4A5TS

Structural basis for the conformational modulation
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
791
structure length
767
Chain Sequence
EPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PLASMINOGEN
publication title Crystal Structure of the Native Plasminogen Reveals an Activation-Resistant Compact Conformation.
pubmed doi rcsb
molecule tags Hydrolase
total genus 181
structure length 767
sequence length 791
ec nomenclature ec 3.4.21.7: Plasmin.
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00024 PAN_1 PAN domain
S PF00051 Kringle Kringle domain
S PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4a5tS08
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4a5tS07
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4a5tS05
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4a5tS06
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4a5tS03
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4a5tS04
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 4a5tS02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 4a5tS01
4Y8XA 1O2QA 4ZKSU 1OWDA 2WPLS 1GJ8B 5C2ZA 5CP9A 1LHCH 2QXIA 2ZF0H 3P8OA 1E38B 1QBNA 5A8XA 3SV2H 4APMA 1BTZA 2BQWB 4DVAU 5DO4H 3RMOH 4Z0DA 1MTNB 3MU8A 1ELGA 1TBZH 2Y6TA 2IPHA 3M7TA 1BRUP 4KGAA 1BQYA 3CP7A 2Z3EA 1BTYA 6GCHG 1GBLA 2A1DB 1AE8H 3A87A 1SHYA 1IQIA 4MPWA 3QK1A 3RXSA 4R19A 4FU8A 2STBE 5FX5A 2BQ7B 1J9CH 3BG8A 1XUKA 1V2ST 3SJ8A 3BN9A 5ESBA 3RC4A 8LPRA 3TJOA 1H9LB 1ELBA 1GI3A 5FCRA 1FV9A 1VITG 3SNAA 3M3SA 1HJ8A 2P8OB 2Z9LA 1HAVA 3DT0H 3LGUA 4FUBA 3A82A 4UAOA 3MH6A 1KY9A 4X1QU 1DITH 1HXFH 1K1NA 1OX1A 2ZHQH 2Q8BA 1C1MA 1O2GH 2BD7A 4MG3A 4AG1A 2ANYA 4AGJA 4ISOA 3PB1E 3RMMH 3T25A 1O3JA 1D3PB 1C2EA 5EXNA 4ABAA 1S84A 1EB2A 1UK3A 2ZDLA 2AIPA 1FJSA 2FI3E 1F0SA 3VEQB 5CT3A 3VB7A 4NFFA 5EPYA 1C1NA 3PYHA 3RU4T 2SGEE 1F0TA 4DIHH 3A7WA 1ACBE 2ZNKH 3RMLH 4KTUA 2Z8VA 2BHGA 1Z8RA 3M37A 1ZGVA 4Z0EA 2JKHA 4IBLH 2R0KA 4FUIA 1O3MA 3ZZ8A 2VNTA 2D2DA 4IN1A 1AZZA 1T7CA 1WQSA 2GV7A 2PUQH 4ZMAH 2H1UA 1EZXC 4Y8ZA 3ELAH 3SNDA 1P09A 2FOFA 2HPPP 3VGCC 1THSH 2DOIA 2VJ1A 4X6NA 1NFUA 1O35A 1F5RA 3GCTG 3T26A 1FNIA 5F8ZA 2FWWA 3UNRA 1HPKA 2FYRA 2HOBA 2WPIS 3IWMA 5EXMA 4KIVA 1UVUH 1YCPM 1C4V2 1EX3A 3TPIZ 1C2LA 2ZU5A 3AVZA 1BMAA 2DE9A 2M5TA 5J4QA 2PLXA 1C2HA 2HNTE 3GDSA 2FESH 1MKWH 1DUAA 3IITA 2C8XB 1NRSH 2WYGA 3TIUA 3RXPA 5JYIA 1AE5A 1H1BA 2PSXA 1GMCF 2SNVA 