4A5TS

Structural basis for the conformational modulation
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
791
structure length
767
Chain Sequence
EPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PLASMINOGEN
publication title Crystal Structure of the Native Plasminogen Reveals an Activation-Resistant Compact Conformation.
pubmed doi rcsb
molecule tags Hydrolase
total genus 181
structure length 767
sequence length 791
ec nomenclature ec 3.4.21.7: Plasmin.
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00024 PAN_1 PAN domain
S PF00051 Kringle Kringle domain
S PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4a5tS08
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4a5tS07
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4a5tS05
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4a5tS06
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4a5tS03
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4a5tS04
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4a5tS02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 4a5tS01
3SU1A 3BT1A 3L3TA 2R2WU 3KEEA 3BTFE 3PV4A 1QA0A 2W7SA 3M5MA 3F9GA 4ASHA 2DOIA 2ZFTA 3BG4C 2H2ZA 1LVYA 1LPKB 1S85A 2ZFRH 5GIBA 1GVZA 1G30B 1YPLH 4APLA 1F7ZA 1IQIA 1GJ7B 3TK6A 5PTPA 4B71A 4YLUA 4BV5A 4ZXYH 1HIAB 4F49A 1PKRA 1MU8B 2C8YB 4CBNA 1TMTH 2WPJS 1MTNB 1GI6A 2H6MA 4WWYA 1XMNB 3RM0H 4UFFH 1YCPK 2VGCC 3FVFB 1UTQA 3GCNA 1TQ0B 3LONA 3MH7A 2FS9A 1KSNA 4NA9H 2D1JA 5GCHF 2Z94A 2HPQP 2QC2A 1P03A 1GI0A 1XVMA 1O39A 1UTMA 1O3KA 1BITA 1EOJA 2UUYA 4E7RG 2BDHA 1V2WT 1TNIA 3SJKA 1DLEA 2WUCA 1C2DA 1YLDA 2QXGA 5GDSH 3OU0A 1SR5C 3G01A 4NFFA 4TPIZ 1SB1H 3NZIA 3SRJA 3O8RA 1O5FH 2VB0A 5SGAE 1ETSH 1S0QA 4WMDA 1W8BH 4OS7A 1MQ6A 5DP8A 3LGIA 5DO4H 3KN2A 3KHVA 1EQ9A 3A8CA 3T62A 2QIQA 3GCTG 1S81A 1C9PA 2VWNA 4K8YA 3U1JB 2ZTYA 5LPFA 3SJOA 5CT3A 1EAIA 1TPAE 2AMPA 2F3CE 4XE4A 4B1TA 1KXCA 2ZDMA 1SI5H 1O2LA 1ZPCA 1C1PA 1D3QB 1GJ4H 3A7TA 2FMJA 1V2MT 3I78A 1Y3VA 3MFJA 2LNCA 4O3TA 1HRTH 2BD5A 4INKA 2A4OA 3RUOA 2XC4A 2HGTH 1AZZA 4K8BA 4Y71A 3RLWH 2OQUA 3KNXA 1DANH 2ZPQA 3SNAA 1URKA 3A85A 1GI4A 2OBQA 5L30H 2BB4A 1QBNA 1OSSA 2GVFA 3IG6B 1CT4E 3GY6A 5G4BA 1QRWA 5DG6A 3BTHE 3IWMA 1KDUA 1HAXB 1X7AC 3A83A 1DWEH 2P8OC 2H9EH 5BRRE 1OP8A 3V12A 5A0CA 1C1RA 1MU6B 1P2MA 1PYTC 1ELTA 1GJDB 1G2LA 3PWCA 3EE0B 3SI4H 1P05A 4UFDH 1H8IH 2Y6TA 3DFJA 2GMTC 4JZDH 1FY5A 4MPWA 2HNTE 2XBVA 3ATIA 1TIOA 3GY5A 3A7XA 2C8WB 4E06H 3A8AA 1VJAU 2G00A 1NS3A 4UD9H 1E35B 3TK9A 1EPTA 1TRMA 2ZDAH 1O2IA 2F9UA 1P2KA 3FANA 1MKWH 2FI3E 2XBXA 1QQ4A 4BVCA 1GMDF 1C9TA 3A7YA 2GT7A 4IUAA 1LPGB 4X8TH 3FZDA 2FESH 1O3FA 3PMAB 1H9IE 2PUXB 3SU2A 4Q7YA 3A84A 2FTLE 1SBWA 3QZQA 1UJ1A 4NIXA 2ZCLP 1UK2A 4MQAA 1BIOA 1O3PB 4IW4E 4D76A 3H5CB 2A5KA 3F9HA 2Z9GA 2B7DH 4I31A 1F0RA 2PKAA 5C3NA 1MTWA 1TALA 3OX7U 3ZV8A 4OS2A 1O30A 1SPJA 2FS8A 4AZ2B 1Z1IA 1RIWB 4AFSA 1P11E 3KIVA 2A4GA 5LPEA 2ZHQH 1K22H 9LPRA 4MLFB 2V6NA 3KL6A 1TGCA 3F1SB 1SGDE 5GCHG 1GHWH 3PWBA 2WV4A 4TPYA 1JXPA 1O5DH 1S83A 1LQDB 1V2OT 1XXFA 3MO9A 1UVTH 3ZLEA 1HAGE 3PLKA 1A61H 1SL3A 1O2HA 2XTTB 4DGJA 1TRNA 5T3HA 3VEQB 3UNRA 1OX1A 3I77A 3ZZ5A 4ISLA 2A32A 4QT8C 1GHBF 4UDWH 2I6SA 4X6NA 5C2ZA 2FO9A 2A5AA 4R1BA 3SV9A 3SRIA 4B75A 2BOKA 5FX6A 3SNBA 1ARBA 2BX4A 4Y0YE 2K51A 2QAAA 5C5NA 1G9IE 1W3CA 3OSYA 4O97A 9ESTA 1K1JA 4CRFA 5E0JA 2OLGA 2ZQ1A 1F0TA 4K1SA 3ZZ7A 2X2ZA 2ZF0H 4GPGA 3QTVH 2A4RA 2SNWA 2R0KA 1MD7A 4ESTE 3UQOA 1CBWC 1TYNA 1YF4A 5CHAC 3MYWA 2TGTA 1BMLA 2OINA 5AF9H 4FXGH 1O2WA 1IQLA 1HAHH 4APMA 1QB1A 3KQBA 1FAKH 1LPZB 1WCZA 4BTUB 1ESBA 1Y5UT 2JH5D 1ZLRA 1EOLA 4Z0EA 3SBKA 2V3OH 7LPRA 1A0LA 4A6LA 1SLWB 3LOXA 4ABJA 2BD3A 1SGYE 1AE8H 3E6PH 1CGJE 2R0LA 2GX4A 2ZGCA 3ATMA 5E0GA 5GJ4B 4D9RA 1BRUP 3QO6A 5I46H 3T28A 4UONA 1FIWA 1V2JT 2VIVA 5GPIB 1O37A 2OUAA 4ABIA 2FZZA 2O8MA 3MH5A 3MU4A 3BG4B 4MNYA 4X8SH 1V2ST 3SJ8A 3ZVFA 2PW8H 4E7NA 1NM6A 4LOYH 2ZPSA 5TCCA 1UTOA 2FYRA 1GJCB 4JZEH 3LGYA 1CGHA 1HLTH 1QRXA 1NO9H 3M37A 1JMOH 2FX6A 2TGPZ 4AB9A 4AFZA 4JMYA 1GJ5H 1C5LH 1XUIA 1AVWA 3S9BA 1CHGA 5F8TA 1GMDG 2VGCB 2SGQE 1XM1A 2EI8A 4OGXA 1V2KT 1P9UA 2Y7XA 1K1OA 1HAOH 4GHQA 2FOHA 1RTFB 1W10U 3ZVCA 1MTUA 1U6QA 4CR9A 2VH6A 3SNDA 1KTTB 1UCYH 1ZPBA 4A92A 2ODPA 1GBAA 1MBQA 1BUIA 5K7RA 1GHAF 2GZ8A 4U32A 3A7ZA 3RU4D 4RKJB 4BTIB 1ABJH 4TY6A 2BD8A 2J38A 3AAUA 2J4IA 2BDCA 1GMHF 4IS5A 3VXEH 3OYPA 3ZZBA 4B2CA 1XXDA 2ZGBH 4XOJA 5JDUB 1AB9C 5FPTA 4DIHH 1LHEH 1ETTH 3VB5A 4WH8A 1G37A 4HI3A 1KRNA 1DWDH 2HNTF 2H5DA 2ZHFH 1C4U2 4FVDA 1OOKB 1L1JA 2ESTE 4X1PU 1NRQH 3BTQE 1ZYOA 1L4ZA 4ISHH 3LT3A 4X2WA 2GCTB 4JK6A 3A7WA 5LPRA 1BT7A 3TK5A 1DT2A 4VGCC 7ESTE 1H8DH 1Y5AT 1BBRH 3Q77A 2FOBA 2CMYA 1NN6A 3MU8A 1GI3A 1KYNA 2QXIA 1GHBG 2I9AA 1HIAA 2ANKH 3S9AA 1T4UH 2F9NA 1ESAA 1HFDA 1PQ5A 2FOCA 2HPQH 2P8OB 1UTLM 5E2PA 1IQNA 1Z6EA 3SU3A 3HMRA 1NZQH 2H5CA 3EA9A 1EB1H 2VIPA 1YLCA 2D2DA 2AH4X 2ZTXA 1D9IA 4MPVA 1D6WA 3SHCH 5DP5A 1CA0C 8GCHF 5EXNA 2P94A 4MPXA 5AHGH 2GMTB 3D49H 2NU2E 1C2LA 2P3TB 3C1KA 1ANCA 4YO9A 1GBCA 1C1VH 1PK4A 2Z3CA 1O3EA 1ZSKA 2Z3DA 4K5ZA 5L6NH 1QR3E 1AFEH 1QA7A 1W0ZU 2P16A 3HMTA 1A0HB 1D4PB 1LHCH 4CR5A 5K0HA 