4A5TS

Structural basis for the conformational modulation
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
791
structure length
767
Chain Sequence
EPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Native Plasminogen Reveals an Activation-Resistant Compact Conformation.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PLASMINOGEN
total genus 181
structure length 767
sequence length 791
ec nomenclature ec 3.4.21.7: Plasmin.
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00024 PAN_1 PAN domain
S PF00051 Kringle Kringle domain
S PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4a5tS08
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4a5tS07
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4a5tS05
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4a5tS06
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4a5tS03
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4a5tS04
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4a5tS02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 4a5tS01
2OC7A 1L1NA 2P94A 5C1YA 2ZCKP 3QX5H 1RTFB 5FBEA 1Y5AT 1HKYA 1O5FH 1MQ5A 4UONA 3VGCC 1GI1A 4FVDA 5EPYA 1KXCA 1UJ1A 2P95A 1TNLA 3SO3A 1SLWB 1KRNA 5EQSA 3RXLA 1PQAA 3DFJA 2RG3A 2GZ9A 3SP8A 4H4FA 1HJ9A 3OU0A 3UUZA 4DG4A 3ZYEA 1O5GH 2PKAB 4FUCA 1G2LA 4CR5A 1QCPA 2AGIX 3TK6A 8GCHF 4MNWA 3SNCA 4APLA 1Y3XA 4CH8B 1XUGA 4XBDA 1V2KT 4B2BA 2G4UA 4APMA 1W11U 1ZTJA 3ZV8A 2A4QA 1ZJDA 2Z8VA 3PO1B 5GCHG 2BY7X 3UNRA 1UCYK 1AE8H 1C4V2 1UCYE 2VVVA 3LPRA 1TNHA 1NFXA 1C2IA 3BG4B 3QGJA 2STBE 2AMQA 2H6MA 1SGEE 5DP4A 1MAXA 1ORFA 3V0XA 2FPZA 4CRAA 1P9UA 1VGCB 3MOCA 2IN2A 3MTYA 2A0QB 1O2WA 1UHBA 1URKA 4CRGA 4ZKRU 1MKWH 2WYJA 2GCTB 1AY6H 1WBGB 3SJOA 5A09A 1HAHH 1O2ZA 4MNVA 4ZHAA 2J94A 4NGAH 3GY5A 1QQUA 2ASUB 3DT0H 1DSUA 4D9RA 2GZ8A 1ESTA 1HAVA 1O5BB 2ZGCA 2CGAA 2JH0D 5CS9A 4MPXA 1GDQA 2VWNA 1W10U 4DOQA 4ZMAH 1ANDA 3VFEA 2BDCA 2P8OC 1C1WH 1GBKA 4MNYA 1C5RA 1A5GH 1GI3A 1MTNC 4X6OA 1KIGH 3GCHC 3RMNH 4FU7A 1GI8B 2AERH 1ZMNA 4R1BA 1GGDB 3URDA 1GGDC 1GPZA 1GMNA 4B76A 4ZKNU 1F5LA 3VXEH 1BMNH 4ABJA 3KHVA 1IQIA 1SGFA 4Y6DA 2IOTA 2SFAA 1C1OA 1TB6H 1VITH 3FP8E 1AVGH 2VIPA 1P05A 1ZRKA 4NA8A 3BTWE 2QXJA 5DKMA 4YESB 3FZDA 1PQ5A 1D4PB 1VITF 2XW9A 1A0HA 4WJG2 3MMGA 1ELDE 2PSYA 4U2WA 1RS0A 1P03A 1BTPA 1IQMA 2PF1A 2A4RA 3KQCA 1HXEH 1H1BA 1W0YH 3GDVA 1EB1H 4I8LA 4BAKB 4JZ1A 1QB6A 1DSTA 4JZFH 4X1PU 2C90B 2QF0A 4NIWA 1O2LA 2BD5A 3SV9A 1FY8E 4X0WU 1P09A 1DUEA 2LPRA 1BJUA 4AGKA 2WPMS 1ABJH 1AGJA 1UCYH 1YPJH 2BQ7B 2VGCB 1WCZA 1S0RA 2DE9A 4XBCA 1MQ6A 1YM0A 1ZTLA 1F5RA 1W8BH 1W0ZU 2ZEBA 1KY9A 1I71A 4MTBA 2F83A 4AORA 1E34B 4BAOB 1K21H 1C1SA 4Y79A 1ELAA 2ODPA 7ESTE 4GAWA 2VVCA 5LH8A 1F2SE 3T62A 1DX5M 1EP5A 1O2KA 1TMUH 4Q7ZA 5CE1A 2FDAA 3FAOA 1CQQA 1IQKA 1QR3E 1T4UH 2ZGBH 2QA9E 3OSYA 3O8RA 1C4Y2 1EPTB 1ARBA 1HJAB 1OWJA 1ZOMA 3E91A 4I8KA 3DHKH 1FMGA 1QGFA 3E0NB 1GG6B 1QRZA 3RM2H 1UK4A 1SHHB 5GIBA 2A2XH 4FVBA 3GY8A 1JOUB 1P0SH 1YPEH 1CHOF 2ZO3H 1JXPA 1L4ZA 1XXDA 1PPEE 3URCA 2LL3A 1D6WA 1K1IA 1TQ7B 1F92A 3GCTG 2GKVE 2AGGX 1BTHH 3UTUH 2CMYA 4IN1A 3ZZ6A 1TOCB 2AIPA 3SJIA 2ESTE 3V13A 3GDUA 1DFPA 2G00A 1S85A 1CE5A 5DP7A 1EAIA 2CXVA 4YM9A 1ELTA 4U30A 1BZXE 4QT8C 2FLRH 1QIXB 3EGKH 1O3EA 2Z9KA 1YYY1 4ZAEA 4UFGH 3RXEA 1N8OB 1DWDH 1KI0A 1UO6A 2TGPZ 1MKXH 2HWLB 5IYTA 3TH3H 5CS3A 4DY7B 1FXYA 6CHAC 1KDQA 1O5CB 3P95A 3S9AA 3RLWH 1L2EA 2ANWA 2Z9GA 4SGAE 5GDSH 2Y8RA 1GBTA 1WYKA 3NPSA 1GI6A 3PLPA 3QGNB 3A81A 2JKHA 1UTQA 2ZHDA 1WQSA 3SGQE 3ZVDA 1OYTH 1AFQB 2PK4A 4WMDA 1NRPH 1XXFA 2ALPA 1A7SA 4BANB 2K4RA 2BLOA 2PFEA 4X1SU 1PPGE 2ZFQH 3M5MA 1LHDH 3PLKA 2G55A 1ELBA 2HGTH 1SLUB 1TGNA 1GHXH 3LGWA 1LPZB 2ODQA 2BYAX 1A5IA 5I46H 4WVPE 1LTOA 1PYTC 1E35B 3BTFE 3SHCH 4D76A 3MH7A 2HLCA 1BDAA 3B23B 4ESTE 2UWPA 1TBRH 1BQYA 2SGAA 2H5DA 3VB6A 4ABDA 2NU2E 2VJ1A 1C1VH 2ZHQH 4Y8XA 2GT8A 3ESTA 5LPEA 5JPMH 3MNBA 3RU4T 1SLVB 2ANKH 1C1NA 2FWWA 2GVFA 3LDXH 4FUFA 3AAUA 1HJ8A 2QC2A 1T8LA 2YIPA 2VH0A 3MU1A 3LGTA 1NY22 2OBOA 1QQ4A 1BRBE 4JYUH 1B0FA 3P8OA 3R3GB 4X2VA 4AG2A 1WQVH 2WYGA 2V6NA 2FOAA 4ZXYH 3RXQA 1DITH 1RJXB 2J8LA 1FDPA 4LOYH 5E2OA 5GCHF 2ZU3A 1INCA 3ZZ5A 1DM4B 4NZLA 1C1QA 1PQ8A 2B8OH 2BX4A 2FI5E 4Z0EA 1EJMA 3RXMA 1B2IA 1SVPA 1SGTA 3ZZDA 1UTMA 3DA9B 3M5OA 3K6YA 1SMFE 3QK1A 3U73A 1GI9B 3UPEA 3SV7A 1OS8A 3SI4H 1V2JT 3S7HB 3SI3H 1GMHF 4KIVA 1SHYA 3QWCH 3LGVA 1C2FA 2W26A 1TA2A 1O2NA 5FPTA 2ZIQH 1AQ7A 7GCHG 1AVWA 1DPOA 1S81A 2BMGB 1O2UA 1HNEE 5HGGA 2EI7A 3TK9A 1OWEA 1TX7A 3A7YA 1S6HA 1GHAG 3A87A 5EW2H 1GJ8B 2FTLE 3I77A 1BBRH 4TY7A 2P8OB 2ZGJA 3MO3A 1O3KA 2XCNA 1F0TA 4OS4A 2R2MB 4FUGA 3SU4A 2UWLA 1LVOA 4K8BA 4MPUA 3PMBB 1TGTA 4X6NA 2VWLA 3VB5A 2NU4E 1HAXB 2B5TB 3HGNA 1BMAA 4MVNA 1FI8A 1VJAU 1A5HA 1O34A 2XWAA 2FX6A 1K1JA 3ATMA 1EZQA 2P3TB 2QJ4A 1HAYB 4ABGA 4ZXXH 4U32A 5CT2A 1XM1A 4GPGA 1CT4E 3MH5A 3Q77A 3KN2A 3PTNA 3FP7E 3OY6U 1UVSH 3NZIA 1SQOA 3A7XA 1LQDB 3SBKA 4Z0KA 4CREA 1YPGH 1LKAA 1EJAA 3Q76A 2BDHA 4X2WA 1C2HA 1G9IE 1YLDA 3HMSA 1FZZA 1TX8A 1A46H 5EODA 4UFEH 1YGCH 2D8WA 5HMAA 2H9TH 4OS7A 2ZFSA 3PO1C 3CP7A 3MNSA 2OCVB 1QY6A 1O2TA 3BV9B 3RXDA 1VR1H 1FJSA 1O3NA 