4A56A

Crystal structure of the type 2 secretion system pilotin from klebsiella oxytoca
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
VSGQAQLEQLASVAAGARYLKNKCNRSDLPADEAINRAAINVGKKRGWANIDANLLSQRSAQLYQQLQQDSTPEATKCSQFNRQLAPFIDSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pilotin-Secretin Recognition in the Type II Secretion System of Klebsiella Oxytoca.
pubmed doi rcsb
molecule keywords PULLULANASE SECRETION PROTEIN PULS
molecule tags Protein transport
source organism Klebsiella oxytoca
total genus 37
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2011-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09691 T2SS_PulS_OutS Type II secretion system pilotin lipoprotein (PulS_OutS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1630 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4a56A00
4K0UA 4A56A 3SOLA 3UTKA
chains in the Genus database with same CATH superfamily
3AA0B 4UVCB 3FB2A 3AE7A 5JDGA 2WMNA 2KWIB 4X62T 2GK9A 4ERRA 1WR6A 4TZ4C 1IJ6A 3ZLIA 3PJAJ 5HEHA 3MACA 2VVSA 3R84B 3SWHA 4YFSA 3KFWX 4PW8A 4DV6T 3AA1B 4U31A 2VL8A 3P7IA 3PUZF 3J7Yq 3ZMVB 3UU6A 4EOZB 3LDQB 2MPKA 1D0ZA 2X0HA 3TLSA 2DI4A 5FXVA 5EK2A 4DR3T 2W4XA 1XNQT 1UK5A 2Y8DA 2KSRA 4HWDA 3A7MA 3JADA 2UXCT 1NWMX 4TWFA 3ZT6A 2Q9QB 4IE4A 1J5ET 2CWOA 3PUYF 4NUVA 2JRKA 5LNKA 5C8YE 2N2NA 2B76A 2X0LB 2WY2A 2V8SV 1D1CA 1D0XA 2XM1A 4NXNT 1BR4A 4J2CA 4BA9A 2K9AA 3PV0F 3AEBA 2ODUA 3AVRA 3UU3A 1GQEA 3UU5A 2HPJA 2BKOA 4TV9E 3EABA 5CB4E 4U2ZA 2VKHA 1UX4A 4I0UA 4EXTA 4UR9A 2Q9QC 2ZM8A 1HNXT 4UF0A 3PU8A 1IAPA 4IL4A 3FHNA 4PFOA 2CXLA 3FXEB 4UVBB 3N2OA 2WDRA 1ZEEA 4BJMA 4QX8B 1U4QA 3L3PA 1YQ3A 3I0OA 4DIDB 2XQ8A 4JI5T 1G8XA 1HCIA 5L4EA 3AECA 4PAGA 1SE7A 3EI0A 1MMAA 2Q9QD 3O1HA 1OWAA 3AE4A 2WDQA 3SRZA 2H7OA 4YLHA 2M67A 1YQ4A 4AISA 3ZSTA 4LF7T 2D2SA 2C5KT 2J4GA 2LT3A 1N33T 3CWZB 2ZM6T 3RC3A 2OV9A 1O3XA 2UUBT 4COFA 5J2UE 4MFRA 3JAFA 4TWHA 3ZT5A 1MMGA 1HTJF 4UV9B 3DJBA 2LKHA 1MIWA 2L9QA 5L47A 2X68A 3GWHA 3FZHB 2LSKA 2XAJB 4A97A 3UUMA 4DMWA 4I4TE 2H3RA 1KK7A 3N9LA 3KVBA 3AA7B 2W61A 3AB3B 2DCFA 2H7VC 4DV7T 2UXXB 4HWCA 4DO0A 3MXZA 5LB7B 3RH3A 5FXZA 4ZS3A 4NIQA 4F6RC 3ONJA 1MNDA 3C98B 4B3TT 2LJLA 5IUXA 3JC6C 5AQTB 4OFZA 2IDOB 4DR4T 1G73A 4M1PA 3EDUA 2JJ9A 2V26A 5LHIB 2MOZA 1MIVA 5LGUB 2NW8A 2XJ7A 2BVLA 3RI5A 2K24A 5FP3A 2XHEB 4YSYA 3ZC1A 2C5IT 3OYZA 2W2UA 4HFIA 4B3MT 4AKRB 3OBVE 4DR5T 3MJXA 2IW5B 3NRXA 3JC6D 5JR9B 4UEMA 2JQHA 4IL9A 1HF8A 4GKJT 4F8HA 1EZ3A 5LA6E 2KLQA 4QWNB 5ETWA 3ONLC 4PFPA 4YJ2E 4QXCB 2V6XA 5AQSB 2CHOA 3FBZA 2N1GA 5JH7E 5A1LA 2PFVA 3B5MA 2VL0A 3AE8A 4ANJA 2YDRA 5J1GA 4Z91A 3R6NA 3MZKB 4DBQA 2XAFB 3G06A 3SS1A 1UUSA 2QGSA 4ZHQE 3Q2MA 4U72A 2XY8B 5F3JA 5JR9C 1T72A 2WAUA 5TAOA 3ZN0B 5GONE 2DHRA 3OYXA 1SA0E 4MLKA 2XQ7A 2ZM2A 2NTXA 4TN7B 4QH1A 1E7PA 4YT0A 2LRLA 3KBTA 2BS4A 4ASKA 5LGTB 3WI3A 1VRBA 4H63V 1OEDB 3P4PA 4PK4A 1J5WA 2WS3A 5L2LA 2IC6A 3HR0A 2D0UA 4I55E 4OK0A 2HHHT 2KNDA 5LMUT 2V6YA 2UXDT 3LK2B 1ZOYA 1R8IA 5LXTE 1WLXA 3HKDE 5HEGA 2CXFA 4EIWA 3O9XA 2IAKA 5HWXA 3D0TA 1X9BA 2L3LA 5LG3A 3H3MA 1US7B 2C0SA 2IMLA 4X64T 2XQ5A 3LBXB 1N32T 1YW0A 2J1DG 2LSJA 4HFDA 3HKEE 1VCTA 2CA5A 4DBRA 4YSXA 1FJGT 3ZYMA 2MAWA 1OEDC 3RQUA 3N9NA 3CKDA 5LJNA 4AKLA 5HCJA 3PUAA 4EAHA 4YTMA 5LBQB 4TX5A 4KBMB 3V5SA 3RIAA 3ZKRA 2UXBT 2JQKA 3EUHA 3Q5EA 4XBFB 4HFVA 2H88A 3LSVA 4CI2B 5AQLB 3O1IA 3J9X1 2CPTA 4IDZA 1HNZT 3MK7C 2BVMA 2ACZA 4JV5T 1BR2A 2V7LA 1E2AA 2IHR1 3UFEA 3LK3B 4AQFC 3VR9A 2BBHA 2EHOB 3FZLB 3ZCIA 3O1JA 5AFUL 3VRBA 3KVAA 2LSYA 2Z6EA 4B3RT 1KFYA 3N2GE 4CXYA 2ZLYA 5F5WA 4EZ4A 1HS7A 1SUMB 4CN6A 3DTOA 3PE0A 2BBJA 2XSBA 4K0KT 4P09A 4L0RA 4AQFA 2X9WA 2HN1A 2XTLA 1BR1A 2I59A 4EYYR 4YHJA 3VKGA 4GOUA 2EHOC 3GN5A 4X1YE 2NR4A 2ACXA 4PJNA 1M62A 4DVDA 1L0VA 4E7SA 3C4XA 3ZYLA 1HG5A 2DLRA 1DU2A 5IHYA 1SHZC 1YKHB 4HGAA 4IHJE 5HXHA 2KMFA 2CBJA 3WAJA 3OJAA 4UF0B 3C4WA 4EB6E 4ILUA 1MMDA 3RYFE 4DR7T 4BJNA 1IBKT 5FKYA 3CX6B 2NW9A 3RKOA 2X66A 3ZPOA 5AQPB 2MYSA 4JLEA 4IGUA 3RIFA 2EHOA 2X9HA 2X9XA 3LG7A 5LMNT 2E5LT 2YEVC 3RYCE 3AEGA 4DMVA 4DR2T 1KNRA 4ILCA 5FL0A 5M4YA 4IIJE 5DQVA 2YDQA 3I0QA 2BKNA 3CIRA 2CE7A 3KV6A 2C5JA 5EZYE 4YTNA 3K1SA 2VASA 3U78A 2A72A 2B1EA 4FI5A 2YKSA 5CJ5A 3TLTA 1HFAA 5AQQB 3GA8A 3AEEA 2XASB 2I0MA 1M7KA 3ETUA 1UX5A 5JRCA 3BQIA 4CI3B 1HG2A 3CQGB 3TLUA 