ B;  3I0O A;  4K0K T;  3CKD A;  5AQG B;  4AKR B;  5JDN A;  2A9U A;  2KT9 A;  4DR5 T;  4ZEY A;  4ZI7 E;  3GMI A;  3PU8 A;  4HWD A;  4BJN A;  4J2C A;  3P4Q A;  1IZN B;  4U7Y A;  2XQ6 A;  2JPF A;  3O4X E;  1UX5 A;  5HCJ A;  5AQU B;  4CI1 B;  4HE8 A;  3AXJ B;  5IUX A;  1W09 A;  5JR9 A;  2PBI A;  4YY3 T;  4DID B;  3SFD A;  3HKD E;  5AQM B;  3RRC A;  4DMV A;  4DR7 T;  5FL1 A;  2Z6E A;  4GYS A;  5LMU T;  1BR2 A;  3AAE B;  4TNW A;  4DV3 T;  1HFA A;  4JI1 T;  2PG8 A;  1MNE A;  3VU7 H;  3CX6 B;  3E0Z A;  3U78 A;  3ZLI A;  4DBR A;  2WS3 A;  4P1N A;  1G73 A;  4XBF B;  2X68 A;  1WR6 A;  4H9S E;  5AQP B;  4ZI2 D;  4Z8X A;  1XNR T;  4AXP A;  4LFB T;  3C51 A;  4IDO A;  2BKO A;  4QWN B;  2IUB A;  4YSY A;  2X9X A;  5HXH A;  4UV9 B;  4EOZ B;  2MOZ A;  4GKJ T;  2YN6 A;  4WBO A;  3R84 B;  4DR6 T;  2JQ9 A;  5FVL A;  3EDU A;  4UXN B;  3UUM A;  2N1G A;  1N33 T;  2CHN A;  1QUU A;  1HF8 A;  3FBL A;  2B1E A;  1VCT A;  2PFV A;  1D1B A;  3A5X A;  3KV4 A;  5EK4 A;  3RHW A;  4DMW A;  4X20 E;  2XQA A;  4KI0 F;  3AE9 A;  3LSV A;  3UUL A;  4H9R C;  3PTR B;  3D0T A;  4B6X A;  5JDF A;  4LF5 T;  5DQV A;  3P7I A;  3P8C D;  4PK5 A;  1KEY A;  4U2Y A;  2R6G F;  4U74 A;  1T72 A;  2CA5 A;  2BG9 E;  4JBW F;  4AQG A;  3ZMZ B;  5AQN B;  4X1Y E;  5HEJ A;  1I94 T;  4F6R C;  1U4Q A;  3AE4 A;  5C3J A;  4L5G A;  3EVY A;  2IIU A;  3K3Q C;  3ZYK A;  5L3D B;  2XQ5 A;  2YU1 A;  3CML A;  4HFD A;  5JDG A;  4UVC B;  5CGM A;  4PJJ A;  5JQG E;  5AQR B;  4O4I E;  3F31 A;  3GWH A;  1XWM A;  1Y64 B;  3AEC A;  3CX7 B;  1FMV A;  5H6Q B;  4ANJ A;  3MAC A;  2NTY A;  2OA5 A;  2V26 A;  2VL8 A;  1CUN A;  3J7Y q;  1BR1 A;  1X9B A;  2X9Y A;  4HFB A;  3R6N A;  3UFE A;  4UEM A;  2WU5 A;  4EV6 A;  5J2U E;  1FEW A;  2W0G A;  4DV4 T;  3N9L A;  2N2N A;  4JYA T;  5EK2 A;  2I0M A;  4GK0 E;  4JV5 T;  1KNP A;  2XSA A;  3LBX B;  4DO0 A;  3CQC B;  4PNI A;  4YTM A;  1Y01 A;  2AXD S;  3AA6 B;  4HFI A;  3PUV F;  2BG9 B;  4H9Q C;  4HTE A;  4I0U A;  1OXZ A;  2YDS A;  4QH5 A;  4PK4 A;  4U33 A;  1J1J A;  2LHR A;  4EGW A;  1S35 A;  3ZYL A;  3QUJ A;  2XAF B;  2JQQ A;  3L3P A;  2LSY A;  4JI5 T;  4E7S A;  1IBL T;  4DND A;  1LKX A;  4O4J E;  2VWA A;  2NTX A;  2XQ4 A;  4I43 B;  1S94 A;  3P50 A;  4I55 E;  2M6I A;  3X1D A;  4B3M T;  2PJQ A;  4EXT A;  1WCR A;  2WMO A;  3PU3 A;  3QB5 K;  3VR8 A;  1ZV4 X;  3PUS A;  4PK6 A;  2Q9Q C;  5AFU