4A5TS

Structural basis for the conformational modulation
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
791
structure length
767
Chain Sequence
b'EPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PLASMINOGEN
publication title Crystal Structure of the Native Plasminogen Reveals an Activation-Resistant Compact Conformation.
pubmed doi rcsb
molecule tags Hydrolase
total genus 181
structure length 767
sequence length 791
ec nomenclature ec 3.4.21.7: Plasmin.
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00024 PAN_1 PAN domain
S PF00051 Kringle Kringle domain
S PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4a5tS08
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4a5tS07
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4a5tS05
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4a5tS06
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4a5tS03
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4a5tS04
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4a5tS02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 4a5tS01
5F6MA 1OWHA 2A0QB 5IDKA 1AZ8A 1SGFG 2UUKB 3SHAH 3AW0A 1GCTC 4ABEA 2ZDKA 4UEHH 1EP6A 1JIRA 2FOHA 2Y81A 1W13U 1WV7H 1ARCA 1O5BB 2THFB 3RXAA 2Z3EA 2NWNA 2QF3A 3E0PB 1LVOA 1C1QA 5H4IB 5ETXA 1DX5M 2CGAA 1TGBA 1O2GH 4H4FA 2WPIS 2G81E 3LC3A 3KQEA 3P92A 3ZZ4A 4QT8C 2HGTH 1HJ8A 2ZGCA 1V3XA 2FOFA 2Z9GA 1W3CA 4K69A 5J4SA 4AB9A 1MD7A 2G51A 1LVMA 3OY6U 1O5FH 2BM2A 1QRZA 3SNCA 1MU6B 3P8OA 4IGDA 1GG6C 2WV4A 2ZPRA 3HPTB 1ORFA 4YZUA 3F9FA 2D2DA 1O2WA 3MH6A 3TGKE 3A7WA 4UFFH 4NA7A 1KY9A 1G2LA 1U6QA 3QWCH 4X6NA 1O5CB 1P2QA 1CBWB 1C5NH 2BY9X 2J94A 4X1NU 2FX6A 4HFPB 1K1MA 2NU2E 5AFZH 1O2YA 1ABJH 1QR3E 1FLEE 4IN1A 5EPNA 2FTMA 3PMJA 5T6FA 4Y0YE 1ZZZA 3UQOA 5FCKA 5DPAA 2AEIH 1KIVA 1GMDG 3RXEA 1D6WA 1QBNA 5ESBA 3RXLA 1NK1A 4YLQH 4GLYA 1XX9A 1IQJA 4BNRA 1UTKA 1C2DA 1DLEA 1DWDH 4WWYA 2BMGB 2JETB 1SFQB 1KXFA 3PROA 4UDWH 1DE7H 2BHGA 5E0GA 3K65B 4FUJA 1P04A 1MKWH 1TRNA 3LJOA 3P95A 3RMLH 1HPGA 1EAIA 1RJXB 1QJ6B 3UOUA 1YLDA 1P01A 1C5QA 1QA7A 5FPTA 1BJUA 2SGDE 1Z1IA 1G36A 2A2XH 4KIVA 2UUYA 1HAPH 1BQYA 2GX4A 2TGPZ 1FAKH 1QL8A 2AMDA 3BTGE 1HYLA 1NRRH 4K3JA 1SMFE 3NWUA 3AASA 5DP9A 5L2YH 1T7CA 1P09A 4K8BA 3GDSA 1V2LT 4Y8XA 1SG8B 2ZI2H 1GBAA 1WTHD 5L2ZH 1O5EH 3I77A 3RXRA 3HK6B 4X0WU 2PKSC 1K2I1 1AU8A 1ZTKA 2F9OA 1QRWA 2UWLA 1S0RA 1GBKA 1EPTB 1JRSA 4XBBA 4B73A 3F9EA 2ZFTA 3PMHB 3IG6B 1RIWB 1TNLA 4FUDA 3TNTA 2PUXB 2Z9JA 4O9VA 2TGAA 2LNCA 3T25A 3EYDA 3QGJA 1ETRH 1KXEA 1WUNH 1AGJA 3M7UA 1GDQA 1QJ1B 1NRPH 2GV7A 3SUDA 3H5CB 3SRJA 2ZEBA 3RXSA 3M3TA 4U30A 1NT1A 5EW1H 3I29A 1WOFA 5I46H 4FXGH 1C5OH 1GI3A 1NRNH 3BEUA 3M7QA 4O3TA 4HZHA 1O0DH 1GI7B 4CRBA 1Y3YA 4BV5A 1C1UH 4GHQA 1QBOA 1TABE 3M36A 1WSSH 4OGYA 4U32A 4LZ1H 1NFYA 1O2PA 3LONA 1HV7A 1KDUA 1BMMH 1O33A 1IQKA 3GY3A 1L2EA 3UWIA 1IHTH 3SUEA 4DY7B 1S83A 4SGAE 4AN7A 4YT7H 3VPKA 2FOAA 3G01A 3P6ZB 2PGQB 1WAYB 1THPB 2NU0E 4IS5A 1O3BA 3ZVBA 1JFNA 1IOEA 1Y3VA 3EA7A 1MD8A 2O8UA 1C1OA 3HMSA 4NG9H 1XXDA 1PFXC 1O2MA 4AYVB 3SGBE 4IUAA 1SSXA 1ZJDA 5E0HA 5FX5A 2BXUH 4CH2B 2G8TA 1WU1A 2J38A 1FZZA 1VZQH 3PYHA 3RLYH 1F0SA 3EQ0H 2ZGXH 1PKRA 1NC6A 1V2OT 5C1XA 1SGQE 7KMEH 2NU4E 3U98H 5L30H 3U8TH 3ZZDA 1AVGH 1DUEA 1YC0A 1ZMJA 9ESTA 4JZIA 1NROH 3M3VA 2OXSA 4NWLA 4A5TS 1MTWA 3LPRA 1KIGH 2PLXA 3KN2A 4ISNA 1KTSB 1GVKB 1C1WH 2CF8H 1O2LA 2ESTE 4I8LA 2QAAA 4BXWA 1ESBA 5DG6A 3TJUA 3DUXH 2KAIB 1MUEB 1TE0A 2ZFSA 2BD2A 4D8NA 3EDXB 4K2YA 1NL1A 1C9PA 1ELVA 2QC2A 3V12A 4E05H 4AOQA 1GBFA 4GAWA 3K2UA 3L33A 2YOLA 3T26A 2GP9B 1HKYA 2CHAC 3HKJB 2Z94A 1O3DA 2F83A 1CGJE 4ABDA 1W7XH 2OBOA 1DSUA 2SNWA 1ID5H 3GYLB 1MTUA 3BSQA 2RDLA 3DT0H 4FUCA 1P57B 4X8TH 3QX5H 2ZU5A 1GDUA 5JBCS 3PO1B 1UVOA 2VIOA 3HKIB 1WYKA 1CA0B 2B0FA 3UQVA 3ZVEA 1NRQH 3QTOH 4B71A 5FBEA 3L3TA 4J2YB 2TGDA 5AFYH 3ESTA 2VIVA 1LPKB 1TGNA 5FHTA 5HGGA 4CIKA 2A7HA 5DK1A 1A46H 1IQLA 3BIUH 1WQSA 1N8OB 2WPHS 2K1QA 2PTCE 3QDZB 3T62A 1RS0A 1TX8A 4X2YA 4BVDA 3FP6E 4A1XA 2VGCC 4I33A 5EOKA 1C2FA 1B0EA 3I78A 2ZDLA 1QGFA 1MZAA 1X7AC 2VWOA 1EZXC 1KDQB 1LHCH 2XWBI 4TPYA 6GCHF 3FAOA 4FUHA 1SLWB 1F0RA 1PYTC 1KXBA 1UHBB 2W3KA 2FOMB 1S0QA 2J95A 2AGGX 4B2BA 5AVDA 4IBLH 5HYOA 2AMQA 2Q6GA 1K1IA 5HXFA 3BG4B 1HAOH 1O3FA 1SC8U 4Y71A 3VXEH 3KL6A 1N1LA 1LTOA 2VU8E 3F9GA 4TY6A 4D7FA 3LT3A 2H5CA 2C3SA 4XSKU 2ZTXA 1AI8H 1J16A 1E38B 1K9OE 2AIPA 1PPHE 1TAWA 3MO9A 1UTPA 4DIIH 2W26A 1EOLA 2XW9A 5CT1A 1HXFH 4M7GA 1TGSZ 2Y80A 1GBIA 1BTWA 1O5AB 1ELFA 1LPGB 1O3AA 1IQMA 3PLBA 1F7ZA 1CE5A 2GT7A 4FVDA 3KQBA 4IW4E 1LDTT 2J34A 3E90B 2H1UA 4OS7A 2VNTA 2W7SA 1P2KA 1GBCA 3UY9A 1PPEE 1DXPA 4OS4A 4X6MA 4WMFA 2B8OH 1EB1H 8GCHG 2FZZA 4NA8A 2SGQE 3T29A 1UK3A 5EQRA 5C5NA 3GISB 2ZGBH 3ZVDA 1FMGA 1GBMA 4NZLA 5ESTE 1SLXB 4CRAA 3P70B 2GDDA 2P94A 2BLVA 4H42U 1TA2A 2Z9LA 3MNBA 3MNXA 3HMTA 4Q7YA 2ANWA 4DT7B 1SGPE 1T31A 2XBYA 1YPHC 3M5OA 4BAQB 3LGVA 2A4OA 3M37A 3ZYEA 5EW2H 3TH3H 5JBAS 1AFQB 3OTJE 2SGFE 4XFQA 1V2KT 2FLBH 2RA0A 1XUJA 3S7KB 3BN9A 1C4U2 1XUFA 3KF2A 1FIZA 1CHOF 1RTLA 1HPKA 4XDEA 9LPRA 4ZHLU 5E2PA 3E6PL 4ABAA 1NESE 1SGNE 2Z6BD 2K4RA 1C2GA 3RXBA 1AD8H 1HIAA 3SU5A 