2FZZA 1KYNA 3ESTA 5SGAE 4FUHA 1B5GH 2C3SA 4ZXYH 1ZMJA 5DKMA 4Q80A 1S85A 3BF6H 1TQ7B 2PWXA 1G36A 1DSUA 5DG6A 4OGYA 3GY2A 2FLBH 2UWPA 4B74A 5TJXA 4ZHAA 2EA3A 5GJ4B 5A2MH 2VGCB 3GY7A 1V2OT 2XC4A 1VGCB 1W8BH 2ZC9H 2BX4A 2BY7X 5I46H 3V0XA 1VITF 2VH6A 1TRNA 1JIMA 1QB9A 3ZVGA 2CF9H 1UMAH 3QZRA 5FPSA 1A1RA 3T5FH 1W8KA 1NM6A 3E6PH 1S83A 4NWKA 3BG4C 1DWDH 4K2YA 2BLOA 1GJ7B 2GGVB 4GSOA 3NUMA 1L1JA 2O8UA 3KQDA 1O2XA 1UTPA 2ZECA 3U1JB 1V3XA 2F9OA 3D65E 3ZVBA 2VVUA 4TWYA 4AORA 5JBCS 4JMYA 1K1LA 1O2UA 2AH4X 2O8MA 2W3KA 2TRMA 2ZFTA 1AO5A 1C4U2 1P2QA 2CN0H 1HNEE 2JETC 4BVCA 1PKRA 4F4OC 3GISB 7ESTE 2B8OH 3RXMA 4NZLA 3MH4A 3S9BA 5LPRA 3RU4D 1DUEA 4CR5A 2ZU4A 1KLTA 4B1TA 1GCDA 1A3EH 2GX4A 4DJZB 1HAVB 2TIOA 4WMDA 5EQSA 4UFEH 1KRNA 4ABGA 2V0BA 3F1SB 3UQVA 2K13X 1MD8A 1WAYB 5E8EH 5ABWA 3E0PB 1ZYOA 1Z71A 3GCNA 1Z8GA 1GJ9B 3GCTF 4ZUHA 4UV6A 4PROA 2G55A 2TGPZ 3CS0A 5COEA 2G4TA 1C5LH 1BBRK 5K0HA 1HJ9A 1LHDH 1QJ6B 2Y80A 1Q3XA 4Q2KA 4ESTE 4BTIB 3MHWU 1OSSA 1EKBB 1EZSC 1BMLA 1D3QB 3UREA 3SJ9A 1O2RA 4UEHH 1SMFE 1XX9A 2W3IA 1TRYA 4X8SH 2VIVA 5EPNA 1CEAA 4NG9H 2ZQ1A 1MKXH 2VIDA 1CT4E 1CVWH 2IJOB 3RXKA 5EU8A 1O30A 3A7XA 1HBTH 1O2OA 2PTCE 1ZTKA 5AFZH 1NFXA 2THFB 1AFQC 4Y6DA 1AMHA 4FVBA 4IS5A 1YPMH 3ZV8A 2A31A 3T29A 3RXVA 4CHAC 3UY9A 5GXPA 1FONA 2ZHWH 4WH8A 5CS5A 1XKBC 5L6NH 1TBQH 1NN6A 1NS3A 1J14A 3O8CA 4H6SB 3RXEA 1AIXH 3SOSA 3TJUA 1P3CA 1C1QA 1Q31A 1KXAA 1JRSA 3QZQA 1PPCE 1P2OA 1BHTA 1QRZA 2AGEX 5DP4A 2OBQA 1EPTC 2ANMH 2QY0B 2Y8RA 4NA9H 1PPHE 1TONA 2AGGX 1QL9A 4OS5A 1WYKA 1K22H 2I9AA 2HWLB 5LPEA 2G4UA 1YPHC 2FODA 4R0IA 4MNYA 2H5DA 1PPZA 1O39A 1O2LA 1C5QA 1VCQA 4BTUB 1CGHA 1TALA 1AB9B 4K8BA 1TGNA 4LXBH 1UTOA 1URKA 1UTNA 2PKSC 4X1SU 2A2XH 3A8DA 2AS9A 2P3UB 1O5CB 1GDNA 1N8OC 3BSQA 1GI9B 8GCHG 1P3EA 4GVUA 2P59A 1RGQA 5C5OA 3SUFA 1C2JA 3S0NA 2ZDMA 1DM4B 3ZV9A 2CXVA 1YKTA 3BTKE 1ETSH 1FAKH 1SVPA 1GL0E 2GCTC 4WMFA 2ZDAH 2CV3A 3MNCA 1QY6A 1V2WT 1Y5AT 2BZ6H 2J92A 1ZJDA 3A8CA 1GBEA 3TGJE 4BTTB 1BHXF 1CE5A 1HIAA 1P2NA 3LH1A 3ENSB 4NIYA 3DD2H 3VB6A 3KQEA 2ANKH 4BAKB 2F9VA 3E90B 4AB8A 4VGCB 2I9BA 2Z8WA 2XBWA 3ZZBA 1QHRB 3ZZ9A 1O31A 1QB1A 1FI8A 1O34A 4Y76A 1DVAH 4LZ1H 1OS8A 2VIOA 4Y7AA 1Y3VA 1LPKB 2FOBA 2PGQB 1HXEH 1TGTA 2YOLA 1SPJA 3PWBA 1BTHH 3DHKH 3QX5H 1KXDA 1O2KA 4IW4E 4YM9A 1LHFH 2BZAA 1DLEA 1QJ1B 1S0RA 1JXPA 3NWUA 1FUJA 4CRDA 2P3FH 1VCWA 1T32A 1TIOA 2A5KA 3RM2H 3DFJA 5HXFA 1C1SA 1L1NA 4JYTA 1YCPH 1AUJA 2VIWA 2WPHS 3OTJE 