2I9BA 2ZU1A 1KYNA 1BIOA 1ZPCA 2VB0A 3RXHA 3GCTF 1FY4A 2G81E 1C2DA 1ETRH 1QJ6B 2QXGA 2LL4M 3PMJA 2ZFRH 2Z3CA 2CV3A 3TNTA 3MO6A 1J17T 3RP2A 3ODFA 1P01A 3A8BA 1GBEA 3EQ0H 3SOSA 1GJDB 2A4OA 1P57B 3SW2B 1V2WT 3ENSB 1LHFH 2OP9A 3A8AA 3NKKA 1EOLA 2BD4A 1NFWA 1C9PA 3SHAH 3GYLB 4E05H 1HDTH 7LPRA 5FXLA 1HUTH 5FCRA 1V2QT 2QCYA 3NK8A 2F9VA 1GJAB 1GVKB 2DUCA 5TCAA 1GHVH 1GI0A 3A7ZA 4X1RU 1NC6A 1MCTA 3SJ9A 1NFUA 4X8TH 5J4SA 2RCEA 2WPKS 3SRJA 1S84A 2QIQA 3R0FA 1ZR0A 4XBBA 3T25A 4Q7XA 1FIZA 4RSPA 1HPGA 1Q31A 2SGDE 2ZHFH 3KQBA 1GBCA 1Z8JB 1BTZA 5A2MH 3ZZCA 3UNSA 3MU8A 1YPLH 5AHGH 3KQEA 2HPPH 1QA0A 1MTSA 1TRYA 1AWFH 2ZDKA 4RN6A 4RKOB 1HXFH 1XVMA 2ODYB 5IDKA 4BV5A 1V2NT 3TH2H 2BDYA 1DXWA 1MKWK 4DW2U 6GCHG 2V3HH 5FX6A 2XC4A 3FZZA 1AKSB 1TALA 1RGQA 2BQ6B 3F68H 4B74A 1C5MD 2A7HA 1PJPA 4YOJA 4R0IA 1CSOE 4KTCA 2FEQH 1A1RA 1J9CH 2OQ5A 3O8DA 1NM6A 2H2ZA 2BLWA 3BTEE 1QNJA 2ALVA 4NCYA 5GWZA 1C1UH 2FOFA 3T5FH 2KAIA 1EX3A 4CBOA 3GY4A 1C5ZB 2BXTH 1HAZB 2QGRA 3BSQA 2BLQA 1O35A 1YLCA 3CENA 4BXSA 1TAWA 1O3DA 3TH4H 4AZ2B 1UVTH 2XBVA 3U8OH 3SGAE 1QA7A 1GJBB 3BTKE 1BA8B 3HKIB 2M5TA 4D8NA 3NWUA 5COEA 4WWYA 3IITA 2TGDA 1W3CA 2HPQP 1O3OA 2Y5FA 2PR3A 3MI4A 2DOIA 1MBMA 1WUNH 2BVSH 4VGCC 1C2MA 1TBZH 4JYVH 3EYDA 1XKAC 5CP9A 1G30B 4LZ1H 2TGAA 1SGQE 1PPZA 1OOKB 1WOFA 1FQ3A 4BVCA 2C8ZB 1H8IH 1S82A 1PK2A 5T6FA 1SBWA 2O9QA 2BB4A 5H4IB 1LO6A 4E7NA 5EOKA 1FY1A 2QXIA 1YPMH 1C5WB 1EASA 1VJ9U 2GV7A 3UNQA 3GY3A 1Y3YA 4Z0DA 1EUFA 2G52A 2D1JA 2NU1E 1X7AC 3S0NA 1SGDE 1A0HB 1BMLA 4J2YB 3E1XB 1GBHA 1V2TT 1QL8A 1GHAF 2GV6A 3BT1A 3F9GA 3RMMH 1OX1A 1CT0E 1KXAA 2B9LA 5DG6A 2OLGA 3LGYA 2Y81A 1YCPK 1QBOA 1KTSB 2ZECA 2BDGA 4ASHA 5A0AE 1Q3XA 2ZDLA 1WSSH 2A5KA 3MNXA 4JZDH 4OS2A 5ESTE 1W2KH 2BDAA 3SV2H 4X8VH 4LK4A 3SU2A 3E3TA 5F03A 1KXBA 3RXJA 3PV4A 3A8DA 3SV6A 2P16A 1C1TA 1HCGA 1UTNA 4K2YA 4A7IB 1GVZA 4ABHA 2C3SA 3RM0H 1ARCA 3MNCA 1TNIA 3HK6B 1Z8GA 3PMAB 4NZQA 1FPHH 1XVOA 2WINI 4B73A 1PK4A 2J9NA 1HPKA 2F91A 4X2YA 1FY5A 1EQ9A 1ELVA 2OC1A 3M5LA 3ZZBA 1ZSKA 2VU8E 3ZVGA 1OPHB 2ANMH 4H6SB 5HM9A 3F9HA 2XTTB 2O8LA 4INLA 4NSYA 3ZZ9A 3RXKA 1ANBA 1BRUP 1FN8A 3ZVAA 3G01A 4I33A 1QRWA 4BAMB 4HFPB 2B7DH 2ZHWH 5C1UA 1VGCC 2OD3B 3QTVH 2FODA 1LMWB 4Y11E 4YLQH 1GBDA 2Q8AA 3RXBA 3UIRA 3F9EA 2WUBA 2ZNKH 5JBCS 1A0JA 3OX7U 2YNBA 2O8UA 1KLTA 1GJ7B 2UUJB 2XC5A 1BTUA 1BJVA 1EPTC 1HJAC 1HAGE 1O5DH 1CEAA 2R2WU 1C5TA 4ABEA 1V2PT 4WH8A 5F8ZA 4CBNA 1QJ7B 1P2MA 1UTPA 3A7VA 3BEIB 2BD7A 3D62A 3GICB 3M5NA 4Y76A 1G3EA 2P59A 8ESTE 2J2UA 3ATWA 1QL7A 3KIDU 2KJ4A 3M7UA 1DOJA 2W7SA 3GY7A 1AO5A 1CT2E 1THPB 1HBTH 4D7FA 2TIOA 1THSH 3RXVA 1PPHE 4TWWA 2HNTE 1ZPBA 5C20A 4I8GA 3M36A 3QTOH 5EG4A 1BITA 3BTDE 1MU8B 1FPCH 2AH4X 2ZDAH 3F1SB 2OXSA 1HAPH 3AASA 1PMLA 4F4OC 4GVUA 1D3TB 2FESH 3NCLA 1WTHD 1EAXA 1ZGVA 2Z9LA 1O33A 1SGPE 2OUAA 2ZPRA 1SFQB 1BRAA 1MUEB 4UDWH 3CS0A 4KP0A 3ZZ3A 2BZ6H 1BB0B 4VGCB 5HM2A 4BXWA 8GCHG 1GVLA 2NU0E 1ZSLA 4ABAA 3Q3YA 5T6GA 3ZZ4A 1GMCG 5CHAC 2KAIB 4UE7H 1DVAH 2QV1A 2X2ZA 1BTWA 1CHOG 3PWCA 2Z6BD 2FTMA 2H9EH 4MQAA 1FUJA 1N6YA 3GYMA 1SG8B 1GJ6A 4I7YH 3UOPA 2AEIH 3RXFA 1O2OA 3PTBA 4IUAA 1ZRBA 1JWTA 1P04A 1FY3A 1GJCB 1TMTH 3H7TA 3HK3B 1ZJKA 1AZZA 1T32A 6LPRA 2F9OA 1Z1JA 4FUDA 4YO9A 3H5CB 1MZAA 4UFDH 1V2OT 5C2ZA 3Q3XA 4K1TA 2VINA 4WY3A 1TIOA 3UWJH 3ZVEA 2BTCE 5HPGA 2Y7XA 4CRCA 2W3KA 3E6PH 1MD7A 1O3LA 2BY6X 4FU8A 2PF2A 1Y3VA 1AFEH 1J15A 2G5VA 5A8ZA 1O2HA 1C1MA 1ESBA 1C5VA 1HIAA 1ZHRA 5T6DA 4K3JA 1NZQH 1O3PB 4UD9H 5CHAB 4WF8A 2Z94A 5FHTA 2ZTYA 4GHTA 2D2DA 2KNFA 2VIQA 5K7RA 1L0ZA 3ZWZA 4O03A 1VZQH 2A31A 4GCHF 3LONA 4CHAB 5E0GA 2EC9H 3KL6A 2GX4A 4XOJA 1BCUH 3GY6A 4JK6A 2PHBA 4ZROA 1BTYA 1WTGH 1N1LA 2CJIA 4INKA 1QTFA 2PKSB 4U01A 3I29A 1SFIA 2O8TA 3FFGA 3I78A 5SGAE 2A5AA 4AYYB 4Y10E 1VCQA 3U8TH 1O36A 3ZVCA 4O3UA 2GCHG 1NRRH 1ZHMA 5L30H 5L6NH 1NRQH 4JYTA 1ZTKA 3VPKA 5LPFA 2GZ7A 2ZCLP 4A92A 2BM2A 3EDXB 1ELGA 1AE5A 2R3UA 1BBRK 4ABBA 2Y7ZA 3RXIA 4GHQA 1UK2A 2ULLA 3VB3A 1A61H 1IHSH 4A5TS 1Z71A 3W95A 1UTJA 2OC8A 1QFKH 2SNVA 2TPIZ 4R1AA 3P17H 3TNSA 1E0FD 2Z7FE 2ZU2A 1O37A 1P3CA 4AB9A 1CVWH 3ATLA 5F6MA 5ETXA 2HALA 1HV7A 1AIXH 1NPMA 1AFQC 4DVAU 2ZA5A 3L3TA 1MAYA 2Z9IA 3OY5U 3H7OA 3IG6B 1WV7H 4H6TA 2A32A 1W13U 1AHTH 5C5NA 2FOEA 3ZVBA 6CHAB 4AFZA 5FAHA 4DURA 3FP6E 2ZTZA 1TNKA 1HYLA 4BVWA 4JZEH 1TPAE 5JBBS 3OTJE 4SGBE 3ZZ8A 4IMZA 1H9LB 3MO9A 5DJ7A 1XUJA 1O2VA 3E16B 3Q00A 1F0RA 2CN0H 4I8HA 2BOHB 3ZZ7A 5E0HA 1I8NA 1IQFA 4B1TA 4AFQA 5EQQA 1T8OA 1CGIE 1O2QA 4NWLA 3P8FA 8LPRA 1SGYE 5PTPA 5TCCA 4WMEA 2FM2A 4FUEA 3SNEA 2YOLA 3MWIU 3PM3A 2Q6GA 1BHTA 1DWCH 4TPIZ 1NL1A 4J1YA 1B5GH 1XMNB 1MTVA 4KELA 3A7TA 4XE4A 1ZGIA 6ESTA 4XDEA 2G8TA 2Z8WA 4BTUB 2Y6TA 3SRIA 3SQEE 1GBLA 1TPSA 2BVXH 4FXGH 3U69H 3RDZA 4DGJA 1O39A 5E8EH 2FOMB 3RXOA 4KTUA 5G4BA 4AB8A 2J4IA 3VXFH 3MFJA 3PYHA 1IQNA 1GDNA 2BD9A 2K1QA 1C5YB 3RMLH 3V7TA 4CRBA 3JZ1B 3W94A 2J95A 5ABWA 2ZFPH 1DUAA 5LPRA 2WV4A 5FBIA 3SNBA 4BTTB 1V2UT 3MHWU 1Q2WA 1QB1A 5EXNA 3RXTA 1P2KA 2GT7A 1JRSA 2PTCE 3EA9A 3KIVA 3DD2H 4AGJA 4F49A 4A6LA 1O31A 3DUXH 5DPAA 2H1UA 3U1IB 4Q2KA 1NRSH 2BOKA 9LPRA 4Y71A 1EP6A 2QJ2A 3HMRA 1EZSC 2XYAA 3TGJE 3T28A 1ZHPA 1UMAH 3P6ZB 1K28D 4DIIH 4ZKOU 