L;  2WAU A;  3C50 A;  5LHH B;  2ZM0 A;  3LG7 A;  3VRB A;  4NUU A;  2J47 A;  3ONX A;  1WLX A;  4O4H E;  5F3J A;  4UV8 B;  2C5I T;  2L3L A;  3JAF A;  3VHL A;  4OFZ A;  5AQI B;  4IIJ E;  2YOE A;  3N2K E;  4PJL A;  3UU4 A;  4ZOL E;  3UUX B;  4WYV A;  3PUW F;  3I9W A;  5ADX L;  4JI3 T;  3MJX A;  1R8I A;  2XUE A;  5JDM A;  4GK5 E;  3ZJ2 A;  2X9W A;  2CPT A;  2HHH T;  4JI7 T;  2CM0 A;  3AEA A;  4H9N C;  4U72 A;  5L4E A;  4UR9 A;  2XQ9 A;  5KXJ A;  2IW5 B;  1XZY A;  4UF0 A;  4LMJ A;  2I6H A;  3Q2M A;  2X67 A;  2K9A A;  4ZS2 A;  5KX5 E;  4JI0 T;  2IML A;  4OYK A;  3RLF F;  1N36 T;  2BVM A;  2LSK A;  5TAO A;  5HYA A;  2WDQ A;  4IRE A;  4AKL A;  3UUN A;  3EI0 A;  5HEO A;  4BAY B;  5CA0 E;  5LHG B;  4IST A;  3KBU A;  4JI2 T;  4XAX B;  4ZI2 C;  4DV6 T;  2L8K A;  2LLY A;  3FB2 A;  4DV0 T;  4O2B E;  5JRC B;  3VKH A;  1BR4 A;  2H3R A;  2UXC T;  3HL6 A;  3RGL A;  1IAP A;  2YU2 A;  2LOP A;  2FJD A;  2XZE A;  3BQL A;  3V5U A;  4EAH A;  5HEU A;  3AEB A;  4BA9 A;  1CHU A;  1E2A A;  1KF6 A;  2C5J A;  3ZN0 B;  3IHR A;  3L8R A;  4WNK A;  5CJ5 A;  5LHI B;  2LSJ A;  1DU2 A;  1OED C;  3E22 E;  3PUZ F;  4ZXL A;  4UVB B;  4ILC A;  3W15 B;  3FZK B;  3OJA A;  4QXC B;  1SA0 E;  4ADZ A;  4HWF A;  4YSX A;  2WZH A;  4JI8 T;  5ABG A;  5JTG A;  3PUA A;  2C0S A;  3I1A A;  1HS7 A;  3RC8 A;  2CMR A;  3AAA B;  2CHO A;  2OV9 A;  3IA3 A;  3TLW A;  2CBJ A;  3AB3 B;  4HEA A;  4YT0 A;  4DV7 T;  2LKG A;  2XY8 B;  4A98 A;  1QLB A;  3AVR A;  4LFA T;  2CBI A;  3UU3 A;  3ONL C;  2N9D A;  3NKZ A;  5FYM A;  1YXR A;  2LT3 A;  5LB7 B;  1OED E;  4JLE A;  5FVK A;  1O3X A;  3DP7 A;  3RKG A;  3JCF A;  1UUR A;  1H7C A;  4HWC A;  4XZC A;  4AQF A;  4CN6 A;  5L3G B;  1LVF A;  2DHR A;  2HN1 A;  2NW7 A;  2RPA A;  2XM2 A;  3C4Z A;  4WW0 A;  5AQK B;  5IHY A;  2W00 A;  3PUQ A;  3RYH E;  3ZSS A;  3BK9 A;  4KX6 A;  5FXV A;  4DBQ A;  5ABE A;  3KV5 A;  2Y48 B;  1D0X A;  1D1C A;  4IDQ A;  2LSG A;  2AE9 A;  2CLY C;  3AVS A;  2SPC A;  3NRX A;  4TNV A;  5JR9 C;  4QXB B;  3AE5 A;  4MFR A;  1JNR A;  3UU5 A;  2D5U A;  4KUM B;  4M1P A;  3OVU A;  1KFY A;  5FL0 A;  4CXX A;  1NAF A;  3DTO A;  4G63 A;  3ZPO A;  1U5P A;  2E8I A;  2XQY A;  3I0Q A;  4GIW A;  4L0R A;  4LF8 T;  2E5V A;  2VB6 A;  1YKE B;  3JAE A;  2MYS A;  4IE4 A;  2DI4 A;  3A7M A;  3MA9 A;  3RIU C;  2E9X A;  4ZZC A;  3FZF B;  3K8P C;  5J2T E;  2XAQ B;  3MKD