2BOKA 2Y7ZA 1ZHMA 2ZCHP 3SNEA 1WSSH 5TCCA 1TABE 1TGSZ 2KNFA 1G3BA 1MBQA 3PTNA 4XDEA 1C1OA 5AF9H 1MU6B 1LKBA 4Z0FA 1EASA 2BX3A 1EAIA 1UVTH 2ZCLP 1LVMA 2VVCA 2Q6FA 2Z3DA 2OC8A 3WY8A 2GZ7A 3LC5A 4ABJA 3A83A 4X2YA 1CGIE 1G2MA 4CREA 2BDCA 4QT8C 4X6OA 3RXTA 4CBOA 2BOHB 1PPGE 3KEEA 1GJAB 1MQ6A 2QGRA 3ATKA 1QA7A 1TOCB 1W0YH 1ANEA 1YPKH 2AEIH 4KP0A 4GLYA 2FI4E 3ZZCA 3SU6A 1JMOH 3GICB 1S6HA 3DUXH 3MU0A 1RD3B 3HGPA 5ESTE 2V3HH 1P12E 3VXFH 1GHVH 3IG6B 3KIVA 5C1XA 2Y5HA 1A0LA 1ARBA 2ZIQH 4LOYH 1XUIA 1T8OA 2RA0A 2GZ9A 4UFGH 1FPHH 1Y3WA 5C1UA 1GBJA 3STJA 2ODYB 1ZPZA 3UR9A 2KAIA 5F6MA 5FCKA 3Q3XA 2PV9B 8GCHF 1E0FD 1MTSA 3S7KB 1ZRBA 1PPEE 3RXHA 1HJAB 1LVOA 1MTVA 1GMDF 1MKWK 2O8TA 4FU9A 3GY3A 1GGDC 2Z9JA 4DCDA 1IQFA 1ZSLA 2BVSH 1FIZA 2HGTH 2CF8H 4D9RA 4TY6A 2GCHG 3MFJA 1DY9A 1FY5A 3M7QA 1AWFH 1IQNA 1JFNA 2AERH 1GJDB 3PLBA 1HYLA 1NFYA 4K3JA 2V6NA 3LGIA 3R3GB 3LGWA 4I8HA 4AOQA 2Y82A 3MU4A 1NROH 3AW1A 1YPGH 2SNWA 3RXBA 1LVBA 2W7SA 4X0WU 1HRTH 4CRGA 4AZ2B 1ZMNA 4INHA 4ZKRU 1ELCA 2P3TB 1ELAA 1JIRA 2OLGA 3RXJA 5L2ZH 1TQ0B 5DK1A 2STAE 1VR1H 2TGTA 3E6PL 3PO1C 4BVDA 1KXBA 1SGIB 2B9LA 4E7NA 4ASHA 2F9PA 1BDAA 1WUNH 2A4OA 4FUJA 4D7FA 5CHAB 1W0ZU 4YLUA 4ZAEA 2ZFQH 1P2IA 4ISHH 1BTWA 2V3OH 3ATLA 1BIOA 1GG6C 5AFYH 5CE1A 1VJ9U 5C20A 1OP8A 2IOTA 1D3TB 4B2AA 1MQ5A 3LC3A 1HIAB 1FAXA 1OXGA 2ALPA 2PHBA 4AB9A 3A8AA 4FUCA 2ZPRA 1UTKA 2Q6DA 1ETTH 2BTCE 2VVVA 1GPZA 1GI8B 1EAWA 3D23A 1TYNA 4HGCA 1HDTH 2P93A 1WOFA 3A7ZA 2PSYA 3BTGE 2BLWA 4ZH8A 1UHBA 2R9PA 2C8ZB 1RRKA 2CMYA 4A7IB 3HMTA 1W10U 4RKOB 5HM9A 2XYAA 4ISNA 4JZIA 4E06H 2B0FA 2HPQH 2WUCA 5CMXH 1KLIH 3T27A 1OWKA 4DG4A 1SQOA 4UFDH 1O32A 1SGCA 3MNBA 1E35B 1GMCG 3P70B 3UNQA 2RDLA 1NTPA 5FBEA 3TNTA 2XCNA 1U6QA 2B7DH 3KN2A 3NK8A 4Z09A 2FM2A 1SI5H 1GBHA 1PK4A 3L33A 4OS2A 2Y5GA 3PV4A 4H42U 1V2MT 1ABJH 1BA8B 1AQ7A 1H4WA 1GWAA 1UCYE 1IQHA 1AFEH 3O8DA 4CIKA 2F3CE 3RLWH 1F5KU 1MUEB 1DWCH 1GMHG 1FY3A 4K1TA 1Z40A 5A0AE 3MYWA 1HUTH 3GCHB 2VWMA 4UE7H 3SU5A 3Q3KA 3A85A 1L0ZA 2EC9H 2BDGA 4FUEA 1V2TT 2GCHF 1ORFA 1V2RT 1OWIA 1J15A 2ZHFH 3UPEA 2ZO3H 4I8GA 1DLKB 3HN4A 1K1OA 4D3CA 3SJOA 1MKXK 3RC5A 1CO7E 1GHZA 5T6GA 2BM2A 1BRCE 1K9OE 4R1BA 2GMTB 1DANH 3LOXA 1GVZA 4GPGA 3ATWA 2PK4A 4BOHA 1HLTH 2I6SA 1BZXE 2ALVA 4BVVA 1ZOMA 2AIQA 3M3TA 1QA0A 3TK9A 3TGKE 1BT7A 1EAXA 1C2IA 2AMDA 5JDUB 2KAIB 1RJXB 1Z7KA 2BXTH 2J4IA 4LZ4B 1LTOA 4AG2A 1I8NA 3LONA 2Y7XA 3UWIA 1H8DH 2ILNA 3CS7A 1HAPH 1P05A 2LL4M 4LK4A 