4ZZCA 2NOXA 4HE8A 2W62A 1W0AA 4MALA 4ZI3C 3W15B 5L3CB 2V5CA 2NW7A 2CHNA 1WR0A 3UQ7A 3TLVA 3ABVA 4JI4T 3AE5A 2L8KA 4YY3T 4X20E 3RPUA 5FXXA 5AQFB 4X1KE 2IC9A 2XQ9A 3AE9A 4AXPA 5BMVE 4KMCA 2KZ7B 3RRCA 2W00A 3PU3A 4ZI7E 1S94A 4Z8XA 2LSIA 4GYRA 1HX1B 4G2AA 1T98A 3F57A 4DV0T 4ZI3D 5CA1E 1NENA 4JI3T 4DV5T 1NAFA 3F2EA 3B57A 1Z8UA 4TWDA 4TNVA 2BS3A 4ILAA 4UIGA 3OTOT 4IDNA 5AQOB 3UU4A 2LE8A 1WYBA 1HR0T 4EZHA 2BS2A 2YU1A 3QUJA 2QVAA 4JUYA 4QHOA 5LOVE 2LEHA 4DR1T 2WWVA 3Q5WA 3EVYA 4TUYE 3RRWA 4EV6A 1S35A 4Q25A 4MBQA 5L3GB 5HCMA 4C90A 2LOPA 4UELA 2JQQA 5FNVE 1LVFA 3ZSSA 1QLBA 5F8PA 3KDSE 3VKHA 4O4JE 2UXNB 3QB5K 2BG9E 4X5TA 1OEDE 4UVAB 2E5VA 4YHHT 4LMKA 4DV1T 1NEKA 2K3WA 4JI6T 2V7KA 3AAEB 2D0TA 4NUUA 2E9XB 2WQYA 3L8RA 5LCYA 4NXMT 4U2YA 3UFGA 1LRZA 3N2KE 3EHZA 3RF1A 4G63A 5JDQA 4CQIA 3UT5E 3RKGA 4FJOA 4H9OC 3CVRA 3P8CD 3RYHE 2AXDS 3ZJ1A 2XUEA 1I94T 1FEWA 1MMNA 3AE2A 2ZMAA 4KP3C 2V6YB 3ZMUB 4MHCA 3IBPA 3NZPA 3H37A 4QXHB 4PK6A 2YOEA 4YJ3E 4UV8B 3LFMA 1XDOA 4YSZA 3K8PC 4EEDA 3AE3A 1Z0PA 4I50E 4I43B 4CXXA 3ZJ2A 2UU9T 2MBGA 4U3CA 3QK6A 2I6HA 1MNEA 4PJJA 4LF4T 4JEHB 5JDLA 4AQGA 4LF9T 2V7MA 3P50A 3QB5A 3C4ZA 4WNKA 5AQUB 2W63A 3T8OA 3ZCJA 4HFCA 2K5BB 3P4RA 2E9XA 3NWIA 4U74A 4B6XA 2M6BA 2KWHA 3PTRB 2WCAA 3N9MA 3AE6A 2W67A 3Q9DA 2XZEA 4JYAT 1XDPA 2V5DA 3ZYKA 2PTFA 2X51A 3JAEA 3LK42 2RA1A 1Y64B 3P4WA 2KT9A 4H9SE 1ZP0A 3T1HT 4HFEA 2RPAA 3K3OA 4O2AE 4QX7B 3AA6B 3NVOA 4NPPA 3A5XA 4O8SA 3K3QC 3QC9A 5AQMB 1X79A 2VQET 3AXJA 4JI0T 5LBMA 5FMNA 3CMLA 3I9WA 4A98A 2MTQA 2A2FX 2LOSA 5FY1A 3DP7A 4ILBA 3I9YA 2HH7A 1J1JA 3RHWA 1UCUA 5HXCA 2V7JA 1FMVA 4AKHA 5JTGA 5L4HA 5L3EB 2P9BA 3AAIA 3K3NA 4KUMB 4A5XA 2PBIA 2WU2A 3CX7B 3UUBA 1KF6A 5CFBA 4IE6A 3GN5B 3NRYA 4HFHA 3ZMSB 4U7YA 4CN1A 3SOLA 3KV5A 5JDHA 5ABFA 4X65T 2WB5A 4N78D 3HKCE 4OYJA 4JI8T 2WM9A 4PK5A 2VVNA 2LHRA 3IEEA 2LM9A 1JNRA 1KNPA 3PURA 3EAMA 3VU7H 3WAKA 2WSSV 4AIUA 2DWKA 2WP9A 1VCSA 2CLYB 1VOMA 2YN6A 5HXSA 2FJDA 1I6ZA 4KI0F 4JEUB 3VRAA 2BG9A 4L9IA 4H9QC 2ODVA 3ETVA 5FVLA 2VK9A 2YINA 4L5GA 1FMWA 3M3ZB 4QH5A 3ESLA 2XQYA 2XSAA 2XPKA 4DUZT 2CXDA 3F31A 4ZEYA 2Y6XA 4WZXA 2CLYC 2J62A 2CCQA 5HXRA 2G0UA 5J0ZA 5JRCB 1OXZA 5ABEA 3PDYA 1XZYA 3T1YT 3QNUA 4GIWA 3ZMZB 3FZMB 2CBIA 1W09A 3KV4A 4ZOLE 3AAAB 2CMRA 3AVSA 4LFBT 4OX9T 2LRKA 1N36T 4WBNE 3EDVA 2HPLA 4DR6T 4X1IE 4H9RC 3OVUA 4HWHA 4K0UA 5KXJA 4EYUA 5AQGB 3UUNA 1H7CA 4LFCT 2EHOD 3ANWA 2R6GF 5ABHA 1B7TA 5JQGE 4GYSA 3RC8A 5JREA 2CM0A 2LM2A 4LFAT 2A3DA 4C91A 5HXEA 3N9PA 3JCFA 2UUAT 3RIUC 4DV3T 3QOFA 2KXPB 3P4QA 3E0ZA 2JQ9A 4IDPA 4PJLA 4AQYT 3KV9A 5AQKB 2WWUA 5EK3A 3AEAA 2Y48B 5FY0A 4JI1T 3CK6A 4Z90A 5AQJB 4O4LE 2XQ3A 2WMOA 2D9DA 2N9DA 2CWYA 5ABGA 4P0BA 3RIUA 2WZHA 5LHHB 4IT4A 1HNWT 3FZFB 3LJCA 3AE1A 4YTPA 2ZM0A 5HAXA 3P4SA 4U33A 2DWGA 4PJMA 5AQRB 2WZIA 2X67A 3VHLA 3BQKA 2FJAA 4QXBB 4QKNA 3TLWA 1UURA 4TV8E 3ZEFB 2VURA 5EK4A 3B13A 4KHPT 4O4HE 1WCRA 3KBUA 1IJ5A 2LSGA 4ZXLA 5J2TE 3CQCB 1UGOA 5FY7A 4A56A 2QRXA 5HEUA 4H9PC 2D5UA 5AQVB 5ADXL 2BKPA 3MKDA 2FUPA 1KEYA 2OLTA 2UUCT 4IE5A 5AQNB 3A8YC 4H9NC 1CUNA 2QYWA 2IIUA 3ZN1B 2BZBA 3SFDA 1CHUA 2Q9QA 3L39A 3N5LA 5DJQC 1IBMT 5LJMA 4X66T 5AQHB 2JPFA 3KINB 5HYAA 3X1DA 1WYCA 2A9UA 2V1DB 2AE9A 5HWYA 3ZC0A 2H89A 4CZZB 5CGMA 5FL1A 4IE0A 4KX6A 5CA0E 1YXRA 1MIYA 5IYZE 4IREA 4GK0E 2W66A 3NBXX 5L3FB 1Y01A 3HKBE 2ES0A 2SPCA 1QUUA 3IF8B 3PUQA 5KMGP 2F4VT 4AKIA 1QSDA 2DNXA 3AEDA 3OPCA 3UTKA 3TKLB 2VWAA 2VKDA 2VB6A 2FJEA 4P1NA 2E8IA 3C50A 3HL6A 3GMIA 3HI2A 3Q5XA 3ONXA 3OKQA 2QA7A 1JNZA 2CRBA 4E7ZA 1ZKEA 4CN4A 3RLFF 4OHFA 3CQXC 2X0YA 3PUSA 4GK5E 3RQWA 2VKJA 2YU2A 4JI2T 1YKEB 3O4XE 2X9YA 1ZHCA 2DL1A 3BK9A 4ZZBA 5H6RB 3FZKB 3HA4A 5FVKA 1HX8A 4UXNB 2J47A 2CEAA 3AXJB 5LGNB 3PUWF 2E9XC 3IHRA 4PNIA 3VR8A 4V1Av 2WU5A 2VKOA 5LHGB 5HEJA 4QH4A 3AEFA 3UUXB 4B3ST 3UU8A 1XMOT 2IUBA 4DNDA 1AJ3A 2PJQA 2JMHA 1D0YA 3E22E 4HWFA 5L3DB 2LHNA 1WRDA 4O2BE 2E9XD 2XAQB 3PJAA 3UQ4A 4GKKT 2RP4A 3MA9A 4XZCA 5KDMC 5ABFB 4U7IA 3NKZA 2WBLA 2NTYA 3ZT7A 2PG8A 4OYKA 4AKGA 4IDQA 2K48A 5LYJE 3CX8B 5JDFA 4BAYB 5FXWA 1XMQT 4WW0A 1IBLT 4LF6T 2WDVA 4EEBA 2YK0A 2M6IA 4HKAA 1YD8G 2BG9B 1XWMA 2FJBA 1KNZA 3H3AA 3L09A 2NWBA 4CI1B 3PUVF 5JVDE 1W0BA 5JR9A 1U5PA 3N9QA 4IE7A 4HTEA 1FIOA 4KHZF 1LVKA 5KX5E 4TNWA 2V7IA 4YXDA 3BQLA 2VQFT 2W0GA 3FXDB 4WYVA 5C3JA 5IWAT 4LMJA 1W9RA 2HN2A 2XQ6A 2BG9C 4CXWA 5C2TA 2LKGA 3CPZA 1N34T 4ZI2C 4HWIB 4ADZA 3RYIE 2XQAA 4LF8T 3RX6A 2E2AA 3ZMTB 4DV2T 4ZS2A 3C51A 1T8BA 3V5UA 4HFBA 1XNRT 4LF5T 1WFDA 5BR8T 4DV4T 1V9DA 4JBWF 2YDSA 5H6QB 3C64A 2BDEA 3ANWB 5DABA 4WBOA 2NP9A 2XAHB 2XM2A 1OEDA 3S4UA 1D1BA 5AQIB 5HEOA 3IA3A 3Q5DA 4ZI2D 3E08A 1IZNB 4XAXB 2OA5A 1ZV4X 4O4IE 5E0OA 3I1AA 3PUGA 5JDMA 1BR0A 5JDNA 5FYMA 4H63H 4P0AA 3UULA 4JI7T 3LBXA 3RGLA 1LKXA 2XQ4A 3NZQA 2JIWA 5LP6E 3U3IA 4EGWA 4AI6A 1E1HB 2KINB 4DUYT 4ISTA 1T7SA 5LG4A 3N9OA 3FBLA 4IDOA 1D1AA 2JMKA 5DQWA 4HN9A 4ISSA 4LMLA 2LLYA 2FBWA 5L3BB 3SFEA 2XAGB 4HEAA 3M65A 3PUXF