1GP9A 3PWBA 1LCYA 2OINA 1DLEA 4WXIA 1RD3B 3BG4C 2BQWB 4IGDA 2PGQB 4DT7B 2GGVB 2BX3A 1OP8A 1HIAB 1TQ0B 1A3BH 3C1KA 3UQVA 3MYWA 1PPFE 2XWBI 4CIKA 1CA0C 1XUFA 2EI8A 2PGBB 4CHAC 4R1CA 1LHEH 3RC5A 3VB4A 1CEBA 1QBNA 4HTCH 1KLJH 1TFXA 2FOBA 2Q1JA 4CR9A 1MZDA 1P2QA 1AUTC 5TJXA 4D9QA 1W14U 5DP9A 2FLBH 3SNDA 1P12E 3LJJA 2V3OH 3BIVH 1KDUA 1UTOA 3SUEA 2PKAA 3UWIA 1ELFA 3RXRA 2BY5X 3SU5A 3A83A 1CA8B 1O30A 1NROH 1V2MT 2SNWA 3HPTB 3SQHE 1Z7KA 1W12U 4ISLA 4LXBH 4ZUHA 1C9TA 2HOBA 2A7JA 3LC5A 1O5EH 4E7RG 4O9VA 3NUMA 2SGFE 2F9BH 4B71A 1IQJA 1T7CA 4MDSA 2AS9A 1AWHB 1BUIA 2W7UA 4WMFA 1C2JA 1P8VC 2QAAA 1GMOA 3BTME 1TPPA 4UEHH 1T31A 4AFSA 1NU7B 2FZZA 3SU6A 3E90B 1C5QA 1XUHA 4UAOA 1PMKA 2JETC 3STIA 1Z40A 2FMJA 1ZMJA 1C1RA 2ZQ1A 2SPTA 1CBWC 2ZHEH 3QZQA 3LAQA 2OTVA 2F9UA 5CSQA 2CF9H 2HVXA 3K9XB 1Z6EA 1S0QA 1FNIA 3P92A 2OBQA 1GBBA 1NRNH 2FS9A 2ZU5A 3LT3A 4Y0ZE 4Y8ZA 4OGYA 1MD8A 4TWYA 3UQOA 1GI5A 2IPHA 2UUFB 5GXPA 2ZWLH 2QYIA 1Y8TA 3RU4D 1RIWC 2BVRH 1MMJN 2VIWA 3GDSA 3P70B 5FCKA 2PKSC 1P2IA 1CA0B 3ATIA 3HATH 2FOGA 2YILA 1CHGA 2ILNA 3NXPA 5A8XA 4H42U 1J14A 1D6RA 1YPHE 3ATKA 1C2EA 2FOCA 1IQGA 1G37A 3GY2A 5HYOA 1RRKA 1Z1IA 2VWMA 1P9SA 2Y80A 1GL0E 5DP5A 3T26A 1UVOA 3LH1A 4R19A 3RXPA 3E6PL 2GMTC 7GCHF 1FLEE 4O3TA 3Q3KA 3T27A 1FV9A 3BTTE 5AVDA 1YPKH 2A2QH 3K65A 1GJ5H 2QF3A 1YKTA 4BNRA 1PYTD 4KKDA 2I9AA 1C2KA 4IW4E 3STJA 3EA7A 1NL2A 4CRDA 2ZI2H 3A85A 2ZQ2A 1LQEA 3M3TA 1ZYOA 1SGRE 1ABIH 1RTKA 1YC0A 1O3JA 2BD2A 1MH0A 1GI7B 3QO6A 2TGTA 4JCNA 3LJOA 3S9BA 1GHBF 5F8TA 4KGAA 3TK5A 1K1MA 1IOEA 1V6DA 2F9NA 3AW0A 5C1XA 4X1QU 1WU1A 5CMXH 2YNAA 1NN6A 2J34A 4OS5A 2K51A 1FIWA 3L33A 2EI6A 2HPPP 4ISIH 1TPKA 4LZ4B 2R0KA 1GWAA 1Y5UT 2EEKA 2A45B 2BY9X 1DY8A 2D26C 1KXDA 2I6QA 3RMOH 3A86A 1O3BA 1HLTH 2V35A 1YCPM 3RC6A 2TBSA 1H4WA 2ZF0H 3RU4E 1EZUC 4AFUA 1XUKA 1L4DA 3K65B 1NU9A 3O8CA 2NWNA 3MKPA 2XNIA 1OWDA 1OP0A 4JZIA 4AG1A 3UY9A 3BT2A 3M35A 2CHAC 3QDZB 4K5ZA 2ZDNA 1S6FA 2PTNA 3KQDA 1ELCA 1ANEA 1AU8A 1OWIA 3PB1E 2PLXA 3KNXA 4GUXA 4NWKA 4OS1A 1GHZA 3MU5A 3SV8A 1E38B 1SC8U 5B6OA 3LU9B 2RA3A 3RXCA 4AYVB 1KXEA 1HAIH 3TJNA 1K2I1 5CT3A 1ETTH 1SGIB 2O8WA 1DE7H 3GOVB 5K0HA 4MLFB 3BTHE 5E0JA 1EAUA 2P3FH 1UHBB 1K1PA 2PWXA 1IAUA 3TLOA 5EGMA 1KXFA 4CH2B 2W3IA 1O2YA 1S83A 1C2GA 4GCHG 3SU1A 2GD4B 4K60A 1C5SA 1JIMA 4HI3A 1MTUA 1TE0A 3RLYH 1C2LA 1THRH 3QUMP 2WUCA 2ZZUH 1T8NA 3TJUA 2DE8A 1H9IE 1LKBA 2K13X 1O3MA 1G2MA 3S7KB 1XUIA 1W7GH 3ITIA 3HMTA 1EATA 1NO9H 2BD8A 3M37A 1A0LA 4E06H 3D49H 1RTLA 4BAHB 1I5KA 2R0LA 3PROA 3ZLEA 4HGCA 4KTSA 3SZNA 1IQEA 1K1NA 3LGUA 2VVUA 2Q8BA 1ZPZA 1D9IA 4X6PA 4NIYA 3S9CA 1W7XH 2XRCA 1Z8IB 3SJ8A 1GBMA 1AKSA 3SU3A 3A84A 3SU0A 1UTKA 2P93A 3V3MA 3EE0B 2PUXB 1DWBH 3E8LA 2FP7B 4Y0YE 3LOXA 1ANCA 1BOQA 3EAJA 2FYQA 2UUYA 5F8XA 3UREA 2PW8H 3SGBE 4IMQA 1O2RA 2JH5D 2GDDA 2R3YA 4IN2A 3SUFA 1G36A 2OQUA 4I31A 1DT2A 5EW1H 1LVBA 1DY9A 4NA9H 5A0BA 3T2NA 3TVJB 1KLIH 5LGOA 2ZCHP 1SOTA 4BAQB 1CO7E 1Y5BT 3A82A 4Q7YA 1GMCF 1HFDA 4ABIA 1TNGA 3MU4A 4RKJB 1C5XB 3P8NA 3BTQE 2EA3A 3D23A 1SL3A 4WXVA 1AZ8A 2STAE 1LPGB 4INHA 3LH3A 1LHCH 2I6SA 2XC0A 1HB0B 4UV6A 2XXLA 2WV5A 4FUIA 5FX5A 3VEQB 1HAVB 3ZYDA 3AVZA 2GTBA 2Y82A 2LNCA 4A1TA 2HGFA 2CF8H 4NG9H 4ISOA 1V2ST 1O3HA 1N8OC 2WPIS 4DIHH 1C5PA 1O2XA 9ESTA 1XX9A 3M7QA 4O97A 4NFFA 3BIUH 2GCTC 4ABFA 2ZGXH 2HNTC 2Z9JA 1SGFG 2C93B 3ZZAA 2C4FH 4IBLH 4ZHLU 4HZHA 1NFYA 4Z0FA 1V2VT 3AW1A 1K22H 1TABE 2PUQH 2QXHA 3V12A 3RXUA 4AN7A 4IC5A 2J8JA 3A88A 3BTGE 1SR5C 1AVXA 1D3QB 3E0PB 1JRTA 2HPQH 4NSVA 1YXEA 2FEBA 1DICA 1BMMH 1IQLA 2Q6FA 4FUHA 3LGIA 2V0BA 2UWOA 1P2JA 1GDUA 2THFB 3BF6H 4X8UH 2ZFFH 1M9UA 2VGCC 3HKJB 5JB8S 3T29A 2RA0A 4B2CA 5A8YA 1HPJA 1OWHA 1OKXA 5I25A 1K9OE 4XFQA 3S69A 1E37B 1UVUH 2C8YB 4ZKSU 5AF9H 4YTAA 1P2NA 4ISHH 5AFZH 1SB1H 1TRNA 1QBVH 3M61U 2ANYA 2SGPE 4D7GA 3P8GA 5A0CA 2A1DB 1WAYB 1G3CA 1GMDG 1H8DH 3U8RH 2AGEX 2ZC9H 2GMTB 2J92A 3B8JA 3UFAA 1P3EA 1TBQH 1TNJA 3RUOA 4Z09A 1BT7A 1ZMLA 2DOHX 1GHYH 4K1EA 1NT1A 4UFFH 2BY8X 1L1JA 2A5IA 4NIVA 4OS6A 3LC3A 1JBUH 2VIVA 1MCVA 5GPIB 2FI3E 5FPYA 1SSXA 3F9FA 5L2YH 1TGBA 2JH6D 2GDEH 3QN7A 1GHBG 2HRVA 4K1SA 1G3DA 1OYQA 2A4GA 1MTNB 2ZPSA 1O38A 1YF4A 1RXPA 2C8XB 2ZPQA 5E2PA 4FU9A 1CU1A 3UR6A 2Q6DA 3FVFB 3M7TA 1E36B 1UVPA 8KME2 2ZG0H 3EA8A 4THNH 1W81A 3KEEA 1C5UA 1DXPA 4XSKU 1F0SA 2GP9B 1KTTB 1OSSA 2BDBA 1LHGH 3TPIZ 1GBIA 5L2ZH 2CHAB 2HNTF 1EB2A 4ISNA 4X6MA 1SQAA 2JETB 2ZDMA 3VB7A 1EZXC 5DP8A 1H9HE 2J38A 2VNTA 1JMOH 4BV7A 1KIVA 1KSNA 1QJ1B 1A4WH 1C5LH 4FUBA 1YPHC 3A89A 3CS7A 4I32A 3ODDA 1O3GA 3GCOA 1QL9A 1V3XA 4BVVA 4TYDA 1TONA 1S5SA 1TX6A 3SJKA 2Y5GA 4GLYA 1TPOA 1F7ZA 4NIXA 1TYNA 1AI8H 2PV9B 4X2XA 3GISB 3MH4A 4OGXA 4D3CA 1O2JA 3C27B 1YP9A 1PPCE 4BOHA 5DGJA 1TA6A 1BHXF 5DP6A 1V2LT 1P02A 3B9FH 4Z6AH 3RC4A 2WPHS 1RFNA 1FAXA 1YBWA 1O3FA 1D3DB 1QB9A 1TGSZ 2F9PA 2VIOA 1HAOH 1C1PA 1OWKA 3OYPA 1HRTH 4IS5A 1IQHA 4CRFA 1DANH 2A7CA 4Y8YA 5JYIA 1FAKH 2FX4A 1ELEE 1PFXC 1GCDA 2YIOA 1QURH 1QRXA 1DWEH 3M3VA 1AD8H 4NA7A 5JBTA 1BBRE 1ZZZA 3QLPH 1DS2E 1GBFA 2SGEE 3VGCB 1ESAA 2P3UB 3SUGA 6GCHF 1PPBH 2FIRH 5C3NA 3GCNA 1V2RT 2XBXA 1UK3A 1GHWH 2ZP0H 1FONA 3BEUA 1P06A 3TJOA 1JFNA 2VH6A 5HXFA 1GI2A 