A;  5FNV E;  5AQJ B;  2IDO B;  1HNZ T;  1WYB A;  2D0T A;  2YK0 A;  2W2U A;  2YIN A;  3Q9D A;  2QYW A;  2V7L A;  4KP3 C;  2IC9 A;  3CX8 B;  3K1S A;  3KBT A;  2G0U A;  3V5S A;  2DWK A;  3EDV A;  2XAH B;  2A72 A;  3AEE A;  3ZYM A;  4I4T E;  4UIG A;  1T8B A;  2JJ9 A;  3K3N A;  4X62 T;  5LMN T;  2V7J A;  3EAM A;  1XDP A;  3ZCJ A;  3JC6 D;  1NWM X;  4IHJ E;  2XM1 A;  4NPP A;  3ZMV B;  4AKG A;  4N78 D;  3K3O A;  3VKG A;  3EHZ A;  4V1A v;  5LBM A;  1HG5 A;  2M6B A;  3AA0 B;  3TLV A;  5JRE A;  5BR8 T;  3Q5X A;  3S4U A;  3N9Q A;  2VK9 A;  4K0U A;  1I6Z A;  4EYU A;  4LF7 T;  3ZEF B;  4LF6 T;  4CQI A;  4HN9 A;  1QSD A;  2M67 A;  4U3C A;  4UF0 B;  3T1Y T;  3C98 B;  4CN1 A;  2UUB T;  2ACX A;  3IEE A;  3OYZ A;  4GKK T;  3ZKR A;  2UXD T;  3E08 A;  3CQX C;  3H3M A;  3UQ4 A;  1D0Y A;  4MLK A;  5L3E B;  2Q9Q B;  4QH1 A;  5LBQ B;  2NW9 A;  3O1I A;  4DV5 T;  3PV0 F;  1XMQ T;  2DLR A;  4HWI B;  2KZ7 B;  3BQI A;  3OBV E;  2K5B B;  3AEG A;  3IBP A;  1W0A A;  4IL9 A;  2X0Y A;  3ANW A;  3AA7 B;  3M3Z B;  3RC3 A;  4YSZ A;  5HWX A;  3SOL A;  5JVD E;  5JRC A;  4EYY R;  3FXE B;  4PFP A;  4JUY A;  2JMH A;  4AIS A;  4I50 E;  3FBZ A;  2K48 A;  2XQ8 A;  4TWF A;  4QH4 A;  2UUA T;  2ODU A;  3ZC1 A;  1XMO T;  2EHO B;  4IDN A;  1IJ6 A;  2VKO A;  2X0H A;  1YQ3 A;  4DR3 T;  4MAL A;  4LF4 T;  2VKD A;  5IYZ E;  5FXX A;  5HXR A;  2UUC T;  3Q5W A;  5ABH A;  3G06 A;  3F2E A;  2JIW A;  4QHO A;  4AQF C;  3QC9 A;  4NXN T;  1ZHC A;  3O1H A;  4AQY T;  1ZKE A;  3RKO A;  3ZJ1 A;  2BVL A;  2JQH A;  3TLU A;  3CVR A;  2UXN B;  1YW0 A;  4EB6 E;  3RYF E;  4AKH A;  1N32 T;  3C4X A;  2WY2 A;  3P4R A;  2MTQ A;  2F4V T;  3LFM A;  5AQF B;  4KBM B;  2NOX A;  2YKS A;  1HX1 B;  3I9Y A;  4X5T A;  4IGU A;  2KXP B;  2WSS V;  2NR4 A;  3UUB A;  3N5L A;  4F8H A;  1HR0 T;  2CWO A;  2K3W A;  5H6R B;  1SUM B;  2FJB A;  4YHJ A;  2X51 A;  2ZM6 T;  4QX7 B;  3N2G E;  2YDR A;  1UK5 A;  3QOF A;  4B3S T;  4ZS3 A;  3JC6 C;  4U7I A;  5L3C B;  2LM9 A;  3CK6 A;  2V6Y A;  4UEL A;  5LGU B;  2C5K T;  4EIW A;  5LJM A;  1MIW A;  4DR4 T;  1NEN A;  3N9M A;  4NXM T;  1E1H B;  1OED A;  3RQU A;  1WYC A;  2OLT A;  2XAJ B;  3IF8 B;  3PUX F;  3A8Y C;  2NW8 A;  2BKP A;  3B13 A;  3C64 A;  2CXF A;  3SWH A;  2RP4 A;  4Q25 A;  4FI5 A;  5LGT B;  1IBM T;  1FIO A;  4H63 H;  2W67 A;  1UUS A;  5L3F B;  4ZI3 D;  2DCF A;  3KV9 A;  1ZEE A;  3ZST A;  