chains in the Genus database with same CATH topology
2L3LA 3AA0B 3KBUA 1IJ5A 4FJOA 4H9OC 2LSGA 3CVRA 1US7B 2C0SA 3P8CD 3RYHE 5J2TE 3LBXB 3ZJ1A 2XUEA 3CQCB 4UVCB 3FB2A 5FY7A 4A56A 1YW0A 2J1DG 1FEWA 2LSJA 4H9PC 5JDGA 3HKEE 2D5UA 1MMNA 2WMNA 5ADXL 2CA5A 3MKDA 2ZMAA 4DBRA 2KWIB 4KP3C 2GK9A 4ERRA 3ZYMA 1WR6A 4TZ4C 4IE5A 3ZMUB 1IJ6A 3IBPA 4MHCA 4H9NC 3ZLIA 3NZPA 1CUNA 3N9NA 3H37A 3MACA 4QXHB 3ZN1B 2BZBA 4PK6A 3R84B 3SWHA 3CKDA 4UV8B 4YJ3E 3KFWX 4YFSA 5LJNA 4PW8A 4AKLA 2Q9QA 3LFMA 3AA1B 2VL8A 3P7IA 3PUAA 4EAHA 5LBQB 3J7Yq 3K8PC 3ZMVB 4TX5A 3N5LA 4KBMB 3V5SA 4EOZB 5DJQC 1Z0PA 4I50E 3EUHA 4XBFB 4I43B 1D0ZA 4HFVA 4CXXA 5LJMA 3ZJ2A 2DI4A 2MBGA 5FXVA 3QK6A 5EK2A 2JPFA 1MNEA 4CI2B 3KINB 5HYAA 4PJJA 2Y8DA 3O1IA 4JEHB 3J9X1 1WYCA 2V1DB 4AQGA 4IDZA 5HWYA 5JDLA 3MK7C 2V7MA 2BVMA 3ZC0A 4CZZB 1NWMX 4IE0A 1BR2A 2V7LA 5CA0E 3C4ZA 4WNKA 2Q9QB 4IE4A 2W63A 3T8OA 3ZCJA 1MIYA 5IYZE 2CWOA 2K5BB 4NUVA 2JRKA 3UFEA 3LK3B 4AQFC 2E9XA 4GK0E 5LNKA 5C8YE 2N2NA 4U74A 4B6XA 2X0LB 2KWHA 3NBXX 5L3FB 3PTRB 3HKBE 2ES0A 2EHOB 1D1CA 2SPCA 3N9MA 1QUUA 1D0XA 3IF8B 3ZCIA 3PUQA 3O1JA 5KMGP 1BR4A 3Q9DA 5AFUL 4J2CA 3ZYKA 2X51A 4BA9A 4AKIA 2K9AA 3LK42 1QSDA 3KVAA 2RA1A 2DNXA 1Y64B 4H9SE 2KT9A 3UTKA 3TKLB 2LSYA 2Z6EA 2ODUA 3AVRA 2VWAA 2HPJA 3N2GE 2VKDA 2VB6A 4CXYA 2ZLYA 4TV9E 2E8IA 3K3OA 4EZ4A 1HS7A 4O2AE 4QX7B 3AA6B 3C50A 3A5XA 3HL6A 5CB4E 3DTOA 4O8SA 2VKHA 1UX4A 3K3QC 3QC9A 3GMIA 4EXTA 3HI2A 3PE0A 1X79A 3ONXA 3Q5XA 2Q9QC 3OKQA 2QA7A 2ZM8A 4P09A 4L0RA 4AQFA 4E7ZA 1ZKEA 2X9WA 4UF0A 2XTLA 3PU8A 1BR1A 5LBMA 2I59A 4OHFA 5FMNA 1IAPA 3CQXC 4EYYR 3CMLA 3FHNA 3PUSA 4GK5E 3I9WA 2VKJA 2MTQA 2YU2A 4YHJA 4GOUA 2A2FX 3VKGA 2LOSA 5FY1A 1YKEB 2EHOC 3GN5A 4X1YE 4PFOA 2ACXA 4PJNA 2CXLA 3FXEB 3DP7A 3I9YA 4UVBB 4DVDA 2HH7A 3N2OA 3O4XE 4E7SA 1UCUA 5HXCA 2V7JA 2X9YA 1ZHCA 3C4XA 3ZYLA 1ZEEA 1FMVA 4AKHA 3BK9A 1HG5A 2DLRA 5H6RB 5IHYA 5L3EB 3HA4A 4BJMA 1SHZC 2P9BA 4QX8B 1HX8A 1YKHB 1U4QA 4HGAA 4IHJE 3L3PA 4UXNB 5HXHA 2CEAA 2KMFA 3AAIA 3K3NA 4KUMB 5LGNB 3I0OA 2PBIA 3WAJA 3OJAA 4UF0B 2E9XC 1G8XA 3CX7B 3C4WA 3IHRA 4PNIA 4EB6E 1HCIA 4V1Av 4PAGA 4ILUA 1MMAA 2Q9QD 2VKOA 5LHGB 1MMDA 3RYFE 4BJNA 4IE6A 3GN5B 3NRYA 3CX6B 2NW9A 3O1HA 1OWAA 3RKOA 3UUXB 2X66A 3SRZA 3ZPOA 2MYSA 4JLEA 3ZMSB 2H7OA 4IGUA 2M67A 2EHOA 2X9HA 2X9XA 3LG7A 4YLHA 3SOLA 2YEVC 2D2SA 2C5KT 3KV5A 3RYCE 4DMVA 5JDHA 4DNDA 1AJ3A 2PJQA 2JMHA 2LT3A 1D0YA 3CWZB 4N78D 3E22E 3RC3A 3HKCE 4OYJA 1O3XA 2WM9A 5L3DB 4PK5A 5M4YA 3IEEA 2LHRA 5J2UE 2LM9A 4MFRA 4IIJE 5DQVA 1MMGA 1HTJF 4UV9B 3DJBA 3I0QA 3PURA 1MIWA 2CE7A 2LHNA 1WRDA 3VU7H 3WAKA 2WSSV 2L9QA 4O2BE 2E9XD 3KV6A 2C5JA 5EZYE 2DWKA 2XAQB 2X68A 2VASA 3U78A 2A72A 2CLYB 1VOMA 3GWHA 2B1EA 5HXSA 2LSKA 2RP4A 3MA9A 4FI5A 2XAJB 4JEUB 4XZCA 5KDMC 4L9IA 3UUMA 4H9QC 2WBLA 1HFAA 4DMWA 2NTYA 3GA8A 4I4TE 2ODVA 2H3RA 1KK7A 2XASB 3N9LA 3KVBA 3AA7B 2W61A 3AB3B 3ETUA 1UX5A 2DCFA 2H7VC 3ETVA 5JRCA 2UXXB 2PG8A 3BQIA 2VK9A 4OYKA 4CI3B 4AKGA 4DO0A 2YINA 3MXZA 1HG2A 2K48A 3CQGB 4L5GA 5LYJE 1FMWA 3CX8B 5JDFA 3RH3A 4BAYB 5FXWA 5FXZA 3ESLA 2NOXA 4ZS3A 4HE8A 4WW0A 2W62A 2XQYA 2YK0A 2CXDA 4F6RC 1MNDA 4MALA 3F31A 4HKAA 3C98B 1YD8G 4ZI3C 2LJLA 3W15B 2Y6XA 5L3CB 2NW7A 3JC6C 2CLYC 4OFZA 1KNZA 2CCQA 3H3AA 1G73A 5HXRA 4M1PA 3EDUA 2G0UA 2NWBA 3L09A 4CI1B 5JRCB 1OXZA 2JJ9A 3PDYA 5JVDE 2V26A 5JR9A 5LHIB 2L8KA 2MOZA 1MIVA 4GIWA 3ZMZB 5LGUB 2NW8A 4X20E 1U5PA 3RPUA 3N9QA 5FXXA 2BVLA 4IE7A 4X1KE 2IC9A 4HTEA 1FIOA 2K24A 5FP3A 2XHEB 3ZC1A 1LVKA 5KX5E 3KV4A 4ZOLE 4AXPA 3AAAB 2C5IT 4KMCA 2CMRA 5BMVE 2KZ7B 3OYZA 3AVSA 3RRCA 2W00A 3PU3A 2V7IA 4ZI7E 4AKRB 3OBVE 1S94A 3BQLA 4Z8XA 4WBNE 2W0GA 3FXDB 3EDVA 3MJXA 2LSIA 2HPLA 4GYRA 4X1IE 2IW5B 4H9RC 4G2AA 1T98A 3F57A 