3TLOA 4JCNA 2P8OC 2G52A 5JBTA 1BDAA 3M5LA 1KLJH 1E37B 2BLOA 4CRDA 2XNIA 1UTOA 5T6DA 4X1PU 3EAJA 3ZVFA 1A0HA 1MU8B 1SGYE 1BZXE 1GBHA 2QCYA 2VJ1A 5AHGH 1HJAC 1DLKB 1BMLA 3RM2H 2AFQB 5T3HA 4DVAU 4THNH 4SGBE 3SJ8A 4U2WA 4ABIA 5AF9H 3ATMA 4WH8A 2Z9IA 2FOCA 1ZOMA 1BMNH 2B7DH 2AERH 4JK5A 1GL0E 3U1IB 1CO7E 4B75A 4CREA 2C8ZB 3NPSA 3DFJA 5GJ4B 2W5EA 1XVOA 1DOJA 2HLCA 4IC6A 4B74A 2ANMH 1EZUC 1YF4A 2EI7A 3F6UH 1T32A 1XM1A 1BJVA 3PMBB 4CRCA 1GL1A 5CMXH 2ZIQH 1FPCH 1LO6A 3MU4A 3SV9A 2H2ZA 4I8KA 2F91A 3OX7U 1HAYB 1OWKA 5A8XA 4F49A 1S82A 1OWDA 2A31A 2SGPE 4X8UH 1TMTH 1GHZA 2FMJA 3GY5A 3AVZA 1JMOH 4AG2A 4DG4A 4Y79A 1BUIA 4Y0ZE 1BRUP 3TIUA 1G3BA 1SPJA 1ZPCA 2QXGA 2OC8A 1GI1A 4DOQA 1AY6H 3GCHC 4MNWA 4MNXA 4MPXA 1O2TA 1SGCA 1GHVH 4ABJA 2XYAA 1P9UA 2XBWA 1T8NA 4WMDA 3SO3A 1K1PA 4UFDH 2EI6A 1H9HE 3D23A 2J8LA 1Z71A 1YPHE 3M5NA 2A7JA 1LHEH 2VB0A 3BTWE 4APLA 5DJ7A 1W14U 3FFGA 4Y8YA 1B5GH 3SZNA 4VGCB 3VGCC 3PWBA 3KNXA 2H6MA 1OP2A 1NFWA 4OS1A 2SNVA 1VJ9U 1Z8IB 3RXMA 2A1DB 3BTQE 2FD6A 1A5IA 3LGUA 2Q6FA 1F92A 1L1NA 2D1JA 2GVFA 1OSSA 1O36A 1ETSH 5EPYA 1P05A 1C1NA 4YO9A 1O3KA 3SN8A 1GI2A 5A8ZA 1H4WA 1DS2E 4UFGH 3SV8A 3ZZCA 2V3OH 4XOJA 1YPLH 1C1RA 4DURA 3CS7A 2ZQ1A 2OD3B 2Y6TA 1BOQA 3U8RH 2PSXA 4APMA 1O2ZA 3GICB 1J9CH 1TBZH 3MO3A 2FIRH 1FIWA 1V6DA 3QLPH 1SB1H 1SGEE 1GI0A 1SR5C 1KRNA 1WQVH 1C2MA 2ZDNA 1BBRH 4FU7A 1UCYH 1ELBA 1P8VC 2DOIA 1TNGA 1FY4A 1UTQA 3RM0H 5DKMA 4PROA 1P3CA 2ZHEH 5GPIB 2G5VA 2A5KA 4A6LA 2XWAA 1UO6A 1GWAA 2CF9H 1AQ7A 4BVCA 1QB6A 1UVPA 4GSOA 1AKSA 4K60A 1N6YA 3LJJA 2O9QA 2FI5E 3RXPA 2TGTA 3O8DA 5HPGA 2HPQP 3O8RA 5C20A 1K1JA 2OLGA 2WYGA 1B7XB 4Y11E 1Y5UT 2CJIA 4CRGA 1G3CA 4UV6A 2PR3A 4Z0FA 2DE8A 2TBSA 1TPOA 5FPSA 4Q7XA 3PWCA 1DANH 3TH2H 2VIWA 1O3MA 2P16A 2QXJA 2LPRA 2IPHA 2A2QH 1HAHH 2ZG0H 4YOJA 2ZECA 3ZZ8A 4HGCA 3SRIA 1Z8GA 4YLUA 1C2EA 3OYPA 1D3TB 1LHFH 1TGCA 1A3EH 2GMTC 3SV6A 2WV5A 2QN5T 1DUAA 3A7ZA 3STJA 2OUAA 2BX3A 6ESTA 2BZ6H 3Q3XA 1XMNB 3MMGA 3LDXH 1O3PB 4RSPA 2C8YB 1GHXH 1TIOA 3A7YA 4ISLA 3SJ9A 3U9AH 1DDJA 3BTDE 2LL4M 5CHAB 3PTNA 2M5TA 4GPGA 1CT0E 4LOYH 1MTNC 3A7TA 4LXBH 1J17T 1GGDB 2ULLA 1GMHG 1SVPA 2BY7X 1TNIA 1PPZA 3R3GB 2XBVA 4YOGA 3R0FA 4Z6AH 1P06A 4XBCA 2XBXA 3EA9A 1GHAG 1GMCF 4NZQA 1PQ5A 2BVSH 1RGQA 3RXUA 3SGAE 1PPGE 4WJG2 3HGPA 1UTMA 4CR5A 1CU1A 5EG4A 5FX6A 2VWMA 1TPAE 4OS2A 3M61U 4BTTB 1AE8H 1TMBH 4GVUA 3T27A 1EB2A 1FNIA 1O2QA 2BDHA 2WUCA 4JZFH 3GY7A 1PYTD 2AGIX 4YESB 1BTYA 2PKAA 2BB4A 1AN1E 1YPMH 1LQEA 1IQFA 1GDNA 1VITG 1FDPA 1ZSJA 1ZYOA 2C8XB 1V2UT 1DWCH 3KIVA 2PF2A 1AWFH 1F5RA 1A0JA 1MCVA 1QY6A 1HFDA 3TGIE 4Y76A 1TFXA 1BB0B 2GCHF 2Y82A 3STIA 4CHAC 1SHYA 3RLWH 2GDEH 2ZZUH 3A84A 2PSYA 2YNBA 3TITA 3RXVA 2BDYA 3S9AA 3FP8E 4ZAEA 3QZRA 1ESTA 1GHWH 4FUBA 2EA3A 4D76A 5A09A 3KQCA 1C5WB 4ABHA 3HMRA 5CSQA 2QXHA 4IMQA 2P3FH 4K1TA 1MKWK 4TWYA 4RN6A 2QJ4A 2BQ7B 1QURH 2GTBA 2WPJS 2ANYA 4AX9H 1NU9A 2C4FH 4AFUA 3O8BA 4NIWA 3SI3H 2F9VA 3HN4A 1M9UA 3VB3A 1GBJA 1QBVH 1GJ4H 2KNFA 5CS1A 1XVMA 2FWWA 4HI3A 1EAXA 3NXPA 1W12U 3EE0B 1O3NA 1A7SA 3A83A 4YM9A 1TRYA 3NK8A 4ZMAH 1O2XA 5DP6A 5A0BA 4TWWA 1O2JA 1H8IH 5F8XA 5EQQA 5GIBA 2YNAA 5JB8S 3MH7A 4E7RG 1GCTB 1GVLA 1WBGB 4YTAA 4X1SU 1DY8A 5ABWA 1PQ7A 2NU1E 2A45B 5FBIA 4KELA 1MKXK 1TNJA 1O2IA 1ZPBA 2F9BH 1C4V2 4NSYA 1AUTC 1ZSKA 2WUBA 3VB6A 5E0JA 1F0TA 2FS8A 2SPTA 2ZCHP 1EZSC 3BF6H 1A61H 1GHBG 2Q1JA 2C90B 5TCAA 2K51A 1GJDB 3BEIB 3QTVH 5T6GA 2RCEA 1GJCB 1ANEA 2XTTB 2Z7FE 4BAMB 3QN7A 2YIOA 4A92A 3T5FH 3MTYA 4TYDA 2OTVA 3SNBA 1K1LA 4UD9H 2Z9KA 1KLIH 1URKA 4I7YH 1UK4A 2VIPA 1GG6B 4NCYA 5F8ZA 2O8MA 1Z6EA 1BTXA 2F3CE 4I8JA 2Y5GA 4AORA 1TMUH 4DIHH 1HAGE 1NU7B 4Z0EA 1C5ZB 1GBTA 3V7TA 3SJOA 4BAHB 2R2MB 3RXHA 2GMTB 3ODFA 3Q76A 1Y5AT 4RKOB 1GMDF 1Q3XA 1C1VH 2ODQA 1O3GA 1TONA 4BVWA 2ZQ2A 1OP0A 1PK2A 3GY6A 3TJNA 4ZH8A 1O35A 5GDSH 4B76A 1MMJN 3GCNA 3PV4A 3D65E 3TH4H 1HUTH 4B1TA 3VB5A 3SORA 1KLTA 1CA8B 1THRH 1KI0A 1F5LA 2XRCA 4AFQA 5EXLA 4BXSA 3A8DA 1P2OA 1VR1H 1V2QT 1UTJA 1BA8B 1TX7A 3NCLA 2VIDA 5LPEA 1H9IE 5K7RA 3BTKE 1QHRB 1UTNA 1GI9B 1VITF 5LGOA 1A5HA 3T28A 1L1GA 5PTPA 3SHCH 1EPTA 1SQOA 2Q6DA 1GI5A 1HB0B 1W10U 1NY22 1MTSA 1TYNA 1BRAA 1T8LA 4X2VA 4E06H 1CSOE 4MPWA 3S7HB 3UOPA 2H9EH 2AMPA 2R9PA 3JZ1B 1LQDB 2H9HA 3VXFH 3MHWU 5FXLA 1GMNA 1GJBB 5TCCA 5DP7A 1NN6A 1NO9H 1DVAH 1P03A 1V2PT 1YKTA 2QV1A 3MNCA 1MH0A 3A89A 3PLKA 4ZROA 3URCA 1A0HB 5B6OA 7GCHG 4NGAH 4TY7A 2DOHX 1YCPK 2FOEA 2ZFFH 3RXDA 2PKSB 1BRCE 2A4QA 2BOKA 1Q2WA 1W7GH 3GCTG 1FY1A 4AGJA 1YYY1 1CEAA 1ZLRA 4BAOB 2G00A 3MU5A 3TVJB 2ZU4A 4K8YA 4OS6A 2TRMA 4D9QA 2GCTC 6CHAC 3VFEA 5C1UA 2ZFPH 1PPBH 2FPZA 3SV2H 1XKBC 1J8AA 1LVYA 1ELCA 1MAXA 2G5NA 3PM3A 3BG8A 4X8SH 5CT2A 4AG1A 1RXPA 3M7TA 1QTFA 1FPHH 4IN2A 1NFXA 1SGIB 4B2CA 1JRTA 1D4PB 2Z3CA 5C3NA 4ISHH 2ANKH 1SGFA 4U01A 1DICA 1ZHRA 4KKDA 3ZVAA 3N7OA 1C5PA 4JYUH 4ZKRU 2B9LA 2FO9A 2FODA 2SGAA 4MDSA 1UTLM 2XC0A 1GHBF 1FY3A 1DITH 1KTTB 1I71A 3HK3B 4HTCH 2QY0B 3MO6A 4TPIZ 3DA9B 1ZGVA 1AFEH 2PGBB 4ISIH 5JYIA 4NSVA 1K28D 2BQWB 2K13X 4CR9A 4CRFA 2G55A 1XUKA 5CT3A 4H6TA 1YP9A 2HVXA 1FY5A 1D3PB 4YOIA 2WPMS 3F9HA 1VCPA 4WMEA 1DXWA 1F0UA 2KAIA 4LZ4B 3SUFA 4O3UA 1CHGA 1BHXF 2JH0D 5FAHA 4IMZA 