4HWH A;  4JI4 T;  2WDV A;  3OYX A;  4MBQ A;  2VVN A;  5AQL B;  2LEH A;  2DL1 A;  2JQK A;  2KWI B;  3AAI A;  4ILA A;  5F8P A;  5A1L A;  2EHO D;  2VUR A;  4KHZ F;  5M4Y A;  3RYI E;  5JR9 B;  2UXB T;  3P4W A;  5ABF A;  3DJB A;  3L09 A;  5AQV B;  4PW8 A;  2XHE B;  2WQY A;  4AIU A;  3TKL B;  4HKA A;  4TX5 A;  5J1G A;  3EAB A;  3TLS A;  5L3B B;  2VAS A;  3GN5 A;  3NZQ A;  1MMG A;  1VOM A;  3QNU A;  3L39 A;  3QB5 A;  1YD8 G;  3AE6 A;  5C8Y E;  4G2A A;  4LMK A;  1UX4 A;  2WP9 A;  2JRK A;  4KMC A;  4X1I E;  3UFG A;  2HPJ A;  3CIR A;  3LK2 B;  2QA7 A;  3VR9 A;  2UU9 T;  5JDQ A;  4OX9 T;  4KHP T;  1IBK T;  5LOV E;  1MMD A;  4ZHQ E;  5L47 A;  2VL0 A;  4IT4 A;  4ASK A;  4ERR A;  2BS2 A;  2BG9 C;  5FP3 A;  2VQF T;  1T7S A;  1LVK A;  4Z91 A;  3VRA A;  4O8S A;  5L2L A;  4X64 T;  1UCU A;  2V7K A;  2LSI A;  4NIQ A;  1SHZ C;  3AA1 B;  4PFO A;  5FKY A;  3OKQ A;  5FY7 A;  4ILB A;  4MHC A;  2FUP A;  3N9O A;  3KVB A;  1ZP0 A;  1HNW T;  3LBX A;  3HR0 A;  4OHF A;  5HEH A;  5DQW A;  1XNQ T;  4JEH B;  2BS3 A;  2CXL A;  4PJM A;  4QKN A;  3HI2 A;  3QK6 A;  4YLH A;  3ZT5 A;  2W63 A;  3AE7 A;  5HAX A;  5LYJ E;  3UQ7 A;  2KND A;  4X66 T;  5LNK A;  4IE0 A;  1D0Z A;  2Y8D A;  4H9O C;  3N2O A;  4YJ3 E;  4EED A;  5KDM C;  3ESL A;  2RA1 A;  4HFH A;  2ZM2 A;  5ETW A;  1YQ4 A;  2V7I A;  4P0A A;  5FXW A;  5HEG A;  3MZK B;  4CXY A;  2ZM8 A;  3RIU A;  1SE7 A;  2BDE A;  2E9X C;  1VRB A;  3CQG B;  2UXX B;  3MXZ A;  2K24 A;  1WR0 A;  3PJA A;  2IHR 1;  4LML A;  4TUY E;  3ZMT B;  4COF A;  3ZMU B;  5KMG P;  4YHH T;  3KFW X;  3NVO A;  3UT5 E;  1V9D A;  2KLQ A;  2CEA A;  2QVA A;  3PE0 A;  5L4H A;  1L0V A;  3RI5 A;  1LRZ A;  4LFC T;  2LHN A;  2J4G A;  4YFS A;  2WCA A;  3ETV A;  2HPL A;  5LG4 A;  4DV1 T;  1MMA A;  2WWU A;  4H63 V;  4L9I A;  3HKC E;  5HXS A;  3SFE A;  1EZ3 A;  2WZI A;  1UGO A;  2H7V C;  2XSB A;  3JAD A;  3Q5D A;  2VQE T;  1FMW A;  2W66 A;  4JI6 T;  5FMN A;  3TLT A;  4A97 A;  4WZX A;  2D9D A;  3UU6 A;  3ZN1 B;  4WBN E;  4QXH B;  2J62 A;  2A2F X;  3FZH B;  1KNZ A;  1ZOY A;  1OED B;  3ABV A;  3LJC A;  3NBX X;  3UTK A;  4BJM A;  2VKJ A;  4DUZ T;  2P9B A;  4IE5 A;  1JNZ A;  1YKH B;  2LJL A;  2LKH A;  2GK9 A;  2V6Y B;  2WBL A;  3O1J A;  3LDQ B;  3PUY F;  4U2Z A;  5EK3 A;  5E0O A;  2WWV A;  4EZ4 A;  4TWD A;  2XQ3 A;  1M62 A;  2QGS A;  2V8S V;  1KK7 A;  2LOS A;  2X66 A;  2D2S A;  