4ZI3D 3NRXA 4K0UA 4CXWA 4EYUA 3JC6D 5CA1E 5JR9B 3CPZA 3UUNA 1H7CA 4ZI2C 2EHOD 3ANWA 4UEMA 1B7TA 4ADZA 5JQGE 4GYSA 3RYIE 1HF8A 1NAFA 3F2EA 3RX6A 1EZ3A 3B57A 3RC8A 3ZMTB 5JREA 5LA6E 2KLQA 2CM0A 4QWNB 5ETWA 4PFPA 4ZS2A 4YJ2E 3C51A 4QXCB 4UIGA 2A3DA 3FBZA 4C91A 3V5UA 2N1GA 5HXEA 5JH7E 5A1LA 2LE8A 1WYBA 3N9PA 2PFVA 2KXPB 4ANJA 4EZHA 5J1GA 1V9DA 2YU1A 3E0ZA 3R6NA 3MZKB 3QUJA 5H6QB 4JUYA 4QHOA 5LOVE 4DBQA 2XAFB 2BDEA 2LEHA 3C64A 4PJLA 3SS1A 2QGSA 3KV9A 2WWUA 3Q5WA 3ANWB 5EK3A 4ZHQE 5DABA 3EVYA 4WBOA 2NP9A 4TUYE 2Y48B 5FY0A 2XAHB 3RRWA 3S4UA 3Q2MA 1D1BA 1S35A 4MBQA 4U72A 5F3JA 5JR9C 4O4LE 4ZI2D 3E08A 2WAUA 5L3GB 1IZNB 4XAXB 5TAOA 2OA5A 1ZV4X 3ZN0B 4C90A 5GONE 4O4IE 5E0OA 2DHRA 2LOPA 3OYXA 4UELA 2JQQA 5FNVE 1LVFA 3I1AA 2WMOA 1SA0E 3PUGA 5JDMA 5F8PA 3KDSE 3VKHA 4O4JE 1BR0A 2N9DA 5JDNA 2UXNB 4MLKA 5FYMA 2CWYA 2ZM2A 2NTXA 4H63H 4TN7B 4P0BA 4UVAB 4P0AA 3UULA 3KBTA 3LBXA 4ASKA 1LKXA 3WI3A 5LHHB 5LGTB 3NZQA 1VRBA 3LJCA 5LP6E 4H63V 3U3IA 4AI6A 1E1HB 2V7KA 2KINB 2ZM0A 2D0TA 3AAEB 5HAXA 4NUUA 4PK4A 4ISTA 2E9XB 5L2LA 5LG4A 2IC6A 3N9OA 3HR0A 2DWGA 3FBLA 2D0UA 4I55E 4OK0A 4PJMA 1D1AA 2KNDA 2X67A 5LCYA 2JMKA 5DQWA 3VHLA 4HN9A 3BQKA 4QXBB 4ISSA 3LK2B 4QKNA 1LRZA 5LXTE 1WLXA 3HKDE 4TV8E 3ZEFB 5L3BB 2CXFA 4EIWA 3N2KE 5EK4A 2XAGB 3O9XA 3B13A 2IAKA 4G63A 4HEAA 5HWXA 3M65A 5JDQA 4CQIA 3UT5E 3D0TA 4O4HE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0U A;  4A56 A;  3SOL A;  3UTK A; 
#chains in the Genus database with same CATH topology
 3AA0 B;  4UVC B;  3FB2 A;  3AE7 A;  5JDG A;  2WMN A;  2KWI B;  4X62 T;  2GK9 A;  4ERR A;  1WR6 A;  4TZ4 C;  1IJ6 A;  3ZLI A;  3PJA J;  5HEH A;  3MAC A;  2VVS A;  3R84 B;  3SWH A;  4YFS A;  3KFW X;  4PW8 A;  4DV6 T;  3AA1 B;  4U31 A;  2VL8 A;  3P7I A;  3PUZ F;  3J7Y q;  3ZMV B;  3UU6 A;  4EOZ B;  3LDQ B;  2MPK A;  1D0Z A;  2X0H A;  3TLS A;  2DI4 A;  5FXV A;  5EK2 A;  4DR3 T;  2W4X A;  1XNQ T;  1UK5 A;  2Y8D A;  2KSR A;  4HWD A;  3A7M A;  3JAD A;  2UXC T;  1NWM X;  4TWF A;  3ZT6 A;  2Q9Q B;  4IE4 A;  1J5E T;  2CWO A;  3PUY F;  4NUV A;  2JRK A;  5LNK A;  5C8Y E;  2N2N A;  2B76 A;  2X0L B;  2WY2 A;  2V8S V;  1D1C A;  1D0X A;  2XM1 A;  4NXN T;  1BR4 A;  4J2C A;  4BA9 A;  2K9A A;  3PV0 F;  3AEB A;  2ODU A;  3AVR A;  3UU3 A;  1GQE A;  3UU5 A;  2HPJ A;  2BKO A;  4TV9 E;  3EAB A;  5CB4 E;  4U2Z A;  2VKH A;  1UX4 A;  4I0U A;  4EXT A;  4UR9 A;  2Q9Q C;  2ZM8 A;  1HNX T;  4UF0 A;  3PU8 A;  1IAP A;  4IL4 A;  3FHN A;  4PFO A;  2CXL A;  3FXE B;  4UVB B;  3N2O A;  2WDR A;  1ZEE A;  4BJM A;  4QX8 B;  1U4Q A;  3L3P A;  1YQ3 A;  3I0O A;  4DID B;  2XQ8 A;  4JI5 T;  1G8X A;  1HCI A;  5L4E A;  3AEC A;  4PAG A;  1SE7 A;  3EI0 A;  1MMA A;  2Q9Q D;  3O1H A;  1OWA A;  3AE4 A;  2WDQ A;  3SRZ A;  2H7O A;  4YLH A;  2M67 A;  1YQ4 A;  4AIS A;  3ZST A;  4LF7 T;  2D2S A;  2C5K T;  2J4G A;  2LT3 A;  1N33 T;  3CWZ B;  2ZM6 T;  3RC3 A;  2OV9 A;  1O3X A;  2UUB T;  4COF A;  5J2U E;  4MFR A;  3JAF A;  4TWH A;  3ZT5 A;  1MMG A;  1HTJ F;  4UV9 B;  3DJB A;  2LKH A;  1MIW A;  2L9Q A;  5L47 A;  2X68 A;  3GWH A;  3FZH B;  2LSK A;  2XAJ B;  4A97 A;  3UUM A;  4DMW A;  4I4T E;  2H3R A;  1KK7 A;  3N9L A;  3KVB A;  3AA7 B;  2W61 A;  3AB3 B;  2DCF A;  2H7V C;  4DV7 T;  2UXX B;  4HWC A;  4DO0 A;  3MXZ A;  5LB7 B;  3RH3 A;  5FXZ A;  4ZS3 A;  4NIQ A;  4F6R C;  3ONJ A;  1MND A;  3C98 B;  4B3T T;  2LJL A;  5IUX A;  3JC6 C;  5AQT B;  4OFZ A;  2IDO B;  4DR4 T;  1G73 A;  4M1P A;  3EDU A;  2JJ9 A;  2V26 A;  5LHI B;  2MOZ A;  1MIV A;  5LGU B;  2NW8 A;  2XJ7 A;  2BVL A;  3RI5 A;  2K24 A;  5FP3 A;  2XHE B;  4YSY A;  3ZC1 A;  2C5I T;  3OYZ A;  2W2U A;  4HFI A;  4B3M T;  4AKR B;  3OBV E;  4DR5 T;  3MJX A;  2IW5 B;  3NRX A;  3JC6 D;  5JR9 B;  4UEM A;  2JQH A;  4IL9 A;  1HF8 A;  4GKJ T;  4F8H A;  1EZ3 A;  5LA6 E;  2KLQ A;  4QWN B;  5ETW A;  3ONL C;  4PFP A;  4YJ2 E;  4QXC B;  2V6X A;  5AQS B;  2CHO A;  3FBZ A;  2N1G A;  5JH7 E;  5A1L A;  2PFV A;  3B5M A;  2VL0 A;  3AE8 A;  4ANJ A;  2YDR A;  5J1G A;  4Z91 A;  3R6N A;  3MZK B;  4DBQ A;  2XAF B;  3G06 A;  3SS1 A;  1UUS A;  2QGS A;  4ZHQ E;  3Q2M A;  4U72 A;  2XY8 B;  5F3J A;  5JR9 C;  1T72 A;  2WAU A;  5TAO A;  3ZN0 B;  5GON E;  2DHR A;  3OYX A;  1SA0 E;  4MLK A;  2XQ7 A;  2ZM2 A;  2NTX A;  4TN7 B;  4QH1 A;  1E7P A;  4YT0 