4R0IA 2ZCKP 2O8LA 3BEFB 4UE7H 4IC5A 1O30A 1DWEH 3EA8A 3RU4E 2Y8RA 3WY8A 3SU0A 3BV9B 1K1NA 1NRSH 1Z8JB 2YILA 1B2IA 3A82A 3RXFA 3SQHE 1FONA 2GZ9A 1E36B 2PUQH 1GBLA 2QYIA 3P8GA 2IOTA 4MVNA 1QB1A 4MTBA 5CS3A 2FOGA 1SHHB 2JH5D 1F5KU 4RKJB 1SBWA 1MBMA 1GI6A 2ILNA 4AFSA 1O39A 1XKAC 2AS9A 1D9IA 1GJ7B 1XUGA 1NZQH 4R1CA 1ZHMA 2P95A 2FEQH 3OSYA 4WXVA 3UR6A 4FVBA 3H7TA 1O3IA 1UVTH 4BV7A 2WYJA 3LIWA 1ZMNA 3TK9A 2XCNA 1CBWC 2CHAB 2HPPH 2FTLE 1WTGH 1SL3A 1NS3A 1NFUA 1V2JT 1AKSB 3LAQA 1P2IA 2Y7XA 2J9NA 2D8WA 2ZWLH 3SU6A 4NWKA 1EAWA 2QXIA 4WXIA 1NL2A 1UJ1A 1HLTH 1MAYA 1TRMA 4INHA 4JZEH 5C5OA 2AH4X 1ZPZA 2J92A 1TOCB 1OYQA 4H6SB 4AYYB 1KXCA 3M5MA 4BANB 3RP2A 1THSH 2G4UA 4J1YA 1OXGA 1DM4B 3UUZA 1YGCH 3MFJA 4I8HA 3P8FA 3RXTA 1FN6A 1GBBA 1UK2A 2JETC 4JYVH 5LH8A 2VGCB 1HDTH 4Z0KA 3E0NB 3RU4T 1PJPA 1PPFE 5C67A 3SU1A 3M3SA 1Z7KA 1CQQA 2ZHDA 2NU3E 3SP8A 1DSTA 4UONA 2QF0A 2ASUB 3MKPA 3D62A 5DP3A 1KSNA 5I25A 1PQ8A 2OC7A 2GGVB 3SUGA 2PHBA 4NFEA 1GBEA 4WH6A 3ATIA 3RXIA 1HAVA 1ANDA 1XXFA 1TPKA 2I6SA 2W3IA 1JBUH 1P9SA 4ZHMU 3UR9A 1RTKA 1OWEA 2O8WA 2O8TA 3ZZ9A 5K0HA 1BHTA 1EPTC 3UPEA 1FI8A 3GDVA 2HNTC 3FZDA 4ABBA 8GCHF 4R1AA 3O8CA 1RIWC 1L0ZA 4ZKSU 4OGXA 2PKAB 2F9UA 2FI4E 1GBDA 4AFZA 1RTFB 1K22H 4FU8A 2W7UA 1QQUA 1C5YB 1G32B 3SU3A 1Z1JA 1ZHPA 2D26C 1VCWA 2HOBA 4BOHA 2FI3E 1C1TA 1BMAA 1QFKH 4X2XA 5A8YA 5TJXA 3ZVGA 5E8EH 1BCUH 1C1SA 3GYMA 1RRKA 1ZJKA 2R3UA 2CXVA 6LPRA 1YM0A 5C2ZA 1LVBA 2BD8A 3RDZA 5A0CA 1UVSH 1QRXA 1SLUB 3ENSB 1A3BH 2BD3A 3RMOH 1O5GH 2EEKA 2QJ2A 3UWJH 4KTUA 5EXNA 1O5DH 3U1JB 1GJAB 3ZVCA 2Y5HA 1J14A 1GI8B 1HAIH 2BVXH 3A88A 7ESTE 3UREA 1YPEH 3BTTE 4NA9H 3NZIA 3OY5U 2FS9A 1XUHA 1C2LA 2P3UB 4FUIA 2P59A 1OYTH 3MI4A 2QGRA 1QIXB 5HM9A 1Q31A 3MU8A 4MNVA 4NIVA 3QGNB 1TB6H 1PMKA 4F4OC 3FVFB 3LGTA 1SQTA 1P2MA 3MNSA 1FQ3A 4KGAA 2P8OB 2BTCE 3B8JA 1V2NT 1YCPM 2ZTYA 2WINI 8LPRA 1EZQA 1SGDE 5CS5A 1BBRK 1UCYK 1I5KA 1AE5A 1EJAA 1O37A 1SLVB 3UIRA 5A0AE 3P8NA 3UNQA 1ELEE 1HJAB 3GY8A 3M35A 4X1QU 1TGTA 2FXRA 5EQSA 5CE1A 1EOJA 1K1OA 3LGIA 1PQAA 4BAKB 1CVWH 3UNRA 3AW1A 1SGTA 3K9XB 4CBOA 2ZO3H 1Z6JH 4YT6H 3E3TA 3URDA 1ZSLA 1GI4A 1LHGH 1Z8RA 2BDBA 2P93A 2CMYA 5FPYA 3OU0A 3RXJA 5IYTA 1O3EA 3RU4D 7LPRA 2A32A 1C4Y2 3LH1A 3W94A 2OC0A 1O2KA 1I8NA 2A7CA 1BTUA 2Z3DA 4JYTA 1ANCA 2HNTE 3A8BA 3ZZBA 1SQAA 2VVVA 4DCDA 4CBNA 2HNTF 2ZC9H 5G4BA 1S6HA 2G4TA 1T4VH 3KGPA 2GKVE 2FYRA 1GP9A 2ZA5A 2R0KA 1ELDE 1RFNA 4A7IB 2BY6X 1MQ6A 2Q8BA 4Y7BA 2AYWA 2ZDVH 3CENA 2ZU2A 1L4DA 2BXTH 3K6YA 4Z0DA 1JWTA 2ZKSA 3SNDA 1N6XA 3VEQB 2OP9A 3LU9B 1L4ZA 1DT2A 3HGNA 1AZZA 2OC1A 1SFIA 1OWIA 3GCHB 3UTUH 1EATA 3PO1C 2AGEX 2YIPA 5JBBS 2VVCA 1GCDA 2J2UA 4AGKA 1CA0C 1HCGA 4INKA 1GPZA 1CGHA 4KTCA 1Y8TA 1EQ9A 2TPIZ 2VWNA 5LPFA 2PF1A 5EXMA 2XC4A 1QJ7B 2L0SA 1A2CH 3ZV8A 4A1VA 3P17H 3H7OA 1QB9A 2JKHA 1GVZA 1S81A 2FM2A 2ZU1A 1MCTA 3E16B 2FOBA 1N8OC 2V35A 3VGCB 3VB7A 1GHYH 1O31A 1TNHA 1ZRKA 1FUJA 2HPPP 3MU1A 1FXYA 1SOTA 1TQ0B 3DD2H 1IQEA 1ZRBA 1O32A 1J15A 1MBQA 3ELAH 1A0LA 1V2MT 3SQEE 1MKXH 2UUJB 3A85A 1F2SE 3AAUA 4Y7AA 5J4QA 1S84A 3GY4A 3PB1E 3PTBA 6GCHG 1S5SA 1QL9A 1YPGH 1BIOA 1S85A 3BG4C 1G30B 4INLA 2SFAA 3RXGA 1HAZB 1GJ6A 1IQIA 1C5SA 1O3CA 3NKKA 3SJIA 5LPRA 5E2OA 1BT7A 1HBTH 2GZ8A 4R1BA 5HM2A 3RXOA 1JIMA 1PMLA 2PK4A 4D3CA 2ALPA 4MQAA 2SGEE 3TU7H 3ODDA 1E35B 1TBQH 4XE4A 1W11U 3S9BA 1AWHB 3B23B 5JB9S 1FY8E 2BD7A 2BYAX 2TIOA 3TK6A 1O2UA 2BD5A 4D9RA 1V2ST 1D6RA 3SU4A 3ZZ7A 1C5UA 3SJKA 4CH8B 1Y3UA 1DPOA 1O3JA 2ZPQA 3RXKA 1LPZB 3BT1A 2XXLA 2BDCA 3B9FH 2Z8WA 1YLCA 1HRTH 1S6FA 3KCGH 3ZZ6A 5DO4H 3RC6A 1IAUA 1O3HA 2VH6A 1BTHH 2PW8H 4ABGA 2BVRH 3C1KA 3C27B 3GDUA 3RMNH 3LGWA 1C2HA 2C93B 1TQ7B 2BLQA 2ZPSA 5GWZA 2R2WU 3BTME 1C1PA 3LH3A 1CGIE 2FDAA 1ANBA 2I9BA 1ABIH 2FLRH 4Q2KA 3MU0A 4A1TA 1TWXB 3KIDU 2HWLB 2A4GA 4I32A 1EKBB 5EU8A 3VB4A 5F8TA 3K65A 1C2JA 1C5RA 1O3OA 4E7NA 2IN2A 4GHTA 1AFQC 4I8GA 3RC5A 3IITA 1ESAA 4Q80A 2ODYB 1EASA 2J4IA 1FN8A 1O38A 2H5DA 3CS0A 1GMHF 3L6PA 2ODPA 3UNSA 3ZZAA 2PV9B 1XUIA 1G2MA 1GHAF 2STBE 1MTNB 3FANA 1AVWA 4BTUB 2HGFA 1CHOG 1ZGIA 1C5TA 4Y8ZA 2STAE 3U73A 4JZ1A 4X8VH 3SOSA 3HATH 4Z09A 1HXEH 2ZHWH 3QO6A 1V2RT 4B2AA 3TJOA 2Y5FA 3K6ZA 1VCQA 2F9NA 3GY2A 2BOHB 2ZTZA 1ELGA 3BTHE 3RXCA 1P12E 3AAVA 1YCPH 2UWPA 3TNSA 3ITIA 4I31A 2ZFQH 1OX1A 4ZHAA 4ISOA 3TPIZ 1BITA 1INCA 2ZHQH 3ZWZA 3A7VA 1L1JA 1IQHA 3MH4A 1GMOA 1W8KA 1HIAB 3SNEA 5A2MH 4ZXYH 3BTFE 4FUEA 1C1MA 5DP4A 1YBWA 1A5GH 1VITH 2I9AA 2BQ6B 3A7XA 4AZ2B 4CHAB 1P11E 3S69A 1ACBE 1YPJH 2BX4A 1ZR0A 1P2NA 4MPUA 3Q3YA 3E91A 2VH0A 2ZU3A 4DGJA 2BY8X 1H1BA 2KJ4A 1EAUA 5BPEA 5CP9A 1PK4A 4Q7ZA 3MWIU 3UFAA 1G37A 1AIXH 1EX3A 2WPLS 3ZLEA 1HAXB 1FAXA 3ZV9A 4R8TB 1IHSH 4JK6A 4LK4A 1TLDA 2XCFA 3JZ2B 3A8CA 1E34B 1TOMH 4AB8A 2BD4A 2FESH 1CT2E 3F68H 3MYWA 5COEA 1CEBA 1C5VA 4BVVA 2BLWA 1AVXA 1UVUH 4GCHG 2AIQA 1KXAA 1T8MA 3MH5A 3V13A 1OPHB 1H9LB 3ZYDA 2DE9A 5EODA 3QUMP 2FEBA 2VWLA 4Y6DA 1NPMA 4MG3A 2ZCLP 1ZTLA 1ETTH 3NUMA 4FU9A 2HPQH 2FP7B 1HGTH 2P3TB 4NIXA 3U8OH 1TALA 3LC5A 4VGCC 1EJNA 2J8JA 2GZ7A 1SI5H 1BTZA 1ELTA 2CN0H 3LGYA 3SW2B 2QIQA 2RA3A 3GCOA 3ZZ5A 1EJMA 1TA6A 3E1XB 4NFFA 3KHVA 4ASHA 1HNEE 1G9IE 1AMHA 1QA0A 2CV3A 2Y7ZA 3A87A 1B0FA 