1SHHB 3A7YA 3UOUA 2O8LA 4D76A 2QXJA 4CH2B 1O2ZA 2ZTYA 1TAWA 1SGNE 1GDQA 1GP9A 3DA9B 1P04A 1GCTC 2XCFA 5GCHF 3T62A 1HAYB 3SO3A 8ESTE 1V2QT 2XWBI 3ZZAA 5CSQA 3ZLEA 3B23B 1P11E 2CHAB 2EI6A 1MU8B 3UNSA 2C93B 4HI3A 2XC5A 1MBMA 1O3OA 2D8WA 2ZFSA 4JZ1A 5AHGH 4XBCA 3Q3YA 1JBUH 3OX7U 2QC2A 1FZZA 4I31A 1GHAF 3SBKA 5JBTA 3PMBB 3GY8A 1QJ7B 1T8NA 4K8YA 1NC6A 1O2YA 4X6PA 4K5ZA 2ZHEH 4NCYA 5E0JA 3A84A 5PTPA 3U9AH 4A92A 1CBWC 1GBIA 1OWEA 1TMTH 4AFQA 2ZEBA 2ZDVH 2A4RA 1Y3XA 1C5WB 4ABHA 4I32A 2GTBA 2OINA 3PM3A 1N1LA 4D7GA 1WBGB 2VH0A 3M3VA 1RIWC 1OP2A 4CBNA 1EOLA 2QAAA 3BTME 1THRH 2VIQA 4B2BA 3ZYEA 3V13A 3LKWA 3MU5A 1GMHF 3S9CA 1UHBB 1GBTA 1GI4A 1D3DB 4IC6A 1QL7A 1HPJA 1O5FH 1UVSH 2TGAA 2W7UA 1UO6A 4NWLA 1DXPA 5CS9A 5A0CA 1A4WH 4B76A 1QGFA 2BD8A 2ZFFH 2Y81A 3SJIA 2BMGB 1YCPK 4BANB 1TNJA 1VITH 1Q2WA 4ABEA 1QQ4A 2FOCA 4XSKU 4X2VA 4X8VH 1Y3YA 3P8GA 1RTKA 3SI3H 5EOKA 1UK4A 1DDJA 1O3HA 1TPPA 4H6TA 3LT3A 2QIQA 3BTDE 3GCOA 3P95A 1GMOA 2NU3E 1K1IA 3MTYA 5DP7A 3GY6A 1IHTH 1ELFA 2ZGCA 4RKJB 1C1TA 1GHXH 5A0BA 2R3YA 1ZSJA 1C5OH 4NA8A 2FIRH 3MI4A 5C3NA 2WV5A 5A8ZA 1EJAA 2BDHA 3LGVA 3HMRA 2FXRA 1Z6EA 4BV5A 4WXVA 5HYOA 3VB3A 3MWIU 1G32B 4NSYA 3GYLB 1C9TA 1TNLA 3F68H 4CR9A 2K1QA 4I33A 4I7YH 1O3GA 1D4PB 1O3PB 1TX7A 2YNAA 1NESE 2FO9A 1BTUA 3QN7A 1BOQA 2OP9A 1PPBH 3ZWZA 1W3CA 3RP2A 4ZKOU 1RTFB 2UUFB 6CHAB 5HM2A 2K51A 1O3BA 4B2CA 2FDAA 5E2OA 2QJ2A 2QXGA 5CT2A 1SG8B 4GUXA 2J8JA 4IMQA 2D1JA 4ZHLU 1DSTA 2YNBA 3PTBA 1SGFG 3PMJA 1NL1A 4J2YB 2Z7FE 4Q7YA 3SV7A 1MTNC 4DW2U 2YILA 2QF0A 3FANA 4MDSA 1HGTH 1G9IE 1GJCB 3V3MA 2H9EH 3ZZ5A 3BEUA 1LPZB 4K1EA 2H5CA 2FEBA 4HZHA 4GAWA 3SUDA 1NRNH 4XBBA 1A5HA 5B6OA 2A0QB 5C67A 1CHGA 1XM1A 1AD8H 1NY22 1P2JA 1UTQA 1LHEH 2WINI 4O03A 3SUGA 1K1JA 4OGXA 1RXPA 3TLOA 7GCHG 1F0RA 5K7RA 3TH4H 4DOQA 1SB1H 3UQOA 1DWBH 1K2I1 1BTXA 3K65A 2F9BH 1ELEE 1PYTD 2P8OC 1C2KA 4Q7ZA 3D62A 4BXWA 3U69H 2G00A 1EP6A 3K6ZA 4XBDA 2XBVA 5FX6A 1UJ1A 1YLCA 1V2LT 1PPFE 2OD3B 1WTGH 1CA0B 2TBSA 2FYQA 2FOGA 2ZU3A 2VU8E 3BEIB 5JBAS 3F9EA 3KIDU 2Q1JA 3RXRA 1EZUC 4INKA 1K21H 2AMQA 2ZU2A 1SGFA 4GHTA 1S0QA 1TA6A 1ELTA 1T4VH 3TGIE 1PMKA 2ZHDA 3L3TA 2A32A 3EA9A 3M5MA 2P95A 2KJ4A 2QJ4A 1G2LA 1Y59T 1DWEH 3U8TH 1P8VC 1SR5C 1BB0B 3GDUA 1LHGH 4RSPA 4NSVA 1Z1JA 3ZVDA 1Y5BT 3NZIA 3W94A 1TE0A 1TPSA 3I78A 1GMDG 2TPIZ 1PFXC 1HAHH 2SFAA 1FY1A 2VB0A 3SGAE 1NPMA 3U98H 2G8TA 1NRQH 4BXSA 4D9QA 2FI5E 1W13U 1ZZZA 3Q00A 3LPRA 5DP9A 2GDEH 2Z9KA 4WWYA 