1V2PT 1ETRH 3Q3KA 4K1EA 5CS5A 1FZZA 2YIOA 4X6OA 1TBZH 1S6FA 4MTBA 1KI0A 1G2MA 2ZHWH 4ZH8A 3PO1C 2FX4A 2I6QA 1MZDA 4X8UH 3Q3XA 1TNHA 2IOTA 1O2YA 1KXEA 3ATLA 4TY7A 3P92A 1CO7E 3E8LA 4B73A 1INCA 1LHDH 2ZHEH 1BDAA 4X2YA 1HDTH 4BAQB 4YTAA 1QBVH 6CHAC 4I8LA 3ZZ4A 2ZDVH 3QWCH 1FPHH 1FUJA 4ZKRU 2DUCA 2CJIA 1P02A 1C2MA 2PR3A 1XX9A 3RXMA 4XDEA 4Z6AH 3K9XB 3TNTA 2NWNA 4AFQA 2HPPH 1V2VT 3SGAE 1C5OH 3LJOA 1P09A 2VWLA 3HK3B 2LL3A 1HUTH 3GCHC 1O31A 3NCLA 4B76A 1WAYB 1PMKA 4Y76A 4NWLA 5B6OA 1GJ9B 1KIVA 2BY8X 1GBLA 3JZ1B 1AQ7A 1AN1E 1EP6A 2XC0A 1OPHB 4CHAC 2FTMA 2GV7A 2ZDLA 2SGPE 2QXHA 2BX3A 1H9HE 5HXFA 1UTNA 2BY6X 4ABEA 5EQQA 1DITH 2OXSA 1V2NT 3SZNA 1W7XH 1DXWA 3U73A 1AMHA 6ESTA 1A5IA 4ABFA 3P8NA 2VIWA 1GMCF 3A87A 3VXFH 1O2UA 4CRDA 1GHAG 5C20A 1TWXB 1AE5A 2BLOA 2ANYA 1ELDE 2OD3B 1J14A 2HVXA 1AVGH 1ZOMA 4LK4A 2BQ6B 2WYGA 3RMNH 1XUKA 1OP2A 2ZU1A 2HLCA 4H4FA 1GVKB 1YBWA 1O35A 4H42U 2GD4B 1DPOA 1HXEH 3B8JA 1DX5M 1W0YH 1EAWA 4GHTA 4TYDA 1SGNE 4WY3A 5A8YA 3V13A 1DDJA 1YPEH 2YNAA 1LVMA 3MI4A 2A45B 1L1GA 2B8OH 3RM2H 1CBWB 1F0UA 5CHAB 3V7TA 3LC3A 4GVUA 3AVZA 3ELAH 1V2TT 1NPMA 2QYIA 5HGGA 1P01A 5CS1A 4HZHA 2BZAA 2UWPA 5EW1H 1BZXE 3VPKA 3MH4A 1P57B 2K4RA 1C1NA 3HN4A 1SOZA 4FUCA 1TPPA 2FWWA 2CF8H 4ZKSU 3PTNA 3SQEE 1Z8RA 2CN0H 3A81A 1YCPM 1TGNA 5A8ZA 2EC9H 4K1TA 1ZTJA 1SLVB 3RMLH 1ELCA 1VJ9U 5J4QA 3QGNB 4XBDA 1YC0A 3UY9A 1JOUB 1NRSH 8GCHG 1HNEE 1LMWB 1UMAH 3BIVH 1IQEA 1L1NA 1PJPA 2Y82A 4FUJA 1V2UT 3SU6A 2ZCKP 3BEIB 3OY6U 4BVDA 3GOVB 1RS0A 2WPLS 4NIYA 6GCHF 1F5LA 4WMFA 3GISB 2FDAA 1AY6H 1ZSJA 2THFB 2PK4A 3SUGA 1C1TA 3A82A 3LKWA 4Y79A 2XWAA 8LPRA 4IMZA 2GKVE 3DUXH 4KTUA 1UTKA 1O5GH 2EA3A 3E91A 4D7GA 3BTDE 1DUEA 4IMQA 3ZVGA 1G3DA 2FOFA 5JBCS 2ZZUH 1CU1A 3ZYEA 2BDAA 2OQ5A 3E0NB 3W95A 3BTME 2Z9LA 3H7TA 5CT1A 1IOEA 3BTKE 1VITH 3HGNA 1DSTA 2UUKB 4D3CA 1PMLA 1DY8A 2FPZA 2ZO3H 2LL4M 2VH0A 3FAOA 3SNEA 5A0AE 4MNWA 3HATH 1C2JA 1C5MD 4MPUA 4NZQA 3A88A 3EA8A 4Z0FA 3A8DA 2PF2A 1GI5A 4LZ1H 1TNKA 3U8TH 3VB7A 1SFQB 5GXPA 5ESTE 3ENSB 1K9OE 1JWTA 2QCYA 1P2JA 2J8LA 2BLWA 2ZGHA 4BTTB 3A8BA 5EQRA 1ZSLA 2QA9E 4A1XA 1A1RA 4ZHAA 1AB9B 3TJOA 2PKSC 2R9PA 1VZQH 1BJVA 3L33A 3TGJE 1F5RA 2OTVA 3MNCA 1EKBB 3TH4H 5F03A 2UWOA 1FV9A 3UUZA 1LKAA 1OKXA 1Q31A 1SGTA 1O3OA 3U69H 4CBOA 3GDVA 1QB6A 2ZEBA 4MG3A 3P6ZB 3ZV9A 1G3CA 1BMAA 4ZHLU 1K28D 1V2QT 1H9LB 2FYQA 3ZZ8A 2GCTC 2NU3E 4WMEA 1LHGH 1YPHE 4RN6A 3HK6B 4GLYA 1AIXH 1GMCG 4UFEH 4VGCB 1TMBH 1GMNA 1K21H 1P8VC 2O9QA 3SHAH 2PSYA 3V3MA 2BD4A 1L4DA 2NU4E 4IN2A 7GCHF 4KTSA 3TVJB 3A80A 1GBFA 1OYTH 1ZRBA 2VIDA 2HPPP 2BY9X 2D8WA 3SV7A 4MDSA 1GCTC 1NFYA 4JYVH 2C90B 1O3HA 3O8BA 3RXUA 1OWIA 1PYTD 1CA0B 1LTOA 3P8FA 1SFIA 4WXVA 3MO3A 1K1IA 1KIGH 1QNJA 3U8RH 4DY7B 2WPHS 1CVWH 3MKPA 1AKSB 5IDKA 1ARCA 3TLOA 2HWLB 3QN7A 4H6TA 1WU1A 2PLXA 2UUFB 3SUDA 4FVBA 3SUEA 3RXDA 1O0DH 2Z3EA 1O2VA 2CV3A 5TJXA 2BTCE 4U2WA 1J17T 1ELBA 2TGDA 5C1UA 2R2MB 3UWJH 1C4V2 2PHBA 1P0SH 3PO1B 1ACBE 4TWYA 1NU7B 1A46H 2NU1E 4YT7H 1CEAA 2VINA 1FIZA 1O2MA 4JK5A 4WJG2 2V0BA 2SNVA 3F68H 4UE7H 3SU4A 2B5TB 2AMDA 5L2ZH 1GDQA 2JKHA 1BRAA 2A7HA 2A2QH 2QXJA 4MNXA 2GZ9A 6CHAB 4BVWA 3MU0A 1EXFA 1O5BB 3T5FH 2YOLA 5JB9S 5FCKA 1RFNA 1BMMH 6GCHG 1OWKA 1O3DA 4DJZB 4NA7A 1CT0E 3QK1A 3LDXH 4R1CA 4OS5A 2G4UA 2Z6BD 4YZUA 3RXQA 2ODYB 3QZRA 1PQ8A 3GCHB 1WTGH 1C2IA 1KLJH 3E1XB 2ZFQH 1P3CA 2C4FH 1SGPE 4KIVA 3RXKA 2V35A 3A89A 1E36B 5AFYH 2ZFSA 3H7OA 1IAUA 4XBBA 1B7XB 1GBJA 2Y80A 3TPIZ 3ZVDA 3MU1A 1TGTA 3E90B 1CT2E 1YXEA 4CHAB 3BV9B 3S69A 2GP9B 1QJ6B 1Y3XA 4XBCA 1HAZB 3RU4T 4YOIA 1C5NH 1QY6A 3RXIA 1DE7H 1Q2WA 2TGAA 2XW9A 1ZMJA 5JBAS 2ZQ2A 2RCEA 1QBOA 3GY2A 1THRH 2SGDE 2ZWLH 3HKIB 4NSVA 1UTJA 4J2YB 1A0HA 2AGGX 3TH3H 1SGFA 1J16A 4DURA 2HGFA 2ULLA 4DT7B 1B2IA 3KCGH 3GY7A 1O3AA 2ZG0H 1UVPA 3AW1A 4ZXXH 2O8LA 4FUDA 1SVPA 2TBSA 3A86A 3M61U 2FI4E 2XC5A 2PGBB 4KGAA 1J8AA 4AGKA 1J9CH 1VCWA 1CHOF 3U98H 1NRPH 4WXIA 4JYUH 5DGJA 2VVCA 4XFQA 3E0PB 5L2YH 1CQQA 4ISNA 1AGJA 3NXPA 4ABHA 1FQ3A 3Q00A 4U01A 3UOUA 4ABGA 2A7CA 1FY3A 1O2PA 1O2KA 4KKDA 3W94A 2F9OA 1N6YA 1DM4B 1NY22 2BDYA 4YT6H 4FUHA 1GCDA 1BQYA 1MD8A 3BG8A 2BMGB 4AB8A 3LPRA 1PQ7A 7GCHG 4SGAE 2OP9A 1AD8H 5DP7A 1GHZA 1O2NA 5EG4A 8KME2 4Y7AA 2G55A 1DOJA 2SGAA 1O3CA 1O5CB 2ZU5A 3TH2H 1THSH 1O5AB 5FXLA 1TMUH 2O8WA 2K13X 5HM2A 1HB0B 4ZAEA 3DD2H 3MOCA 2WYJA 1RD3B 1ZR0A 2AFQB 5HMAA 1O2XA 4YM9A 2J94A 2OCVB 2ZFFH 1FY4A 3Q76A 2Q6FA 4FUGA 1HAYB 3AAVA 1PPBH 2Z8WA 2GV6A 3UWIA 1VCPA 1TX6A 5F8ZA 4IC6A 4JZ1A 2ODQA 2IPHA 4LXBH 2G5NA 1GVLA 1Z1JA 3VB4A 2ZC9H 5FPYA 2FEBA 3BN9A 2J34A 1LKBA 1MCTA 4TWWA 3RXPA 1GBMA 5DP9A 1KDQA 4ABAA 4AX9H 3SGBE 2P3UB 1GWAA 3UOPA 2WPKS 2XCNA 2BQWB 2Z9KA 1TGBA 1NT1A 4RSPA 1K1NA 5ESBA 4FUBA 1EJMA 1OP0A 1ZGVA 5EPYA 1JRTA 4MNVA 3MNSA 1CGIE 4Y6DA 2RA0A 1TLDA 1O2TA 5HM9A 1W13U 2WINI 2AERH 3HMSA 3TITA 1C2KA 2XXLA 3RC5A 2GGVB 1B0FA 3BTWE 3BT2A 1HAVB 1TNLA 3U9AH 1GHYH 1S6HA 1Q3XA 2CHAC 1O2ZA 1BHTA 1TNGA 3RXJA 1UO6A 5EOKA 4DOQA 1XUJA 3ZZ3A 1O38A 1EZUC 3GY3A 2WPIS 1GGDC 5ETXA 2TRMA 4X0WU 1FAXA 3KQEA 1CA8B 2ZECA 4INHA 2PKSB 1EASA 3M36A 5EXLA 3SW2B 1G36A 1N6XA 4FU9A 1C5YB 3RXFA 1E0FD 3MNXA 1GBKA 2BLQA 2Y7ZA 3VFEA 3GY8A 4UAOA 5IYTA 4BAKB 