2V5C A;  2A3D A;  3B57 A;  1M7K A;  3FHN A;  5CB4 E;  4NUV A;  3U3I A;  1HCI A;  2MPK A;  2CRB A;  3EUH A;  2E2A A;  5AQS B;  4C91 A;  2Q9Q A;  3O9X A;  2MBG A;  4FJO A;  2WB5 A;  3CPZ A;  2WM9 A;  2LRK A;  1E7P A;  2XPK A;  4ILU A;  4TV9 E;  5C2T A;  3OPC A;  5CFB A;  5LJN A;  3KIN B;  4EZH A;  4DR1 T;  1MND A;  2BBJ A;  3KVA A;  4EEB A;  4PJN A;  1J5E T;  3N9P A;  2ZLY A;  3H37 A;  4C90 A;  5AQQ B;  1T98 A;  4IE7 A;  3RQW A;  3ONJ A;  4YJ2 E;  4AI6 A;  2L9Q A;  5HXE A;  2CXD A;  2ZMA A;  1B7T A;  2XAG B;  4X1K E;  3UU8 A;  1W0B A;  2DWG A;  3AE3 A;  3ZT6 A;  4CXW A;  3WAJ A;  3P4S A;  3PUR A;  2X9H A;  2W4X A;  4P0B A;  3PUG A;  2YDQ A;  4O2A E;  4JEU B;  4HGA A;  4QX8 B;  2MAW A;  5AQH B;  5EZY E;  5HXC A;  4ZZB A;  5JDL A;  1N34 T;  1KNR A;  2XQ7 A;  2Q9Q D;  4HFC A;  5FY1 A;  2V7M A;  3SRZ A;  4YTN A;  2V1D B;  2LE8 A;  3LK3 B;  4TWH A;  2EHO A;  2I59 A;  2V5D A;  2IAK A;  2X0L B;  2YEV C;  3PJA J;  2W62 A;  4X65 T;  3AED A;  3OTO T;  1NEK A;  1D1A A;  2BKN A;  5AQO B;  2LRL A;  1HNX T;  2KMF A;  1US7 B;  2V6X A;  1Z0P A;  2DNX A;  2WU2 A;  1HX8 A;  2E9X B;  2J1D G;  1HTJ F;  3HA4 A;  4HFE A;  4TV8 E;  5LA6 E;  5FY0 A;  4A5X A;  1WFD A;  4CN4 A;  3F57 A;  2H88 A;  3C4W A;  1GQE A;  3AE1 A;  2CWY A;  3ANW B;  3RH3 A;  4HFV A;  3FZM B;  2H7O A;  3HKB E;  3RYC E;  4E7Z A;  3WAK A;  2BBH A;  2E9X D;  3NWI A;  5CA1 E;  4GOU A;  3CWZ B;  3LK4 2;  4GYR A;  5HWY A;  4OYJ A;  2XJ7 A;  4YTP A;  5LG3 A;  3T1H T;  4ISS A;  2VKH A;  4P09 A;  5BMV E;  5JH7 E;  3ZC0 A;  5FXZ A;  4YXD A;  3FXD B;  3KV6 A;  2XTL A;  5LGN B;  4B3R T;  3RIA A;  3J9X 1;  2FBW A;  4PAG A;  1OWA A;  5HCM A;  3B5M A;  2QRX A;  3H3A A;  2B76 A;  3N9N A;  2JMK A;  1G8X A;  2CCQ A;  3ZMS B;  4B3T T;  1X79 A;  1IJ5 A;  4ZI3 C;  1Z8U A;  2FJE A;  5DJQ C;  4Z90 A;  3WI3 A;  2XAS B;  3M65 A;  3T8O A;  4U31 A;  3AXJ A;  2WMN A;  3AE8 A;  4DV2 T;  1MIV A;  2HN2 A;  2EHO C;  4DR2 T;  3P4P A;  5LCY A; 
#chains in the Genus database with same CATH homology