5DGJA 4Q7XA 5EODA 5DJ7A 3RXQA 2WPMS 1CSOE 3MO3A 3RUOA 4FUDA 4U30A 1WCZA 1A61H 3JZ2B 4CRFA 2F91A 2OTVA 1KSNA 3FZDA 4YOGA 1LMWB 1GBDA 3TH3H 1NT1A 2ULLA 4I8JA 1D6RA 2AFQB 2HVXA 1QCPA 2B5TB 2NU2E 3U1IB 2UWOA 1I71A 1O3LA 1O3EA 1QBOA 1GI1A 1LPGB 1EXFA 1NRRH 3I29A 1SOTA 2PF2A 1UCYK 3K9XB 4X1NU 2ZI2H 2VWLA 5BRRE 3M35A 3SQEE 2EEKA 1ZMLA 2ASUB 3O8BA 1K28D 2XTTB 3BIVH 3UUZA 1HFDA 3GY4A 2Z6BD 1J8AA 3SRJA 2BDAA 3RM0H 4RN6A 1MAXA 2A2QH 5T3HA 2PFEA 1L4ZA 1QTFA 4TYDA 3ZZ3A 1IOEA 2RG3A 1C2DA 2FMJA 3SGBE 2VGCC 1JOUB 3FP7E 1VGCC 4R1AA 3KGPA 3UR6A 3FFGA 2C4FH 1A5GH 3OY5U 3EGKH 7GCHF 2QXHA 4DURA 1AKSA 3HGNA 3SW2B 4DGJA 1V6DA 1O36A 1ESBA 3FZZA 2A4GA 3HPTB 1GJBB 2FS8A 2PUXB 1H9HE 3QGNB 3HATH 3VGCB 1GHBG 3BTQE 4B71A 2FX4A 1TMBH 1SGQE 1B7XB 3OYPA 3Q76A 4CRCA 1ZGIA 2XXLA 1IQGA 3ODFA 4ZKNU 1PYTC 4FUFA 1LCYA 1N6YA 4JCNA 3LGTA 3QTOH 4Y10E 4DY7B 1VCPA 2ZCKP 1Y3UA 1TB6H 1XXDA 4ISIH 5GPIB 3SRIA 3TJNA 5FHTA 8KME2 1G3CA 5BPEA 3QUMP 2H9TH 5LGOA 3P17H 3PLKA 3U73A 2SGFE 1O0DH 4K60A 3NPSA 1PJPA 1EPTA 3QLPH 3LDXH 1BHXB 2X2ZA 3A7VA 2ZPQA 1GJ4H 2OC1A 3K65B 3MH5A 1O2NA 4BNRA 4MPUA 2ZQ2A 3KQCA 1ZPCA 2W26A 1C2FA 4MNWA 1LO6A 2BD2A 2HNTC 4I8LA 1NK1A 5HMAA 3UIRA 3STIA 1L1GA 1XMNB 4O9VA 1GVLA 1XVMA 2HALA 3A81A 1I5KA 2ZFPH 1C9PA 1KXCA 4AFSA 1ZTLA 1ID5H 3BG4B 2OCVB 5JBBS 1XKAC 2R0LA 2BVRH 2FS9A 2GDDA 4R8TB 1W7XH 2ZTZA 1IHSH 3E3TA 2ZGHA 1FXYA 2G51A 3ZVCA 1ZHPA 1IQMA 4BV7A 4MNXA 4Y71A 2BXUH 5C5NA 4X2WA 1BMNH 1B0FA 3GYMA 1HAXB 1SGRE 1A46H 2P16A 1QBVH 4NZQA 1P57B 2JETB 1C4Y2 1TA2A 1T4UH 1GBFA 2QN5T 5FAHA 3SU2A 4YT7H 2GKVE 1UTMA 3MNXA 2ZPSA 1PMLA 1TNIA 1B0EA 3OU0A 3SV6A 1SQAA 2Q8AA 1BJUA 5GCHG 2QA9E 1E36B 2XBYA 2C8WB 3PMAB 9ESTA 1YPHE 4AX9H 2W5EA 4WXIA 3ZVEA 5L30H 1YBWA 4YESB 1GHBF 3DFLA 4WF8A 1E34B 1EAUA 1P9UA 4IGDA 2GP9B 3VPKA 1N6XA 4FU7A 1YF4A 3SUEA 2BY9X 2ZZUH 4OS6A 2A5AA 2EI8A 1S5SA 1GHAG 4A6LA 2ZA5A 1A0HB 3A86A 4FVDA 4U32A 1C1UH 1TGCA 1LQEA 1ANBA 3E16B 1O2JA 2SGPE 1LQDB 1WQVH 3KQBA 4WMEA 1TPKA 1P10A 2Z9GA 1L2EA 2HRVA 6LPRA 2CJIA 4OS1A 1Y8TA 3SNBA 4KELA 3RU4E 1FY4A 2BD4A 1C5SA 2GZ8A 4AN7A 2VWOA 1VJAU 4YOJA 1HKYA 2GD4B 1AB9C 1OP0A 1O2SA 1YM0A 3HK3B 4JZEH 1OPHB 1F2SE 1WTHD 2BVXH 4NIWA 1O2PA 2ZGJA 1MTUA 2PR3A 1F7ZA 1AKSB 2BDIA 3RXDA 1QL8A 4MVNA 3G01A 2OC0A 4F49A 1H9IE 1EQ9A 1UCYH 2H6MA 1G37A 3EE0B 3MH7A 5FPTA 1AFQB 1JWTA 3A7TA 1NRPH 2NWNA 3MOCA 3TNSA 1O5GH 2ESTE 2FEQH 5JPMH 2G52A 1TFXA 4CHAB 1IQLA 3GY5A 2NU1E 4XOJA 1FY8E 4INLA 4UONA 