2G51A 2R9PA 4Y7AA 2QY0B 3HN4A 1J16A 1O2MA 4MNXA 1LPKB 1AMHA 1Y3UA 1GCTB 3KGPA 1AN1E 4I8JA 1LDTT 1F5KU 4TPYA 1TLDA 3IWMA 4MPVA 1O3AA 4DJZB 1DLKB 1BTXA 1O3CA 2L0SA 2QN5T 3N7OA 1EJNA 2BHGA 1Z8RA 1ID5H 1G32B 1U6QA 1NESE 1D3PB 1BHXB 2SGQE 2G5NA 4PROA 1K1OA 4ZHMU 2BLVA 2FOHA 4TY6A 1IHTH 3WY8A 1EPTA 2B0FA 2C8WB 1VITG 2ZTXA 1T4VH 2GCHF 3UOUA 3U9AH 2AIQA 4M7GA 5DP3A 4GSOA 4YOIA 1TOMH 3TIUA 4JMYA 5JDUB 1VCPA 2FD6A 1AUJA 1CGJE 3TITA 1HGTH 3M3SA 1SPJA 2UUKB 1O0DH 1SGNE 3BEFB 1EXFA 4AX9H 1NK1A 4K8YA 1GJ4H 4Q80A 1EKBB 1C4U2 1AB9B 2XCFA 1ETSH 1MTWA 2NU3E 4B75A 1FN6A 2FI4E 2OC0A 4A1XA 1SLXB 3MH6A 1GL1A 3DFLA 4K69A 2BDIA 4MPWA 1LVYA 1GBAA 1PKRA 1VCWA 3QZRA 5JBAS 1O2PA 5EXMA 1ACBE 1T8MA 3SORA 1GI4A 1O5AB 1MBQA 1GCTC 1P11E 1PQ7A 3RXAA 4A1VA 4ZH8A 3F6UH 2AMDA 3A80A 3UR9A 3BN9A 2AFQB 5T3HA 2TRMA 1XKBC 2ZGHA 4YOGA 1O2SA 2WPLS 2H9HA 2IJOB 5DK1A 2W5EA 3A8CA 1GG6C 3U98H 3MU0A 1KDQB 3A7WA 5EXLA 1NS3A 2FO9A 5AFYH 3FANA 2H5CA 5BRRE 1N6XA 3TJVA 1A3EH 5CS5A 2AMPA 1QHRB 1DDJA 1GBJA 4Y7BA 4YT7H 4MG3A 1LVMA 1SOZA 3D65E 1K1LA 2Z3DA 1C5NH 3JZ2B 1O32A 1MU6B 1UTLM 3L6PA 2ZU4A 4YLUA 4YT6H 1SQTA 1TRMA 1Z6JH 2FXRA 2ZFTA 1A2CH 4X1NU 3SNAA 5GJ4B 2PSXA 1SI5H 1TMBH 1JIRA 5FPSA 1W8KA 2XBYA 3BG8A 3ZVFA 1CGHA 2FS8A 2Y5HA 1EOJA 3LIWA 4NFEA 5BPEA 3TGKE 1NTPA 3KCGH 1P10A 2FYRA 1SGCA 4YZUA 1OP2A 4X8SH 2F3CE 2RDLA 1MKXK 5JB9S 2ZKSA 1TGCA 1C5OH 1GMHG 3AAVA 7KMEH 3HGPA 1GMDF 2XBWA 2ZDVH 4AOQA 4WH6A 1F0UA 1GJ9B 1RIWB 2VIDA 5ESBA 4R8TB 5DO4H 3O8BA 4BVDA 3RXGA 3ZV9A 5EU8A 2BZAA 1EAWA 5CS1A 5EQRA 1Y3WA 3TU7H 1AB9C 3K2UA 4DCDA 5EPNA 2G4TA 2BD3A 2AYWA 1OXGA 1O3IA 1Y59T 5J4QA 1O2IA 2VWOA 2Z3EA 3KF2A 3LKWA 3PLBA 1O2GH 3RXSA 1YCPH 1L1GA 2BXUH 5C5OA 1G3BA 3PMHB 3SUDA 1ZSJA 1CBWB 3SN8A 1BRCE 4IC6A 2O8MA 1TWXB 5C67A 4JK5A 1B7XB 1ZLRA 1P2OA 4FUJA 3ELAH 2WPJS 3TGIE 3U1JB 1B0EA 5CT1A 3GCHB 4BTIB 1J8AA 3K6ZA 4B2AA
chains in the Genus database with same CATH superfamily
2OC7A 1L1NA 2P94A 5C1YA 2ZCKP 3QX5H 1RTFB 5FBEA 1Y5AT 1HKYA 3GS9A 1O5FH 1MQ5A 4UONA 3VGCC 1GI1A 4FVDA 5EPYA 1KXCA 1UJ1A 2P95A 1TNLA 3SO3A 1SLWB 1KRNA 5EQSA 3RXLA 1PQAA 3DFJA 2RG3A 2GZ9A 3SP8A 4H4FA 1HJ9A 3OU0A 3UUZA 4DG4A 5C17A 3ZYEA 1O5GH 2PKAB 4FUCA 1G2LA 4CR5A 1QCPA 2AGIX 3TK6A 8GCHF 4MNWA 3SNCA 4APLA 1Y3XA 4CH8B 1XUGA 4XBDA 1V2KT 4B2BA 2G4UA 4APMA 1W11U 1ZTJA 3ZV8A 2A4QA 1ZJDA 2Z8VA 3PO1B 5GCHG 2BY7X 1EFRD 3UNRA 1UCYK 1AE8H 1C4V2 1UCYE 2VVVA 3LPRA 1TNHA 1NFXA 1C2IA 3BG4B 3QGJA 2STBE 2AMQA 5FL7D 2H6MA 1SGEE 5DP4A 1MAXA 1ORFA 3V0XA 2FPZA 4CRAA 1P9UA 1VGCB 3MOCA 2IN2A 3MTYA 2A0QB 1O2WA 1UHBA 1URKA 4CRGA 1SQRA 4ZKRU 1MKWH 2WYJA 2GCTB 1AY6H 1WBGB 3SJOA 5A09A 1HAHH 1O2ZA 4MNVA 4ZHAA 2J94A 4NGAH 3GY5A 1QQUA 2ASUB 3DT0H 1DSUA 4D9RA 2GZ8A 1ESTA 1HAVA 1O5BB 2ZGCA 2CGAA 2JH0D 5CS9A 4MPXA 1GDQA 2VWNA 2YMSB 1W10U 2OK5A 4DOQA 4ZMAH 1ANDA 3VFEA 2BDCA 2P8OC 1C1WH 1GBKA 4MNYA 1C5RA 1A5GH 1GI3A 1MTNC 4X6OA 1KIGH 3GCHC 3RMNH 4FU7A 1GI8B 2GJGA 2AERH 1ZMNA 4R1BA 1GGDB 3URDA 1GGDC 1GPZA 1GMNA 4B76A 4ZKNU 1F5LA 3VXEH 1BMNH 2L6OA 4ABJA 3KHVA 1IQIA 1SGFA 4Y6DA 2IOTA 2SFAA 1C1OA 1TB6H 1VITH 3FP8E 1AVGH 2VIPA 1P05A 1ZRKA 4NA8A 4RT0A 3BTWE 2QXJA 5DKMA 4YESB 3FZDA 1PQ5A 1D4PB 1VITF 2XW9A 1A0HA 1S6LA 4WJG2 3OFND 3MMGA 1NBMD 5F53A 1ELDE 2PSYA 3PRBA 1RS0A 4U2WA 1P03A 1BTPA 1IQMA 2PF1A 2A4RA 3KQCA 1HXEH 1H1BA 1W0YH 3GDVA 1EB1H 4I8LA 4BAKB 4JZ1A 1QB6A 1DSTA 4JZFH 4X1PU 2C90B 2QF0A 4NIWA 1O2LA 2BD5A 3SV9A 1FY8E 4X0WU 1P09A 1DUEA 2LPRA 1BJUA 4AGKA 1ABJH 1AGJA 1YPJH 1UCYH 2VGCB 2BQ7B 2WPMS 1WCZA 1S0RA 2DE9A 4XBCA 1MQ6A 1YM0A 1ZTLA 1F5RA 1W8BH 1W0ZU 2ZEBA 1KY9A 1I71A 4MTBA 2F83A 4AORA 1E34B 4BAOB 1K21H 1C1SA 4Y79A 1ELAA 2ODPA 7ESTE 4GAWA 2VVCA 1WXRA 5LH8A 1F2SE 3T62A 1DX5M 1EP5A 1O2KA 1TMUH 4Q7ZA 5CE1A 2FDAA 3N7EA 2W6ID 1CQQA 3FAOA 3NRLA 1IQKA 1QR3E 1T4UH 2ZGBH 2QA9E 3OSYA 3O8RA 1C4Y2 1EPTB 1ARBA 1HJAB 1OWJA 1ZOMA 3E91A 4I8KA 3DHKH 1FMGA 1QGFA 3E0NB 1GG6B 1QRZA 3RM2H 2JIZD 2KL5A 1UK4A 1SHHB 5GIBA 2KM0A 2A2XH 4FVBA 5EIYA 3GY8A 1JOUB 1P0SH 1YPEH 1CHOF 3VG8A 2ZO3H 1JXPA 1L4ZA 1XXDA 1PPEE 3URCA 2LL3A 4ASUD 1D6WA 1K1IA 1TQ7B 1F92A 3GCTG 2GKVE 2AGGX 1BTHH 3UTUH 2CMYA 4IN1A 3ZZ6A 1TOCB 2AIPA 3SJIA 2ESTE 3V13A 3GDUA 1DFPA 2G00A 1S85A 1CE5A 5DP7A 1EAIA 2CXVA 4YM9A 1ELTA 4U30A 1BZXE 4QT8C 2FLRH 1QIXB 3EGKH 1O3EA 2Z9KA 1YYY1 4ZAEA 4UFGH 3RXEA 1N8OB 1DWDH 1KI0A 1UO6A 2TGPZ 1MKXH 2HWLB 5IYTA 3N99A 3TH3H 5CS3A 4DY7B 1FXYA 6CHAC 1KDQA 1O5CB 3P95A 3S9AA 3RLWH 1L2EA 1VKYA 2ANWA 2Z9GA 4SGAE 5GDSH 2Y8RA 1GBTA 1WYKA 3NPSA 1GI6A 3PLPA 1W0KD 3QGNB 3A81A 2JKHA 1UTQA 2ZHDA 1WQSA 3WW7A 3SGQE 3ZVDA 1OYTH 1AFQB 2PK4A 4WMDA 1NRPH 1XXFA 2ALPA 1A7SA 4BANB 2K4RA 2BLOA 2PFEA 4X1SU 1PPGE 2ZFQH 2KZ4A 1LHDH 3M5MA 3PLKA 2G55A 1ELBA 2HGTH 1SLUB 1TGNA 1GHXH 3LGWA 1LPZB 2ODQA 2BYAX 1A5IA 5I46H 4WVPE 1LTOA 1PYTC 1E35B 3BTFE 3SHCH 4D76A 3MH7A 2HLCA 3F3BA 1BDAA 3B23B 4ESTE 2UWPA 1TBRH 1BQYA 2SGAA 2H5DA 3VB6A 4ABDA 2NU2E 2VJ1A 1C1VH 2ZHQH 4Y8XA 2GT8A 3ESTA 5LPEA 5JPMH 3MNBA 3RU4T 1SLVB 2ANKH 1C1NA 2FWWA 2GVFA 3LDXH 4FUFA 3AAUA 1HJ8A 2QC2A 1T8LA 4XRNA 2YIPA 2VH0A 3MU1A 3LGTA 1NY22 1H8HD 2OBOA 1QQ4A 1BRBE 4JYUH 1B0FA 3P8OA 3R3GB 4X2VA 4AG2A 1WQVH 2WYGA 2V6NA 2FOAA 4ZXYH 