2A31A 2G5VA 3FFGA 3LJJA 7KMEH 3M7QA 2A0QB 5E8EH 2SPTA 3HGPA 1EJAA 1S84A 1UTPA 3BEUA 4IN1A 2YILA 1HKYA 4HTCH 2QN5T 4H6SB 3M5LA 1O3BA 1TONA 2BOHB 3RXSA 1BTZA 2Q1JA 1SQTA 4X1SU 1G3EA 5DP4A 1BTWA 2D26C 1P3EA 5EPNA 3MHWU 1GMOA 4FU7A 1MQ5A 1GCTB 2Y81A 2WV5A 2VIQA 1AHTH 1NU9A 1P10A 2PFEA 1C5ZB 1QHRB 3GDSA 4IBLH 2BDIA 1C2FA 1CE5A 1CHOG 1HPKA 2ZPRA 2ZCHP 3LGWA 3LGVA 3ESTA 3KQDA 1O2JA 3UFAA 3K6ZA 2O8UA 5A0BA 1BRBE 3BTEE 4NG9H 3FP6E 1MTSA 1A0JA 1H4WA 3V0XA 1BTHH 4JCNA 3GY4A 3TNSA 1O2SA 4X2VA 2W26A 1AU8A 4I8KA 2OC8A 5AVDA 2FOAA 1KXDA 1P06A 4CREA 4Z0DA 1BCUH 1HV7A 2F83A 2QGRA 5CP9A 1YKTA 1ELEE 2BVRH 3NUMA 2IN2A 2RG3A 5TCAA 4ABBA 3DT0H 4ZKNU 5JBTA 1KXFA 2GDEH 3UQVA 3PYHA 1Z8JB 4ABDA 1C5PA 5DPAA 4FU8A 3QTOH 1D3DB 2Q6GA 1BA8B 1JRSA 3I29A 2STBE 1H1BA 1GJ8B 1ZGIA 1C1OA 2BXUH 1MCVA 1S82A 1WUNH 3DA9B 2JH0D 3MTYA 1ZMLA 2VIOA 4X1NU 3STIA 4BAOB 3SU5A 3UR6A 1TFXA 1KXAA 3F9FA 3NWUA 4PROA 3U1IB 1EAXA 1W14U 3RXOA 1W12U 1T8NA 1GBBA 5FHTA 4BVVA 2ZTZA 4K69A 1BHXB 1T4VH 1FXYA 4DCDA 4CRCA 1O3JA 1MUEB 1NRNH 1O36A 4GSOA 1EZSC 3RXGA 1EX3A 1TAWA 1AKSA 3EGKH 3SI3H 4X8VH 1SSXA 4BXSA 2VWOA 2ZU4A 1A7SA 1WBGB 3ODFA 2ZDKA 2NU0E 1MMJN 2FP7B 1MZAA 2J92A 3LH1A 1I5KA 1GMHG 5E2OA 3OY5U 1NFUA 2KJ4A 3M7TA 4RKOB 1T8LA 1KDQB 1LCYA 2YNBA 3E6PL 3EDXB 1Y5BT 5A2MH 1A5HA 2F9PA 4Y0ZE 1BTYA 2OC0A 3SJ9A 1EUFA 1ABIH 3KGPA 3RMOH 2K1QA 5I25A 1RJXB 1BHXF 2ZU3A 2VU8E 1QFKH 2W3IA 1YM0A 4MVNA 1P2OA 1BOQA 4M7GA 1BRCE 1ANBA 3RC6A 2GZ7A 3RLYH 2UWLA 4XSKU 1E37B 3GDUA 3NKKA 1CEBA 2BQ7B 4Y7BA 1EZQA 3BF6H 3LC5A 1Y8TA 2ANWA 1DSUA 5LH8A 1GL1A 4Y8ZA 3TGIE 3PLPA 4F4OC 3RXRA 4BANB 1OXGA 3L6PA 3RXVA 4NFEA 4O9VA 3ITIA 1OWDA 5FPSA 1B5GH 1EB2A 1WYKA 2V3HH 1GBHA 1RGQA 5AFZH 1ZPZA 1UK4A 1TX8A 1PPCE 3RDZA 4DW2U 2IJOB 1Z71A 3TU7H 1QTFA 4BOHA 4X2XA 1SLUB 1HBTH 1O2OA 1FLEE 2BZ6H 1YYY1 2FXRA 4A7IB 3M5OA 3K65B 1UVUH 1LHFH 1MKXH 3SOSA 4D9QA 1Y3UA 2Z9JA 1ELGA 4R19A 3RC4A 2ZIQH 5A8XA 4KP0A 5COEA 2W7UA 1FONA 4NSYA 2LPRA 2M5TA 2XBYA 3RXLA 4FUIA 2DOHX 1SGCA 3ZVEA 3UIRA 3UNSA 2PF1A 5T6FA 1N8OB 3CP7A 4JYTA 2F9VA 2SGFE 5JYIA 1PPFE 5JB8S 1MAXA 4ZROA 2FOGA 1GI2A 4X6MA 1F2SE 3FZZA 3RXBA 3ZZ9A 1SQAA 1EZXC 4FUFA 3RXTA 3SO3A 4AG2A 2HALA 1V2RT 2HNTC 2CHAB 1TPOA 3QX5H 5FX5A 1BTXA 1VR1H 1AUTC 3RP2A 1C5RA 1D3TB 4R1AA 4OGYA 1K1LA 1PPZA 2ANMH 3URDA 1C5WB 5F8XA 1KLIH 1GGDB 1QURH 2ZI2H 1O2GH 1SGFG 1HJ9A 1FNIA 1W2KH 2XNIA 1PPHE 1MKWK 1T8OA 2ZA5A 1VITF 2SGEE 3TIUA 3MMGA 1ELVA 1OWJA 2BVSH 4R0IA 4OS6A 1EPTC 2Y5FA 2ZHDA 1ZHPA 4I8GA 1F0SA 4LZ4B 2R3YA 3K2UA 1IQHA 5C1XA 2A2XH 2XYAA 1QB9A 1ZHMA 2CXVA 4GAWA 1UVSH 1HCGA 1AWHB 4AYVB 1C5VA 3M7UA 3TJNA 3UTUH 1UHBB 2QF0A 2VWMA 3WY8A 4Z09A 1NC6A 4AYYB 2RA3A 3SN8A 2Q8AA 2BDBA 3IITA 1MH0A 2EEKA 5C1YA 4ISOA 1O2QA 2AIPA 3FP7E 4ZUHA 1YCPH 2L0SA 4NZLA 4DG4A 2FLRH 1HJ8A 2ZP0H 1JBUH 3EYDA 1I71A 4I33A 3O8CA 2EI7A 1HAVA 1KTSB 1BTPA 1W11U 1SMFE 1J15A 2Y8RA 4ZHMU 4BV7A 2GCHF 4CRAA 5LGOA 1UCYE 1ZTLA 2Z9IA 1TABE 1Z40A 1GPZA 1D6RA 2AGEX 2BD7A 3BIUH 1IQGA 3BTGE 2PV9B 2VVUA 4Q7ZA 3ZZAA 4WVPE 1TOCB 1LVBA 1TX7A 2BXTH 1ZRKA 1C1WH 4DVAU 1QGFA 3D65E 1ID5H 2QV1A 3AW0A 4A5TS 1QQUA 1QIXB 1O32A 4X1RU 4Y8XA 1WQSA 1LDTT 3P95A 1ELAA 3RXCA 1AO5A 1GG6C 1HJAC 2XCFA 1IQMA 1GJ6A 1O3MA 3ZZDA 3R0FA 1ANDA 2G52A 5JPMH 1DVAH 4OS4A 2PWXA 3P8OA 3LGUA 1C1UH 3LU9B 1Y3YA 3VGCC 1O2RA 1W81A 3VB6A 1GI7B 1N1LA 2J2UA 5GWZA 2BDGA 1SQOA 1BBRE 2TPIZ 2Z7FE 1TE0A 4NCYA 1C1MA 1GI9B 3STJA 4CRBA 1AI8H 2XWBI 2G8TA 5FBEA 1AFQC 3MWIU 1KXBA 1O5EH 4Q80A 2BY7X 5FBIA 2ZGJA 2F91A 4JZFH 1YGCH 3BSQA 3OTJE 3PB1E 3SU0A 1IHTH 5J4SA 2QJ4A 1ELFA 1DY9A 3T29A 1WSSH 1O3GA 5C67A 1ZHRA 3Q3YA 2J9NA 1GI1A 4NIWA 2JETB 3KIDU 1YPMH 3CS0A 3PLBA 4Q2KA 2FI5E 1FN6A 3HPTB 1TBRH 4BNRA 1AVXA 1FJSA 1O3NA 4NGAH 1DXPA 3GYLB 1K2I1 4HGCA 1WTHD 1ZZZA 5FCRA 2I9BA 1GDUA 3P17H 1HPJA 4D7FA 2FOMB 3R3GB 1C1QA 3P70B 3O8DA 4YLQH 1C5UA 1T7CA 5H4IB 2Q8BA 1QJ7B 3B23B 1B0EA 2GT8A 1HGTH 1VCQA 3T2NA 2AIQA 2GDDA 3AASA 1YPGH 4NA8A 2PGQB 3CS7A 1DUAA 4CH2B 1SGIB 1WV7H 2BY5X 1FN8A 1VITG 1C5XB 1PQAA 3M3SA 1RTKA 5DJ7A 1TQ7B 5DP6A 1C4Y2 1TBQH 1SOTA 2A5IA 3ZVAA 3T26A 1P2IA 3ATWA 3M3VA 2XBWA 2FLBH 2FD6A 1UCYK 1XUFA 2ZDNA 3M35A 1NRRH 1G32B 5EXMA 1WQVH 2QF3A 1A3BH 2C3SA 1EATA 1C2HA 1TA2A 1SGRE 2W5EA 1AWFH 1EAUA 1JIMA 1TA6A 1KLTA 2W3KA 5DK1A 4BAMB 1C5QA 1FY8E 1GJAB 1GDNA 1XKAC 1VGCC 1LQEA 2VNTA 3PMBB 3UR9A 3SORA 4DIIH 3MNBA 4OS1A 1PFXC 1DICA 1K1MA 2A1DB 2BLVA 2Q6DA 1W8KA 1YPJH 3QUMP 1Z6JH 4B2BA 1NK1A 2WPMS 2GCHG 5CS3A 4E05H 3M3TA 1C5SA 1GBDA 1QRZA 1TB6H 2ALVA 4YESB 1XKBC 1FY1A 1BBRK 1Z8GA 2OC1A 4BXWA 3ATKA 2FEQH 3E3TA 3MO6A 1F92A 5DKMA 2G4TA 3RXAA 4ISIH 2F9BH 2KAIA 3ZVBA 3ZZCA 4ZKOU 5ABWA 1IQJA 1PPEE 1T8MA 3P8GA 1N8OC 3QGJA 1UK3A 5T6GA 3GCOA 1D3PB 4CH8B 4IC5A 1EJNA 1DLKB 1E38B 4A1VA 4HFPB 1KY9A 1GHXH 3UNQA 1MTNC 5EODA 1T32A 1C2GA 5EGMA 4WF8A 1PPGE 1F5KU 1TPSA 1NROH 4INLA 2C8XB 1GP9A 4SGBE 3SP8A 2AGIX 4I8JA 1TGSZ 3BEFB 3TGKE 4B2AA 3T27A 4GCHF 3SV8A 1OYQA 4CRGA 3UREA 3S0NA 5CSQA 1NL1A 4ZMAH 4WH6A 1FDPA 1ESTA 3NPSA 4UFGH 3SNCA 1RRKA 1A4WH 3M5NA 1C2EA 1HXFH 3TJUA 1EPTB 5EU8A 2P59A 3ZYDA 4CIKA 1NFWA 1O3LA 2TIOA 1C1SA 3SV2H 1IHSH 4Q7XA 4NIVA 2H9TH 1A3EH 2AS9A 3K65A 2WUBA 3MH6A 3PTBA 1TOMH 