A;  2LRL A;  3KBT A;  2BS4 A;  4ASK A;  5LGT B;  3WI3 A;  1VRB A;  4H63 V;  1OED B;  3P4P A;  4PK4 A;  1J5W A;  2WS3 A;  5L2L A;  2IC6 A;  3HR0 A;  2D0U A;  4I55 E;  4OK0 A;  2HHH T;  2KND A;  5LMU T;  2V6Y A;  2UXD T;  3LK2 B;  1ZOY A;  1R8I A;  5LXT E;  1WLX A;  3HKD E;  5HEG A;  2CXF A;  4EIW A;  3O9X A;  2IAK A;  5HWX A;  3D0T A;  1X9B A;  2L3L A;  5LG3 A;  3H3M A;  1US7 B;  2C0S A;  2IML A;  4X64 T;  2XQ5 A;  3LBX B;  1N32 T;  1YW0 A;  2J1D G;  2LSJ A;  4HFD A;  3HKE E;  1VCT A;  2CA5 A;  4DBR A;  4YSX A;  1FJG T;  3ZYM A;  2MAW A;  1OED C;  3RQU A;  3N9N A;  3CKD A;  5LJN A;  4AKL A;  5HCJ A;  3PUA A;  4EAH A;  4YTM A;  5LBQ B;  4TX5 A;  4KBM B;  3V5S A;  3RIA A;  3ZKR A;  2UXB T;  2JQK A;  3EUH A;  3Q5E A;  4XBF B;  4HFV A;  2H88 A;  3LSV A;  4CI2 B;  5AQL B;  3O1I A;  3J9X 1;  2CPT A;  4IDZ A;  1HNZ T;  3MK7 C;  2BVM A;  2ACZ A;  4JV5 T;  1BR2 A;  2V7L A;  1E2A A;  2IHR 1;  3UFE A;  3LK3 B;  4AQF C;  3VR9 A;  2BBH A;  2EHO B;  3FZL B;  3ZCI A;  3O1J A;  5AFU L;  3VRB A;  3KVA A;  2LSY A;  2Z6E A;  4B3R T;  1KFY A;  3N2G E;  4CXY A;  2ZLY A;  5F5W A;  4EZ4 A;  1HS7 A;  1SUM B;  4CN6 A;  3DTO A;  3PE0 A;  2BBJ A;  2XSB A;  4K0K T;  4P09 A;  4L0R A;  4AQF A;  2X9W A;  2HN1 A;  2XTL A;  1BR1 A;  2I59 A;  4EYY R;  4YHJ A;  3VKG A;  4GOU A;  2EHO C;  3GN5 A;  4X1Y E;  2NR4 A;  2ACX A;  4PJN A;  1M62 A;  4DVD A;  1L0V A;  4E7S A;  3C4X A;  3ZYL A;  1HG5 A;  2DLR A;  1DU2 A;  5IHY A;  1SHZ C;  1YKH B;  4HGA A;  4IHJ E;  5HXH A;  2KMF A;  2CBJ A;  3WAJ A;  3OJA A;  4UF0 B;  3C4W A;  4EB6 E;  4ILU A;  1MMD A;  3RYF E;  4DR7 T;  4BJN A;  1IBK T;  5FKY A;  3CX6 B;  2NW9 A;  3RKO A;  2X66 A;  3ZPO A;  5AQP B;  2MYS A;  4JLE A;  4IGU A;  3RIF A;  2EHO A;  2X9H A;  2X9X A;  3LG7 A;  5LMN T;  2E5L T;  2YEV C;  3RYC E;  3AEG A;  4DMV A;  4DR2 T;  1KNR A;  4ILC A;  5FL0 A;  5M4Y A;  4IIJ E;  5DQV A;  2YDQ A;  3I0Q A;  2BKN A;  3CIR A;  2CE7 A;  3KV6 A;  2C5J A;  5EZY E;  4YTN A;  3K1S A;  2VAS A;  3U78 A;  2A72 A;  2B1E A;  4FI5 A;  2YKS A;  5CJ5 A;  3TLT A;  1HFA A;  5AQQ B;  3GA8 A;  3AEE A;  2XAS B;  2I0M A;  1M7K A;  3ETU A;  1UX5 A;  5JRC A;  3BQI A;  4CI3 B;  1HG2 A;  3CQG B;  3TLU A;  4ZZC A;  2NOX A;  4HE8 A;  2W62 A;  1W0A A;  4MAL A;  4ZI3 C;  3W15 B;  5L3C B;  2V5C A;  2NW7 A;  2CHN A;  1WR0 A;  3UQ7 A;  3TLV A;  3ABV A;  4JI4 T;  3AE5 A;  2L8K A;  4YY3 T;  4X20 E;  3RPU A;  5FXX A;  5AQF B;  4X1K E;  2IC9 A;  2XQ9 A;  3AE9 A;  4AXP A;  5BMV E;  4KMC A;  2KZ7 B;  3RRC A;  2W00 A;  3PU3 A;  4ZI7 E;  1S94 A;  4Z8X A;  2LSI A;  4GYR A;  1HX1 B;  4G2A A;  1T98 A;  3F57 A;  4DV0 T;  4ZI3 D;  5CA1 E;  1NEN A;  4JI3 T;  4DV5 T;  1NAF A;  3F2E A;  3B57 A;  1Z8U A;  4TWD A;  4TNV A;  2BS3 A;  4ILA A;  4UIG A;  3OTO T;  4IDN A;  5AQO B;  3UU4 A;  2LE8 A;  1WYB A;  1HR0 T;  4EZH A;  2BS2 A;  2YU1 A;  3QUJ A;  2QVA A;  4JUY A;  4QHO A;  5LOV E;  2LEH A;  4DR1 T;  2WWV A;  3Q5W A;  3EVY A;  4TUY E;  3RRW A;  4EV6 A;  1S35 A;  4Q25 A;  4MBQ A;  5L3G B;  5HCM A;  4C90 A;  2LOP A;  4UEL A;  2JQQ A;  5FNV E;  1LVF A;  3ZSS A;  1QLB A;  5F8P A;  3KDS E;  3VKH A;  4O4J E;  2UXN B;  3QB5 K;  2BG9 E;  4X5T A;  1OED E;  4UVA B;  2E5V A;  4YHH T;  4LMK A;  4DV1 T;  1NEK A;  2K3W A;  4JI6 T;  2V7K A;  3AAE B;  2D0T A;  4NUU A;  2E9X B;  2WQY A;  3L8R A;  5LCY A;  4NXM T;  4U2Y A;  3UFG A;  1LRZ A;  3N2K E;  3EHZ A;  3RF1 A;  4G63 A;  5JDQ A;  4CQI A;  3UT5 E;  3RKG A;  4FJO A;  4H9O C;  3CVR A;  3P8C D;  3RYH E;  2AXD S;  3ZJ1 A;  2XUE A;  1I94 T;  1FEW A;  1MMN A;  3AE2 A;  2ZMA A;  4KP3 C;  2V6Y B;  3ZMU B;  4MHC A;  3IBP A;  3NZP A;  3H37 A;  4QXH B;  4PK6 A;  2YOE A;  4YJ3 E;  4UV8 B;  3LFM A;  1XDO A;  4YSZ A;  3K8P C;  4EED A;  3AE3 A;  1Z0P A;  4I50 E;  4I43 B;  4CXX A;  3ZJ2 A;  2UU9 T;  2MBG A;  4U3C A;  3QK6 A;  2I6H A;  1MNE A;  4PJJ A;  4LF4 T;  4JEH B;  5JDL A;  4AQG A;  4LF9 T;  2V7M A;  3P50 A;  3QB5 A;  3C4Z A;  4WNK A;  5AQU B;  2W63 A;  3T8O A;  3ZCJ A;  4HFC A;  2K5B B;  3P4R A;  2E9X A;  3NWI A;  4U74 A;  4B6X A;  2M6B A;  2KWH A;  3PTR B;  2WCA A;  3N9M A;  3AE6 A;  2W67 A;  3Q9D A;  2XZE A;  4JYA T;  1XDP A;  2V5D A;  3ZYK A;  2PTF A;  2X51 A;  3JAE A;  3LK4 2;  2RA1 A;  1Y64 B;  3P4W A;  2KT9 A;  4H9S E;  1ZP0 