3RXQA 1DITH 1RJXB 2J8LA 2QF4A 1FDPA 4LOYH 5E2OA 5GCHF 2ZU3A 1INCA 3ZZ5A 1DM4B 4NZLA 1C1QA 1PQ8A 2B8OH 2BX4A 2FI5E 4Z0EA 1EJMA 3RXMA 2EQNA 1B2IA 2KX4A 1SVPA 1SGTA 3ZZDA 1UTMA 3DA9B 3M5OA 3K6YA 1SMFE 2J5UA 3QK1A 3U73A 1GI9B 4XD7D 3UPEA 3SV7A 1OS8A 3SI4H 1V2JT 3S7HB 3SI3H 1GMHF 4KIVA 1SHYA 3QWCH 3LGVA 1C2FA 2W26A 1TA2A 1O2NA 5FPTA 2ZIQH 1AQ7A 7GCHG 1AVWA 1DPOA 1S81A 2BMGB 1O2UA 1HNEE 5HGGA 2EI7A 3TK9A 1OWEA 2JJ2D 1TX7A 3A7YA 1S6HA 1GHAG 3SZEA 3A87A 5EW2H 1GJ8B 2YMSC 2FTLE 3I77A 1BBRH 4TY7A 2P8OB 2ZGJA 3MO3A 1O3KA 2XCNA 1F0TA 4OS4A 2R2MB 4FUGA 3SU4A 2UWLA 1LVOA 4K8BA 4MPUA 3PMBB 1TGTA 4X6NA 2VWLA 3VB5A 2NU4E 1HAXB 2B5TB 3HGNA 1BMAA 4MVNA 1FI8A 1VJAU 1A5HA 1O34A 2XWAA 2FX6A 1K1JA 3ATMA 1EZQA 2P3TB 2QJ4A 1HAYB 4ABGA 4ZXXH 4U32A 5CT2A 1XM1A 4GPGA 1CT4E 3MH5A 3Q77A 3KN2A 3PTNA 3FP7E 3OY6U 1UVSH 3NZIA 1SQOA 3A7XA 1LQDB 3SBKA 4Z0KA 4CREA 1YPGH 1LKAA 1EJAA 3Q76A 2BDHA 4X2WA 1C2HA 1G9IE 1YLDA 3HMSA 1FZZA 1TX8A 5DSFA 1A46H 5EODA 4HG6A 1YGCH 4UFEH 2D8WA 5HMAA 2H9TH 2V7QD 4OS7A 2ZFSA 3PO1C 3CP7A 3MNSA 2OCVB 1QY6A 1O2TA 3BV9B 3PRDA 3RXDA 1VR1H 1FJSA 5B6LA 1O3NA 2I9BA 2ZU1A 1KYNA 1BIOA 1ZPCA 2VB0A 3RXHA 3GCTF 1FY4A 2G81E 1C2DA 1ETRH 1QJ6B 2QXGA 5GNDA 3PMJA 2LL4M 2ZFRH 2Z3CA 2CV3A 3TNTA 3MO6A 1J17T 3RP2A 3ODFA 1P01A 1YWUA 1GBEA 3A8BA 3EQ0H 3SOSA 1GJDB 2A4OA 1P57B 3SW2B 2F43B 1V2WT 3ENSB 1LHFH 2OP9A 3A8AA 3NKKA 1EOLA 2BD4A 1NFWA 1C9PA 3SHAH 3GYLB 4E05H 1HDTH 7LPRA 5FXLA 5DN6D 1HUTH 5FCRA 1V2QT 2QCYA 3NK8A 2F9VA 1GJAB 1GVKB 2DUCA 5TCAA 1GHVH 1GI0A 3A7ZA 4X1RU 1NC6A 3FKSD 1MCTA 3SJ9A 1NFUA 4X8TH 5J4SA 2RCEA 2WPKS 3SRJA 1S84A 2QIQA 1COWD 3SYJA 3R0FA 1ZR0A 4XBBA 3T25A 4Q7XA 1FIZA 4RSPA 1HPGA 1Q31A 2SGDE 3EE7A 2ZHFH 3KQBA 1GBCA 1Z8JB 1BTZA 5A2MH 3ZZCA 3UNSA 2LELA 3MU8A 1YPLH 2K8IA 5AHGH 3KQEA 2HPPH 1QA0A 1MTSA 1TRYA 1AWFH 2ZDKA 4RN6A 4RKOB 1HXFH 1XVMA 2ODYB 2V3MA 3F0OA 5IDKA 4BV5A 1V2NT 3TH2H 2BDYA 1DXWA 1MKWK 4DW2U 6GCHG 2V3HH 5FX6A 2XC4A 2KCYA 3FZZA 1AKSB 1TALA 2WSSD 1RGQA 2BQ6B 3F68H 4B74A 1C5MD 2A7HA 1PJPA 4YOJA 4R0IA 1CSOE 4KTCA 2HVYB 2FEQH 1A1RA 1J9CH 2OQ5A 1MABB 3O8DA 1NM6A 2H2ZA 2BLWA 3BTEE 1QNJA 3OAAD 2ALVA 4NCYA 5GWZA 1C1UH 2FOFA 3T5FH 2KAIA 1EX3A 4CBOA 3GY4A 1C5ZB 2BXTH 1HAZB 2QGRA 3BSQA 2BLQA 1O35A 1YLCA 3CENA 4BXSA 1TAWA 1O3DA 3TH4H 4AZ2B 1UVTH 2XBVA 3U8OH 3SGAE 1QA7A 1GJBB 4P02A 3BTKE 2HLDD 1BA8B 3HKIB 2M5TA 4D8NA 3NWUA 5COEA 4WWYA 3IITA 2TGDA 1W3CA 2HPQP 1O3OA 2Y5FA 2PR3A 3MI4A 2DOIA 1MBMA 1WUNH 2BVSH 3OE7D 4VGCC 1C2MA 1TBZH 4JYVH 3EYDA 1XKAC 5CP9A 1G30B 4LZ1H 2TGAA 1SGQE 1PPZA 1OOKB 2JDID 1WOFA 1FQ3A 4BVCA 2C8ZB 1H8IH 1S82A 1PK2A 5T6FA 1SBWA 2O9QA 2BB4A 5H4IB 1LO6A 4E7NA 4Q4LA 5EOKA 1FY1A 2F4LA 2QXIA 1YPMH 1C5WB 2YMSD 1EASA 1VJ9U 2GV7A 3UNQA 3GY3A 1Y3YA 4Z0DA 1EUFA 2G52A 2D1JA 2NU1E 1X7AC 3S0NA 1SGDE 1A0HB 1BMLA 4J2YB 3E1XB 1GBHA 1V2TT 1QL8A 1GHAF 2GV6A 3BT1A 3FOAA 4B6EA 3F9GA 3RMMH 1OX1A 1CT0E 1KXAA 2B9LA 5DG6A 2OLGA 3LGYA 2Y81A 1YCPK 1QBOA 1KTSB 2ZECA 2BDGA 4ASHA 5A0AE 1Q3XA 2ZDLA 1WSSH 2A5KA 3MNXA 4JZDH 4OS2A 5ESTE 1W2KH 2BDAA 3SV2H 4X8VH 4LK4A 3SU2A 3E3TA 5F03A 1KXBA 3RXJA 3PV4A 3A8DA 3SV6A 2P16A 1C1TA 1HCGA 1UTNA 4K2YA 4A7IB 1GVZA 4ABHA 2C3SA 3RM0H 1ARCA 3MNCA 1TNIA 3HK6B 1Z8GA 3PMAB 4Q63A 4NZQA 1FPHH 1XVOA 2WINI 4B73A 1PK4A 2J9NA 1HPKA 2F91A 4X2YA 1FY5A 1EQ9A 2W6JD 1ELVA 2OC1A 3M5LA 3ZZBA 5KECA 1ZSKA 2VU8E 3ZVGA 1OPHB 2ANMH 4H6SB 5HM9A 3F9HA 2XTTB 2O8LA 4INLA 4NSYA 3ZZ9A 3RXKA 1ANBA 1BRUP 1FN8A 3ZVAA 3G01A 4I33A 1QRWA 5KGOA 4BAMB 4HFPB 2B7DH 2ZHWH 5C1UA 1VGCC 2OD3B 3QTVH 2FODA 1LMWB 4Y11E 4YLQH 1GBDA 2Q8AA 3RXBA 3UIRA 3F9EA 2WUBA 2ZNKH 5IK2D 5JBCS 1A0JA 3OX7U 2YNBA 2O8UA 1KLTA 1GJ7B 2UUJB 2XC5A 1BTUA 1BJVA 1EPTC 1HJAC 1HAGE 1O5DH 1CEAA 2R2WU 1C5TA 4ABEA 1V2PT 4WH8A 5F8ZA 4CBNA 1QJ7B 1P2MA 1UTPA 3A7VA 3BEIB 2BD7A 3D62A 3GICB 3M5NA 4Y76A 4ZCNA 1G3EA 2P59A 8ESTE 2J2UA 3ATWA 1QL7A 3KIDU 2KJ4A 3M7UA 1DOJA 2W7SA 3GY7A 1AO5A 1CT2E 1THPB 1HBTH 4D7FA 2TIOA 1THSH 2EY4C 3RXVA 3U28C 1PPHE 2AHME 2J98B 4ACAA 4TWWA 2HNTE 1ZPBA 5C20A 4I8GA 3M36A 3QTOH 5EG4A 1BITA 3BTDE 1MU8B 1FPCH 2AH4X 2ZDAH 3F1SB 2OXSA 1HAPH 3AASA 1PMLA 4F4OC 4GVUA 1D3TB 2FESH 3NCLA 1WTHD 1EAXA 1ZGVA 2Z9LA 1O33A 1SGPE 3AK5A 2OUAA 2ZPRA 1SFQB 1BRAA 1MUEB 4UDWH 3CS0A 4KP0A 3ZZ3A 2BZ6H 1BB0B 4VGCB 5HM2A 4BXWA 8GCHG 1GVLA 1KMHB 1ZSLA 2NU0E 4ABAA 3Q3YA 5T6GA 3FO8D 3ZZ4A 1GMCG 5CHAC 2KAIB 4UE7H 1DVAH 2QV1A 2X2ZA 1BTWA 1CHOG 3PWCA 2Z6BD 2FTMA 2H9EH 4MQAA 1FUJA 1N6YA 2KFWA 3GYMA 1SG8B 1GJ6A 4I7YH 3UOPA 2AEIH 3RXFA 1O2OA 3PTBA 4IUAA 1ZRBA 1JWTA 1P04A 1FY3A 2WHXA 1GJCB 1TMTH 3H7TA 3HK3B 1ZJKA 1AZZA 1T32A 6LPRA 2F9OA 1Z1JA 4FUDA 4YO9A 3H5CB 1MZAA 4UFDH 1V2OT 5C2ZA 2J98A 3Q3XA 4K1TA 2VINA 4WY3A 1TIOA 3UWJH 3ZVEA 2BTCE 5HPGA 2Y7XA 4CRCA 2W3KA 3E6PH 1MD7A 1O3LA 2BY6X 4FU8A 2PF2A 1Y3VA 1AFEH 1J15A 2G5VA 5A8ZA 1O2HA 1C1MA 1ESBA 1C5VA 1HIAA 1ZHRA 5T6DA 4K3JA 1NZQH 1O3PB 4UD9H 5CHAB 4WF8A 2Z94A 1OHHD 2ZTYA 2LP6A 4GHTA 5FHTA 2K0QA 2D2DA 2KNFA 5KEDA 2VIQA 5K7RA 1L0ZA 3ZWZA 4O03A 1VZQH 2A31A 4GCHF 3LONA 4CHAB 5E0GA 2EC9H 3KL6A 2GX4A 4XOJA 1BCUH 3GY6A 4JK6A 2PHBA 4ZROA 1BTYA 1WTGH 1N1LA 2CJIA 4INKA 3KYFA 1QTFA 2PKSB 4U01A 3I29A 1SFIA 2O8TA 4F55A 3FFGA 