4AFUA 2JH6D 4R8TB 3RXHA 1GBIA 2P93A 1K1PA 1A5GH 1O33A 2O8TA 1ANEA 4O03A 1AZ8A 2AYWA 5HYOA 2BD9A 1XUHA 1O34A 3EAJA 5E0HA 2QJ2A 3LAQA 1HAPH 1YPKH 2BYAX 3F6UH 1P9SA 2P95A 4NWKA 2PKAB 1GHVH 4AG1A 1DWCH 2OBOA 1OWEA 1NESE 1SHYA 2AEIH 3RMMH 1P04A 3ODDA 3URCA 2G81E 4X1QU 2FIRH 1M9UA 1MBMA 4X6PA 2ASUB 2H9HA 3F9EA 1T31A 2CGAA 3CENA 2FODA 5JBBS 4I7YH 3KQCA 3S7KB 1DFPA 2G51A 2R3UA 4K60A 1NL2A 5A09A 1Y3WA 1LVOA 1C5TA 3VB3A 2BVXH 2CF9H 2BHGA 2H1UA 1IQKA 3QDZB 5HPGA 4I32A 4O3UA 3S9CA 5CE1A 2Y5HA 2EI6A 2BD2A 3DHKH 3ZWZA 3DFLA 4AN7A 3SGQE 3PM3A 3EA7A 1MTVA 1XVOA 3ZZ6A 2PSXA 1GG6B 1HJAB 3RU4E 1P2NA 5BPEA 3S7HB 1E34B 4J1YA 4BAHB 2ILNA 1GL0E 3T25A 1FMGA 4B74A 1OS8A 1TRYA 3UPEA 1LO6A 3VGCB 1TPKA 1P12E 2UUJB 2DE9A 2J8JA 1GBTA 3PMHB 4UV6A 1ZTKA 1MAYA 1UHBA 4IGDA 2ALPA 1P2QA 3D23A 3PMJA 4AORA 3B9FH 2C93B 3KF2A 3A7VA 1AFQB 5FAHA 2KNFA 4UEHH 1GI8B 1Z7KA 4I8HA 4KTCA 1V6DA 3QLPH 1TNJA 2A4QA 3PROA 1V3XA 4D8NA 2ZFPH 2B9LA 1OWHA 4YOGA 1BJUA 1CSOE 3C27B 1JFNA 2STAE 8ESTE 1RIWC 4AOQA 3GCTF 2JETC 4GUXA 3NK8A 1AUJA 1QL9A 4Y8YA 3SV6A 3U8OH 3TJVA 2Y5GA 4GCHG 1GBEA 2PUQH 1QL7A 2OC7A 3BTTE 4K2YA 3MU5A 1BB0B 1HYLA 3K6YA 2VVVA 1ZMNA 3SUFA 4YOJA 4JZIA 2PTNA 1QCPA 1A2CH 1MKXK 1ORFA 3LIWA 1Y59T 1RXPA 1YP9A 2KAIB 3RXEA 2YIPA 2J95A 3SQHE 1THPB 2XRCA 4Z0KA 5C5OA 1ZJDA 4Y10E 1G3BA 5CMXH 1RTLA 1SG8B 1EP5A 1PK2A 3GYMA 3JZ2B 1NTPA 1S5SA 2ZU2A 3LH3A 1ZJKA 3D62A 1FPCH 4THNH 2A7JA 1QL8A 1L0ZA 2DE8A 2ZNKH 2P3FH 4FUEA 1W7GH 1HPGA 4U30A 1L2EA 1SHHB 5CT2A 1BMNH 1UVOA 1NFXA 1SGEE 2FM2A 2Z8VA 1Z8IB 2B0FA 2FOEA 4KELA 5EW2H 2VJ1A 3EQ0H 2HRVA 5EQSA 5T6DA 1FI8A 1JIRA 1SC8U 2HOBA 4K3JA 4Y11E 2AMQA 1HAIH 2ZGXH 2ZKSA 5DP3A 1SLXB 2QY0B 2C8ZB 1DWBH 1S0RA 3FP8E 1I8NA 4A1TA 1QJ1B 1SGQE 1BTUA 1GJBB 2PTCE 3GICB 1V2LT 3SJIA 1VGCB 2BM2A 6LPRA 2RDLA 2SFAA 1WOFA 1DS2E 5F6MA 3N7OA 3E16B 3HKJB 5CS9A 1IQFA 1YPHC 2GTBA 1XUGA 3LGTA 1O3IA 4AGJA
chains in the Genus database with same CATH superfamily
3SU1A 3BT1A 3L3TA 2R2WU 3KEEA 3BTFE 3PV4A 1QA0A 2W7SA 3M5MA 3F9GA 4ASHA 2DOIA 2ZFTA 3BG4C 2H2ZA 1LVYA 1LPKB 1S85A 2ZFRH 5GIBA 1GVZA 1G30B 1YPLH 4APLA 1F7ZA 1IQIA 1GJ7B 3TK6A 5PTPA 4B71A 4YLUA 2GJGA 4BV5A 1WXRA 4ZXYH 1HIAB 4F49A 1PKRA 1MU8B 2C8YB 1QZ8A 4Q4LA 4CBNA 1TMTH 2WPJS 1MTNB 1GI6A 2H6MA 4WWYA 1XMNB 3RM0H 4UFFH 1YCPK 2VGCC 3FVFB 1UTQA 3GCNA 2YMSB 1TQ0B 3LONA 3MH7A 2FS9A 1KSNA 4NA9H 2D1JA 5GCHF 2Z94A 2HPQP 2QC2A 1P03A 1GI0A 1XVMA 1O39A 1UTMA 1O3KA 1BITA 1EOJA 2UUYA 4E7RG 2BDHA 1V2WT 1TNIA 3SJKA 1DLEA 2KX4A 2WUCA 1C2DA 1YLDA 2QXGA 5GDSH 3OU0A 1SR5C 2KCYA 3G01A 4NFFA 3AK5A 4TPIZ 1SB1H 4FETA 3NZIA 3SRJA 3O8RA 1O5FH 2VB0A 5SGAE 1ETSH 1S0QA 4WMDA 1W8BH 4OS7A 1MQ6A 5DP8A 3LGIA 5DO4H 3KN2A 3KHVA 1EQ9A 3KYFA 3A8CA 3T62A 2QIQA 3GCTG 1S81A 1C9PA 2VWNA 4K8YA 3U1JB 2ZTYA 5LPFA 3SJOA 5CT3A 1EAIA 1TPAE 2AMPA 2F3CE 4XE4A 3FN8A 4B1TA 5HKKD 1KXCA 2ZDMA 1SI5H 1O2LA 1ZPCA 1C1PA 1D3QB 1GJ4H 3A7TA 2FMJA 3SZEA 1V2MT 3I78A 1Y3VA 3MFJA 2LNCA 4O3TA 1HRTH 2BD5A 4INKA 2A4OA 3RUOA 2XC4A 2HGTH 1AZZA 4K8BA 4Y71A 3RLWH 2OQUA 3KNXA 1DANH 2ZPQA 3SNAA 1URKA 3A85A 1GI4A 2OBQA 5L30H 2BB4A 1QBNA 1OSSA 2GVFA 3IG6B 1CT4E 3GY6A 5G4BA 1QRWA 5DG6A 3BTHE 1MABB 3IWMA 1KDUA 1HAXB 1X7AC 1E79D 3A83A 1DWEH 4YXWD 2P8OC 5EIYA 2H9EH 5BRRE 1OP8A 3V12A 5A0CA 1C1RA 1MU6B 1P2MA 1PYTC 1ELTA 1GJDB 1G2LA 3PWCA 3EE0B 3SI4H 1P05A 4UFDH 1H8IH 2Y6TA 3DFJA 2GMTC 4JZDH 1FY5A 4MPWA 2HNTE 2XBVA 3ATIA 1TIOA 3GY5A 3A7XA 2C8WB 4E06H 3A8AA 1VJAU 2G00A 1NS3A 4UD9H 1E35B 3TK9A 1EPTA 1TRMA 2ZDAH 1O2IA 2F9UA 1P2KA 3FANA 1MKWH 2FI3E 2XNDD 2XBXA 1QQ4A 4BVCA 1GMDF 1C9TA 3A7YA 2GT7A 4IUAA 1COWD 1LPGB 4X8TH 3FZDA 2FESH 2KCPA 1O3FA 3PMAB 1H9IE 2PUXB 3SU2A 2WV9A 4Q7YA 3A84A 2FTLE 1SBWA 3QZQA 1UJ1A 4NIXA 2ZCLP 1UK2A 4MQAA 4B6EA 1BIOA 1O3PB 4IW4E 2HLDD 4D76A 3H5CB 2A5KA 3F9HA 2Z9GA 2B7DH 4I31A 1F0RA 2PKAA 5C3NA 1MTWA 1TALA 3OX7U 3ZV8A 4OS2A 1O30A 1SPJA 2FS8A 4AZ2B 1Z1IA 1RIWB 4AFSA 1P11E 3KIVA 2A4GA 5LPEA 2ZHQH 1K22H 9LPRA 4MLFB 3OEHD 2V6NA 3KL6A 1TGCA 3F1SB 1SGDE 5GCHG 1GHWH 3PWBA 2WV4A 4TPYA 1JXPA 1O5DH 1S83A 1LQDB 1V2OT 1XXFA 3MO9A 1UVTH 3ZLEA 1HAGE 3PLKA 1A61H 1SL3A 1O2HA 2XTTB 4DGJA 1TRNA 5T3HA 3VEQB 3UNRA 1OX1A 3I77A 3ZZ5A 4ISLA 2A32A 4QT8C 1GHBF 4UDWH 2I6SA 4X6NA 5C2ZA 2FO9A 2A5AA 4R1BA 3SV9A 3SRIA 4B75A 2BOKA 2VBCA 5FX6A 5HIZA 3SNBA 1ARBA 2BX4A 4Y0YE 2K51A 2QAAA 5C5NA 1G9IE 1W3CA 3OSYA 4O97A 9ESTA 1K1JA 4CRFA 5E0JA 2OLGA 2ZQ1A 1F0TA 4K1SA 3ZZ7A 2X2ZA 2ZF0H 4GPGA 3QTVH 2A4RA 2SNWA 2R0KA 1MD7A 4ESTE 2JJ2D 2XOKD 3UQOA 1CBWC 1TYNA 1YF4A 5CHAC 3MYWA 2TGTA 1BMLA 2OINA 5AF9H 4FXGH 1O2WA 1IQLA 1HAHH 4APMA 1QB1A 3KQBA 1FAKH 1LPZB 1WCZA 4BTUB 1ESBA 1Y5UT 2JH5D 1ZLRA 1EOLA 4Z0EA 3SBKA 2V3OH 7LPRA 1A0LA 4A6LA 1SLWB 3LOXA 4ABJA 2BD3A 1SGYE 1AE8H 3E6PH 1CGJE 2R0LA 2GX4A 2ZGCA 3ATMA 5E0GA 5GJ4B 4D9RA 1BRUP 3QO6A 5I46H 3T28A 4UONA 1FIWA 1V2JT 2VIVA 5GPIB 1O37A 2OUAA 4ABIA 2FZZA 2O8MA 3ZIAD 3MH5A 3MU4A 3BG4B 4MNYA 2AHME 4X8SH 1V2ST 3SJ8A 3ZVFA 2PW8H 4E7NA 1NM6A 4LOYH 2ZPSA 5TCCA 1UTOA 2FYRA 3WWBA 1GJCB 4JZEH 3LGYA 1CGHA 1HLTH 1QRXA 2RDEA 1NO9H 3M37A 1JMOH 2FX6A 2TGPZ 4AB9A 4AFZA 3PRDA 4JMYA 1GJ5H 1C5LH 1XUIA 1AVWA 3S9BA 1CHGA 5F8TA 1GMDG 2VGCB 2SGQE 2W6JD 1XM1A 