A;  3T1H T;  4HFE A;  2RPA A;  3K3O A;  4O2A E;  4QX7 B;  3AA6 B;  3NVO A;  4NPP A;  3A5X A;  4O8S A;  3K3Q C;  3QC9 A;  5AQM B;  1X79 A;  2VQE T;  3AXJ A;  4JI0 T;  5LBM A;  5FMN A;  3CML A;  3I9W A;  4A98 A;  2MTQ A;  2A2F X;  2LOS A;  5FY1 A;  3DP7 A;  4ILB A;  3I9Y A;  2HH7 A;  1J1J A;  3RHW A;  1UCU A;  5HXC A;  2V7J A;  1FMV A;  4AKH A;  5JTG A;  5L4H A;  5L3E B;  2P9B A;  3AAI A;  3K3N A;  4KUM B;  4A5X A;  2PBI A;  2WU2 A;  3CX7 B;  3UUB A;  1KF6 A;  5CFB A;  4IE6 A;  3GN5 B;  3NRY A;  4HFH A;  3ZMS B;  4U7Y A;  4CN1 A;  3SOL A;  3KV5 A;  5JDH A;  5ABF A;  4X65 T;  2WB5 A;  4N78 D;  3HKC E;  4OYJ A;  4JI8 T;  2WM9 A;  4PK5 A;  2VVN A;  2LHR A;  3IEE A;  2LM9 A;  1JNR A;  1KNP A;  3PUR A;  3EAM A;  3VU7 H;  3WAK A;  2WSS V;  4AIU A;  2DWK A;  2WP9 A;  1VCS A;  2CLY B;  1VOM A;  2YN6 A;  5HXS A;  2FJD A;  1I6Z A;  4KI0 F;  4JEU B;  3VRA A;  2BG9 A;  4L9I A;  4H9Q C;  2ODV A;  3ETV A;  5FVL A;  2VK9 A;  2YIN A;  4L5G A;  1FMW A;  3M3Z B;  4QH5 A;  3ESL A;  2XQY A;  2XSA A;  2XPK A;  4DUZ T;  2CXD A;  3F31 A;  4ZEY A;  2Y6X A;  4WZX A;  2CLY C;  2J62 A;  2CCQ A;  5HXR A;  2G0U A;  5J0Z A;  5JRC B;  1OXZ A;  5ABE A;  3PDY A;  1XZY A;  3T1Y T;  3QNU A;  4GIW A;  3ZMZ B;  3FZM B;  2CBI A;  1W09 A;  3KV4 A;  4ZOL E;  3AAA B;  2CMR A;  3AVS A;  4LFB T;  4OX9 T;  2LRK A;  1N36 T;  4WBN E;  3EDV A;  2HPL A;  4DR6 T;  4X1I E;  4H9R C;  3OVU A;  4HWH A;  4K0U A;  5KXJ A;  4EYU A;  5AQG B;  3UUN A;  1H7C A;  4LFC T;  2EHO D;  3ANW A;  2R6G F;  5ABH A;  1B7T A;  5JQG E;  4GYS A;  3RC8 A;  5JRE A;  2CM0 A;  2LM2 A;  4LFA T;  2A3D A;  4C91 A;  5HXE A;  3N9P A;  3JCF A;  2UUA T;  3RIU C;  4DV3 T;  3QOF A;  2KXP B;  3P4Q A;  3E0Z A;  2JQ9 A;  4IDP A;  4PJL A;  4AQY T;  3KV9 A;  5AQK B;  2WWU A;  5EK3 A;  3AEA A;  2Y48 B;  5FY0 A;  4JI1 T;  3CK6 A;  4Z90 A;  5AQJ B;  4O4L E;  2XQ3 A;  2WMO A;  2D9D A;  2N9D A;  2CWY A;  5ABG A;  4P0B A;  3RIU A;  2WZH A;  5LHH B;  4IT4 A;  1HNW T;  3FZF B;  3LJC A;  3AE1 A;  4YTP A;  2ZM0 A;  5HAX A;  3P4S A;  4U33 A;  2DWG A;  4PJM A;  5AQR B;  2WZI A;  2X67 A;  3VHL A;  3BQK A;  2FJA A;  4QXB B;  4QKN A;  3TLW A;  1UUR A;  4TV8 E;  3ZEF B;  2VUR A;  5EK4 A;  3B13 A;  4KHP T;  4O4H E;  1WCR A;  3KBU A;  1IJ5 A;  2LSG A;  4ZXL A;  5J2T E;  3CQC B;  1UGO A;  5FY7 A;  4A56 A;  2QRX A;  5HEU A;  4H9P C;  2D5U A;  5AQV B;  5ADX L;  2BKP A;  3MKD A;  2FUP A;  1KEY A;  2OLT A;  2UUC T;  4IE5 A;  5AQN B;  3A8Y C;  4H9N C;  1CUN A;  2QYW A;  2IIU A;  3ZN1 B;  2BZB A;  3SFD A;  1CHU A;  2Q9Q A;  3L39 A;  3N5L A;  5DJQ C;  1IBM T;  5LJM A;  4X66 T;  5AQH B;  2JPF A;  3KIN B;  5HYA A;  3X1D A;  1WYC A;  2A9U A;  2V1D B;  2AE9 A;  5HWY A;  3ZC0 A;  2H89 A;  4CZZ B;  5CGM A;  5FL1 A;  4IE0 A;  4KX6 A;  5CA0 E;  1YXR A;  1MIY A;  5IYZ E;  4IRE A;  4GK0 E;  2W66 A;  3NBX X;  5L3F B;  1Y01 A;  3HKB E;  2ES0 A;  2SPC A;  1QUU A;  3IF8 B;  3PUQ A;  5KMG P;  2F4V T;  4AKI A;  1QSD A;  2DNX A;  3AED A;  3OPC A;  3UTK A;  3TKL B;  2VWA A;  2VKD A;  2VB6 A;  2FJE A;  4P1N A;  2E8I A;  3C50 A;  3HL6 A;  3GMI A;  3HI2 A;  3Q5X A;  3ONX A;  3OKQ A;  2QA7 A;  1JNZ A;  2CRB A;  4E7Z A;  1ZKE A;  4CN4 A;  3RLF F;  4OHF A;  3CQX C;  2X0Y A;  3PUS A;  4GK5 E;  3RQW A;  2VKJ A;  2YU2 A;  4JI2 T;  1YKE B;  3O4X E;  2X9Y A;  1ZHC A;  2DL1 A;  3BK9 A;  4ZZB A;  5H6R B;  3FZK B;  3HA4 A;  5FVK A;  1HX8 A;  4UXN B;  2J47 A;  2CEA A;  3AXJ B;  5LGN B;  3PUW F;  2E9X C;  3IHR A;  4PNI A;  3VR8 A;  4V1A v;  2WU5 A;  2VKO A;  5LHG B;  5HEJ A;  4QH4 A;  3AEF A;  3UUX B;  4B3S T;  3UU8 A;  1XMO T;  2IUB A;  4DND A;  1AJ3 A;  2PJQ A;  2JMH A;  1D0Y A;  3E22 E;  4HWF A;  5L3D B;  2LHN A;  1WRD A;  4O2B E;  2E9X D;  2XAQ B;  3PJA A;  3UQ4 A;  4GKK T;  2RP4 A;  3MA9 A;  4XZC A;  5KDM C;  5ABF B;  4U7I A;  3NKZ A;  2WBL A;  2NTY A;  3ZT7 A;  2PG8 A;  4OYK A;  4AKG A;  4IDQ A;  2K48 A;  5LYJ E;  3CX8 B;  5JDF A;  4BAY B;  5FXW A;  1XMQ T;  4WW0 A;  1IBL T;  4LF6 T;  2WDV A;  4EEB A;  2YK0 A;  2M6I A;  4HKA A;  1YD8 G;  2BG9 B;  1XWM A;  2FJB A;  1KNZ A;  3H3A A;  3L09 A;  2NWB A;  4CI1 B;  3PUV F;  5JVD E;  1W0B A;  5JR9 A;  1U5P A;  3N9Q A;  4IE7 A;  4HTE A;  1FIO A;  4KHZ F;  1LVK A;  5KX5 E;  4TNW A;  2V7I A;  4YXD A;  3BQL A;  2VQF T;  