3I78A 5SGAE 2A5AA 4AYYB 4Y10E 1VCQA 3U8TH 1O36A 3ZVCA 2XOKD 4O3UA 2GCHG 1NRRH 3FN8A 1ZHMA 5L30H 2VBCA 5L6NH 1NRQH 4JYTA 1ZTKA 3VPKA 5LPFA 2GZ7A 2ZCLP 4A92A 2BM2A 3EDXB 1ELGA 1AE5A 2R3UA 1BBRK 1BMFD 4ABBA 2Y7ZA 3RXIA 4GHQA 4TT3D 1UK2A 2ULLA 3VB3A 1A61H 1IHSH 4A5TS 1Z71A 3W95A 1UTJA 2OC8A 1QFKH 2SNVA 2TPIZ 4R1AA 3P17H 3TNSA 1E0FD 2Z7FE 2ZU2A 1O37A 1P3CA 4AB9A 1CVWH 3ATLA 5F6MA 5ETXA 5C0UA 2HALA 1HV7A 1AIXH 1NPMA 1AFQC 4DVAU 2ZA5A 2KCOA 3L3TA 1MAYA 2Z9IA 3OY5U 3H7OA 3IG6B 1WV7H 4H6TA 2A32A 1W13U 1AHTH 3F0PA 5C5NA 2FOEA 5C94A 3ZVBA 6CHAB 4AFZA 5FAHA 4DURA 3FP6E 2ZTZA 1TNKA 1HYLA 4BVWA 4JZEH 4P00A 1TPAE 5JBBS 3OTJE 4SGBE 3ZZ8A 4IMZA 4DT4A 1H9LB 3MO9A 5DJ7A 1XUJA 1O2VA 3E16B 3Q00A 1F0RA 2CN0H 4I8HA 2BOHB 3ZZ7A 5E0HA 1I8NA 1IQFA 4B1TA 4AFQA 1FX0B 5EQQA 1T8OA 1CGIE 1O2QA 4NWLA 3P8FA 8LPRA 1SGYE 5PTPA 5TCCA 4WMEA 2FM2A 4FUEA 3SNEA 2YOLA 3MWIU 3PM3A 2Q6GA 1BHTA 4YIZA 1DWCH 4TPIZ 1NL1A 4J1YA 1B5GH 1XMNB 1MTVA 4KELA 3A7TA 4XE4A 1ZGIA 6ESTA 4FETA 4XDEA 2G8TA 2Z8WA 4BTUB 2Y6TA 3SRIA 3SQEE 5EJ1A 1GBLA 1TPSA 2BVXH 4FXGH 3U69H 4I86A 3RDZA 4DGJA 1O39A 5E8EH 2FOMB 3RXOA 4KTUA 5G4BA 4AB8A 2J4IA 3VXFH 3MFJA 3PYHA 2KCPA 1IQNA 1GDNA 2BD9A 2K1QA 1C5YB 3RMLH 3V7TA 4CRBA 3JZ1B 3W94A 2J95A 5ABWA 3WWBA 2ZFPH 1DUAA 5LPRA 2WV4A 5FBIA 3SNBA 4BTTB 1V2UT 3MHWU 1Q2WA 1QB1A 5EXNA 3RXTA 1P2KA 2GT7A 1JRSA 2PTCE 3EA9A 4RT1A 3KIVA 3DD2H 4AGJA 4F49A 3OTPA 1O31A 4A6LA 3DUXH 4YIVA 5DPAA 2H1UA 3U1IB 2CK3D 4Q2KA 1NRSH 2BOKA 9LPRA 4Y71A 1EP6A 2QJ2A 3HMRA 1EZSC 2XYAA 3TGJE 3T28A 1ZHPA 1UMAH 3P6ZB 1K28D 4DIIH 4ZKOU 1NBME 4OM9A 5C0TA 1GP9A 3PWBA 1LCYA 2OINA 1DLEA 4WXIA 1RD3B 3BG4C 2BQWB 4IGDA 2PGQB 4DT7B 2GGVB 2BX3A 1OP8A 1HIAB 1TQ0B 1A3BH 3C1KA 3UQVA 3MYWA 1PPFE 2XWBI 4CIKA 1CA0C 1XUFA 2EI8A 2PGBB 4CHAC 4R1CA 1LHEH 3RC5A 3VB4A 1CEBA 1QBNA 4HTCH 1KLJH 1TFXA 2FOBA 2Q1JA 4CR9A 1MZDA 1P2QA 1AUTC 5TJXA 4D9QA 1W14U 5DP9A 2FLBH 3SNDA 1P12E 3LJJA 2WPDD 2RDEA 2V3OH 3BIVH 1KDUA 1UTOA 3SUEA 2PKAA 3UWIA 1ELFA 3RXRA 2BY5X 3SU5A 3A83A 1CA8B 1O30A 1NROH 1V2MT 4Z1MD 2SNWA 3HPTB 3SQHE 1Z7KA 1W12U 4ISLA 4LXBH 5EJLA 4ZUHA 1C9TA 2HOBA 2A7JA 3LC5A 1O5EH 4E7RG 4O9VA 3PV5A 3NUMA 2SGFE 2F9BH 4B71A 4YXWD 1IQJA 1T7CA 4MDSA 2AS9A 1AWHB 1BUIA 2W7UA 4WMFA 1C2JA 1P8VC 2QAAA 1GMOA 3BTME 1TPPA 3DSOA 4F48B 4UEHH 1T31A 4AFSA 1NU7B 2FZZA 3SU6A 3E90B 1C5QA 1XUHA 4UAOA 1PMKA 2JETC 3STIA 1Z40A 2FMJA 1ZMJA 1C1RA 2ZQ1A 2SPTA 1CBWC 2ZHEH 3QZQA 3LAQA 2OTVA 2F9UA 5CSQA 2CF9H 2HVXA 3K9XB 1Z6EA 1S0QA 1FNIA 3P92A 2OBQA 1GBBA 1NRNH 2FS9A 2ZU5A 3LT3A 4Y0ZE 4Y8ZA 4OGYA 1MD8A 4TWYA 3UQOA 1GI5A 2IPHA 1H8ED 2UUFB 5GXPA 2ZWLH 2QYIA 1Y8TA 3RU4D 3DSGA 1RIWC 2BVRH 1MMJN 2VIWA 3GDSA 3P70B 5FCKA 2PKSC 1P2IA 2PP6A 1CA0B 3ATIA 3HATH 2FOGA 2YILA 1CHGA 2ILNA 3NXPA 5A8XA 4H42U 1J14A 1D6RA 1YPHE 3ATKA 1C2EA 1SKYE 2FOCA 1IQGA 1G37A 3GY2A 5HYOA 1RRKA 1Z1IA 2VWMA 1P9SA 2Y80A 1GL0E 5DP5A 3T26A 1UVOA 3LH1A 4R19A 3RXPA 3E6PL 2GMTC 7GCHF 1FLEE 4O3TA 3Q3KA 3T27A 1FV9A 3BTTE 5AVDA 1YPKH 2A2QH 3K65A 1GJ5H 2QF3A 1YKTA 4BNRA 1PYTD 4KKDA 2I9AA 1C2KA 4IW4E 3STJA 3EA7A 1NL2A 4CRDA 2ZI2H 3A85A 2ZQ2A 1LQEA 3M3TA 1ZYOA 1SGRE 1ABIH 5HIYA 1RTKA 1YC0A 1O3JA 2BD2A 1MH0A 1GI7B 3QO6A 2TGTA 4JCNA 3LJOA 3S9BA 1GHBF 5F8TA 4KGAA 3TK5A 5CHBA 1E79D 1K1MA 1IOEA 1V6DA 2F9NA 3AW0A 5C1XA 4X1QU 1WU1A 5CMXH 2YNAA 1NN6A 2J34A 4OS5A 2K51A 1FIWA 3L33A 2EI6A 2HPPP 4ISIH 1TPKA 4LZ4B 2R0KA 1GWAA 1Y5UT 2EEKA 2A45B 2BY9X 1DY8A 2D26C 1KXDA 2I6QA 3RMOH 3A86A 1O3BA 1HLTH 5CDFE 2V35A 1YCPM 3DSPA 3RC6A 2TBSA 1H4WA 2ZF0H 3RU4E 1EZUC 4AFUA 1XUKA 1L4DA 3K65B 1NU9A 3O8CA 2NWNA 3MKPA 2XNIA 1OWDA 1OP0A 4JZIA 4AG1A 3UY9A 3BT2A 3M35A 3WWFA 2CHAC 3QDZB 4K5ZA 2ZDNA 1S6FA 2PTNA 3KQDA 1ELCA 1ANEA 1AU8A 1OWIA 3PB1E 2PLXA 3KNXA 4GUXA 4NWKA 4OS1A 1GHZA 3MU5A 3SV8A 1E38B 1SC8U 5B6OA 3LU9B 3KYGA 2RA3A 3RXCA 4AYVB 1KXEA 1HAIH 3TJNA 1K2I1 5CT3A 1ETTH 1SGIB 2O8WA 1DE7H 3GOVB 5K0HA 4MLFB 3BTHE 5E0JA 3UAIC 1EAUA 2P3FH 1UHBB 1K1PA 2PWXA 1IAUA 3TLOA 5EGMA 1KXFA 4CH2B 2W3IA 1O2YA 1S83A 1C2GA 4GCHG 3SU1A 2GD4B 4K60A 1YLNA 1C5SA 1JIMA 4HI3A 1MTUA 1TE0A 3RLYH 1C2LA 1THRH 3QUMP 2WUCA 2ZZUH 1T8NA 3TJUA 2DE8A 1H9IE 1LKBA 2K13X 1O3MA 1G2MA 3S7KB 3DCLA 5HIZA 1XUIA 1W7GH 3ITIA 3HMTA 1EATA 1NO9H 2BD8A 3M37A 1A0LA 4E06H 3D49H 1RTLA 4BAHB 1I5KA 2R0LA 3PROA 3ZLEA 4HGCA 4KTSA 3SZNA 1IQEA 1K1NA 3LGUA 4FOUC 2VVUA 2Q8BA 1ZPZA 1D9IA 4X6PA 4NIYA 3S9CA 1W7XH 2XRCA 1Z8IB 3SJ8A 1GBMA 1AKSA 3SU3A 3A84A 3SU0A 1UTKA 2P93A 3V3MA 3EE0B 2WV9A 2PUXB 1DWBH 3E8LA 2FP7B 4Y0YE 3LOXA 1ANCA 1BOQA 3EAJA 3F2HA 2FYQA 2UUYA 5F8XA 3UREA 2QE7D 2PW8H 3SGBE 4IMQA 1O2RA 2JH5D 2GDDA 2R3YA 2KR7A 4IN2A 3SUFA 1G36A 2OQUA 4I31A 1DT2A 5EW1H 1LVBA 1DY9A 4NA9H 5A0BA 3T2NA 3TVJB 1KLIH 3KQ5A 5LGOA 2ZCHP 1SOTA 4BAQB 1CO7E 1Y5BT 3A82A 4Q7YA 1GMCF 1HFDA 4ABIA 1TNGA 3MU4A 4RKJB 1C5XB 3P8NA 3BTQE 2EA3A 3D23A 1SL3A 4WXVA 1AZ8A 2STAE 1LPGB 4INHA 3LH3A 1LHCH 2I6SA 2XC0A 1HB0B 3MQKC 2XXLA 4UV6A 2WV5A 4FUIA 5FX5A 3VEQB 1HAVB 3ZYDA 3AVZA 2GTBA 2Y82A 2LNCA 4A1TA 2HGFA 2CF8H 4NG9H 4ISOA 1V2ST 1O3HA 1N8OC 2IPQX 2WPIS 4DIHH 1C5PA 1O2XA 9ESTA 1XX9A 3M7QA 4O97A 4NFFA 3BIUH 2GCTC 4ABFA 2ZGXH 3H09A 2HNTC 2Z9JA 1SGFG 2C93B 3ZZAA 2C4FH 4IBLH 