2EI8A 4OGXA 2QF5A 1V2KT 1P9UA 2Y7XA 1K1OA 2YMSD 1HAOH 4GHQA 2FOHA 1RTFB 1W10U 3ZVCA 1MTUA 1U6QA 4CR9A 2VH6A 3SNDA 1KTTB 1UCYH 1ZPBA 4A92A 2ODPA 1GBAA 1MBQA 4DT4A 1BUIA 5K7RA 1GHAF 2GZ8A 4U32A 3A7ZA 3RU4D 4RKJB 4BTIB 1ABJH 4TY6A 2BD8A 2J38A 3AAUA 2J4IA 2BDCA 1GMHF 4IS5A 3VXEH 3OYPA 3ZZBA 4B2CA 1XXDA 2ZGBH 4XOJA 5JDUB 1EFRD 1AB9C 5FPTA 4DIHH 1LHEH 1ETTH 4RT0A 3VB5A 4WH8A 1G37A 4HI3A 1KRNA 1DWDH 2HNTF 2H5DA 2ZHFH 1C4U2 4FVDA 1OOKB 1L1JA 2ESTE 4X1PU 1NRQH 3BTQE 1ZYOA 1L4ZA 4ISHH 3LT3A 4X2WA 2GCTB 4JK6A 3A7WA 5LPRA 1BT7A 3TK5A 1DT2A 4VGCC 7ESTE 1H8DH 1Y5AT 1BBRH 3NRLA 3Q77A 2FOBA 2CMYA 1NN6A 3MU8A 1GI3A 1KYNA 2QXIA 1GHBG 2I9AA 1HIAA 2ANKH 3S9AA 1T4UH 2F9NA 1ESAA 1H8HD 1HFDA 1PQ5A 2FOCA 2HPQH 2P8OB 1UTLM 5E2PA 5CDFE 1IQNA 1Z6EA 3SU3A 3HMRA 1NZQH 1W0JD 2H5CA 1EB1H 3EA9A 3PV2A 2VIPA 1YLCA 2D2DA 2AH4X 2ZTXA 1BMFD 1D9IA 4MPVA 1D6WA 3SHCH 5DP5A 1CA0C 8GCHF 5EXNA 2P94A 4MPXA 5AHGH 2GMTB 3D49H 2NU2E 2WSSD 1C2LA 2P3TB 3C1KA 1ANCA 4YO9A 1GBCA 1C1VH 1PK4A 2Z3CA 1O3EA 1ZSKA 2Z3DA 4K5ZA 5FL7D 5L6NH 1QR3E 1AFEH 1QA7A 1W0ZU 2P16A 3HMTA 1A0HB 1D4PB 1LHCH 4CR5A 5K0HA 1V2PT 1ETRH 1OHHD 3Q3KA 4K1EA 5CS5A 1FZZA 2YIOA 4X6OA 1TBZH 1S6FA 4MTBA 1KI0A 1G2MA 2ZHWH 4ZH8A 3PO1C 2FX4A 2I6QA 1MZDA 4X8UH 3Q3XA 1TNHA 2IOTA 1O2YA 1KXEA 3ATLA 4TY7A 5KEDA 3P92A 1CO7E 3E8LA 4B73A 1INCA 1LHDH 2ZHEH 4YIZA 1BDAA 4X2YA 1HDTH 4BAQB 4YTAA 1QBVH 6CHAC 4I8LA 3ZZ4A 3F2GA 2ZDVH 3QWCH 1FPHH 1FUJA 4ZKRU 2DUCA 2CJIA 1P02A 1C2MA 2PR3A 1XX9A 3RXMA 4XDEA 5GNDA 4Z6AH 3K9XB 3TNTA 2NWNA 4AFQA 2HPPH 1V2VT 2QE7D 3SGAE 1C5OH 3LJOA 1P09A 2VWLA 3HK3B 2LL3A 1HUTH 3GCHC 1O31A 3NCLA 4B76A 1WAYB 1PMKA 4Y76A 4NWLA 5B6OA 1GJ9B 1KIVA 2BY8X 1GBLA 3PV5A 3JZ1B 1AQ7A 1AN1E 1EP6A 2XC0A 1OPHB 4CHAC 2FTMA 2GV7A 2ZDLA 2SGPE 2QXHA 2BX3A 1H9HE 5HXFA 1UTNA 2BY6X 4ABEA 5EQQA 1DITH 2OXSA 1V2NT 3SZNA 1W7XH 1DXWA 3U73A 1AMHA 6ESTA 1A5IA 4ABFA 3P8NA 2VIWA 1GMCF 3A87A 3VXFH 1O2UA 4CRDA 1GHAG 5C20A 1TWXB 1AE5A 2BLOA 2ANYA 1ELDE 2OD3B 1E1RD 3PRBA 1J14A 2HVXA 1AVGH 1ZOMA 4LK4A 2BQ6B 2WYGA 3RMNH 2W6ID 3FOAA 1XUKA 1OP2A 2ZU1A 2HLCA 4H4FA 1GVKB 1YBWA 1O35A 4H42U 2GD4B 1DPOA 1HXEH 3B8JA 1DX5M 1W0YH 1EAWA 4GHTA 4TYDA 1SGNE 4WY3A 5A8YA 3V13A 1DDJA 1YPEH 3W1EA 2YNAA 1LVMA 3MI4A 2A45B 1L1GA 2B8OH 3RM2H 1CBWB 1F0UA 5CHAB 3V7TA 3LC3A 4GVUA 3AVZA 3ELAH 1V2TT 1NPMA 2QYIA 5HGGA 1P01A 5CS1A 4HZHA 2BZAA 2UWPA 5EW1H 1BZXE 3VPKA 3MH4A 1P57B 2K4RA 1C1NA 3HN4A 1SOZA 4FUCA 1TPPA 2FWWA 2CF8H 4ZKSU 3PTNA 3SQEE 1Z8RA 2CN0H 3A81A 1YCPM 1TGNA 5A8ZA 2EC9H 4K1TA 1ZTJA 1SLVB 3RMLH 3GS9A 1ELCA 1VJ9U 4F48B 3QGNB 4XBDA 5J4QA 1YC0A 3UY9A 1JOUB 1NRSH 8GCHG 1HNEE 1LMWB 1UMAH 3BIVH 1IQEA 1L1NA 1PJPA 2Y82A 4FUJA 1V2UT 3SU6A 2ZCKP 3BEIB 3OY6U 4BVDA 3GOVB 1RS0A 2WPLS 3FO8D 4NIYA 4YIVA 6GCHF 1F5LA 4WMFA 4XD7D 3GISB 2FDAA 1AY6H 1ZSJA 2THFB 2PK4A 3SUGA 1C1TA 3A82A 3LKWA 4Y79A 2XWAA 8LPRA 4IMZA 2GKVE 3DUXH 4KTUA 1UTKA 1O5GH 2EA3A 3E91A 4D7GA 3BTDE 1DUEA 4IMQA 2KZ4A 3ZVGA 1G3DA 2FOFA 5JBCS 2ZZUH 1CU1A 3ZYEA 2BDAA 2OQ5A 3E0NB 3W95A 3BTME 2Z9LA 4ACBA 3H7TA 5CT1A 1IOEA 3BTKE 1VITH 3HGNA 1DSTA 2UUKB 4D3CA 1PMLA 1DY8A 2FPZA 2ZO3H 2LL4M 2VH0A 3FAOA 3SNEA 5A0AE 4MNWA 3HATH 1C2JA 1C5MD 4MPUA 4NZQA 3A88A 3EA8A 4Z0FA 3A8DA 3F0OA 2PF2A 1GI5A 4LZ1H 1TNKA 3U8TH 3VB7A 1SFQB 5GXPA 5ESTE 3ENSB 1K9OE 1JWTA 2QCYA 2IJD1 1P2JA 2J8LA 2BLWA 2ZGHA 2K8IA 4BTTB 3A8BA 5EQRA 1ZSLA 2QA9E 4A1XA 1A1RA 1H8ED 1AB9B 4ZHAA 3TJOA 2PKSC 2R9PA 1VZQH 4AC9A 1BJVA 3L33A 3TGJE 1F5RA 5C0UA 2OTVA 3MNCA 1EKBB 3TH4H 5F03A 2UWOA 1FV9A 3UUZA 1LKAA 1OKXA 1Q31A 1SGTA 1O3OA 3U69H 4CBOA 3GDVA 5F53A 1QB6A 2ZEBA 2J97A 4MG3A 3P6ZB 3ZV9A 1G3CA 1BMAA 4ZHLU 1K28D 1V2QT 1H9LB 2FYQA 3ZZ8A 2EY4C 2GCTC 2NU3E 4WMEA 1LHGH 1YPHE 4RN6A 2JDID 3HK6B 4GLYA 1AIXH 1GMCG 2WZQA 4UFEH 4VGCB 1TMBH 1GMNA 1K21H 1P8VC 2O9QA 3SHAH 2PSYA 3V3MA 1E1QD 3SYJA 2BD4A 1L4DA 2NU4E 4IN2A 7GCHF 4KTSA 3TVJB 1NBMD 4P02A 3A80A 1GBFA 1OYTH 1ZRBA 2VIDA 2HPPP 2BY9X 1VKYA 2D8WA 3SV7A 4MDSA 1GCTC 1NFYA 4JYVH 2C90B 1O3HA 2CK3D 3O8BA 3RXUA 1OWIA 1PYTD 1CA0B 1LTOA 3P8FA 1SFIA 4WXVA 3MO3A 1K1IA 1KIGH 1QNJA 3U8RH 4DY7B 2WPHS 1CVWH 3MKPA 1AKSB 5IDKA 1ARCA 3TLOA 5EJ1A 2HWLB 2J98B 3QN7A 4H6TA 1WU1A 2PLXA 2UUFB 1FX0B 3SUDA 4FVBA 3SUEA 3RXDA 1O0DH 4F55A 2Z3EA 1O2VA 2CV3A 5TJXA 2BTCE 4U2WA 1J17T 1ELBA 2TGDA 3UAIC 5C1UA 2R2MB 3UWJH 1C4V2 2PHBA 1P0SH 3PO1B 1ACBE 4TWYA 1NU7B 1A46H 1YY3A 2NU1E 4YT7H 2VINA 1CEAA 1FIZA 1O2MA 4JK5A 4WJG2 2V0BA 2SNVA 3F68H 4UE7H 3SU4A 4OM9A 2B5TB 3F2FA 2AMDA 5L2ZH 1GDQA 2JKHA 2EQNA 1BRAA 2A7HA 2A2QH 2QXJA 3DCLA 4MNXA 2GZ9A 6CHAB 4BVWA 3MU0A 1EXFA 1O5BB 3T5FH 2YOLA 5JB9S 5FCKA 1RFNA 1BMMH 6GCHG 1OWKA 1O3DA 4DJZB 4NA7A 1CT0E 3QK1A 3LDXH 4R1CA 4OS5A 2G4UA 5EJZA 2Z6BD 4YZUA 3RXQA 2ODYB 3QZRA 1PQ8A 3GCHB 1WTGH 1C2IA 1KLJH 3E1XB 2ZFQH 1P3CA 2C4FH 1SGPE 5DSFA 4KIVA 3RXKA 2V35A 3A89A 1E36B 5AFYH 2ZFSA 3H7OA 1IAUA 4XBBA 1B7XB 1GBJA 2Y80A 3TPIZ 1NBME 3ZVDA 3MU1A 1TGTA 3E90B 1CT2E 1YXEA 4CHAB 3BV9B 3S69A 2GP9B 1QJ6B 1Y3XA 4XBCA 1HAZB 3RU4T 4YOIA 1C5NH 1QY6A 2V3MA 3RXIA 1DE7H 1Q2WA 2TGAA 2XW9A 1ZMJA 5JBAS 1UW7A 2ZQ2A 2RCEA 2M2AA 1QBOA 3GY2A 1THRH 2SGDE 2ZWLH 3HKIB 4NSVA 1UTJA 4J2YB 1A0HA 2AGGX 3TH3H 1SGFA 1J16A 