1IQJA 2R2MB 4KTCA 1GDUA 3AASA 2YIOA 2WV4A 1BMMH 1W2KH 3BTWE 3A80A 2J34A 1O2VA 4DIIH 4VGCC 1C1VH 1J17T 2DUCA 1GL1A 2PW8H 1FMGA 1AVWA 2RA3A 1UVOA 2OXSA 1DT2A 3K6YA 1YC0A 1SC8U 2VIPA 1EPTB 1ELDE 1TPOA 4YO9A 4CH8B 5JB9S 1QNJA 1M9UA 1JRTA 1X7AC 1O2IA 1DPOA 1BRAA 1YPJH 4Y7BA 5E0GA 1XUHA 1CQQA 1CA8B 4MNVA 1YPEH 1XUFA 3E8LA 2QF3A 4A1VA 2YIPA 4APLA 1DXWA 2HLCA 2PKSB 3SU0A 3T2NA 4ABDA 2BLVA 2F9UA 1P2KA 1GBKA 1N8OB 3RC6A 4Z6AH 3GDVA 3RXFA 3BT1A 2XWAA 1SGPE 4AGKA 1UVPA 2H9HA 4O97A 1INCA 1BCUH 1O5DH 1SSXA 2GCTB 4GCHG 3PMHB 1W81A 4R1CA 3F9HA 3N7OA 3T28A 2IN2A 2ZKSA 1O33A 3B9FH 1XVOA 4XE4A 1H8IH 4AYYB 4Z0KA 1OOKB 5E2PA 1ESAA 3BIUH 3CENA 1NZQH 3LH3A 4X8TH 3E0NB 2UWLA 1DY8A 1EUFA 4WJG2 1O3IA 1P0SH 1FDPA 1W14U 1KDQA 3R0FA 1EP5A 4NIVA 5C1YA 2H2ZA 3SHAH 1V2PT 1AN1E 2FTLE 3PROA 4JK6A 2HNTF 5ETXA 4B73A 1TOMH 3ATIA 1TX8A 1YP9A 1A2CH 2HPQP 1C5NH 2R3UA 4UFFH 4AFZA 4U2WA 2C8YB 3GOVB 3LGYA 2ANWA 1KXEA 4JK5A 1GI6A 3SV8A 3UWJH 4BAQB 5EXLA 2NU4E 1AU8A 4YTAA 1SGYE 3VFEA 2CGAA 3ATMA 1YLDA 1C2MA 5EW2H 1KIVA 3URCA 3D49H 2PGBB 2FX6A 1SOZA 2J9NA 5IYTA 1HAGE 2A7JA 3EA7A 5DP6A 6GCHF 1XUGA 2ODPA 3NCLA 2ZFRH 2DOHX 4K69A 1HJAC 1SGDE 3RLYH 3TK5A 2A4QA 3ODDA 1TLDA 3JZ1B 2Z3CA 1MD7A 1THPB 5JB8S 2OBOA 1UTLM 2DE8A 3LJJA 3BTTE 4X8UH 1GVKB 1QRXA 1G3EA 1GJ5H 3SU1A 3P6ZB 4ABFA 3M36A 2G5NA 3MKPA 3MO6A 5H4IB 3LAQA 2XC0A 1HB0B 1TX6A 1C5ZB 1OYQA 2WPKS 1F0UA 1HAIH 9LPRA 6ESTA 1CT0E 3P8NA 1J16A 1KTSB 1C1PA 1CHOG 1KIGH 1RFNA 1OYTH 4ZHMU 3SHCH 2J2UA 3F9GA 1WV7H 1KXFA 4ZXXH 2A7HA 3U8RH 1O2TA 1TNHA 2BDYA 1KDUA 5EGMA 3P8FA 3MU1A 2FTMA 1A7SA 4NA7A 2XW9A 1ZRKA 2FP7B 1A0JA 1QIXB 5CHAC 1C5YB 3KCGH 4MLFB 1KI0A 1GI2A 3RXCA 4UDWH 3NXPA 1TPAE 5FBIA 3S7HB 1EJNA 3KL6A 2BD3A 2UUKB 1O38A 5CS1A 4BVWA 3B8JA 4SGBE 4BAMB 5A09A 3SU4A 2JH5D 4J1YA 1F5LA 3KF2A 3QGJA 1SLWB 4IC5A 2FOMB 5EQQA 3LIWA 2Z94A 1FQ3A 1GBCA 1C1WH 2VWNA 1GGDB 1TMUH 4GCHF 3UOPA 1C5VA 2WUBA 1NO9H 2UUJB 4MQAA 1OKXA 1BJVA 4WY3A 4UD9H 3U8OH 4I8KA 5A8YA 3M7UA 1NU9A 1DOJA 3V12A 1O3KA 4AYVB 4JZFH 3ZZ4A 1CT2E 5E0HA 1O2HA 2ZDNA 4YT6H 2J94A 4FXGH 3LU9B 3SZNA 1SLUB 3S69A 1P02A 1Z8JB 3W95A 3S9AA 3URDA 2GVFA 4NIXA 3BTHE 4A1TA 2A5IA 1ZPBA 3SQHE 1C2GA 3HMSA 3QDZB 4K1SA 3UFAA 3HKIB 4E05H 1P9SA 1O2MA 1LVYA 2PF1A 2ZTXA 3A88A 3PO1B 3ZZDA 4IN2A 1PQ7A 2ZU1A 2BD9A 4Y0YE 4AFUA 4WVPE 5DP3A 5F8XA 2ODQA 3BTFE 1GG6B 4OS7A 1O5BB 1V2VT 7LPRA 4KKDA 1PQAA 1GBMA 4M7GA 1P01A 3FP6E 1GHWH 1VZQH 3HKJB 4MPVA 3GCHC 1SGEE 3MMGA 