2RG3A 1EXFA 1VGCC 4FUFA 3SNAA 2FX4A 2QA9E 4K1SA 1O2HA 1V2TT 4X6OA 4NIYA 1C9TA 1W0YH 1P3EA 1TX6A 2B5TB 5GCHG 2X2ZA 1ZMLA 1V2WT 1AUJA 2C8WB 2VVUA 5CS9A 2LL3A 1AB9C 3FZZA 1Y5BT 3F1SB 4K1EA 5FCRA 1QL7A 1IQNA 1P10A 2BZAA 3MOCA 2ZFRH 4MLFB 3TJVA 3Q3KA 2EI8A 3A86A 3A8AA 5F03A 1T4UH 3Q00A 5L6NH 1TBRH 1HAVB 2A4RA 2V3HH 3A81A 1O34A 3LKWA 3BIVH 4JZDH 3KEEA 3EGKH 1OS8A 1W8BH 3LOXA 1P02A 2OQUA 1C5MD 2V6NA 1HPJA 1ZTJA 3CP7A 3V3MA 4UFEH 1JOUB 1TNKA 1EP5A 4ZKNU 2Z8VA 1O2RA 1MQ5A 2I6QA 1HJ9A 1T8OA 1RD3B 4MPVA 4DJZB 3PLPA 3S0NA 1GJ8B 1P0SH 2ZDAH 1NTPA 1ELAA 3W95A 5GXPA 2IJOB 4KTSA 3S9CA 3TK5A 1O2SA 1KYNA 1OKXA 1G3EA 3SI4H 3T2NA 1Z40A 2F9PA 1KXDA 3ATKA 1MZDA 1WCZA 1C5LH 1KDQA 2WPKS 2V0BA 2JH6D 2PWXA 2ZDMA 1W0ZU 1D3QB 1UHBA 8ESTE 1DWBH 1OOKB 2BY5X 1BHXB 2OINA 1TPSA 1A1RA 1YXEA 5CHAC 1O2VA 1O3LA 1AHTH 1GGDC 1NM6A 4D7GA 2OQ5A 1MTVA 7GCHF 1H8DH 1QNJA 5C1YA 3RXQA 4OS5A 1C2KA 3A80A 1C5XB 2Q8AA 1LMWB 1IQGA 4BTIB 2ZF0H 3RC4A 1Y3WA 1UMAH 1VJAU 4FUGA 1EUFA 3GCTF 1BRBE 4X6PA 2BD9A 2ZP0H 2FYQA 1O2OA 3Q77A 5EGMA 2GD4B 1A4WH 1GMCG 5DP8A 1DFPA 1Y59T 3PMAB 4Y10E 4K5ZA 3SGQE 2HRVA 4WY3A 5BRRE 3QK1A 1AO5A 4ZKOU 2R3YA 2OBQA 3RMMH 2BDGA 2OCVB 1TPPA 1W81A 8KME2 1LKBA 1GJ5H 4GCHF 4WVPE 2GCTB 3ATLA 5DP5A 6CHAB 3D49H 3V0XA 3KQDA 4ABFA 3ATWA 2XC5A 4JMYA 2A5IA 4X2WA 1LHDH 2PTNA 1SGRE 1BTPA 2GV6A 2VIQA 1LCYA 3BTEE 4X1RU 5DGJA 5JPMH 3FP7E 4DW2U 2ZNKH 1P2JA 3DHKH 4MNYA 1C2IA 1LKAA 1OWJA 1FJSA 4ZUHA 1G3DA 1Y3XA 2GCHG 1ARBA 2UUFB 3E6PH 3GOVB 2A5AA 5SGAE 1OP8A 4UAOA 1K21H 2PFEA 2GT8A 3ZZ3A 1JXPA 2ZGJA 3TGJE 1CT4E 5HMAA 4WF8A 2HALA 3E8LA 2R0LA 3U69H 2ZGHA 2ZHFH 1D3DB 1BBRE 1SOZA 3RUOA 1UCYE 1YPKH 5GCHF 1DY9A 3SV7A 1O2NA 2EC9H 2ALVA 4O97A 3SU2A 2H9TH 1VGCB 4ESTE 1W2KH 4GUXA 3BT2A 2BDIA 4KP0A 4R19A 3IWMA 1E0FD 1QCPA 4ZXXH 3DFLA 5JDUB 2BDAA 4XBDA 2UWOA 1AB9B 4O03A 1GJ9B 1PPCE 2VINA 1QQ4A 1V2VT 3QZQA 2DUCA 3SBKA 1FV9A
chains in the Genus database with same CATH superfamily
5F6MA 1OWHA 2A0QB 5IDKA 1AZ8A 1SGFG 2UUKB 3SHAH 3AW0A 1GCTC 4ABEA 2ZDKA 4UEHH 4RT0A 5FL7D 1EP6A 1JIRA 2FOHA 2Y81A 1W13U 1WV7H 1ARCA 1O5BB 2THFB 3RXAA 2Z3EA 2NWNA 2QF3A 1FX0B 3E0PB 1LVOA 1C1QA 5H4IB 5ETXA 1DX5M 2CGAA 1TGBA 1O2GH 4H4FA 2WPIS 2G81E 3LC3A 3KQEA 3P92A 3ZZ4A 4QT8C 2HGTH 1HJ8A 2ZGCA 1V3XA 2FOFA 2Z9GA 1W3CA 4K69A 5J4SA 4AB9A 1MD7A 2G51A 1LVMA 3OY6U 1O5FH 2BM2A 2YMSC 1QRZA 3SNCA 1MU6B 3P8OA 4IGDA 1GG6C 2WV4A 2ZPRA 3HPTB 1ORFA 4YZUA 3F9FA 2D2DA 1O2WA 3MH6A 3TGKE 3A7WA 4UFFH 4NA7A 1KY9A 1G2LA 1U6QA 3QWCH 4X6NA 1O5CB 1P2QA 1CBWB 1C5NH 2BY9X 5GNDA 2J94A 4X1NU 2FX6A 4HFPB 1K1MA 2NU2E 5AFZH 1O2YA 1ABJH 1QR3E 1FLEE 4IN1A 5EPNA 2FTMA 3PMJA 5T6FA 4P02A 4Y0YE 1ZZZA 3UQOA 5FCKA 5DPAA 2AEIH 1KIVA 2KZ4A 1GMDG 3RXEA 1D6WA 1QBNA 5ESBA 3RXLA 1NK1A 4YLQH 4GLYA 1XX9A 1IQJA 4BNRA 1UTKA 1C2DA 1DLEA 1DWDH 4WWYA 2BMGB 1K0HA 2JETB 1SFQB 1KXFA 3PROA 4UDWH 1DE7H 2BHGA 5E0GA 3K65B 4FUJA 1P04A 1MKWH 1TRNA 3LJOA 3P95A 3RMLH 1HPGA 1EAIA 1RJXB 1QJ6B 3UOUA 1YLDA 1P01A 3SZEA 1C5QA 1QA7A 5FPTA 1BJUA 4M9FA 4F55A 2SGDE 1Z1IA 1G36A 2A2XH 4F48B 4KIVA 2UUYA 2L74A 1HAPH 1BQYA 2GX4A 2TGPZ 1FAKH 1QL8A 2AMDA 2KR7A 3BTGE 1HYLA 1NRRH 4K3JA 1SMFE 3NWUA 3AASA 5DP9A 5L2YH 1T7CA 1P09A 2WPDD 4K8BA 3GDSA 1V2LT 4Y8XA 1SG8B 2ZI2H 1GBAA 1WTHD 1H8HD 5L2ZH 1O5EH 3I77A 3RXRA 3HK6B 4X0WU 2PKSC 1K2I1 1AU8A 1ZTKA 2F9OA 1QRWA 2UWLA 1S0RA 1GBKA 1EPTB 1JRSA 4XBBA 4B73A 3F9EA 2ZFTA 3PMHB 3IG6B 1RIWB 1TNLA 4FUDA 3TNTA 2PUXB 2Z9JA 4O9VA 2TGAA 2LNCA 3T25A 3EYDA 3QGJA 1ETRH 1KXEA 1WUNH 1AGJA 3ZIAD 3M7UA 1GDQA 1QJ1B 1NRPH 2GV7A 3SUDA 3H5CB 3SRJA 2ZEBA 3RXSA 3M3TA 4U30A 1NT1A 5EW1H 3I29A 1WOFA 2VBCA 5I46H 4FXGH 1C5OH 1GI3A 1NRNH 3BEUA 3M7QA 4O3TA 4HZHA 1O0DH 1GI7B 4CRBA 1Y3YA 4BV5A 1C1UH 4GHQA 1QBOA 1TABE 3M36A 1WSSH 4OGYA 4U32A 4FOUC 4LZ1H 1NFYA 1O2PA 3LONA 1HV7A 1KDUA 1BMMH 1O33A 1IQKA 3GY3A 1L2EA 3UWIA 1IHTH 3SUEA 4DY7B 1S83A 4SGAE 4AN7A 4YT7H 3VPKA 2FOAA 3G01A 3P6ZB 2PGQB 1WAYB 1THPB 2NU0E 4IS5A 1O3BA 3ZVBA 1JFNA 1IOEA 1Y3VA 3EA7A 4YXWD 1MD8A 2O8UA 1C1OA 3HMSA 4NG9H 1XXDA 1PFXC 5EIYA 1O2MA 4AYVB 2WSSD 3SGBE 4IUAA 1SSXA 1ZJDA 5E0HA 5FX5A 2BXUH 4CH2B 2G8TA 1WU1A 2J38A 1FZZA 1VZQH 3PYHA 3RLYH 1F0SA 3EQ0H 3N7EA 2ZGXH 1PKRA 1NC6A 1V2OT 5C1XA 3OAAD 1SGQE 7KMEH 2NU4E 3U98H 5L30H 3U8TH 3ZZDA 1AVGH 1DUEA 1YC0A 1ZMJA 9ESTA 4JZIA 1NROH 3M3VA 2OXSA 4NWLA 4A5TS 1MTWA 3LPRA 1KIGH 2PLXA 3KN2A 4ISNA 1KTSB 3H09A 1GVKB 1C1WH 3WW7A 2CF8H 1O2LA 2ESTE 4I8LA 2QAAA 4BXWA 1ESBA 5DG6A 3FOAA 3TJUA 3DUXH 2KAIB 2W6ID 1MUEB 1TE0A 2ZFSA 2BD2A 4D8NA 3EDXB 4K2YA 1NL1A 1C9PA 1ELVA 2QC2A 3V12A 4E05H 4AOQA 1GBFA 4GAWA 3K2UA 3KYFA 3L33A 2YOLA 3T26A 2GP9B 1HKYA 2CHAC 3HKJB 2Z94A 1O3DA 2F83A 1CGJE 4ABDA 1W7XH 2OBOA 1DSUA 2SNWA 1ID5H 3GYLB 1MTUA 3BSQA 2RDLA 3DT0H 4FUCA 1P57B 4X8TH 3QX5H 2ZU5A 1GDUA 5JBCS 3PO1B 1UVOA 2VIOA 3HKIB 2L6OA 1WYKA 1CA0B 2B0FA 3UQVA 3ZVEA 1NRQH 3QTOH 4B71A 5FBEA 3L3TA 4J2YB 2TGDA 5AFYH 3ESTA 2VIVA 1LPKB 1TGNA 3OTPA 3F2FA 5FHTA 5HGGA 4CIKA 2A7HA 5DK1A 1A46H 1IQLA 3BIUH 1WQSA 1N8OB 2WPHS 2K1QA 2PTCE 2GJGA 3QDZB 3T62A 1RS0A 1TX8A 4X2YA 4BVDA 3FP6E 4A1XA 2VGCC 4I33A 5EOKA 1C2FA 1B0EA 3I78A 2ZDLA 1QGFA 1MZAA 1X7AC 2VWOA 1EZXC 1KDQB 1LHCH 2XWBI 4TPYA 