4ZHLU 4HZHA 4B6FA 1NFYA 3PV2A 1V2VT 4Z0FA 3AW1A 1K22H 1TABE 2PUQH 2QXHA 3V12A 3RXUA 4AN7A 4ACBA 4IC5A 2J8JA 3A88A 3BTGE 1SR5C 1AVXA 1D3QB 3E0PB 1JRTA 2HPQH 4NSVA 3W1EA 2FEBA 1YXEA 1DICA 1BMMH 1IQLA 2Q6FA 4FUHA 3LGIA 2V0BA 2UWOA 1P2JA 1GDUA 2THFB 3BF6H 4X8UH 2ZFFH 1M9UA 2VGCC 3HKJB 5JB8S 3T29A 2RA0A 4B2CA 5A8YA 1HPJA 1OWHA 1OKXA 5I25A 1K9OE 4XFQA 3S69A 1E37B 1UVUH 2C8YB 4ZKSU 5AF9H 4YTAA 2XNDD 1P2NA 4ISHH 5HKKD 5AFZH 1SB1H 1TRNA 1QBVH 3M61U 2ANYA 2SGPE 2QF5A 4D7GA 3P8GA 5A0CA 2A1DB 1WAYB 1G3CA 1GMDG 1H8DH 3U8RH 1E1QD 2AGEX 2ZC9H 2GMTB 2J92A 3B8JA 4M9FA 2L74A 3UFAA 1P3EA 1TBQH 1TNJA 3RUOA 4Z09A 5EJZA 1BT7A 1ZMLA 2DOHX 1GHYH 4K1EA 1NT1A 4UFFH 2BY8X 1L1JA 2A5IA 4NIVA 4OS6A 3LC3A 1JBUH 2VIVA 1MCVA 5GPIB 2FI3E 5FPYA 1SSXA 3F9FA 5L2YH 1TGBA 2JH6D 1QZ8A 2GDEH 3QN7A 1GHBG 2HRVA 4K1SA 1G3DA 1OYQA 2A4GA 1MTNB 2ZPSA 1WDIA 1O38A 4RI0A 1YF4A 1RXPA 2C8XB 2ZPQA 3CNRA 5E2PA 4FU9A 1CU1A 3UR6A 2Q6DA 3FVFB 3M7TA 1E36B 1UVPA 8KME2 2ZG0H 3EA8A 4THNH 4TSFD 1W81A 3KEEA 1C5UA 1DXPA 4XSKU 1F0SA 2GP9B 1KTTB 1OSSA 2BDBA 1LHGH 3TPIZ 1GBIA 5L2ZH 2CHAB 2HNTF 1EB2A 4ISNA 4X6MA 1SQAA 2JETB 2ZDMA 3VB7A 1EZXC 5DP8A 1H9HE 2J38A 1JMOH 2VNTA 4BV7A 1KIVA 1KSNA 1QJ1B 1A4WH 1E1RD 1C5LH 4FUBA 1YPHC 3A89A 3CS7A 4I32A 3ODDA 1O3GA 3GCOA 1QL9A 1V3XA 4BVVA 4TYDA 1TONA 1S5SA 1TX6A 3SJKA 2Y5GA 4GLYA 1TPOA 1F7ZA 4NIXA 1TYNA 1AI8H 2PV9B 4X2XA 3GISB 3MH4A 4OGXA 4D3CA 1O2JA 1K0HA 3C27B 1YP9A 1PPCE 4BOHA 5DGJA 3F2GA 1TA6A 1BHXF 5DP6A 1V2LT 1P02A 3B9FH 4Z6AH 3RC4A 2WPHS 1RFNA 1YY3A 1FAXA 1YBWA 1O3FA 1D3DB 1QB9A 1TGSZ 2F9PA 2VIOA 1HAOH 1C1PA 1OWKA 3OYPA 1HRTH 4IS5A 1IQHA 4CRFA 1DANH 2A7CA 4Y8YA 5JYIA 1FAKH 2FX4A 1ELEE 1PFXC 1GCDA 2YIOA 1QURH 1QRXA 1DWEH 3M3VA 1AD8H 4NA7A 5JBTA 1BBRE 1ZZZA 3QLPH 1DS2E 1GBFA 2SGEE 3VGCB 1ESAA 2P3UB 3SUGA 6GCHF 1PPBH 1W0JD 2FIRH 5C3NA 3GCNA 2IJD1 1V2RT 2XBXA 1UK3A 1GHWH 2ZP0H 1FONA 3OEED 3BEUA 1P06A 3TJOA 1JFNA 2VH6A 5HXFA 1GI2A 5T1VA 2WZQA 2G51A 2R9PA 1UW7A 4Y7AA 2QY0B 3HN4A 1J16A 1O2MA 4MNXA 1LPKB 1AMHA 1Y3UA 1GCTB 3KGPA 1AN1E 4I8JA 2RFKC 1LDTT 1F5KU 4TPYA 1TLDA 3IWMA 4MPVA 1O3AA 4DJZB 1DLKB 1BTXA 1O3CA 2L0SA 2QN5T 3N7OA 1EJNA 2BHGA 1Z8RA 1ID5H 1G32B 1U6QA 1NESE 1D3PB 3UB0A 1BHXB 2SGQE 2G5NA 4PROA 1K1OA 4ZHMU 2BLVA 2FOHA 4TY6A 1IHTH 3OEHD 3WY8A 1EPTA 2B0FA 2C8WB 1VITG 2ZTXA 1T4VH 2GCHF 3UOUA 3U9AH 2AIQA 4M7GA 5DP3A 4GSOA 4YOIA 1TOMH 3TIUA 4JMYA 5JDUB 1VCPA 2FD6A 1AUJA 1CGJE 3TITA 1HGTH 3M3SA 1SPJA 2UUKB 1O0DH 1SGNE 3BEFB 1EXFA 4AX9H 1NK1A 4K8YA 1GJ4H 4Q80A 1EKBB 1C4U2 1AB9B 2XCFA 1ETSH 1MTWA 2NU3E 2J97A 4B75A 1FN6A 2FI4E 2OC0A 4A1XA 4AC9A 1SLXB 2JJ1D 1GL1A 3MH6A 3DFLA 4K69A 2BDIA 4MPWA 1LVYA 1GBAA 1PKRA 1VCWA 3QZRA 5JBAS 1O2PA 5EXMA 1ACBE 1T8MA 3SORA 1GI4A 1O5AB 1MBQA 1GCTC 1P11E 1PQ7A 3RXAA 4A1VA 2M2AA 4ZH8A 3F6UH 2AMDA 3A80A 3UR9A 3BN9A 2AFQB 5T3HA 2TRMA 1XKBC 2ZGHA 4YOGA 1O2SA 2WPLS 2H9HA 2IJOB 5DK1A 2W5EA 3A8CA 1GG6C 3U98H 3MU0A 1KDQB 3A7WA 5EXLA 1NS3A 2FO9A 5AFYH 3FANA 2H5CA 5BRRE 1N6XA 3TJVA 1A3EH 5CS5A 2AMPA 1QHRB 1DDJA 1GBJA 4Y7BA 4YT7H 4MG3A 1LVMA 1SOZA 3D65E 1K1LA 2Z3DA 1C5NH 3JZ2B 3N7DA 1O32A 1MU6B 1UTLM 3L6PA 2ZU4A 4YLUA 4YT6H 1SQTA 1TRMA 1Z6JH 2FXRA 2ZFTA 1A2CH 4X1NU 3SNAA 5GJ4B 2PSXA 1SI5H 1TMBH 1JIRA 5FPSA 1W8KA 2XBYA 3BG8A 3ZVFA 1CGHA 2FS8A 2Y5HA 1EOJA 3LIWA 4NFEA 5BPEA 3TGKE 1NTPA 3KCGH 1P10A 2KCAA 2FYRA 1SGCA 4YZUA 1OP2A 4X8SH 3F2FA 2F3CE 2RDLA 1MKXK 5JB9S 2ZKSA 1TGCA 1C5OH 1GMHG 3AAVA 7KMEH 3HGPA 1GMDF 2XBWA 2ZDVH 4AOQA 4WH6A 1F0UA 1GJ9B 1RIWB 2VIDA 5ESBA 4R8TB 5DO4H 3O8BA 4BVDA 3RXGA 3ZV9A 5EU8A 2BZAA 1EAWA 5CS1A 5EQRA 1Y3WA 3TU7H 1AB9C 3K2UA 4DCDA 5EPNA 2G4TA 2BD3A 2AYWA 1OXGA 1O3IA 1Y59T 5J4QA 1O2IA 2VWOA 2Z3EA 3KF2A 3LKWA 3PLBA 1O2GH 3RXSA 1YCPH 1L1GA 2BXUH 5C5OA 1G3BA 3PMHB 3SUDA 1ZSJA 1CBWB 3SN8A 3ZIAD 1BRCE 4IC6A 2O8MA 1TWXB 5C67A 4JK5A 1B7XB 1ZLRA 1P2OA 4FUJA 3ELAH 2WPJS 3TGIE 3U1JB 1B0EA 5CT1A 3GCHB 4BTIB 1J8AA 3K6ZA 4B2AA
chains in the Genus database with same CATH topology
2OC7A 1L1NA 2P94A 5C1YA 2ZCKP 3QX5H 1RTFB 5FBEA 1Y5AT 1HKYA 1O5FH 1MQ5A 4UONA 3VGCC 1GI1A 4FVDA 5EPYA 1KXCA 1UJ1A 2P95A 1TNLA 3SO3A 1SLWB 1KRNA 5EQSA 3RXLA 1PQAA 3DFJA 2RG3A 2GZ9A 3SP8A 4H4FA 1HJ9A 3OU0A 3UUZA 4DG4A 3ZYEA 1O5GH 2PKAB 4FUCA 1G2LA 4CR5A 1QCPA 2AGIX 3TK6A 8GCHF 4MNWA 3SNCA 4APLA 1Y3XA 4CH8B 1XUGA 4XBDA 1V2KT 4B2BA 2G4UA 4APMA 1W11U 1ZTJA 3ZV8A 2A4QA 1ZJDA 2Z8VA 3PO1B 5GCHG 2BY7X 3UNRA 1UCYK 1AE8H 1C4V2 1UCYE 2VVVA 3LPRA 1TNHA 1NFXA 1C2IA 3BG4B 3QGJA 2STBE 2AMQA 2H6MA 1SGEE 5DP4A 1MAXA 1ORFA 3V0XA 2FPZA 4CRAA 1P9UA 1VGCB 3MOCA 2IN2A 3MTYA 2A0QB 1O2WA 1UHBA 1URKA 4CRGA 4ZKRU 1MKWH 2WYJA 2GCTB 1AY6H 1WBGB 3SJOA 5A09A 1HAHH 1O2ZA 4MNVA 4ZHAA 2J94A 4NGAH 3GY5A 1QQUA 2ASUB 3DT0H 1DSUA 4D9RA 2GZ8A 1ESTA 1HAVA 1O5BB 2ZGCA 2CGAA 2JH0D 5CS9A 4MPXA 1GDQA 2VWNA 1W10U 4DOQA 4ZMAH 1ANDA 3VFEA 2BDCA 2P8OC 1C1WH 1GBKA 4MNYA 1C5RA 1A5GH 1GI3A 1MTNC 4X6OA 1KIGH 3GCHC 3RMNH 4FU7A 1GI8B 2AERH 1ZMNA 4R1BA 1GGDB 3URDA 1GGDC 1GPZA 1GMNA 4B76A 4ZKNU 1F5LA 3VXEH 1BMNH 4ABJA 3KHVA 1IQIA 1SGFA 4Y6DA 2IOTA 2SFAA 1C1OA 1TB6H 1VITH 3FP8E 1AVGH 2VIPA 1P05A 1ZRKA 4NA8A 3BTWE 2QXJA 5DKMA 4YESB 3FZDA 1PQ5A 1D4PB 1VITF 2XW9A 