3RXUA 3ZZ7A 2LNCA 1KDQB 1GJ6A 1CGJE 1ETRH 1XXFA 1AVGH 1Y5UT 4A1XA 4ISLA 2C90B 1NU7B 2L0SA 4XFQA 5F03A 5AVDA 5J4SA 1C1RA 1SL3A 2JH6D 1C5RA 3QO6A 1ZJKA 1RTLA 2P94A 2FLRH 1TRMA 4O3UA 2G81E 1QB6A 4DT7B 1EZQA 1P03A 1DX5M 1O5EH 2GMTC 2WPJS 1V2NT 2QCYA 1GBBA 1CHOF 5FXLA 2GT8A 3LJOA 5F8TA 1ANDA 4WH6A 5GDSH 4NFEA 5TCAA 4Y8YA 2ZP0H 3H7OA 4H4FA 1ZTJA 3VB4A 3C27B 2BD5A 1O3FA 3QTVH 1C5XB 1O3AA 1LKAA 2SGDE 1G3DA 2EI7A 2WYJA 1C5UA 3H7TA 4X6MA 1GI0A 1OWJA 3TU7H 4JYVH 3KHVA 1EATA 1AWHB 1QQUA 5GWZA 1DS2E 1SLVB 1SLXB 1O3DA 2FOHA 2ZGXH 3E1XB 3BTEE 4U01A 1ZLRA 2GT7A 5FPYA 4CRAA 1K1PA 1FN8A 2A45B 2QV1A 1O3CA 1BRBE 3TH2H 5DPAA 4OS4A 3I77A 2F83A 3A8BA 3SJKA 2PKAA 1BITA 1QURH 2ZG0H 1Z8IB 4THNH 2V35A 2CHAC 4YZUA 4HTCH 4Y79A 3UTUH 2BYAX 1DFPA 3M5NA 1ZSKA 4Y0ZE 2K4RA 4Y11E 3F9FA 1BTPA 3ITIA 3BT2A 4O3TA 4X1RU 3PLPA 3ZYDA 2PTNA 4NGAH 1YGCH 4FUGA 1P2MA 5EW1H 1YXEA 1UK2A 2J95A 2AGIX 1A0HA 4JZDH 1TNGA 2A7CA 1AGJA 1TBRH 3PWCA 1EB1H 1G30B 1O5AB 3MO9A 4TY7A 1QFKH 4E7RG 2LPRA 1GBAA 2FPZA 2AYWA 1O2WA 3M5LA 4YLQH 3RDZA 3EYDA 4ABIA 1NL2A 3SORA 2ZGBH 2ZWLH 1ZHRA 5DP8A 5T6DA 2BY8X 1XUJA 1MZDA 2SPTA 3VB5A 1F92A 5CT1A 3FP8E 4B75A 1T8LA 2OQUA 1TGBA 1C5MD 3E91A 1GCTB 3H5CB 2FOEA 1MAYA 3SNCA 2O8WA 2Y5FA 1T8MA 3BEFB 3BV9B 2XNIA 4MPXA 4A5TS 1FPCH 1ELVA 1SFIA 2SGQE 1LDTT 1PK2A 1O3NA 5HGGA 2D26C 5LPFA 2OUAA 3M5OA 3O8RA 3EDXB 1W11U 2QYIA 2FOAA 1Z6JH 2J8LA 1AY6H 5EG4A 4KTSA 1SFQB 3K2UA 1AVXA 1CU1A 3L6PA 1BBRE 1FIWA 3ZZ6A 1EJMA 4BAOB 1L4DA 1CBWB 3RXAA 4D8NA 1V2JT 1A3BH 2NU0E 4X2XA 1V2UT 2ZDKA 3TJVA 3RXGA 1C5PA 4BAHB 1BBRH 1HCGA 1PQ8A 1D9IA 1SBWA 3M61U 3SP8A 3ZVAA 1RIWB 1GHYH 1MH0A 4TPIZ 2OQ5A 2RCEA 4YOIA 1SGTA 1Z1IA 1ARCA 1BUIA 3TK6A 2XBXA 1AUTC 3P92A 5I25A 3SGQE 3ZVFA 3V7TA 1OWHA 3TVJB 3SV9A 1ESTA 2VINA 2BY6X 1HV7A 1DICA 1WU1A 3AW0A 2BY5X 3EA8A 1IQKA 1P06A 3KNXA 1GI7B 1C5TA 1A5IA 3TITA 3VXEH 1UTJA 1V2KT 3Q77A 2J38A 1NFWA 3EQ0H 2G5VA 2O9QA 1CEBA 6CHAC 7KMEH 1DE7H 5LH8A 1K1MA 2UUYA 1QRWA 4JYUH 1KTTB 3RMNH 1SQTA 4ABBA 3AAUA 4CRBA 2JH0D 1HPGA 5IDKA 2F9NA 2R2WU 5T6FA 1YPLH 3FAOA 3A89A 1T31A 3FVFB 1AI8H 3OSYA 3MNSA 2BQ6B 1B2IA 2HGFA 4IMZA 5HPGA 5L2YH 1AHTH 1FLEE 1E37B 3SN8A 1AZ8A 1HAZB 2BLQA 1HAOH 4SGAE 1PQ5A 1S81A 1IAUA 1ABIH 2LL3A 2PKAB 3AAVA 1YYY1 1RS0A 1EOJA 2BDBA 5EQRA 3QWCH 3HK6B 1GI5A 1MMJN 1D6WA 3OY6U 3RXIA 5CS3A 1W12U 4MTBA 2OC7A 2HPPH 1FN6A 1ANCA 1IQEA 4TPYA 4GHQA 3RXOA 3RXLA 2SGAA 4TWWA 4ZROA 2BB4A 1MTWA 5G4BA 1S6FA 2AMPA 5GIBA 1O37A 3F6UH 4X1PU 2TGDA 1ZR0A 1MCVA 1QR3E 4IUAA 5DP5A 1S82A 2XRCA 1CA0C 2Z9IA 3EAJA 3NKKA 1MZAA 1TNKA 2GV6A 2FD6A 1KLJH 1W7GH 2Q6GA 4HFPB 3C1KA 2I6QA 1TWXB 1GMNA 1MCTA 3SI4H 3SU3A