6GCHF 4OM9A 3FAOA 4FUHA 1SLWB 1F0RA 1PYTC 1KXBA 1UHBB 2W3KA 5B6LA 2FOMB 5C17A 1S0QA 2J95A 2AGGX 4B2BA 5AVDA 3MQKC 4IBLH 5HYOA 2AMQA 2Q6GA 1K1IA 5HXFA 3BG4B 1HAOH 1O3FA 1SC8U 4Y71A 3VXEH 3KL6A 1N1LA 1LTOA 2VU8E 3F9GA 4TY6A 4D7FA 3LT3A 2H5CA 2C3SA 4XSKU 2ZTXA 1AI8H 1J16A 1E38B 1K9OE 2AIPA 1PPHE 1S6LA 1TAWA 3MO9A 1UTPA 4DIIH 2W26A 1EOLA 2XW9A 5CT1A 1HXFH 4M7GA 1TGSZ 2Y80A 1GBIA 1BTWA 1O5AB 1ELFA 1LPGB 1O3AA 1IQMA 3PLBA 1F7ZA 1CE5A 2GT7A 4FVDA 3KQBA 4IW4E 1LDTT 2J34A 3E90B 2H1UA 4OS7A 2VNTA 2W7SA 1P2KA 1GBCA 3UY9A 1PPEE 1DXPA 4OS4A 4X6MA 4WMFA 2B8OH 1EB1H 8GCHG 2FZZA 4NA8A 2SGQE 3T29A 1UK3A 5EQRA 5C5NA 3GISB 2ZGBH 2IJD1 3ZVDA 1FMGA 2YMSD 1GBMA 4NZLA 5ESTE 3CNRA 1SLXB 4CRAA 3P70B 2GDDA 2P94A 2BLVA 4H42U 1TA2A 2Z9LA 1YY3A 3MNBA 3MNXA 3HMTA 4Q7YA 2ANWA 4DT7B 1SGPE 1T31A 2XBYA 1YPHC 3M5OA 4BAQB 3LGVA 2A4OA 3M37A 3ZYEA 5EW2H 3TH3H 5JBAS 1AFQB 2EQNA 3OTJE 2SGFE 5CHBA 2RDEA 3KQ5A 1V2KT 4XFQA 2FLBH 2RA0A 1XUJA 3S7KB 3BN9A 1C4U2 1XUFA 3KF2A 1FIZA 1CHOF 1RTLA 1HPKA 2K8IA 4XDEA 9LPRA 4ZHLU 5CDFE 5E2PA 3E6PL 1SQRA 4ABAA 1NESE 1SGNE 2Z6BD 2K4RA 1C2GA 3RXBA 1AD8H 1HIAA 3SU5A 3TLOA 4JCNA 2P8OC 2G52A 5JBTA 1BDAA 3M5LA 1KLJH 1E37B 2BLOA 4CRDA 2XNIA 1UTOA 5T6DA 3FKSD 4X1PU 3EAJA 4HG6A 3ZVFA 1A0HA 1MU8B 1SGYE 1BZXE 1GBHA 2QCYA 2VJ1A 5AHGH 2OK5A 1HJAC 1DLKB 1BMLA 3RM2H 2AFQB 5T3HA 4DVAU 4THNH 4SGBE 3SJ8A 4U2WA 4ABIA 5AF9H 3ATMA 4WH8A 2Z9IA 2FOCA 1ZOMA 1BMNH 2B7DH 2AERH 4JK5A 1GL0E 3U1IB 1CO7E 4B75A 4CREA 2C8ZB 3NPSA 3DFJA 5GJ4B 2W5EA 1XVOA 1DOJA 2HLCA 4IC6A 4B74A 2ANMH 1EZUC 1YF4A 2EI7A 3F6UH 1T32A 1XM1A 1BJVA 4YIVA 3PMBB 4CRCA 1GL1A 5CMXH 2ZIQH 1FPCH 1LO6A 3MU4A 3SV9A 2H2ZA 4I8KA 2F91A 3OX7U 1HAYB 1OWKA 5A8XA 4F49A 2J5UA 1S82A 1OWDA 2A31A 2SGPE 4X8UH 1TMTH 1GHZA 2FMJA 3GY5A 3AVZA 1JMOH 4AG2A 4DG4A 4Y79A 1BUIA 4Y0ZE 1BRUP 3TIUA 1G3BA 1SPJA 1ZPCA 2QXGA 2OC8A 2WV9A 1GI1A 4DOQA 1AY6H 3GCHC 4MNWA 4MNXA 4MPXA 1O2TA 1SGCA 1GHVH 4ABJA 2XYAA 1P9UA 2XBWA 1T8NA 4WMDA 3SO3A 1K1PA 4UFDH 2EI6A 1H9HE 3D23A 2J8LA 1Z71A 1YPHE 3M5NA 2A7JA 1LHEH 2VB0A 3BTWE 4APLA 5DJ7A 1W14U 3FFGA 4Q4LA 4Y8YA 1B5GH 3SZNA 4VGCB 3VGCC 1QZ8A 3PWBA 1W0KD 3KNXA 2H6MA 1OP2A 2HVYB 1NFWA 4DT4A 4OS1A 2SNVA 1VJ9U 1Z8IB 3RXMA 2A1DB 3BTQE 2FD6A 1A5IA 3LGUA 2Q6FA 1F92A 1L1NA 2D1JA 2GVFA 1OSSA 1O36A 1ETSH 5EPYA 1P05A 1C1NA 4YO9A 1O3KA 3SN8A 1GI2A 5A8ZA 1H4WA 1DS2E 4UFGH 3SV8A 3ZZCA 2V3OH 4XOJA 1YPLH 1C1RA 4DURA 3CS7A 2ZQ1A 2OD3B 2Y6TA 1BOQA 3U8RH 2PSXA 4APMA 1O2ZA 3F0OA 3GICB 1J9CH 1TBZH 3MO3A 2FIRH 1FIWA 1V6DA 3QLPH 1SB1H 1SGEE 1GI0A 1SR5C 4ACAA 1WQVH 1KRNA 1C2MA 2ZDNA 1BBRH 4FU7A 1UCYH 1ELBA 1P8VC 2DOIA 1TNGA 1FY4A 1UTQA 3RM0H 5DKMA 4PROA 1P3CA 2ZHEH 5GPIB 2G5VA 2A5KA 4A6LA 2XWAA 1UO6A 1GWAA 2CF9H 1AQ7A 4BVCA 1QB6A 1UVPA 4GSOA 1AKSA 4K60A 1N6YA 3LJJA 2O9QA 5HKKD 2FI5E 3RXPA 2TGTA 3O8DA 5HPGA 2HPQP 3O8RA 5C20A 1K1JA 2OLGA 2WYGA 1B7XB 4Y11E 1Y5UT 2CJIA 4CRGA 1G3CA 4UV6A 2PR3A 4Z0FA 2DE8A 2TBSA 1TPOA 5FPSA 4Q7XA 3PWCA 1DANH 3TH2H 2VIWA 1O3MA 2P16A 2QXJA 2LPRA 2IPHA 2A2QH 1HAHH 2ZG0H 4YOJA 2ZECA 3ZZ8A 4HGCA 3SRIA 1Z8GA 4YLUA 1C2EA 3OYPA 1D3TB 1LHFH 1TGCA 1A3EH 2GMTC 3SV6A 2WV5A 2QN5T 1DUAA 3A7ZA 3STJA 2OUAA 2BX3A 6ESTA 2BZ6H 3Q3XA 1XMNB 3MMGA 4B6EA 3LDXH 1O3PB 4RSPA 2C8YB 1GHXH 1TIOA 3A7YA 4ISLA 3SJ9A 3U9AH 1DDJA 1EFRD 3BTDE 2LL4M 5CHAB 3PTNA 2M5TA 4GPGA 1CT0E 4LOYH 1MTNC 3A7TA 4LXBH 1J17T 1GGDB 2ULLA 1GMHG 1SVPA 2BY7X 1TNIA 5HIZA 3N99A 1PPZA 3R3GB 2XBVA 4YOGA 3R0FA 4Z6AH 1P06A 4XBCA 2XBXA 3EA9A 1GHAG 1GMCF 4NZQA 3F0PA 1PQ5A 2BVSH 1RGQA 3RXUA 3SGAE 1PPGE 4WJG2 3HGPA 1UTMA 4CR5A 1CU1A 5EG4A 5FX6A 2VWMA 1TPAE 4OS2A 3M61U 4BTTB 1AE8H 1TMBH 4GVUA 3T27A 1EB2A 1FNIA 1O2QA 2BDHA 2WUCA 4JZFH 3GY7A 3F2HA 1PYTD 2AGIX 4YESB 1BTYA 2PKAA 2BB4A 1AN1E 1YPMH 1LQEA 1IQFA 1GDNA 4I86A 1VITG 1FDPA 1ZSJA 1ZYOA 2C8XB 1V2UT 1DWCH 3KIVA 2PF2A 4XD7D 1AWFH 1F5RA 1WXRA 1A0JA 1MCVA 1QY6A 1HFDA 3TGIE 4Y76A 5DSFA 1TFXA 1BB0B 2GCHF 2Y82A 3STIA 4CHAC 1SHYA 3RLWH 2GDEH 2ZZUH 3OEHD 3A84A 2PSYA 2YNBA 3TITA 3RXVA 2BDYA 3S9AA 3FP8E 4ZAEA 3QZRA 1ESTA 1GHWH 2QE7D 4FUBA 2EA3A 3SYJA 4D76A 5A09A 3KQCA 1C5WB 4ABHA 3HMRA 5CSQA 2QXHA 4IMQA 2P3FH 4K1TA 1MKWK 4TWYA 4RN6A 2QJ4A 2BQ7B 1QURH 2GTBA 2WPJS 4FETA 2ANYA 4AX9H 1NU9A 2C4FH 4AFUA 3O8BA 4NIWA 3SI3H 2F9VA 3HN4A 1H8ED 1M9UA 3VB3A 1GBJA 1QBVH 1GJ4H 2KNFA 5CS1A 1XVMA 2FWWA 4HI3A 1EAXA 3NXPA 1W12U 3EE0B 1O3NA 1A7SA 3A83A 4YM9A 2EY4C 1TRYA 3NK8A 4ZMAH 1O2XA 5DP6A 5A0BA 4TWWA 1O2JA 1H8IH 5F8XA 5EQQA 5GIBA 2YNAA 5JB8S 3MH7A 4E7RG 1GCTB 1GVLA 1WBGB 4YTAA 4X1SU 1DY8A 5ABWA 1PQ7A 2NU1E 5IK2D 2A45B 5FBIA 4KELA 1MKXK 1TNJA 3OE7D 1O2IA 1ZPBA 2F9BH 1C4V2 4NSYA 4Q63A 1AUTC 1ZSKA 2WUBA 3VB6A 5DN6D 1COWD 5E0JA 1F0TA 2FS8A 2SPTA 2ZCHP 1EZSC 3BF6H 1A61H 1GHBG 2Q1JA 2C90B 5TCAA 2K51A 1GJDB 3BEIB 3QTVH 5T6GA 2RCEA 2KCAA 1GJCB 1ANEA 2XTTB 2Z7FE 4BAMB 3QN7A 2YIOA 4A92A 3T5FH 3MTYA 4TYDA 2OTVA 3SNBA 1K1LA 4UD9H 3OFND 2Z9KA 1KLIH 1URKA 4I7YH 2YMSB 5EJLA 1UK4A 2VIPA 1GG6B 1UW7A 4NCYA 5F8ZA 2O8MA 1Z6EA 1BTXA 2F3CE 4I8JA 2Y5GA 4AORA 1TMUH 4DIHH 1HAGE 1NU7B 4Z0EA 1C5ZB 1GBTA 3V7TA 3SJOA 4BAHB 2R2MB 3RXHA 2GMTB 3ODFA 3Q76A 1Y5AT 4RKOB 1GMDF 1Q3XA 1C1VH 2ODQA 1O3GA 1TONA 4BVWA 2ZQ2A 