2W0G A;  3FXD B;  4WYV A;  5C3J A;  5IWA T;  4LMJ A;  1W9R A;  2HN2 A;  2XQ6 A;  2BG9 C;  4CXW A;  5C2T A;  2LKG A;  3CPZ A;  1N34 T;  4ZI2 C;  4HWI B;  4ADZ A;  3RYI E;  2XQA A;  4LF8 T;  3RX6 A;  2E2A A;  3ZMT B;  4DV2 T;  4ZS2 A;  3C51 A;  1T8B A;  3V5U A;  4HFB A;  1XNR T;  4LF5 T;  1WFD A;  5BR8 T;  4DV4 T;  1V9D A;  4JBW F;  2YDS A;  5H6Q B;  3C64 A;  2BDE A;  3ANW B;  5DAB A;  4WBO A;  2NP9 A;  2XAH B;  2XM2 A;  1OED A;  3S4U A;  1D1B A;  5AQI B;  5HEO A;  3IA3 A;  3Q5D A;  4ZI2 D;  3E08 A;  1IZN B;  4XAX B;  2OA5 A;  1ZV4 X;  4O4I E;  5E0O A;  3I1A A;  3PUG A;  5JDM A;  1BR0 A;  5JDN A;  5FYM A;  4H63 H;  4P0A A;  3UUL A;  4JI7 T;  3LBX A;  3RGL A;  1LKX A;  2XQ4 A;  3NZQ A;  2JIW A;  5LP6 E;  3U3I A;  4EGW A;  4AI6 A;  1E1H B;  2KIN B;  4DUY T;  4IST A;  1T7S A;  5LG4 A;  3N9O A;  3FBL A;  4IDO A;  1D1A A;  2JMK A;  5DQW A;  4HN9 A;  4ISS A;  4LML A;  2LLY A;  2FBW A;  5L3B B;  3SFE A;  2XAG B;  4HEA A;  3M65 A;  3PUX F; 
#chains in the Genus database with same CATH homology
 2L3L A;  3AA0 B;  3KBU A;  1IJ5 A;  4FJO A;  4H9O C;  2LSG A;  3CVR A;  1US7 B;  2C0S A;  3P8C D;  3RYH E;  5J2T E;  3LBX B;  3ZJ1 A;  2XUE A;  3CQC B;  4UVC B;  3FB2 A;  5FY7 A;  4A56 A;  1YW0 A;  2J1D G;  1FEW A;  2LSJ A;  4H9P C;  5JDG A;  3HKE E;  2D5U A;  1MMN A;  2WMN A;  5ADX L;  2CA5 A;  3MKD A;  2ZMA A;  4DBR A;  2KWI B;  4KP3 C;  2GK9 A;  4ERR A;  3ZYM A;  1WR6 A;  4TZ4 C;  4IE5 A;  3ZMU B;  1IJ6 A;  3IBP A;  4MHC A;  4H9N C;  3ZLI A;  3NZP A;  1CUN A;  3N9N A;  3H37 A;  3MAC A;  4QXH B;  3ZN1 B;  2BZB A;  4PK6 A;  3R84 B;  3SWH A;  3CKD A;  4UV8 B;  4YJ3 E;  3KFW X;  4YFS A;  5LJN A;  4PW8 A;  4AKL A;  2Q9Q A;  3LFM A;  3AA1 B;  2VL8 A;  3P7I A;  3PUA A;  4EAH A;  5LBQ B;  3J7Y q;  3K8P C;  3ZMV B;  4TX5 A;  3N5L A;  4KBM B;  3V5S A;  4EOZ B;  5DJQ C;  1Z0P A;  4I50 E;  3EUH A;  4XBF B;  4I43 B;  1D0Z A;  4HFV A;  4CXX A;  5LJM A;  3ZJ2 A;  2DI4 A;  2MBG A;  5FXV A;  3QK6 A;  5EK2 A;  2JPF A;  1MNE A;  4CI2 B;  3KIN B;  5HYA A;  4PJJ A;  2Y8D A;  3O1I A;  4JEH B;  3J9X 1;  1WYC A;  2V1D B;  4AQG A;  4IDZ A;  5HWY A;  5JDL A;  3MK7 C;  2V7M A;  2BVM A;  3ZC0 A;  4CZZ B;  1NWM X;  4IE0 A;  1BR2 A;  2V7L A;  5CA0 E;  3C4Z A;  4WNK A;  2Q9Q B;  4IE4 A;  2W63 A;  3T8O A;  3ZCJ A;  1MIY A;  5IYZ E;  2CWO A;  2K5B B;  4NUV A;  2JRK A;  3UFE A;  3LK3 B;  4AQF C;  2E9X A;  4GK0 E;  5LNK A;  5C8Y E;  2N2N A;  4U74 A;  4B6X A;  2X0L B;  2KWH A;  3NBX X;  5L3F B;  3PTR B;  3HKB E;  2ES0 A;  2EHO B;  1D1C A;  2SPC A;  3N9M A;  1QUU A;  1D0X A;  3IF8 B;  3ZCI A;  3PUQ A;  3O1J A;  5KMG P;  1BR4 A;  3Q9D A;  5AFU L;  4J2C A;  3ZYK A;  2X51 A;  4BA9 A;  4AKI A;  2K9A A;  3LK4 2;  1QSD A;  3KVA A;  2RA1 A;  2DNX A;  1Y64 B;  4H9S E;  2KT9 A;  3UTK A;  3TKL B;  2LSY A;  2Z6E A;  2ODU A;  3AVR A;  2VWA A;  2HPJ A;  3N2G E;  2VKD A;  2VB6 A;  4CXY A;  2ZLY A;  4TV9 E;  2E8I A;  3K3O A;  4EZ4 A;  1HS7 A;  4O2A E;  4QX7 B;  3AA6 B;  3C50 A;  3A5X A;  3HL6 A;  5CB4 E;  3DTO A;  4O8S A;  2VKH A;  1UX4 A;  3K3Q C;  3QC9 A;  3GMI A;  4EXT A;  3HI2 A;  3PE0 A;  1X79 A;  3ONX A;  3Q5X A;  2Q9Q C;  3OKQ A;  2QA7 A;  2ZM8 A;  4P09 A;  4L0R A;  4AQF A;  4E7Z A;  1ZKE A;  2X9W A;  4UF0 A;  2XTL A;  3PU8 A;  1BR1 A;  5LBM A;  2I59 A;  4OHF A;  5FMN A;  1IAP A;  3CQX C;  4EYY R;  3CML A;  3FHN A;  3PUS A;  4GK5 E;  3I9W A;  2VKJ A;  2MTQ A;  2YU2 A;  4YHJ A;  4GOU A;  2A2F X;  3VKG A;  2LOS A;  5FY1 A;  1YKE B;  2EHO C;  3GN5 A;  4X1Y E;  4PFO A;  2ACX A;  4PJN A;  2CXL A;  3FXE B;  3DP7 A;  3I9Y A;  4UVB B;  4DVD A;  2HH7 A;  3N2O A;  3O4X E;  4E7S A;  1UCU A;  5HXC A;  2V7J A;  2X9Y A;  1ZHC A;  3C4X A;  3ZYL A;  1ZEE A;  1FMV A;  4AKH A;  3BK9 A;  1HG5 A;  2DLR A;  5H6R B;  5IHY A;  5L3E B;  3HA4 A;  4BJM A;  1SHZ C;  2P9B A;  4QX8 B;  1HX8 A;  1YKH B;  1U4Q A;  4HGA A;  4IHJ E;  3L3P A;  4UXN B;  5HXH A;  2CEA A;  2KMF A;  3AAI A;  3K3N A;  4KUM B;  5LGN B;  3I0O A;  2PBI A;  3WAJ A;  3OJA A;  4UF0 B;  2E9X C;  1G8X A;  3CX7 B;  3C4W A;  3IHR A;  4PNI A;  4EB6 E;  1HCI A;  4V1A v;  4PAG A;  4ILU A;  1MMA A;  2Q9Q D;  2VKO A;  5LHG B;  1MMD A;  3RYF E;  4BJN A;  4IE6 A;  3GN5 B;  3NRY A;  3CX6 B;  2NW9 A;  3O1H A;  1OWA A;  3RKO A;  3UUX B;  2X66 A;  