 5LXT E;  1WRD A;  3NRY A;  4A56 A;  3RPU A;  2CE7 A;  3NZP A;  3MK7 C;  4IE6 A;  2BZB A;  2NWB A;  3PDY A;  3HKE E;  4OK0 A;  3RRW A;  5JDH A;  3BQK A;  2D0U A;  3VKG A;  2HH7 A;  3GA8 A;  3KDS E;  4O4L E;  1BR0 A;  5DAB A;  2ODV A;  3SS1 A;  4TZ4 C;  3ETU A;  2KIN B;  4CI2 B;  4CI3 B;  3GN5 B;  4TN7 B;  4DVD A;  4AKI A;  2ES0 A;  4UVA B;  4IDZ A;  3RX6 A;  5LP6 E;  5GON E;  2CLY B;  4H9P C;  1AJ3 A;  1MMN A;  1HG2 A;  1MIY A;  2NP9 A;  2W61 A;  2Y6X A;  2KWH A;  2IC6 A;  3ZCI A;  4CZZ B;  3I0O A;  3CKD A;  4AKR B;  5JDN A;  2KT9 A;  4ZI7 E;  3GMI A;  3PU8 A;  4BJN A;  4J2C A;  1IZN B;  2JPF A;  3O4X E;  1UX5 A;  4CI1 B;  4HE8 A;  5JR9 A;  2PBI A;  3HKD E;  3RRC A;  4DMV A;  2Z6E A;  4GYS A;  1BR2 A;  3AAE B;  1HFA A;  2PG8 A;  1MNE A;  3VU7 H;  3CX6 B;  3E0Z A;  3U78 A;  3ZLI A;  4DBR A;  1G73 A;  4XBF B;  2X68 A;  1WR6 A;  4H9S E;  4ZI2 D;  4Z8X A;  4AXP A;  3C51 A;  4QWN B;  2X9X A;  5HXH A;  4UV9 B;  4EOZ B;  2MOZ A;  4WBO A;  3R84 B;  3EDU A;  4UXN B;  2N1G A;  3FBL A;  1QUU A;  1HF8 A;  2B1E A;  2PFV A;  1D1B A;  3A5X A;  3KV4 A;  5EK4 A;  4DMW A;  4X20 E;  3UUL A;  4H9R C;  3PTR B;  3D0T A;  4B6X A;  5JDF A;  5DQV A;  3P7I A;  3P8C D;  4PK5 A;  4U74 A;  2CA5 A;  4AQG A;  3ZMZ B;  4X1Y E;  1U4Q A;  4L5G A;  3EVY A;  3K3Q C;  3ZYK A;  5L3D B;  2YU1 A;  3CML A;  5JDG A;  5JQG E;  4UVC B;  4PJJ A;  5H6Q B;  4O4I E;  3F31 A;  3GWH A;  4ANJ A;  1Y64 B;  3CX7 B;  1FMV A;  3MAC A;  2NTY A;  2OA5 A;  2V26 A;  2VL8 A;  1CUN A;  3J7Y q;  1BR1 A;  2X9Y A;  3R6N A;  4UEM A;  1FEW A;  2W0G A;  3N9L A;  2N2N A;  5EK2 A;  4GK0 E;  3LBX B;  4DO0 A;  3CQC B;  4PNI A;  3AA6 B;  3RYC E;  4HTE A;  4H9Q C;  4PK4 A;  1OXZ A;  2LHR A;  1S35 A;  3ZYL A;  3QUJ A;  2XAF B;  2JQQ A;  3L3P A;  2LSY A;  4E7S A;  4DND A;  1LKX A;  4O4J E;  2VWA A;  2NTX A;  4I43 B;  1S94 A;  4I55 E;  2PJQ A;  4EXT A;  2WMO A;  3PU3 A;  1ZV4 X;  3PUS A;  4PK6 A;  2Q9Q C;  5AFU L;  2WAU A;  3C50 A;  5LHH B;  2ZM0 A;  3LG7 A;  4NUU A;  3ONX A;  1WLX A;  4O4H E;  5F3J A;  4UV8 B;  2C5I T;  2L3L A;  3VHL A;  4OFZ A;  4IIJ E;  3N2K E;  4PJL A;  5ADX L;  4ZOL E;  3UUX B;  3I9W A;  3MJX A;  2XUE A;  5JDM A;  4GK5 E;  3ZJ2 A;  2X9W A;  2CM0 A;  4U72 A;  4H9N C;  2IW5 B;  4UF0 A;  3Q2M A;  2X67 A;  2K9A A;  4ZS2 A;  5KX5 E;  4OYK A;  2BVM A;  2LSK A;  5TAO A;  5HYA A;  4AKL A;  3UUN A;  4BAY B;  5LHG B;  5CA0 E;  4IST A;  3KBU A;  4XAX B;  4ZI2 C;  2L8K A;  3FB2 A;  4O2B E;  5JRC B;  3VKH A;  1BR4 A;  2H3R A;  3HL6 A;  1IAP A;  2YU2 A;  2LOP A;  3BQL A;  4EAH A;  3V5U A;  4BA9 A;  5LHI B;  2C5J A;  3ZN0 B;  3IHR A;  4WNK A;  2LSJ A;  3E22 E;  4UVB B;  3W15 B;  3OJA A;  4QXC B;  4ADZ A;  1SA0 E;  3PUA A;  2C0S A;  