4DURA 2HGFA 2ULLA 4DT7B 1B2IA 3KCGH 3GY7A 4TSFD 1O3AA 2ZG0H 1UVPA 3AW1A 4ZXXH 2O8LA 4FUDA 1SVPA 2TBSA 3A86A 3M61U 2FI4E 2XC5A 2PGBB 4KGAA 1J8AA 1K0HA 4AGKA 1J9CH 1VCWA 1CHOF 3U98H 1NRPH 4WXIA 4JYUH 5DGJA 2VVCA 4XFQA 3E0PB 5L2YH 1CQQA 4ISNA 1AGJA 3NXPA 4ABHA 1FQ3A 3Q00A 4U01A 3UOUA 4ABGA 2A7CA 1FY3A 1O2PA 1O2KA 4KKDA 3W94A 2F9OA 1N6YA 1DM4B 1NY22 2BDYA 4YT6H 4FUHA 1GCDA 1BQYA 1MD8A 3BG8A 2BMGB 4AB8A 3LPRA 1PQ7A 7GCHG 4SGAE 2OP9A 1AD8H 5DP7A 1GHZA 1O2NA 5EG4A 8KME2 4Y7AA 2G55A 1DOJA 2SGAA 2WPDD 1O3CA 1O5CB 2ZU5A 3TH2H 1THSH 1O5AB 5FXLA 1TMUH 2O8WA 2K13X 5HM2A 1HB0B 4ZAEA 2WHXA 3MOCA 3OAAD 3DD2H 2WYJA 1RD3B 1ZR0A 2AFQB 3DSPA 1O2XA 5HMAA 4YM9A 2J94A 2OCVB 2ZFFH 1FY4A 3Q76A 2Q6FA 4FUGA 1HAYB 3AAVA 1PPBH 2Z8WA 2GV6A 3UWIA 1VCPA 1TX6A 5F8ZA 4IC6A 4JZ1A 2ODQA 2IPHA 4LXBH 2G5NA 1GVLA 1Z1JA 3VB4A 2ZC9H 5FPYA 2FEBA 3BN9A 2J34A 1LKBA 1MCTA 4TWWA 3RXPA 1GBMA 5DP9A 1KDQA 4ABAA 4AX9H 3SGBE 2P3UB 1GWAA 3UOPA 2WPKS 2XCNA 2BQWB 2Z9KA 1TGBA 1NT1A 4RSPA 1K1NA 5ESBA 4FUBA 1EJMA 1OP0A 1ZGVA 5EPYA 2K0QA 1JRTA 3MNSA 1CGIE 4MNVA 2RFKC 3F0PA 3F2HA 4Y6DA 2RA0A 1TLDA 1O2TA 5HM9A 1W13U 2WINI 2AERH 3HMSA 3TITA 1C2KA 2XXLA 3RC5A 2GGVB 1B0FA 3BTWE 3BT2A 1HAVB 1TNLA 4TT3D 3U9AH 1GHYH 1S6HA 1Q3XA 2CHAC 1O2ZA 1BHTA 1TNGA 3RXJA 1UO6A 5EOKA 4DOQA 1XUJA 3ZZ3A 1O38A 1EZUC 3GY3A 2WPIS 1GGDC 5ETXA 2TRMA 4X0WU 1FAXA 3KQEA 1CA8B 2ZECA 4INHA 2PKSB 1EASA 3M36A 5EXLA 3SW2B 1G36A 1N6XA 4FU9A 1C5YB 3RXFA 1E0FD 3MNXA 1GBKA 2BLQA 2Y7ZA 3VFEA 3GY8A 4UAOA 5IYTA 4BAKB 2A31A 2G5VA 3WW7A 3FFGA 3LJJA 7KMEH 3M7QA 2A0QB 5E8EH 2SPTA 3HGPA 1EJAA 1S84A 1UTPA 3BEUA 4IN1A 2YILA 1HKYA 4HTCH 2QN5T 4H6SB 3M5LA 1O3BA 1TONA 2BOHB 3RXSA 1BTZA 2Q1JA 1SQTA 4X1SU 1G3EA 5DP4A 1BTWA 2D26C 5B6LA 1P3EA 5EPNA 3MHWU 1GMOA 4FU7A 1MQ5A 1GCTB 2Y81A 2WV5A 2VIQA 1AHTH 1NU9A 5IK2D 1P10A 2PFEA 1C5ZB 1QHRB 3GDSA 4IBLH 2BDIA 1C2FA 1CE5A 1CHOG 1HPKA 2ZPRA 2ZCHP 3LGWA 3LGVA 3ESTA 2KCOA 3KQDA 1O2JA 3UFAA 3K6ZA 2O8UA 5A0BA 1BRBE 3BTEE 4NG9H 3FP6E 1MTSA 1A0JA 3MQKC 1H4WA 2J5UA 1BTHH 4JCNA 3V0XA 3GY4A 3TNSA 1O2SA 4X2VA 2W26A 1AU8A 4I8KA 2OC8A 5AVDA 2FOAA 1KXDA 1P06A 4CREA 4Z0DA 1BCUH 1HV7A 2F83A 2QGRA 5CP9A 1YKTA 4P00A 1ELEE 2BVRH 3NUMA 2IN2A 2RG3A 5TCAA 4ABBA 3DT0H 4ZKNU 5JBTA 1KXFA 2GDEH 3UQVA 3PYHA 1YWUA 1Z8JB 4ABDA 3EE7A 1C5PA 5DPAA 4FU8A 3QTOH 1D3DB 2Q6GA 1BA8B 1JRSA 3I29A 2STBE 1H1BA 1GJ8B 1ZGIA 1C1OA 2BXUH 1MCVA 1S82A 1WUNH 3DA9B 2JH0D 3MTYA 1ZMLA 2VIOA 2PP6A 4X1NU 3STIA 4BAOB 3SU5A 3UR6A 1TFXA 1KXAA 3F9FA 3NWUA 4PROA 3U1IB 1EAXA 1W14U 3RXOA 1W12U 1T8NA 1GBBA 5FHTA 4BVVA 2ZTZA 4K69A 1BHXB 1T4VH 1FXYA 4DCDA 4CRCA 1O3JA 1MUEB 1NRNH 3WWFA 1O36A 4GSOA 1EZSC 3RXGA 1EX3A 1TAWA 1AKSA 3EGKH 3SI3H 4X8VH 1SSXA 4BXSA 2VWOA 2J98A 2ZU4A 1A7SA 1WBGB 3ODFA 2ZDKA 2NU0E 1MMJN 2FP7B 1MZAA 2J92A 3LH1A 1I5KA 1GMHG 5E2OA 3OY5U 5EJLA 1NFUA 2KJ4A 3M7TA 4RKOB 1T8LA 1KDQB 1LCYA 2YNBA 3E6PL 3EDXB 1Y5BT 5A2MH 1A5HA 2F9PA 4Y0ZE 1BTYA 2OC0A 3SJ9A 1EUFA 1ABIH 3KGPA 3RMOH 2K1QA 5I25A 1RJXB 3OTPA 1BHXF 2ZU3A 2VU8E 1QFKH 3VG8A 2W3IA 1YM0A 4MVNA 1P2OA 1BOQA 4M7GA 1BRCE 1S6LA 1ANBA 3RC6A 2GZ7A 3RLYH 5KECA 2UWLA 4XSKU 1E37B 3GDUA 3NKKA 1CEBA 2BQ7B 4Y7BA 1EZQA 3BF6H 3LC5A 1Y8TA 2ANWA 1DSUA 5LH8A 1GL1A 4Y8ZA 3TGIE 3PLPA 4F4OC 3RXRA 4BANB 1OXGA 3L6PA 4I86A 3RXVA 4NFEA 4O9VA 3ITIA 1OWDA 5FPSA 1B5GH 1EB2A 1WYKA 2V3HH 1GBHA 1RGQA 5AFZH 1ZPZA 1UK4A 1TX8A 1PPCE 3RDZA 4DW2U 2IJOB 1Z71A 3TU7H 1QTFA 4BOHA 4X2XA 1SLUB 1HBTH 1O2OA 1FLEE 2BZ6H 1YYY1 2FXRA 4A7IB 3M5OA 3K65B 1UVUH 1LHFH 1MKXH 3SOSA 4D9QA 1Y3UA 2Z9JA 1ELGA 4R19A 3RC4A 4XRNA 2ZIQH 5A8XA 4KP0A 5COEA 2W7UA 1FONA 4NSYA 2LPRA 2M5TA 2XBYA 3RXLA 4FUIA 2DOHX 1SKYE 1SGCA 3ZVEA 3UIRA 3UNSA 2PF1A 5T6FA 1N8OB 3CP7A 4JYTA 2F9VA 2SGFE 5JYIA 1PPFE 5JB8S 1MAXA 3FKSD 4ZROA 3F3BA 2FOGA 1GI2A 4X6MA 1F2SE 3FZZA 3RXBA 3ZZ9A 1SQAA 1EZXC 4FUFA 3RXTA 3SO3A 4AG2A 2HALA 1V2RT 2HNTC 2CHAB 1TPOA 3QX5H 5FX5A 1BTXA 1VR1H 1AUTC 3RP2A 1C5RA 1D3TB 4R1AA 4OGYA 1K1LA 1PPZA 2ANMH 3URDA 1C5WB 5F8XA 1KLIH 1GGDB 1QURH 2ZI2H 1O2GH 1SGFG 1HJ9A 1FNIA 1W2KH 2IPQX 2XNIA 1PPHE 2V7QD 1MKWK 1T8OA 2ZA5A 1VITF 2SGEE 3TIUA 3MMGA 1ELVA 1OWJA 2BVSH 4R0IA 4OS6A 3OE7D 1EPTC 2Y5FA 2ZHDA 1ZHPA 4I8GA 1F0SA 4LZ4B 2R3YA 3K2UA 1IQHA 5C1XA 2A2XH 2XYAA 1QB9A 1ZHMA 2L6OA 2CXVA 4GAWA 1UVSH 1HCGA 1AWHB 4AYVB 1C5VA 3M7UA 3TJNA 3UTUH 1UHBB 2F43B 2QF0A 2KM0A 2VWMA 4ZCNA 3WY8A 4Z09A 1NC6A 4AYYB 2RA3A 3SN8A 2Q8AA 2BDBA 3IITA 1MH0A 2EEKA 5C1YA 4ISOA 1O2QA 4B6FA 2AIPA 3FP7E 4ZUHA 1YCPH 2L0SA 4NZLA 4DG4A 2FLRH 1HJ8A 2ZP0H 1JBUH 3EYDA 1I71A 4I33A 3O8CA 2EI7A 1HAVA 1KTSB 1BTPA 1W11U 1SMFE 1J15A 2Y8RA 4ZHMU 4BV7A 2GCHF 4CRAA 5LGOA 1UCYE 1ZTLA 2Z9IA 1TABE 1Z40A 1GPZA 1D6RA 2AGEX 2BD7A 3BIUH 1IQGA 3BTGE 2PV9B 2VVUA 4Q7ZA 1W0KD 3ZZAA 4WVPE 1TOCB 1LVBA 1TX7A 2BXTH 1ZRKA 1C1WH 4DVAU 1QGFA 3D65E 1ID5H 2QV1A 3AW0A 3N7DA 4A5TS 1QQUA 1QIXB 1O32A 4X1RU 4Y8XA 1WQSA 1LDTT 3P95A 1ELAA 3RXCA 1AO5A 1GG6C 1HJAC 2XCFA 1IQMA 1GJ6A 1O3MA 3ZZDA 3R0FA 1ANDA 2G52A 5JPMH 1DVAH 4OS4A 2PWXA 3P8OA 3LGUA 1C1UH 3LU9B 1Y3YA 3VGCC 1O2RA 2JIZD 1W81A 1SQRA 3VB6A 1GI7B 1N1LA 2J2UA 5GWZA 2BDGA 1SQOA 1BBRE 2TPIZ 2Z7FE 1TE0A 4RT1A 4NCYA 1C1MA 3CNRA 1GI9B 3STJA 4CRBA 