1OP0A 1PK2A 3GY6A 3PRBA 3TJNA 4ZH8A 1O35A 2QF5A 5GDSH 4B76A 1MMJN 3GCNA 3PV4A 3D65E 3TH4H 1HUTH 4B1TA 3VB5A 3SORA 1KLTA 1CA8B 1THRH 1KI0A 1F5LA 2XRCA 4AFQA 5EXLA 4BXSA 3A8DA 2LELA 1P2OA 3U28C 1VR1H 1V2QT 1UTJA 1BA8B 1TX7A 1YLNA 3NCLA 2VIDA 5LPEA 1H9IE 5K7RA 3BTKE 1QHRB 1UTNA 1GI9B 1VITF 5LGOA 1A5HA 3T28A 1L1GA 3N7DA 5PTPA 3SHCH 1EPTA 1SQOA 2Q6DA 1GI5A 1HB0B 1W10U 1NY22 1MTSA 1TYNA 1BRAA 1T8LA 4X2VA 4E06H 1CSOE 4MPWA 3S7HB 3UOPA 2H9EH 2AMPA 2R9PA 3JZ1B 1LQDB 2H9HA 3VXFH 3MHWU 5FXLA 1GMNA 1GJBB 5TCCA 5DP7A 1NN6A 1NO9H 1DVAH 1P03A 1V2PT 1YKTA 2QV1A 3MNCA 1MH0A 3A89A 3PLKA 4ZROA 3URCA 1A0HB 5B6OA 3PV5A 7GCHG 4NGAH 4TY7A 2DOHX 1YCPK 2FOEA 2ZFFH 3RXDA 2PKSB 1BRCE 2A4QA 2BOKA 1Q2WA 1W7GH 3GCTG 1NBME 1FY1A 4AGJA 1YYY1 1CEAA 1ZLRA 4BAOB 2G00A 3MU5A 3TVJB 2ZU4A 4K8YA 4OS6A 2TRMA 4D9QA 2GCTC 6CHAC 3VFEA 5C1UA 2ZFPH 1PPBH 2FPZA 3SV2H 1XKBC 1J8AA 1LVYA 1ELCA 1MAXA 2G5NA 3PM3A 3UB0A 3BG8A 4X8SH 5CT2A 4AG1A 1RXPA 3M7TA 1QTFA 1FPHH 4IN2A 1NFXA 1SGIB 4B2CA 1JRTA 1D4PB 2Z3CA 5C3NA 4ISHH 2ANKH 1SGFA 4U01A 1DICA 1ZHRA 4KKDA 3ZVAA 3N7OA 1C5PA 4JYUH 4ZKRU 2B9LA 2JIZD 2FO9A 2FODA 2SGAA 4MDSA 1UTLM 2XC0A 1GHBF 1FY3A 1DITH 1KTTB 1I71A 2J98B 3HK3B 4HTCH 2QY0B 3MO6A 4TPIZ 1YWUA 2JDID 1ZGVA 3DA9B 1AFEH 2PGBB 4ISIH 5JYIA 4NSVA 1K28D 2BQWB 2K13X 4CR9A 4CRFA 2G55A 1XUKA 5CT3A 4H6TA 1YP9A 2HVXA 1FY5A 1D3PB 4YOIA 2WPMS 3F9HA 1VCPA 4WMEA 1DXWA 1F0UA 2KAIA 4LZ4B 3SUFA 4O3UA 1CHGA 1BHXF 2JH0D 5FAHA 4IMZA 4R0IA 2ZCKP 4P00A 2O8LA 3BEFB 4UE7H 4IC5A 1O30A 1DWEH 3EA8A 3RU4E 2Y8RA 3WY8A 3SU0A 3BV9B 1K1NA 4YIZA 1NRSH 1Z8JB 2YILA 1B2IA 3A82A 3RXFA 3SQHE 1FONA 1E1RD 2GZ9A 1E36B 2PUQH 1GBLA 2QYIA 3P8GA 2IOTA 4MVNA 1QB1A 4MTBA 5CS3A 2FOGA 1SHHB 2JH5D 1F5KU 4RKJB 1SBWA 1MBMA 1GI6A 2ILNA 4AFSA 1O39A 1XKAC 2AS9A 1D9IA 1GJ7B 1XUGA 1NZQH 4R1CA 1ZHMA 5KEDA 2P95A 2FEQH 3OSYA 4WXVA 3UR6A 2F43B 4FVBA 3H7TA 1O3IA 1UVTH 4BV7A 2WYJA 3LIWA 1ZMNA 3TK9A 2XCNA 1CBWC 2CHAB 2HPPH 2FTLE 1WTGH 1SL3A 5T1VA 1NS3A 1NFUA 1V2JT 1AKSB 3LAQA 1P2IA 2Y7XA 2J9NA 2D8WA 2ZWLH 3SU6A 4NWKA 1EAWA 2QXIA 4WXIA 1NL2A 1KMHB 1UJ1A 1HLTH 1MAYA 1TRMA 4INHA 4JZEH 5C5OA 2AH4X 1ZPZA 2J92A 1TOCB 1OYQA 4H6SB 4AYYB 1KXCA 3M5MA 4BANB 3RP2A 1THSH 2G4UA 4J1YA 1OXGA 1DM4B 3UUZA 1YGCH 3MFJA 4I8HA 3P8FA 3RXTA 1FN6A 1GBBA 1UK2A 3UAIC 2JETC 4JYVH 5LH8A 2VGCB 1HDTH 4Z0KA 3E0NB 3RU4T 1PJPA 1PPFE 3W1EA 5C67A 1WDIA 3SU1A 3M3SA 1Z7KA 1CQQA 2ZHDA 2NU3E 2WZQA 3AK5A 3SP8A 1DSTA 4UONA 2KCPA 3FO8D 2QF0A 3VG8A 2ASUB 3MKPA 3D62A 5DP3A 1KSNA 2WHXA 2CK3D 5I25A 5EJZA 1PQ8A 2OC7A 3DCLA 2GGVB 2V7QD 2PHBA 3SUGA 4NFEA 1GBEA 4WH6A 3ATIA 3RXIA 1HAVA 1ANDA 2JJ1D 1XXFA 1TPKA 2I6SA 2W3IA 1JBUH 1P9SA 4ZHMU 3UR9A 2IPQX 1RTKA 1OWEA 2O8WA 2O8TA 3ZZ9A 5K0HA 1BHTA 1EPTC 3UPEA 1FI8A 3GDVA 2HNTC 3FZDA 4ABBA 8GCHF 4R1AA 1BMFD 3O8CA 1RIWC 1L0ZA 4ZKSU 4OGXA 2PKAB 2F9UA 2FI4E 1GBDA 4AFZA 1RTFB 1K22H 4FU8A 2W7UA 1QQUA 1C5YB 1G32B 3SU3A 1Z1JA 1ZHPA 2D26C 1VCWA 2HOBA 4BOHA 2FI3E 1C1TA 1BMAA 1QFKH 4X2XA 5A8YA 2RFKC 5TJXA 3ZVGA 5E8EH 1BCUH 1C1SA 3GYMA 1RRKA 1ZJKA 2R3UA 2CXVA 6LPRA 1YM0A 5C2ZA 1LVBA 2BD8A 3RDZA 5A0CA 1UVSH 1QRXA 1SLUB 3ENSB 1A3BH 2BD3A 3RMOH 1O5GH 2EEKA 2M2AA 2QJ2A 3UWJH 4KTUA 5EXNA 1O5DH 3U1JB 1GJAB 3ZVCA 2Y5HA 1J14A 1GI8B 1HAIH 2BVXH 3A88A 7ESTE 3UREA 1YPEH 3BTTE 4NA9H 3NZIA 3OY5U 2KX4A 2FS9A 1XUHA 1C2LA 2P3UB 4FUIA 2P59A 1OYTH 3MI4A 2QGRA 1QIXB 5HM9A 1Q31A 3MU8A 4MNVA 4NIVA 3QGNB 1TB6H 1PMKA 4F4OC 2KL5A 3FVFB 3LGTA 1SQTA 1P2MA 3MNSA 1FQ3A 2HLDD 4KGAA 2BTCE 2P8OB 3B8JA 1V2NT 1YCPM 2ZTYA 2WINI 8LPRA 1EZQA 1SGDE 5CS5A 1BBRK 1UCYK 1I5KA 1AE5A 1EJAA 1O37A 4RT1A 2XNDD 1SLVB 3UIRA 5A0AE 3P8NA 3UNQA 1ELEE 1HJAB 3GY8A 3M35A 4X1QU 1TGTA 2FXRA 5EQSA 5CE1A 1EOJA 1K1OA 3LGIA 1PQAA 2LP6A 4BAKB 1CVWH 3UNRA 3AW1A 1SGTA 3K9XB 4CBOA 2ZO3H 1Z6JH 4YT6H 3DSPA 3E3TA 3URDA 1ZSLA 5C0TA 1GI4A 1LHGH 1Z8RA 2BDBA 2P93A 2CMYA 5FPYA 3OU0A 3RXJA 5IYTA 1O3EA 2QF4A 3RU4D 7LPRA 3PV2A 2A32A 1C4Y2 3LH1A 3W94A 2OC0A 1O2KA 1I8NA 4ACBA 2A7CA 1VKYA 1BTUA 2Z3DA 4JYTA 1ANCA 2HNTE 3A8BA 3ZZBA 1SQAA 2VVVA 4DCDA 4CBNA 2HNTF 2ZC9H 5G4BA 1S6HA 2G4TA 1T4VH 3KGPA 2GKVE 2FYRA 1GP9A 2ZA5A 3DSGA 2R0KA 1ELDE 1RFNA 4A7IB 2BY6X 1MQ6A 2Q8BA 4Y7BA 2AYWA 2ZDVH 3CENA 2ZU2A 1L4DA 2K0QA 2BXTH 3K6YA 4Z0DA 1JWTA 2ZKSA 3SNDA 1N6XA 3VEQB 2OP9A 3LU9B 1L4ZA 1DT2A 3HGNA 1AZZA 2OC1A 1SFIA 1OWIA 3GCHB 3UTUH 1EATA 3PO1C 2AGEX 2YIPA 5JBBS 2VVCA 1GCDA 2J2UA 4AGKA 1CA0C 1HCGA 4INKA 1GPZA 1CGHA 4KTCA 1Y8TA 1EQ9A 2TPIZ 2VWNA 5LPFA 2PF1A 5EXMA 2XC4A 1QJ7B 2L0SA 1A2CH 3ZV8A 4A1VA 3P17H 3H7OA 1QB9A 2JKHA 1GVZA 1S81A 2FM2A 2ZU1A 1MCTA 3E16B 2FOBA 1N8OC 2V35A 3VGCB 3VB7A 4ASUD 1GHYH 1O31A 1ZRKA 1TNHA 1FUJA 2HPPP 3MU1A 1FXYA 1SOTA 1TQ0B 3DD2H 1IQEA 1ZRBA 1O32A 1J15A 1MBQA 3KYGA 3ELAH 1A0LA 2F4LA 1V2MT 3SQEE 1MKXH 2UUJB 3A85A 1F2SE 3AAUA 4Y7AA 5J4QA 1S84A 3GY4A 3PB1E 3PTBA 6GCHG 1S5SA 1QL9A 1YPGH 1BIOA 1S85A 3F2GA 3BG4C 1G30B 4INLA 2SFAA 3RXGA 1HAZB 2JJ2D 1GJ6A 1IQIA 1C5SA 1O3CA 3NKKA 3SJIA 5LPRA 5E2OA 1BT7A 1HBTH 2GZ8A 4R1BA 5HM2A 3RXOA 1JIMA 1PMLA 2PK4A 4D3CA 2ALPA 3WWFA 4MQAA 2SGEE 3TU7H 3ODDA 1E35B 1TBQH 4XE4A 1W11U 3S9BA 1AWHB 3PRDA 3B23B 5JB9S 1FY8E 2BD7A 2BYAX 2TIOA 3TK6A 1O2UA 2BD5A 