3I1A A;  1HS7 A;  3RC8 A;  2CMR A;  3AAA B;  3AB3 B;  4HEA A;  3AVR A;  2N9D A;  5FYM A;  2LT3 A;  4JLE A;  1O3X A;  3DP7 A;  4XZC A;  1H7C A;  4AQF A;  5L3G B;  1LVF A;  2DHR A;  2NW7 A;  4WW0 A;  3C4Z A;  3UFE A;  4CXW A;  5IHY A;  2W00 A;  3PUQ A;  3RYH E;  3BK9 A;  5FXV A;  4DBQ A;  3KV5 A;  2Y48 B;  1D0X A;  1D1C A;  2LSG A;  2CLY C;  3AVS A;  2SPC A;  3NRX A;  5JR9 C;  4QXB B;  4MFR A;  2D5U A;  4KUM B;  4M1P A;  4CXX A;  5J2U E;  1NAF A;  3DTO A;  4G63 A;  3ZPO A;  1U5P A;  2E8I A;  2XQY A;  3I0Q A;  4GIW A;  4L0R A;  4F6R C;  2VB6 A;  1YKE B;  2MYS A;  4IE4 A;  2DI4 A;  3MA9 A;  2E9X A;  5J2T E;  3K8P C;  2XAQ B;  3MKD A;  5FNV E;  1WYB A;  2D0T A;  2YK0 A;  2YIN A;  3Q9D A;  2V7L A;  4KP3 C;  2IC9 A;  3CX8 B;  3KBT A;  3V5S A;  2G0U A;  2DWK A;  3EDV A;  2XAH B;  2A72 A;  3ZYM A;  4I4T E;  4UIG A;  2JJ9 A;  3K3N A;  2V7J A;  3ZCJ A;  3JC6 D;  1NWM X;  4IHJ E;  3ZMV B;  4AKG A;  4N78 D;  3K3O A;  4V1A v;  5LBM A;  1HG5 A;  3AA0 B;  5JRE A;  3Q5X A;  3S4U A;  3N9Q A;  2VK9 A;  4K0U A;  4EYU A;  3ZEF B;  4HN9 A;  1QSD A;  2M67 A;  4UF0 B;  3C98 B;  2ACX A;  3IEE A;  3OYZ A;  3E08 A;  3CQX C;  1D0Y A;  4MLK A;  5L3E B;  2Q9Q B;  5LBQ B;  2NW9 A;  3O1I A;  2DLR A;  2KZ7 B;  3BQI A;  3OBV E;  2K5B B;  3IBP A;  3ANW A;  3AA7 B;  3RC3 A;  5HWX A;  3SOL A;  5JVD E;  5JRC A;  4EYY R;  3FXE B;  4PFP A;  4JUY A;  2JMH A;  4I50 E;  3FBZ A;  2K48 A;  2ODU A;  3ZC1 A;  2EHO B;  1IJ6 A;  2VKO A;  4MAL A;  2VKD A;  5IYZ E;  5FXX A;  5HXR A;  3Q5W A;  3F2E A;  4AQF C;  4QHO A;  3QC9 A;  1ZHC A;  3O1H A;  1ZKE A;  3RKO A;  3ZJ1 A;  2BVL A;  3CVR A;  2UXN B;  1YW0 A;  4EB6 E;  3RYF E;  4AKH A;  3C4X A;  2MTQ A;  3LFM A;  4KBM B;  2NOX A;  3I9Y A;  4IGU A;  2KXP B;  2WSS V;  3N5L A;  2CWO A;  5H6R B;  4YHJ A;  2X51 A;  4QX7 B;  3N2G E;  4ZS3 A;  3JC6 C;  5L3C B;  2LM9 A;  4UEL A;  5LGU B;  2C5K T;  4EIW A;  5LJM A;  1MIW A;  3N9M A;  1E1H B;  1WYC A;  3IF8 B;  2XAJ B;  3UUM A;  2NW8 A;  3C64 A;  3B13 A;  3SWH A;  2CXF A;  2RP4 A;  5LGT B;  4FI5 A;  1FIO A;  4H63 H;  5L3F B;  4ZI3 D;  2DCF A;  3KV9 A;  1ZEE A;  3OYX A;  4MBQ A;  5A1L A;  5F8P A;  2LEH A;  2KWI B;  3AAI A;  5M4Y A;  2EHO D;  3RYI E;  5JR9 B;  3DJB A;  3L09 A;  4PW8 A;  2XHE B;  3TKL B;  4HKA A;  4TX5 A;  5J1G A;  5L3B B;  2VAS A;  3GN5 A;  3NZQ A;  1MMG A;  1VOM A;  1YD8 G;  5C8Y E;  4G2A