1A0HA 4WJG2 3MMGA 1ELDE 2PSYA 4U2WA 1RS0A 1P03A 1BTPA 1IQMA 2PF1A 2A4RA 3KQCA 1HXEH 1H1BA 1W0YH 3GDVA 1EB1H 4I8LA 4BAKB 4JZ1A 1QB6A 1DSTA 4JZFH 4X1PU 2C90B 2QF0A 4NIWA 1O2LA 2BD5A 3SV9A 1FY8E 4X0WU 1P09A 1DUEA 2LPRA 1BJUA 4AGKA 2WPMS 1ABJH 1AGJA 1UCYH 1YPJH 2BQ7B 2VGCB 1WCZA 1S0RA 2DE9A 4XBCA 1MQ6A 1YM0A 1ZTLA 1F5RA 1W8BH 1W0ZU 2ZEBA 1KY9A 1I71A 4MTBA 2F83A 4AORA 1E34B 4BAOB 1K21H 1C1SA 4Y79A 1ELAA 2ODPA 7ESTE 4GAWA 2VVCA 5LH8A 1F2SE 3T62A 1DX5M 1EP5A 1O2KA 1TMUH 4Q7ZA 5CE1A 2FDAA 3FAOA 1CQQA 1IQKA 1QR3E 1T4UH 2ZGBH 2QA9E 3OSYA 3O8RA 1C4Y2 1EPTB 1ARBA 1HJAB 1OWJA 1ZOMA 3E91A 4I8KA 3DHKH 1FMGA 1QGFA 3E0NB 1GG6B 1QRZA 3RM2H 2KL5A 1UK4A 1SHHB 5GIBA 2A2XH 4FVBA 3GY8A 1JOUB 1P0SH 1YPEH 1CHOF 2ZO3H 1JXPA 1L4ZA 1XXDA 1PPEE 3URCA 2LL3A 1D6WA 1K1IA 1TQ7B 1F92A 3GCTG 2GKVE 2AGGX 1BTHH 3UTUH 2CMYA 4IN1A 3ZZ6A 1TOCB 2AIPA 3SJIA 2ESTE 3V13A 3GDUA 1DFPA 2G00A 1S85A 1CE5A 5DP7A 1EAIA 2CXVA 4YM9A 1ELTA 4U30A 1BZXE 4QT8C 2FLRH 1QIXB 3EGKH 1O3EA 2Z9KA 1YYY1 4ZAEA 4UFGH 3RXEA 1N8OB 1DWDH 1KI0A 1UO6A 2TGPZ 1MKXH 2HWLB 5IYTA 3TH3H 5CS3A 4DY7B 1FXYA 6CHAC 1KDQA 1O5CB 3P95A 3S9AA 3RLWH 1L2EA 2ANWA 2Z9GA 4SGAE 5GDSH 2Y8RA 1GBTA 1WYKA 3NPSA 1GI6A 3PLPA 3QGNB 3A81A 2JKHA 1UTQA 2ZHDA 1WQSA 3SGQE 3ZVDA 1OYTH 1AFQB 2PK4A 4WMDA 1NRPH 1XXFA 2ALPA 1A7SA 4BANB 2K4RA 2BLOA 2PFEA 4X1SU 1PPGE 2ZFQH 3M5MA 1LHDH 3PLKA 2G55A 1ELBA 2HGTH 1SLUB 1TGNA 1GHXH 3LGWA 1LPZB 2ODQA 2BYAX 1A5IA 5I46H 4WVPE 1LTOA 1PYTC 1E35B 3BTFE 3SHCH 4D76A 3MH7A 2HLCA 1BDAA 3B23B 4ESTE 2UWPA 1TBRH 1BQYA 2SGAA 2H5DA 3VB6A 4ABDA 2NU2E 2VJ1A 1C1VH 2ZHQH 4Y8XA 2GT8A 3ESTA 5LPEA 5JPMH 3MNBA 3RU4T 1SLVB 2ANKH 1C1NA 2FWWA 2GVFA 3LDXH 4FUFA 3AAUA 1HJ8A 2QC2A 1T8LA 2YIPA 2VH0A 3MU1A 3LGTA 1NY22 2OBOA 1QQ4A 1BRBE 4JYUH 1B0FA 3P8OA 3R3GB 4X2VA 4AG2A 1WQVH 2WYGA 2V6NA 2FOAA 4ZXYH 3RXQA 1DITH 1RJXB 2J8LA 1FDPA 4LOYH 5E2OA 5GCHF 2ZU3A 1INCA 3ZZ5A 1DM4B 4NZLA 1C1QA 1PQ8A 2B8OH 2BX4A 2FI5E 4Z0EA 1EJMA 3RXMA 1B2IA 1SVPA 1SGTA 3ZZDA 1UTMA 3DA9B 3M5OA 3K6YA 1SMFE 3QK1A 3U73A 1GI9B 3UPEA 3SV7A 1OS8A 3SI4H 1V2JT 3S7HB 3SI3H 1GMHF 4KIVA 1SHYA 3QWCH 3LGVA 1C2FA 2W26A 1TA2A 1O2NA 5FPTA 2ZIQH 1AQ7A 7GCHG 1AVWA 1DPOA 1S81A 2BMGB 1O2UA 1HNEE 5HGGA 2EI7A 3TK9A 1OWEA 1TX7A 3A7YA 1S6HA 1GHAG 3A87A 5EW2H 1GJ8B 2FTLE 3I77A 1BBRH 4TY7A 2P8OB 2ZGJA 3MO3A 1O3KA 2XCNA 1F0TA 4OS4A 2R2MB 4FUGA 3SU4A 2UWLA 1LVOA 4K8BA 4MPUA 3PMBB 1TGTA 4X6NA 2VWLA 3VB5A 2NU4E 1HAXB 2B5TB 3HGNA 1BMAA 4MVNA 1FI8A 1VJAU 1A5HA 1O34A 2XWAA 2FX6A 1K1JA 3ATMA 1EZQA 2P3TB 2QJ4A 1HAYB 4ABGA 4ZXXH 4U32A 5CT2A 1XM1A 4GPGA 1CT4E 3MH5A 3Q77A 3KN2A 3PTNA 3FP7E 3OY6U 1UVSH 3NZIA 1SQOA 3A7XA 1LQDB 3SBKA 4Z0KA 4CREA 1YPGH 1LKAA 1EJAA 3Q76A 2BDHA 4X2WA 1C2HA 1G9IE 1YLDA 3HMSA 1FZZA 1TX8A 1A46H 5EODA 4UFEH 1YGCH 2D8WA 5HMAA 2H9TH 4OS7A 2ZFSA 3PO1C 3CP7A 3MNSA 2OCVB 1QY6A 1O2TA 3BV9B 3RXDA 1VR1H 1FJSA 1O3NA 2I9BA 2ZU1A 1KYNA 1BIOA 1ZPCA 2VB0A 3RXHA 3GCTF 1FY4A 2G81E 1C2DA 1ETRH 1QJ6B 2QXGA 2LL4M 3PMJA 2ZFRH 2Z3CA 2CV3A 3TNTA 3MO6A 1J17T 3RP2A 3ODFA 1P01A 3A8BA 1GBEA 3EQ0H 3SOSA 1GJDB 2A4OA 1P57B 3SW2B 1V2WT 3ENSB 1LHFH 2OP9A 3A8AA 3NKKA 1EOLA 2BD4A 1NFWA 1C9PA 3SHAH 3GYLB 4E05H 1HDTH 7LPRA 5FXLA 1HUTH 5FCRA 1V2QT 2QCYA 3NK8A 2F9VA 1GJAB 1GVKB 2DUCA 5TCAA 1GHVH 1GI0A 3A7ZA 4X1RU 1NC6A 1MCTA 3SJ9A 1NFUA 4X8TH 5J4SA 2RCEA 2WPKS 3SRJA 1S84A 2QIQA 3R0FA 1ZR0A 4XBBA 3T25A 4Q7XA 1FIZA 4RSPA 1HPGA 1Q31A 2SGDE 2ZHFH 3KQBA 1GBCA 1Z8JB 1BTZA 5A2MH 3ZZCA 3UNSA 3MU8A 1YPLH 5AHGH 3KQEA 2HPPH 1QA0A 1MTSA 1TRYA 1AWFH 2ZDKA 4RN6A 4RKOB 1HXFH 1XVMA 2ODYB 5IDKA 4BV5A 1V2NT 3TH2H 2BDYA 1DXWA 1MKWK 4DW2U 6GCHG 2V3HH 5FX6A 2XC4A 3FZZA 1AKSB 1TALA 1RGQA 2BQ6B 3F68H 4B74A 1C5MD 2A7HA 1PJPA 4YOJA 4R0IA 1CSOE 4KTCA 2FEQH 1A1RA 1J9CH 2OQ5A 3O8DA 1NM6A 2H2ZA 2BLWA 3BTEE 1QNJA 2ALVA 4NCYA 5GWZA 1C1UH 2FOFA 3T5FH 2KAIA 1EX3A 4CBOA 3GY4A 1C5ZB 2BXTH 1HAZB 2QGRA 3BSQA 2BLQA 1O35A 1YLCA 3CENA 4BXSA 1TAWA 1O3DA 3TH4H 4AZ2B 1UVTH 2XBVA 3U8OH 3SGAE 1QA7A 1GJBB 3BTKE 1BA8B 3HKIB 2M5TA 4D8NA 3NWUA 5COEA 4WWYA 3IITA 2TGDA 1W3CA 2HPQP 1O3OA 2Y5FA 2PR3A 3MI4A 2DOIA 1MBMA 1WUNH 2BVSH 4VGCC 1C2MA 1TBZH 4JYVH 3EYDA 1XKAC 5CP9A 1G30B 4LZ1H 2TGAA 1SGQE 1PPZA 1OOKB 1WOFA 1FQ3A 4BVCA 2C8ZB 1H8IH 1S82A 1PK2A 5T6FA 1SBWA 2O9QA 2BB4A 5H4IB 1LO6A 4E7NA 5EOKA 1FY1A 2QXIA 1YPMH 1C5WB 1EASA 1VJ9U 2GV7A 3UNQA 3GY3A 1Y3YA 4Z0DA 1EUFA 2G52A 2D1JA 2NU1E 1X7AC 3S0NA 1SGDE 1A0HB 1BMLA 4J2YB 3E1XB 1GBHA 1V2TT 1QL8A 1GHAF 2GV6A 3BT1A 3F9GA 3RMMH 1OX1A 1CT0E 1KXAA 2B9LA 5DG6A 2OLGA 3LGYA 2Y81A 1YCPK 1QBOA 1KTSB 2ZECA 2BDGA 4ASHA 5A0AE 1Q3XA 2ZDLA 1WSSH 2A5KA 3MNXA 4JZDH 4OS2A 5ESTE 1W2KH 2BDAA 3SV2H 4X8VH 4LK4A 3SU2A 3E3TA 5F03A 1KXBA 3RXJA 3PV4A 3A8DA 3SV6A 2P16A 1C1TA 1HCGA 1UTNA 4K2YA 4A7IB 1GVZA 4ABHA 2C3SA 3RM0H 1ARCA 3MNCA 1TNIA 3HK6B 1Z8GA 3PMAB 4NZQA 1FPHH 1XVOA 2WINI 4B73A 1PK4A 2J9NA 1HPKA 2F91A 4X2YA 1FY5A 1EQ9A 1ELVA 2OC1A 3M5LA 3ZZBA 1ZSKA 2VU8E 3ZVGA 1OPHB 2ANMH 4H6SB 5HM9A 3F9HA 2XTTB 2O8LA 4INLA 4NSYA 3ZZ9A 3RXKA 1ANBA 1BRUP 1FN8A 3ZVAA 3G01A 4I33A 1QRWA 4BAMB 4HFPB 2B7DH 2ZHWH 5C1UA 1VGCC 2OD3B 3QTVH 2FODA 1LMWB 4Y11E 4YLQH 1GBDA 2Q8AA 3RXBA 3UIRA 3F9EA 2WUBA 2ZNKH 5JBCS