4D9RA 1V2ST 1D6RA 3SU4A 3ZZ7A 1C5UA 3SJKA 2KFWA 1Y3UA 4CH8B 1DPOA 1O3JA 2V3MA 2ZPQA 3RXKA 1LPZB 3BT1A 2XXLA 2BDCA 3B9FH 2Z8WA 1YLCA 1HRTH 1S6FA 3KCGH 5HIYA 3ZZ6A 5DO4H 3RC6A 1IAUA 1O3HA 2VH6A 1BTHH 1W0JD 2PW8H 4ABGA 2BVRH 3C1KA 3C27B 3GDUA 3RMNH 3LGWA 1C2HA 2C93B 1TQ7B 2BLQA 2ZPSA 5GWZA 2R2WU 3BTME 1C1PA 3LH3A 1CGIE 2FDAA 1ANBA 2I9BA 1ABIH 2FLRH 4Q2KA 5EJ1A 3MU0A 4A1TA 1TWXB 3KIDU 2HWLB 2A4GA 4I32A 1EKBB 5EU8A 3VB4A 5F8TA 3K65A 1C2JA 1C5RA 1O3OA 3EE7A 4E7NA 2IN2A 2W6JD 4GHTA 1AFQC 4I8GA 3RC5A 3IITA 1ESAA 4Q80A 2ODYB 1EASA 2J4IA 1FN8A 1O38A 2H5DA 3CS0A 1GMHF 3L6PA 2ODPA 3UNSA 3ZZAA 2PV9B 1XUIA 1G2MA 1GHAF 2STBE 1MTNB 4B6FA 3FANA 1AVWA 4BTUB 2HGFA 1CHOG 1ZGIA 1C5TA 4Y8ZA 2STAE 3U73A 4JZ1A 4X8VH 3SOSA 3HATH 4Z09A 1HXEH 2ZHWH 3QO6A 1V2RT 4B2AA 3TJOA 2Y5FA 3K6ZA 1VCQA 2F9NA 3GY2A 2BOHB 2ZTZA 1ELGA 3BTHE 3RXCA 1P12E 3AAVA 1YCPH 2KCYA 2UWPA 3TNSA 3ITIA 4I31A 2ZFQH 1OX1A 4ZHAA 4ISOA 3TPIZ 1BITA 1INCA 2ZHQH 3ZWZA 3A7VA 1L1JA 1IQHA 3MH4A 5KECA 1GMOA 1W8KA 1HIAB 3SNEA 5A2MH 2XOKD 4ZXYH 3BTFE 4FUEA 1C1MA 5DP4A 1YBWA 1A5GH 1VITH 2I9AA 2BQ6B 3A7XA 4AZ2B 4CHAB 1P11E 3S69A 1ACBE 1YPJH 2BX4A 1ZR0A 1P2NA 4MPUA 3Q3YA 3E91A 2VH0A 2ZU3A 4DGJA 2BY8X 1H1BA 1E79D 2KJ4A 4ZCNA 1EAUA 5BPEA 4RI0A 1PK4A 4Q7ZA 3MWIU 3UFAA 5CP9A 1G37A 1AIXH 1EX3A 2WPLS 3ZLEA 1HAXB 1FAXA 2KCOA 3ZV9A 4R8TB 1IHSH 4JK6A 4LK4A 1TLDA 2XCFA 3JZ2B 3A8CA 1E34B 1TOMH 4AB8A 2BD4A 2FESH 1CT2E 3F68H 3MYWA 5COEA 1CEBA 1C5VA 4BVVA 2BLWA 1AVXA 1UVUH 4GCHG 4TT3D 5F53A 2AIQA 1KXAA 1T8MA 3MH5A 3V13A 1OPHB 1H9LB 3ZYDA 2DE9A 5EODA 3QUMP 2FEBA 2VWLA 4Y6DA 1NPMA 4MG3A 2ZCLP 1ZTLA 1ETTH 3NUMA 4FU9A 2HPQH 2FP7B 1HGTH 2P3TB 4NIXA 3U8OH 1TALA 3LC5A 4VGCC 1EJNA 2J8JA 2GZ7A 1SI5H 1BTZA 1ELTA 2CN0H 3LGYA 3SW2B 2QIQA 2RA3A 3GCOA 3ZZ5A 1EJMA 1TA6A 3E1XB 4NFFA 3KHVA 4ASHA 1HNEE 1G9IE 1AMHA 1QA0A 2CV3A 2Y7ZA 3A87A 1B0FA 2RG3A 1EXFA 1VGCC 4FUFA 3SNAA 2FX4A 2QA9E 4K1SA 1O2HA 1V2TT 4X6OA 4NIYA 1C9TA 1W0YH 1P3EA 1TX6A 2B5TB 5GCHG 2X2ZA 1ZMLA 1V2WT 1AUJA 2C8WB 2VVUA 5CS9A 2LL3A 1AB9C 3FZZA 1Y5BT 3F1SB 4K1EA 5FCRA 1QL7A 1IQNA 1P10A 2BZAA 3MOCA 5C0UA 2ZFRH 4MLFB 3TJVA 3Q3KA 2EI8A 3A86A 3A8AA 1SKYE 1OHHD 5F03A 1T4UH 4XRNA 3Q00A 5L6NH 1TBRH 1HAVB 2A4RA 2V3HH 3A81A 3GS9A 1O34A 3LKWA 3BIVH 4JZDH 3KEEA 3EGKH 1OS8A 1W8BH 3LOXA 1P02A 2OQUA 1C5MD 2V6NA 1HPJA 1ZTJA 3WWBA 3CP7A 3V3MA 4UFEH 1JOUB 1TNKA 1EP5A 4ZKNU 2AHME 2Z8VA 1O2RA 1MQ5A 2I6QA 1HJ9A 1T8OA 1RD3B 4MPVA 4DJZB 3PLPA 3S0NA 1GJ8B 1P0SH 2ZDAH 1NTPA 1ELAA 3OEED 3W95A 5GXPA 1E1QD 2IJOB 4KTSA 3S9CA 3TK5A 1O2SA 1KYNA 1OKXA 1G3EA 3SI4H 3T2NA 1Z40A 2F9PA 4AC9A 1KXDA 2PP6A 3ATKA 1MZDA 1WCZA 1C5LH 1KDQA 2WPKS 2V0BA 2JH6D 2PWXA 2ZDMA 1W0ZU 1D3QB 1UHBA 8ESTE 1DWBH 1OOKB 2BY5X 1BHXB 2OINA 1TPSA 1A1RA 1YXEA 5CHAC 1O2VA 4Z1MD 1O3LA 1AHTH 1GGDC 1NM6A 4D7GA 2OQ5A 2J97A 1MTVA 7GCHF 1H8DH 1QNJA 5C1YA 3RXQA 4OS5A 1C2KA 3A80A 1C5XB 2Q8AA 1LMWB 1IQGA 4BTIB 2ZF0H 3RC4A 1Y3WA 1UMAH 1VJAU 4FUGA 1EUFA 3GCTF 1BRBE 4X6PA 2BD9A 2ZP0H 2FYQA 1O2OA 3Q77A 5EGMA 2GD4B 1A4WH 1GMCG 5DP8A 1DFPA 1Y59T 3PMAB 4Y10E 4K5ZA 3SGQE 2HRVA 4WY3A 5BRRE 3QK1A 1AO5A 5C94A 4ZKOU 2R3YA 2OBQA 3RMMH 2BDGA 3F3BA 1MABB 2OCVB 3NRLA 1TPPA 1W81A 8KME2 1LKBA 1GJ5H 4GCHF 4WVPE 2GCTB 3ATLA 5DP5A 6CHAB 3D49H 3V0XA 2J98A 3KQDA 4ABFA 3ATWA 2XC5A 4JMYA 2A5IA 4X2WA 1LHDH 2PTNA 1SGRE 1BTPA 2GV6A 2VIQA 1LCYA 3BTEE 4X1RU 5DGJA 5JPMH 3FP7E 4DW2U 2ZNKH 1P2JA 3DHKH 4MNYA 1C2IA 1LKAA 4TSFD 1OWJA 1FJSA 4ZUHA 1G3DA 1Y3XA 2GCHG 1ARBA 2UUFB 3E6PH 3GOVB 2A5AA 5SGAE 1OP8A 4UAOA 1K21H 2PFEA 2GT8A 3ZZ3A 1JXPA 2KM0A 5KGOA 2ZGJA 3FN8A 3TGJE 1CT4E 5HMAA 4WF8A 2HALA 3E8LA 2R0LA 3U69H 2ZGHA 2ZHFH 1D3DB 1BBRE 1SOZA 3RUOA 1UCYE 1YPKH 5GCHF 1DY9A 3SV7A 1NBMD 1O2NA 2EC9H 2ALVA 4O97A 3SU2A 2H9TH 1VGCB 4ESTE 1W2KH 4GUXA 3BT2A 2BDIA 4KP0A 4R19A 3IWMA 1E0FD 1QCPA 4ZXXH 3DFLA 5JDUB 2BDAA 4XBDA 2UWOA 1AB9B 4O03A 1GJ9B 1PPCE 2VINA 3DSOA 1QQ4A 1V2VT 3QZQA 2DUCA 3SBKA 1FV9A
chains in the Genus database with same CATH topology
5F6MA 1OWHA 2A0QB 5IDKA 1AZ8A 1SGFG 2UUKB 3SHAH 3AW0A 1GCTC 4ABEA 2ZDKA 4UEHH 1EP6A 1JIRA 2FOHA 2Y81A 1W13U 1WV7H 1ARCA 1O5BB 2THFB 3RXAA 2Z3EA 2NWNA 2QF3A 3E0PB 1LVOA 1C1QA 5H4IB 5ETXA 1DX5M 2CGAA 1TGBA 1O2GH 4H4FA 2WPIS 2G81E 3LC3A 3KQEA 3P92A 3ZZ4A 4QT8C 2HGTH 1HJ8A 2ZGCA 1V3XA 2FOFA 2Z9GA 1W3CA 4K69A 5J4SA 4AB9A 1MD7A 2G51A 1LVMA 3OY6U 1O5FH 2BM2A 1QRZA 3SNCA 1MU6B 3P8OA 4IGDA 1GG6C 2WV4A 2ZPRA 3HPTB 1ORFA 4YZUA 3F9FA 2D2DA 1O2WA 3MH6A 3TGKE 3A7WA 4UFFH 4NA7A 1KY9A 1G2LA 1U6QA 3QWCH 4X6NA 1O5CB 1P2QA 1CBWB 1C5NH 2BY9X 2J94A 4X1NU 2FX6A 4HFPB 1K1MA 2NU2E 5AFZH 1O2YA 1ABJH 1QR3E 1FLEE 4IN1A 5EPNA 2FTMA 3PMJA 5T6FA 4Y0YE 1ZZZA 3UQOA 5FCKA 5DPAA 2AEIH 1KIVA 1GMDG 3RXEA 1D6WA 1QBNA 5ESBA 3RXLA 1NK1A 4YLQH 4GLYA 1XX9A 1IQJA 4BNRA 1UTKA 1C2DA 1DLEA 1DWDH 4WWYA 2BMGB 2JETB 1SFQB 1KXFA 3PROA 4UDWH 1DE7H 2BHGA 5E0GA 3K65B 4FUJA 1P04A 1MKWH 1TRNA 3LJOA 3P95A 3RMLH 1HPGA 1EAIA 1RJXB 1QJ6B 3UOUA 1YLDA 1P01A 1C5QA 1QA7A 5FPTA 1BJUA 2SGDE 1Z1IA 1G36A 2A2XH 4KIVA 2UUYA 1HAPH 1BQYA 2GX4A 2TGPZ 1FAKH 1QL8A 2AMDA 3BTGE 1HYLA 1NRRH 4K3JA 1SMFE 3NWUA 3AASA 5DP9A 5L2YH 1T7CA 1P09A 4K8BA 3GDSA 1V2LT 4Y8XA 1SG8B 2ZI2H 1GBAA 