A;  1UX4 A;  2JRK A;  4KMC A;  4X1I E;  2HPJ A;  3LK2 B;  2QA7 A;  5JDQ A;  5LOV E;  1MMD A;  4ZHQ E;  4ASK A;  4ERR A;  5FP3 A;  1LVK A;  4O8S A;  5L2L A;  1UCU A;  2V7K A;  2LSI A;  1SHZ C;  3AA1 B;  4PFO A;  3OKQ A;  5FY7 A;  4MHC A;  3N9O A;  3KVB A;  3LBX A;  3HR0 A;  4OHF A;  5DQW A;  4JEH B;  4YLH A;  2CXL A;  4PJM A;  4QKN A;  3HI2 A;  3QK6 A;  4CQI A;  2W63 A;  5HAX A;  5LYJ E;  2KND A;  5LNK A;  4IE0 A;  2Y8D A;  1D0Z A;  4H9O C;  3N2O A;  4YJ3 E;  5KDM C;  3ESL A;  2RA1 A;  2ZM2 A;  5ETW A;  4P0A A;  2V7I A;  5FXW A;  4CXY A;  3MZK B;  2ZM8 A;  2BDE A;  2E9X C;  1VRB A;  3CQG B;  2UXX B;  3MXZ A;  2K24 A;  3ZMT B;  4TUY E;  3ZMU B;  5KMG P;  3KFW X;  3UT5 E;  1V9D A;  2KLQ A;  2CEA A;  3PE0 A;  1LRZ A;  2LHN A;  4YFS A;  3ETV A;  2HPL A;  5LG4 A;  1MMA A;  2WWU A;  4H63 V;  4L9I A;  3HKC E;  5HXS A;  1EZ3 A;  2H7V C;  1FMW A;  5FMN A;  3ZN1 B;  4WBN E;  1KNZ A;  4QXH B;  2A2F X;  3LJC A;  3NBX X;  3UTK A;  4BJM A;  2VKJ A;  2P9B A;  4IE5 A;  1YKH B;  2LJL A;  2WBL A;  2GK9 A;  3O1J A;  5EK3 A;  5E0O A;  4EZ4 A;  2QGS A;  1KK7 A;  2LOS A;  2X66 A;  2D2S A;  5CB4 E;  2A3D A;  3B57 A;  3FHN A;  3U3I A;  4NUV A;  1HCI A;  3EUH A;  4C91 A;  3O9X A;  2Q9Q A;  2MBG A;  4FJO A;  3CPZ A;  4ILU A;  2WM9 A;  4TV9 E;  5LJN A;  3KIN B;  4EZH A;  1MND A;  3KVA A;  4PJN A;  3N9P A;  2ZLY A;  3H37 A;  4C90 A;  1T98 A;  4IE7 A;  4AI6 A;  4YJ2 E;  2L9Q A;  5HXE A;  2CXD A;  2ZMA A;  1B7T A;  2XAG B;  4X1K E;  2DWG A;  3WAJ A;  3PUR A;  2X9H A;  4P0B A;  3PUG A;  4O2A E;  4JEU B;  4HGA A;  4QX8 B;  5EZY E;  5HXC A;  5JDL A;  2Q9Q D;  3SRZ A;  5FY1 A;  2V7M A;  2V1D B;  2LE8 A;  3LK3 B;  2EHO A;  2I59 A;  2IAK A;  2X0L B;  2YEV C;  2W62 A;  1D1A A;  2KMF A;  1Z0P A;  1US7 B;  2DNX A;  5LA6 E;  3HA4 A;  1HX8 A;  2E9X B;  1HTJ F;  2J1D G;  4TV8 E;  5FY0 A;  3F57 A;  3C4W A;  2CWY A;  3ANW B;  3RH3 A;  4HFV A;  2H7O A;  3HKB E;  4E7Z A;  3WAK A;  2E9X D;  5CA1 E;  4GOU A;  3CWZ B;  3LK4 2;  4GYR A;  5HWY A;  4OYJ A;  4ISS A;  2VKH A;  4P09 A;  5BMV E;  5JH7 E;  3ZC0 A;  5FXZ A;  5LGN B;  3FXD B;  3KV6 A;  2XTL A;  3J9X 1;  4PAG A;  1OWA A;  3H3A A;  3N9N A;  3ZMS B;  2JMK A;  1G8X A;  2CCQ A;  1X79 A;  1IJ5 A;  4ZI3 C;  5DJQ C;  3WI3 A;  2XAS B;  3M65 A;  3T8O A;  2WMN A;  1MIV A;  2EHO C;  5LCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...