1AI8H 2XWBI 2G8TA 5FBEA 1AFQC 3MWIU 1KXBA 1O5EH 4Q80A 2BY7X 5FBIA 2ZGJA 2F91A 4JZFH 1YGCH 3BSQA 3OTJE 3PB1E 3SU0A 1IHTH 5J4SA 2QJ4A 1ELFA 1DY9A 3T29A 1WSSH 1O3GA 5C67A 1ZHRA 3Q3YA 2J9NA 3UB0A 1GI1A 4NIWA 2JETB 3KIDU 1YPMH 3CS0A 3PLBA 4Q2KA 2FI5E 1FN6A 3HPTB 1TBRH 4BNRA 1AVXA 1FJSA 1O3NA 3KQ5A 4NGAH 1DXPA 3GYLB 1K2I1 4HGCA 1WTHD 1ZZZA 5FCRA 2I9BA 1GDUA 3P17H 1HPJA 4D7FA 2FOMB 3R3GB 1C1QA 3P70B 3O8DA 4YLQH 1C5UA 1T7CA 3OFND 5H4IB 5C17A 2Q8BA 1QJ7B 3B23B 1B0EA 2GT8A 5C94A 1HGTH 1VCQA 3T2NA 2AIQA 2GDDA 3AASA 1YPGH 3U28C 4NA8A 2PGQB 3CS7A 1DUAA 4CH2B 1SGIB 1WV7H 2BY5X 5T1VA 1FN8A 1VITG 1C5XB 1PQAA 3M3SA 4RI0A 1RTKA 5DJ7A 1TQ7B 5DP6A 5KGOA 1C4Y2 1TBQH 1SOTA 2A5IA 3ZVAA 3T26A 1P2IA 3ATWA 3M3VA 2XBWA 2FLBH 2FD6A 1UCYK 1XUFA 2ZDNA 3M35A 1NRRH 1G32B 5EXMA 1WQVH 2QF3A 1A3BH 2C3SA 1EATA 1C2HA 1TA2A 1SGRE 2W5EA 1AWFH 1EAUA 1JIMA 2JJ1D 1TA6A 1KLTA 2W3KA 5DK1A 4BAMB 1C5QA 1FY8E 1GJAB 5CHBA 1GDNA 1XKAC 1VGCC 1LQEA 2VNTA 3PMBB 3UR9A 3SORA 4DIIH 3MNBA 4OS1A 1PFXC 1DICA 1K1MA 2A1DB 2BLVA 2Q6DA 1W8KA 1YPJH 3QUMP 1Z6JH 4B2BA 1NK1A 2WPMS 2GCHG 5CS3A 4E05H 3M3TA 1C5SA 1GBDA 1QRZA 1TB6H 2ALVA 4YESB 1XKBC 1FY1A 1BBRK 1Z8GA 2OC1A 4BXWA 3ATKA 2FEQH 3E3TA 3MO6A 1F92A 5DKMA 2G4TA 3RXAA 4ISIH 2F9BH 2KAIA 3ZVBA 3ZZCA 4ZKOU 5ABWA 1IQJA 1PPEE 1T8MA 3P8GA 1N8OC 3QGJA 1UK3A 5T6GA 2LP6A 3GCOA 1D3PB 4CH8B 4IC5A 1EJNA 1DLKB 1E38B 4A1VA 4HFPB 1KY9A 1GHXH 3UNQA 1MTNC 5EODA 1T32A 1C2GA 5EGMA 4WF8A 1PPGE 1F5KU 1TPSA 1NROH 4INLA 2C8XB 1GP9A 4SGBE 3SP8A 2AGIX 2YMSC 4I8JA 1TGSZ 3BEFB 3TGKE 4B2AA 3T27A 4GCHF 3SV8A 1OYQA 4CRGA 3UREA 4ASUD 3S0NA 5CSQA 1NL1A 2KR7A 4ZMAH 3H09A 4WH6A 1FDPA 1ESTA 3NPSA 4UFGH 3N99A 1RRKA 3SNCA 1A4WH 3M5NA 1C2EA 1HXFH 3TJUA 3DSGA 1EPTB 5EU8A 2P59A 3ZYDA 4CIKA 1NFWA 1O3LA 2TIOA 1C1SA 3SV2H 1IHSH 4Q7XA 4NIVA 2H9TH 1A3EH 2AS9A 3K65A 2WUBA 3MH6A 3PTBA 1TOMH 4AFUA 2JH6D 4R8TB 3RXHA 1GBIA 3OEED 2P93A 1K1PA 1A5GH 1O33A 1ANEA 2O8TA 4O03A 1AZ8A 2AYWA 5HYOA 2BD9A 1XUHA 1O34A 3EAJA 5E0HA 2QJ2A 3LAQA 1HAPH 4Z1MD 1YPKH 1KMHB 2BYAX 3F6UH 1P9SA 2P95A 4NWKA 2PKAB 1GHVH 4AG1A 1DWCH 2OBOA 1OWEA 1NESE 1SHYA 2AEIH 2KFWA 3RMMH 1P04A 3ODDA 3URCA 2KCAA 2G81E 4X1QU 2FIRH 1M9UA 1MBMA 4X6PA 2ASUB 2H9HA 3F9EA 1T31A 2CGAA 3CENA 2FODA 2HVYB 2OK5A 5JBBS 4I7YH 3KQCA 3S7KB 1DFPA 2G51A 2R3UA 4K60A 1NL2A 5A09A 1Y3WA 1LVOA 3DSOA 1C5TA 3VB3A 2BVXH 2CF9H 2BHGA 2H1UA 1IQKA 3QDZB 5HPGA 4I32A 4O3UA 3S9CA 5CE1A 2Y5HA 2EI6A 2BD2A 2QF4A 3DHKH 2L74A 3DFLA 3ZWZA 4AN7A 3SGQE 4HG6A 3PM3A 3EA7A 1MTVA 1XVOA 3ZZ6A 2PSXA 1GG6B 1HJAB 4FOUC 3RU4E 1P2NA 3N7EA 5BPEA 3S7HB 1E34B 4J1YA 4BAHB 2ILNA 1GL0E 3T25A 1FMGA 4B74A 1OS8A 1TRYA 3UPEA 1LO6A 3VGCB 1TPKA 1P12E 2UUJB 2DE9A 2J8JA 1GBTA 3PMHB 4UV6A 1ZTKA 1MAYA 1UHBA 4IGDA 2ALPA 1P2QA 3D23A 3PMJA 4AORA 3B9FH 2C93B 3KF2A 3A7VA 1AFQB 5FAHA 2KNFA 4UEHH 1GI8B 1Z7KA 1WDIA 4I8HA 4KTCA 1V6DA 3QLPH 1TNJA 2A4QA 3PROA 1V3XA 4D8NA 2ZFPH 2B9LA 1OWHA 4YOGA 1BJUA 1CSOE 3C27B 1JFNA 2STAE 4M9FA 4Q63A 1RIWC 4AOQA 3GCTF 2JETC 8ESTE 4GUXA 3NK8A 1AUJA 1QL9A 4Y8YA 3SV6A 3U8OH 3TJVA 2KL5A 2Y5GA 4GCHG 1GBEA 2PUQH 1QL7A 2OC7A 3BTTE 4K2YA 3MU5A 1BB0B 1HYLA 3K6YA 2VVVA 1ZMNA 3SUFA 4YOJA 4JZIA 2PTNA 1QCPA 1A2CH 1MKXK 1ORFA 3LIWA 2LELA 1Y59T 1RXPA 1YP9A 2KAIB 3RXEA 2YIPA 2J95A 3SQHE 1THPB 2XRCA 4Z0KA 5C5OA 1ZJDA 4Y10E 1G3BA 5CMXH 1RTLA 1SG8B 1EP5A 1PK2A 3GYMA 3JZ2B 1NTPA 1S5SA 2ZU2A 3LH3A 1ZJKA 3D62A 1FPCH 4THNH 2A7JA 1QL8A 1L0ZA 2DE8A 2ZNKH 2P3FH 4FUEA 1W7GH 1HPGA 4U30A 1L2EA 1SHHB 5CT2A 1BMNH 1UVOA 1NFXA 1SGEE 2FM2A 2Z8VA 1Z8IB 2B0FA 2FOEA 4KELA 5EW2H 2VJ1A 3EQ0H 2HRVA 5EQSA 4ACAA 5T6DA 1FI8A 1JIRA 1SC8U 2HOBA 4K3JA 4Y11E 1YLNA 2AMQA 1HAIH 5C0TA 5DN6D 2ZGXH 2ZKSA 5DP3A 1SLXB 2QY0B 2C8ZB 1DWBH 1S0RA 3FP8E 1I8NA 3KYGA 4A1TA 1QJ1B 1SGQE 1BTUA 1GJBB 2PTCE 3GICB 1V2LT 3SJIA 1VGCB 2BM2A 6LPRA 2RDLA 2SFAA 1WOFA 1DS2E 5HIYA 5F6MA 3N7OA 3E16B 3HKJB 5CS9A 2F4LA 1IQFA 1YPHC 2GTBA 1XUGA 3LGTA 1O3IA 4AGJA
chains in the Genus database with same CATH topology
3SU1A 3BT1A 3L3TA 2R2WU 3KEEA 3BTFE 3PV4A 1QA0A 2W7SA 3M5MA 3F9GA 4ASHA 2DOIA 2ZFTA 3BG4C 2H2ZA 1LVYA 1LPKB 1S85A 2ZFRH 5GIBA 1GVZA 1G30B 1YPLH 4APLA 1F7ZA 1IQIA 1GJ7B 3TK6A 5PTPA 4B71A 4YLUA 4BV5A 4ZXYH 1HIAB 4F49A 1PKRA 1MU8B 2C8YB 4CBNA 1TMTH 2WPJS 1MTNB 1GI6A 2H6MA 4WWYA 1XMNB 3RM0H 4UFFH 1YCPK 2VGCC 3FVFB 1UTQA 3GCNA 1TQ0B 3LONA 3MH7A 2FS9A 1KSNA 4NA9H 2D1JA 5GCHF 2Z94A 2HPQP 2QC2A 1P03A 1GI0A 1XVMA 1O39A 1UTMA 1O3KA 1BITA 1EOJA 2UUYA 4E7RG 2BDHA 1V2WT 1TNIA 3SJKA 1DLEA 2WUCA 1C2DA 1YLDA 2QXGA 5GDSH 3OU0A 1SR5C 3G01A 4NFFA 4TPIZ 1SB1H 3NZIA 3SRJA 3O8RA 1O5FH 2VB0A 5SGAE 1ETSH 1S0QA 4WMDA 1W8BH 4OS7A 1MQ6A 5DP8A 3LGIA 5DO4H 3KN2A 3KHVA 1EQ9A 3A8CA 3T62A 2QIQA 3GCTG 1S81A 1C9PA 2VWNA 4K8YA 3U1JB 2ZTYA 5LPFA 3SJOA 5CT3A 1EAIA 1TPAE 2AMPA 2F3CE 4XE4A 4B1TA 1KXCA 2ZDMA 1SI5H 1O2LA 1ZPCA 1C1PA 1D3QB 1GJ4H 3A7TA 2FMJA 1V2MT 3I78A 1Y3VA 3MFJA 2LNCA 4O3TA 1HRTH 2BD5A 4INKA 2A4OA 3RUOA 2XC4A 2HGTH 1AZZA 4K8BA 4Y71A 3RLWH 2OQUA 3KNXA 1DANH 2ZPQA 3SNAA 1URKA 3A85A 1GI4A 2OBQA 5L30H 2BB4A 1QBNA 1OSSA 2GVFA 3IG6B 1CT4E 3GY6A 5G4BA 1QRWA 5DG6A 3BTHE 3IWMA 1KDUA 1HAXB 1X7AC 3A83A 1DWEH 2P8OC 2H9EH 5BRRE 1OP8A 3V12A 