3SRZ A;  3ZPO A;  2MYS A;  4JLE A;  3ZMS B;  2H7O A;  4IGU A;  2M67 A;  2EHO A;  2X9H A;  2X9X A;  3LG7 A;  4YLH A;  3SOL A;  2YEV C;  2D2S A;  2C5K T;  3KV5 A;  3RYC E;  4DMV A;  5JDH A;  4DND A;  1AJ3 A;  2PJQ A;  2JMH A;  2LT3 A;  1D0Y A;  3CWZ B;  4N78 D;  3E22 E;  3RC3 A;  3HKC E;  4OYJ A;  1O3X A;  2WM9 A;  5L3D B;  4PK5 A;  5M4Y A;  3IEE A;  2LHR A;  5J2U E;  2LM9 A;  4MFR A;  4IIJ E;  5DQV A;  1MMG A;  1HTJ F;  4UV9 B;  3DJB A;  3I0Q A;  3PUR A;  1MIW A;  2CE7 A;  2LHN A;  1WRD A;  3VU7 H;  3WAK A;  2WSS V;  2L9Q A;  4O2B E;  2E9X D;  3KV6 A;  2C5J A;  5EZY E;  2DWK A;  2XAQ B;  2X68 A;  2VAS A;  3U78 A;  2A72 A;  2CLY B;  1VOM A;  3GWH A;  2B1E A;  5HXS A;  2LSK A;  2RP4 A;  3MA9 A;  4FI5 A;  2XAJ B;  4JEU B;  4XZC A;  5KDM C;  4L9I A;  3UUM A;  4H9Q C;  2WBL A;  1HFA A;  4DMW A;  2NTY A;  3GA8 A;  4I4T E;  2ODV A;  2H3R A;  1KK7 A;  2XAS B;  3N9L A;  3KVB A;  3AA7 B;  2W61 A;  3AB3 B;  3ETU A;  1UX5 A;  2DCF A;  2H7V C;  3ETV A;  5JRC A;  2UXX B;  2PG8 A;  3BQI A;  2VK9 A;  4OYK A;  4CI3 B;  4AKG A;  4DO0 A;  2YIN A;  3MXZ A;  1HG2 A;  2K48 A;  3CQG B;  4L5G A;  5LYJ E;  1FMW A;  3CX8 B;  5JDF A;  3RH3 A;  4BAY B;  5FXW A;  5FXZ A;  3ESL A;  2NOX A;  4ZS3 A;  4HE8 A;  4WW0 A;  2W62 A;  2XQY A;  2YK0 A;  2CXD A;  4F6R C;  1MND A;  4MAL A;  3F31 A;  4HKA A;  3C98 B;  1YD8 G;  4ZI3 C;  2LJL A;  3W15 B;  2Y6X A;  5L3C B;  2NW7 A;  3JC6 C;  2CLY C;  4OFZ A;  1KNZ A;  2CCQ A;  3H3A A;  1G73 A;  5HXR A;  4M1P A;  3EDU A;  2G0U A;  2NWB A;  3L09 A;  4CI1 B;  5JRC B;  1OXZ A;  2JJ9 A;  3PDY A;  5JVD E;  2V26 A;  5JR9 A;  5LHI B;  2L8K A;  2MOZ A;  1MIV A;  4GIW A;  3ZMZ B;  5LGU B;  2NW8 A;  4X20 E;  1U5P A;  3RPU A;  3N9Q A;  5FXX A;  2BVL A;  4IE7 A;  4X1K E;  2IC9 A;  4HTE A;  1FIO A;  2K24 A;  5FP3 A;  2XHE B;  3ZC1 A;  1LVK A;  5KX5 E;  3KV4 A;  4ZOL E;  4AXP A;  3AAA B;  2C5I T;  4KMC A;  2CMR A;  5BMV E;  2KZ7 B;  3OYZ A;  3AVS A;  3RRC A;  2W00 A;  3PU3 A;  2V7I A;  4ZI7 E;  4AKR B;  3OBV E;  1S94 A;  3BQL A;  4Z8X A;  4WBN E;  2W0G A;  3FXD B;  3EDV A;  3MJX A;  2LSI A;  2HPL A;  4GYR A;  4X1I E;  2IW5 B;  4H9R C;  4G2A A;  1T98 A;  3F57 A;  4ZI3 D;  3NRX A;  4K0U A;  4CXW A;  4EYU A;  3JC6 D;  5CA1 E;  5JR9 B;  3CPZ A;  3UUN A;  1H7C A;  4ZI2 C;  2EHO D;  3ANW A;  4UEM A;  1B7T A;  4ADZ A;  5JQG E;  4GYS A;  3RYI E;  1HF8 A;  1NAF A;  3F2E A;  3RX6 A;  1EZ3 A;  3B57 A;  3RC8 A;  3ZMT B;  5JRE A;  5LA6 E;  2KLQ A;  2CM0 A;  4QWN B;  5ETW A;  4PFP A;  4ZS2 A;  4YJ2 E;  3C51 A;  4QXC B;  4UIG A;  2A3D A;  3FBZ A;  4C91 A;  3V5U A;  2N1G A;  5HXE A;  5JH7 E;  5A1L A;  2LE8 A;  1WYB A;  3N9P A;  2PFV A;  2KXP B;  4ANJ A;  4EZH A;  5J1G A;  1V9D A;  2YU1 A;  3E0Z A;  3R6N A;  3MZK B;  3QUJ A;  5H6Q B;  4JUY A;  4QHO A;  5LOV E;  4DBQ A;  2XAF B;  2BDE A;  2LEH A;  3C64 A;  4PJL A;  3SS1 A;  2QGS A;  3KV9 A;  2WWU A;  3Q5W A;  3ANW B;  5EK3 A;  4ZHQ E;  5DAB A;  3EVY A;  4WBO A;  2NP9 A;  4TUY E;  2Y48 B;  5FY0 A;  2XAH B;  3RRW A;  3S4U A;  3Q2M A;  1D1B A;  1S35 A;  4MBQ A;  4U72 A;  5F3J A;  5JR9 C;  4O4L E;  4ZI2 D;  3E08 A;  2WAU A;  5L3G B;  1IZN B;  4XAX B;  5TAO A;  2OA5 A;  1ZV4 X;  3ZN0 B;  4C90 A;  5GON E;  4O4I E;  5E0O A;  2DHR A;  2LOP A;  3OYX A;  4UEL A;  2JQQ A;  5FNV E;  1LVF A;  3I1A A;  2WMO A;  1SA0 E;  3PUG A;  5JDM A;  5F8P A;  3KDS E;  3VKH A;  4O4J E;  1BR0 A;  2N9D A;  5JDN A;  2UXN B;  4MLK A;  5FYM A;  2CWY A;  2ZM2 A;  2NTX A;  4H63 H;  4TN7 B;  4P0B A;  4UVA B;  4P0A A;  3UUL A;  3KBT A;  3LBX A;  4ASK A;  1LKX A;  3WI3 A;  5LHH B;  5LGT B;  3NZQ A;  1VRB A;  3LJC A;  5LP6 E;  4H63 V;  3U3I A;  4AI6 A;  1E1H B;  2V7K A;  2KIN B;  2ZM0 A;  2D0T A;  3AAE B;  5HAX A;  4NUU A;  4PK4 A;  4IST A;  2E9X B;  5L2L A;  5LG4 A;  2IC6 A;  3N9O A;  3HR0 A;  2DWG A;  3FBL A;  2D0U A;  4I55 E;  4OK0 A;  4PJM A;  1D1A A;  2KND A;  2X67 A;  5LCY A;  2JMK A;  5DQW A;  3VHL A;  4HN9 A;  3BQK A;  4QXB B;  4ISS A;  3LK2 B;  4QKN A;  1LRZ A;  5LXT E;  1WLX A;  3HKD E;  4TV8 E;  3ZEF B;  5L3B B;  2CXF A;  4EIW A;  3N2K E;  5EK4 A;  2XAG B;  3O9X A;  3B13 A;  2IAK A;  4G63 A;  4HEA A;  5HWX A;  3M65 A;  5JDQ A;  4CQI A;  3UT5 E;  3D0T A;  4O4H E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...