1WTHD 5L2ZH 1O5EH 3I77A 3RXRA 3HK6B 4X0WU 2PKSC 1K2I1 1AU8A 1ZTKA 2F9OA 1QRWA 2UWLA 1S0RA 1GBKA 1EPTB 1JRSA 4XBBA 4B73A 3F9EA 2ZFTA 3PMHB 3IG6B 1RIWB 1TNLA 4FUDA 3TNTA 2PUXB 2Z9JA 4O9VA 2TGAA 2LNCA 3T25A 3EYDA 3QGJA 1ETRH 1KXEA 1WUNH 1AGJA 3M7UA 1GDQA 1QJ1B 1NRPH 2GV7A 3SUDA 3H5CB 3SRJA 2ZEBA 3RXSA 3M3TA 4U30A 1NT1A 5EW1H 3I29A 1WOFA 5I46H 4FXGH 1C5OH 1GI3A 1NRNH 3BEUA 3M7QA 4O3TA 4HZHA 1O0DH 1GI7B 4CRBA 1Y3YA 4BV5A 1C1UH 4GHQA 1QBOA 1TABE 3M36A 1WSSH 4OGYA 4U32A 4LZ1H 1NFYA 1O2PA 3LONA 1HV7A 1KDUA 1BMMH 1O33A 1IQKA 3GY3A 1L2EA 3UWIA 1IHTH 3SUEA 4DY7B 1S83A 4SGAE 4AN7A 4YT7H 3VPKA 2FOAA 3G01A 3P6ZB 2PGQB 1WAYB 1THPB 2NU0E 4IS5A 1O3BA 3ZVBA 1JFNA 1IOEA 1Y3VA 3EA7A 1MD8A 2O8UA 1C1OA 3HMSA 4NG9H 1XXDA 1PFXC 1O2MA 4AYVB 3SGBE 4IUAA 1SSXA 1ZJDA 5E0HA 5FX5A 2BXUH 4CH2B 2G8TA 1WU1A 2J38A 1FZZA 1VZQH 3PYHA 3RLYH 1F0SA 3EQ0H 2ZGXH 1PKRA 1NC6A 1V2OT 5C1XA 1SGQE 7KMEH 2NU4E 3U98H 5L30H 3U8TH 3ZZDA 1AVGH 1DUEA 1YC0A 1ZMJA 9ESTA 4JZIA 1NROH 3M3VA 2OXSA 4NWLA 4A5TS 1MTWA 3LPRA 1KIGH 2PLXA 3KN2A 4ISNA 1KTSB 1GVKB 1C1WH 2CF8H 1O2LA 2ESTE 4I8LA 2QAAA 4BXWA 1ESBA 5DG6A 3TJUA 3DUXH 2KAIB 1MUEB 1TE0A 2ZFSA 2BD2A 4D8NA 3EDXB 4K2YA 1NL1A 1C9PA 1ELVA 2QC2A 3V12A 4E05H 4AOQA 1GBFA 4GAWA 3K2UA 3L33A 2YOLA 3T26A 2GP9B 1HKYA 2CHAC 3HKJB 2Z94A 1O3DA 2F83A 1CGJE 4ABDA 1W7XH 2OBOA 1DSUA 2SNWA 1ID5H 3GYLB 1MTUA 3BSQA 2RDLA 3DT0H 4FUCA 1P57B 4X8TH 3QX5H 2ZU5A 1GDUA 5JBCS 3PO1B 1UVOA 2VIOA 3HKIB 1WYKA 1CA0B 2B0FA 3UQVA 3ZVEA 1NRQH 3QTOH 4B71A 5FBEA 3L3TA 4J2YB 2TGDA 5AFYH 3ESTA 2VIVA 1LPKB 1TGNA 5FHTA 5HGGA 4CIKA 2A7HA 5DK1A 1A46H 1IQLA 3BIUH 1WQSA 1N8OB 2WPHS 2K1QA 2PTCE 3QDZB 3T62A 1RS0A 1TX8A 4X2YA 4BVDA 3FP6E 4A1XA 2VGCC 4I33A 5EOKA 1C2FA 1B0EA 3I78A 2ZDLA 1QGFA 1MZAA 1X7AC 2VWOA 1EZXC 1KDQB 1LHCH 2XWBI 4TPYA 6GCHF 3FAOA 4FUHA 1SLWB 1F0RA 1PYTC 1KXBA 1UHBB 2W3KA 2FOMB 1S0QA 2J95A 2AGGX 4B2BA 5AVDA 4IBLH 5HYOA 2AMQA 2Q6GA 1K1IA 5HXFA 3BG4B 1HAOH 1O3FA 1SC8U 4Y71A 3VXEH 3KL6A 1N1LA 1LTOA 2VU8E 3F9GA 4TY6A 4D7FA 3LT3A 2H5CA 2C3SA 4XSKU 2ZTXA 1AI8H 1J16A 1E38B 1K9OE 2AIPA 1PPHE 1TAWA 3MO9A 1UTPA 4DIIH 2W26A 1EOLA 2XW9A 5CT1A 1HXFH 4M7GA 1TGSZ 2Y80A 1GBIA 1BTWA 1O5AB 1ELFA 1LPGB 1O3AA 1IQMA 3PLBA 1F7ZA 1CE5A 2GT7A 4FVDA 3KQBA 4IW4E 1LDTT 2J34A 3E90B 2H1UA 4OS7A 2VNTA 2W7SA 1P2KA 1GBCA 3UY9A 1PPEE 1DXPA 4OS4A 4X6MA 4WMFA 2B8OH 1EB1H 8GCHG 2FZZA 4NA8A 2SGQE 3T29A 1UK3A 5EQRA 5C5NA 3GISB 2ZGBH 3ZVDA 1FMGA 1GBMA 4NZLA 5ESTE 1SLXB 4CRAA 3P70B 2GDDA 2P94A 2BLVA 4H42U 1TA2A 2Z9LA 3MNBA 3MNXA 3HMTA 4Q7YA 2ANWA 4DT7B 1SGPE 1T31A 2XBYA 1YPHC 3M5OA 4BAQB 3LGVA 2A4OA 3M37A 3ZYEA 5EW2H 3TH3H 5JBAS 1AFQB 3OTJE 2SGFE 4XFQA 1V2KT 2FLBH 2RA0A 1XUJA 3S7KB 3BN9A 1C4U2 1XUFA 3KF2A 1FIZA 1CHOF 1RTLA 1HPKA 4XDEA 9LPRA 4ZHLU 5E2PA 3E6PL 4ABAA 1NESE 1SGNE 2Z6BD 2K4RA 1C2GA 3RXBA 1AD8H 1HIAA 3SU5A 3TLOA 4JCNA 2P8OC 2G52A 5JBTA 1BDAA 3M5LA 1KLJH 1E37B 2BLOA 4CRDA 2XNIA 1UTOA 5T6DA 4X1PU 3EAJA 3ZVFA 1A0HA 1MU8B 1SGYE 1BZXE 1GBHA 2QCYA 2VJ1A 5AHGH 1HJAC 1DLKB 1BMLA 3RM2H 2AFQB 5T3HA 4DVAU 4THNH 4SGBE 3SJ8A 4U2WA 4ABIA 5AF9H 3ATMA 4WH8A 2Z9IA 2FOCA 1ZOMA 1BMNH 2B7DH 2AERH 4JK5A 1GL0E 3U1IB 1CO7E 4B75A 4CREA 2C8ZB 3NPSA 3DFJA 5GJ4B 2W5EA 1XVOA 1DOJA 2HLCA 4IC6A 4B74A 2ANMH 1EZUC 1YF4A 2EI7A 3F6UH 1T32A 1XM1A 1BJVA 4YIVA 3PMBB 4CRCA 1GL1A 5CMXH 2ZIQH 1FPCH 1LO6A 3MU4A 3SV9A 2H2ZA 4I8KA 2F91A 3OX7U 1HAYB 1OWKA 5A8XA 4F49A 1S82A 1OWDA 2A31A 2SGPE 4X8UH 1TMTH 1GHZA 2FMJA 3GY5A 3AVZA 1JMOH 4AG2A 4DG4A 4Y79A 1BUIA 4Y0ZE 1BRUP 3TIUA 1G3BA 1SPJA 1ZPCA 2QXGA 2OC8A 1GI1A 4DOQA 1AY6H 3GCHC 4MNWA 4MNXA 4MPXA 1O2TA 1SGCA 1GHVH 4ABJA 2XYAA 1P9UA 2XBWA 1T8NA 4WMDA 3SO3A 1K1PA 4UFDH 2EI6A 1H9HE 3D23A 2J8LA 1Z71A 1YPHE 3M5NA 2A7JA 1LHEH 2VB0A 3BTWE 4APLA 5DJ7A 1W14U 3FFGA 4Y8YA 1B5GH 3SZNA 4VGCB 3VGCC 3PWBA 3KNXA 2H6MA 1OP2A 1NFWA 4OS1A 2SNVA 1VJ9U 1Z8IB 3RXMA 2A1DB 3BTQE 2FD6A 1A5IA 3LGUA 2Q6FA 1F92A 1L1NA 2D1JA 2GVFA 1OSSA 1O36A 1ETSH 5EPYA 1P05A 1C1NA 4YO9A 1O3KA 3SN8A 1GI2A 5A8ZA 1H4WA 1DS2E 4UFGH 3SV8A 3ZZCA 2V3OH 4XOJA 1YPLH 1C1RA 4DURA 3CS7A 2ZQ1A 2OD3B 2Y6TA 1BOQA 3U8RH 2PSXA 4APMA 1O2ZA 3GICB 1J9CH 1TBZH 3MO3A 2FIRH 1FIWA 1V6DA 3QLPH 1SB1H 1SGEE 1GI0A 1SR5C 1KRNA 1WQVH 1C2MA 2ZDNA 1BBRH 4FU7A 1UCYH 1ELBA 1P8VC 2DOIA 1TNGA 1FY4A 1UTQA 3RM0H 5DKMA 4PROA 1P3CA 2ZHEH 5GPIB 2G5VA 2A5KA 4A6LA 2XWAA 1UO6A 1GWAA 2CF9H 1AQ7A 4BVCA 1QB6A 1UVPA 4GSOA 1AKSA 4K60A 1N6YA 3LJJA 2O9QA 2FI5E 3RXPA 2TGTA 3O8DA 5HPGA 2HPQP 3O8RA 5C20A 1K1JA 2OLGA 2WYGA 1B7XB 4Y11E 1Y5UT 2CJIA 4CRGA 1G3CA 4UV6A 2PR3A 4Z0FA 2DE8A 2TBSA 1TPOA 5FPSA 4Q7XA 3PWCA 1DANH 3TH2H 2VIWA 1O3MA 2P16A 2QXJA 2LPRA 2IPHA 2A2QH 1HAHH 2ZG0H 4YOJA 2ZECA 3ZZ8A 4HGCA 3SRIA 1Z8GA 4YLUA 1C2EA 3OYPA 1D3TB 1LHFH 1TGCA 1A3EH 2GMTC 3SV6A 2WV5A 2QN5T 1DUAA 3A7ZA 3STJA 2OUAA 2BX3A 6ESTA 2BZ6H 3Q3XA 1XMNB 3MMGA 3LDXH 1O3PB 4RSPA 2C8YB 1GHXH 1TIOA 3A7YA 4ISLA 3SJ9A 3U9AH 1DDJA 3BTDE 2LL4M 5CHAB 3PTNA 2M5TA 4GPGA 1CT0E 4LOYH 1MTNC 3A7TA 4LXBH 1J17T 1GGDB 2ULLA 1GMHG 1SVPA 2BY7X 1TNIA 1PPZA 3R3GB 2XBVA 4YOGA 3R0FA 4Z6AH 1P06A 4XBCA 2XBXA 3EA9A 1GHAG 1GMCF 4NZQA 1PQ5A 2BVSH 1RGQA 3RXUA 3SGAE 1PPGE 4WJG2 3HGPA 1UTMA 4CR5A 1CU1A