5A0CA 1C1RA 1MU6B 1P2MA 1PYTC 1ELTA 1GJDB 1G2LA 3PWCA 3EE0B 3SI4H 1P05A 4UFDH 1H8IH 2Y6TA 3DFJA 2GMTC 4JZDH 1FY5A 4MPWA 2HNTE 2XBVA 3ATIA 1TIOA 3GY5A 3A7XA 2C8WB 4E06H 3A8AA 1VJAU 2G00A 1NS3A 4UD9H 1E35B 3TK9A 1EPTA 1TRMA 2ZDAH 1O2IA 2F9UA 1P2KA 3FANA 1MKWH 2FI3E 2XBXA 1QQ4A 4BVCA 1GMDF 1C9TA 3A7YA 2GT7A 4IUAA 1LPGB 4X8TH 3FZDA 2FESH 1O3FA 3PMAB 1H9IE 2PUXB 3SU2A 4Q7YA 3A84A 2FTLE 1SBWA 3QZQA 1UJ1A 4NIXA 2ZCLP 1UK2A 4MQAA 1BIOA 1O3PB 4IW4E 4D76A 3H5CB 2A5KA 3F9HA 2Z9GA 2B7DH 4I31A 1F0RA 2PKAA 5C3NA 1MTWA 1TALA 3OX7U 3ZV8A 4OS2A 1O30A 1SPJA 2FS8A 4AZ2B 1Z1IA 1RIWB 4AFSA 1P11E 3KIVA 2A4GA 5LPEA 2ZHQH 1K22H 9LPRA 4MLFB 2V6NA 3KL6A 1TGCA 3F1SB 1SGDE 5GCHG 1GHWH 3PWBA 2WV4A 4TPYA 1JXPA 1O5DH 1S83A 1LQDB 1V2OT 1XXFA 3MO9A 1UVTH 3ZLEA 1HAGE 3PLKA 1A61H 1SL3A 1O2HA 2XTTB 4DGJA 1TRNA 5T3HA 3VEQB 3UNRA 1OX1A 3I77A 3ZZ5A 4ISLA 2A32A 4QT8C 1GHBF 4UDWH 2I6SA 4X6NA 5C2ZA 2FO9A 2A5AA 4R1BA 3SV9A 3SRIA 4B75A 2BOKA 5FX6A 3SNBA 1ARBA 2BX4A 4Y0YE 2K51A 2QAAA 5C5NA 1G9IE 1W3CA 3OSYA 4O97A 9ESTA 1K1JA 4CRFA 5E0JA 2OLGA 2ZQ1A 1F0TA 4K1SA 3ZZ7A 2X2ZA 2ZF0H 4GPGA 3QTVH 2A4RA 2SNWA 2R0KA 1MD7A 4ESTE 3UQOA 1CBWC 1TYNA 1YF4A 5CHAC 3MYWA 2TGTA 1BMLA 2OINA 5AF9H 4FXGH 1O2WA 1IQLA 1HAHH 4APMA 1QB1A 3KQBA 1FAKH 1LPZB 1WCZA 4BTUB 1ESBA 1Y5UT 2JH5D 1ZLRA 1EOLA 4Z0EA 3SBKA 2V3OH 7LPRA 1A0LA 4A6LA 1SLWB 3LOXA 4ABJA 2BD3A 1SGYE 1AE8H 3E6PH 1CGJE 2R0LA 2GX4A 2ZGCA 3ATMA 5E0GA 5GJ4B 4D9RA 1BRUP 3QO6A 5I46H 3T28A 4UONA 1FIWA 1V2JT 2VIVA 5GPIB 1O37A 2OUAA 4ABIA 2FZZA 2O8MA 3MH5A 3MU4A 3BG4B 4MNYA 4X8SH 1V2ST 3SJ8A 3ZVFA 2PW8H 4E7NA 1NM6A 4LOYH 2ZPSA 5TCCA 1UTOA 2FYRA 1GJCB 4JZEH 3LGYA 1CGHA 1HLTH 1QRXA 1NO9H 3M37A 1JMOH 2FX6A 2TGPZ 4AB9A 4AFZA 4JMYA 1GJ5H 1C5LH 1XUIA 1AVWA 3S9BA 1CHGA 5F8TA 1GMDG 2VGCB 2SGQE 1XM1A 2EI8A 4OGXA 1V2KT 1P9UA 2Y7XA 1K1OA 1HAOH 4GHQA 2FOHA 1RTFB 1W10U 3ZVCA 1MTUA 1U6QA 4CR9A 2VH6A 3SNDA 1KTTB 1UCYH 1ZPBA 4A92A 2ODPA 1GBAA 1MBQA 1BUIA 5K7RA 1GHAF 2GZ8A 4U32A 3A7ZA 3RU4D 4RKJB 4BTIB 1ABJH 4TY6A 2BD8A 2J38A 3AAUA 2J4IA 2BDCA 1GMHF 4IS5A 3VXEH 3OYPA 3ZZBA 4B2CA 1XXDA 2ZGBH 4XOJA 5JDUB 1AB9C 5FPTA 4DIHH 1LHEH 1ETTH 3VB5A 4WH8A 1G37A 4HI3A 1KRNA 1DWDH 2HNTF 2H5DA 2ZHFH 1C4U2 4FVDA 1OOKB 1L1JA 2ESTE 4X1PU 1NRQH 3BTQE 1ZYOA 1L4ZA 4ISHH 3LT3A 4X2WA 2GCTB 4JK6A 3A7WA 5LPRA 1BT7A 3TK5A 1DT2A 4VGCC 7ESTE 1H8DH 1Y5AT 1BBRH 3Q77A 2FOBA 2CMYA 1NN6A 3MU8A 1GI3A 1KYNA 2QXIA 1GHBG 2I9AA 1HIAA 2ANKH 3S9AA 1T4UH 2F9NA 1ESAA 1HFDA 1PQ5A 2FOCA 2HPQH 2P8OB 1UTLM 5E2PA 1IQNA 1Z6EA 3SU3A 3HMRA 1NZQH 2H5CA 3EA9A 1EB1H 2VIPA 1YLCA 2D2DA 2AH4X 2ZTXA 1D9IA 4MPVA 1D6WA 3SHCH 5DP5A 1CA0C 8GCHF 5EXNA 2P94A 4MPXA 5AHGH 2GMTB 3D49H 2NU2E 1C2LA 2P3TB 3C1KA 1ANCA 4YO9A 1GBCA 1C1VH 1PK4A 2Z3CA 1O3EA 1ZSKA 2Z3DA 4K5ZA 5L6NH 1QR3E 1AFEH 1QA7A 1W0ZU 2P16A 3HMTA 1A0HB 1D4PB 1LHCH 4CR5A 5K0HA 1V2PT 1ETRH 3Q3KA 4K1EA 5CS5A 1FZZA 2YIOA 4X6OA 1TBZH 1S6FA 4MTBA 1KI0A 1G2MA 2ZHWH 4ZH8A 3PO1C 2FX4A 2I6QA 1MZDA 4X8UH 3Q3XA 1TNHA 2IOTA 1O2YA 1KXEA 3ATLA 4TY7A 3P92A 1CO7E 3E8LA 4B73A 1INCA 1LHDH 2ZHEH 4YIZA 1BDAA 4X2YA 1HDTH 4BAQB 4YTAA 1QBVH 6CHAC 4I8LA 3ZZ4A 2ZDVH 3QWCH 1FPHH 1FUJA 4ZKRU 2DUCA 2CJIA 1P02A 1C2MA 2PR3A 1XX9A 3RXMA 4XDEA 4Z6AH 3K9XB 3TNTA 2NWNA 4AFQA 2HPPH 1V2VT 3SGAE 1C5OH 3LJOA 1P09A 2VWLA 3HK3B 2LL3A 1HUTH 3GCHC 1O31A 3NCLA 4B76A 1WAYB 1PMKA 4Y76A 4NWLA 5B6OA 1GJ9B 1KIVA 2BY8X 1GBLA 3JZ1B 1AQ7A 1AN1E 1EP6A 2XC0A 1OPHB 4CHAC 2FTMA 2GV7A 2ZDLA 2SGPE 2QXHA 2BX3A 1H9HE 5HXFA 1UTNA 2BY6X 4ABEA 5EQQA 1DITH 2OXSA 1V2NT 3SZNA 1W7XH 1DXWA 3U73A 1AMHA 6ESTA 1A5IA 4ABFA 3P8NA 2VIWA 1GMCF 3A87A 3VXFH 1O2UA 4CRDA 1GHAG 5C20A 1TWXB 1AE5A 2BLOA 2ANYA 1ELDE 2OD3B 1J14A 2HVXA 1AVGH 1ZOMA 4LK4A 2BQ6B 2WYGA 3RMNH 1XUKA 1OP2A 2ZU1A 2HLCA 4H4FA 1GVKB 1YBWA 1O35A 4H42U 2GD4B 1DPOA 1HXEH 3B8JA 1DX5M 1W0YH 1EAWA 4GHTA 4TYDA 1SGNE 4WY3A 5A8YA 3V13A 1DDJA 1YPEH 2YNAA 1LVMA 3MI4A 2A45B 1L1GA 2B8OH 3RM2H 1CBWB 1F0UA 5CHAB 3V7TA 3LC3A 4GVUA 3AVZA 3ELAH 1V2TT 1NPMA 2QYIA 5HGGA 1P01A 5CS1A 4HZHA 2BZAA 2UWPA 5EW1H 1BZXE 3VPKA 3MH4A 1P57B 2K4RA 1C1NA 3HN4A 1SOZA 4FUCA 1TPPA 2FWWA 2CF8H 4ZKSU 3PTNA 3SQEE 1Z8RA 2CN0H 3A81A 1YCPM 1TGNA 5A8ZA 2EC9H 4K1TA 1ZTJA 1SLVB 3RMLH 1ELCA 1VJ9U 5J4QA 3QGNB 4XBDA 1YC0A 3UY9A 1JOUB 1NRSH 8GCHG 1HNEE 1LMWB 1UMAH 3BIVH 1IQEA 1L1NA 1PJPA 2Y82A 4FUJA 1V2UT 3SU6A 2ZCKP 3BEIB 3OY6U 4BVDA 3GOVB 1RS0A 2WPLS 4NIYA 4YIVA 6GCHF 1F5LA 4WMFA 3GISB 2FDAA 1AY6H 1ZSJA 2THFB 2PK4A 3SUGA 1C1TA 3A82A 3LKWA 4Y79A 2XWAA 8LPRA 4IMZA 2GKVE 3DUXH 4KTUA 1UTKA 1O5GH 2EA3A 3E91A 4D7GA 3BTDE 1DUEA 4IMQA 3ZVGA 1G3DA 2FOFA 5JBCS 2ZZUH 1CU1A 3ZYEA 2BDAA 2OQ5A 3E0NB 3W95A 3BTME 2Z9LA 3H7TA 5CT1A 1IOEA 3BTKE 1VITH 3HGNA 1DSTA 2UUKB 4D3CA 1PMLA 1DY8A 2FPZA 2ZO3H 2LL4M 2VH0A 3FAOA 3SNEA 5A0AE 4MNWA 3HATH 1C2JA 1C5MD 4MPUA 4NZQA 3A88A 3EA8A 4Z0FA 3A8DA 2PF2A 1GI5A 4LZ1H 1TNKA 3U8TH 3VB7A 1SFQB 5GXPA 5ESTE 3ENSB 1K9OE 1JWTA 2QCYA 1P2JA 2J8LA 2BLWA 2ZGHA 4BTTB 3A8BA 5EQRA 1ZSLA 2QA9E 4A1XA 1A1RA 4ZHAA 1AB9B 3TJOA 2PKSC 2R9PA 1VZQH 1BJVA 3L33A 3TGJE 1F5RA 2OTVA 3MNCA 1EKBB 3TH4H 5F03A 2UWOA 1FV9A 3UUZA 1LKAA 1OKXA 1Q31A 1SGTA 1O3OA 3U69H 4CBOA 3GDVA 1QB6A 2ZEBA 4MG3A