chains in the Genus database with same CATH superfamily
4Y8XA 1O2QA 4ZKSU 1OWDA 2WPLS 1GJ8B 5C2ZA 5CP9A 3VG8A 1LHCH 2QXIA 2ZF0H 3P8OA 4YXWD 1E38B 1QBNA 5A8XA 3SV2H 4APMA 1BTZA 2BQWB 4DVAU 5DO4H 3RMOH 4Z0DA 1MTNB 3MU8A 1ELGA 1TBZH 2Y6TA 2IPHA 3M7TA 1BRUP 4KGAA 1BQYA 3CP7A 2Z3EA 1BTYA 6GCHG 1GBLA 2A1DB 1AE8H 3A87A 1SHYA 1IQIA 4MPWA 3QK1A 3RXSA 4R19A 4FU8A 2STBE 5FX5A 2BQ7B 1J9CH 3BG8A 1XUKA 3MQKC 3DSPA 1V2ST 3SJ8A 3BN9A 5ESBA 3RC4A 8LPRA 3TJOA 1H9LB 1ELBA 1GI3A 5FCRA 1FV9A 1VITG 3SNAA 3M3SA 1HJ8A 3N7EA 2P8OB 2Z9LA 1HAVA 3DT0H 3LGUA 4FUBA 3A82A 4UAOA 3MH6A 1KY9A 4X1QU 1DITH 1HXFH 3F2HA 1K1NA 1OX1A 2ZHQH 2Q8BA 1C1MA 1O2GH 2BD7A 4MG3A 4AG1A 2ANYA 4AGJA 4M9FA 4ISOA 3PB1E 3RMMH 3T25A 1O3JA 1D3PB 1C2EA 5EXNA 4ABAA 1S84A 2XNDD 1EB2A 1UK3A 2ZDLA 2AIPA 1FJSA 2FI3E 1F0SA 3VEQB 5CT3A 3VB7A 4NFFA 5EPYA 1C1NA 3PYHA 3RU4T 2SGEE 1F0TA 4DIHH 3A7WA 1ACBE 2ZNKH 3RMLH 4KTUA 2Z8VA 2BHGA 1Z8RA 3M37A 1ZGVA 4Z0EA 2JKHA 4IBLH 2R0KA 4FUIA 1O3MA 3ZZ8A 2VNTA 2D2DA 4IN1A 1AZZA 1T7CA 5GNDA 1WQSA 2GV7A 2PUQH 4ZMAH 2H1UA 1EZXC 4Y8ZA 3ELAH 3SNDA 1P09A 2FOFA 2HPPP 3VGCC 1THSH 2DOIA 2VJ1A 4X6NA 1NFUA 1O35A 1F5RA 3GCTG 3T26A 1FNIA 5F8ZA 2FWWA 3UNRA 2PP6A 4P02A 2FYRA 1HPKA 2HOBA 2WPIS 3IWMA 5EXMA 4KIVA 1UVUH 1YCPM 1C4V2 1EX3A 3TPIZ 1C2LA 2ZU5A 3AVZA 1BMAA 2DE9A 2M5TA 5J4QA 2PLXA 1C2HA 2HNTE 3GDSA 2FESH 1MKWH 1DUAA 3OAAD 3IITA 1UW7A 2C8XB 1NRSH 2WYGA 2J98A 3TIUA 3RXPA 5JYIA 1AE5A 1H1BA 2PSXA 1GMCF 2SNVA 2FZZA 1KYNA 3ESTA 5SGAE 4FUHA 1B5GH 2C3SA 4ZXYH 1ZMJA 5DKMA 4Q80A 1S85A 3F3BA 3BF6H 1TQ7B 2PWXA 1G36A 1DSUA 5DG6A 4OGYA 3GY2A 3ZIAD 2FLBH 2UWPA 4B74A 5TJXA 4ZHAA 2EA3A 5GJ4B 5A2MH 2VGCB 3GY7A 1V2OT 2XC4A 1VGCB 1W8BH 2ZC9H 5EJLA 2BX4A 2BY7X 5CHBA 5I46H 3V0XA 1VITF 2RDEA 2VH6A 1TRNA 1JIMA 1QB9A 3ZVGA 2CF9H 1UMAH 3QZRA 5FPSA 1A1RA 3T5FH 1VKYA 1NM6A 3E6PH 1W8KA 1S83A 4NWKA 3BG4C 1DWDH 4K2YA 2BLOA 1GJ7B 2GGVB 4GSOA 3NUMA 1L1JA 2O8UA 3KQDA 1SKYE 1O2XA 1UTPA 2ZECA 3U1JB 1V3XA 2F9OA 3D65E 3ZVBA 2VVUA 4TWYA 4AORA 5JBCS 5C0UA 4JMYA 1K1LA 1O2UA 2AH4X 2O8MA 2W3KA 2TRMA 2ZFTA 1AO5A 1C4U2 1P2QA 2CN0H 1HNEE 2JETC 4BVCA 1PKRA 4F4OC 4P00A 3GISB 7ESTE 2B8OH 3RXMA 4NZLA 3MH4A 3S9BA 5LPRA 3RU4D 2KFWA 1DUEA 4CR5A 2ZU4A 1KLTA 4B1TA 1GCDA 1A3EH 3WWBA 2GX4A 4DJZB 1HAVB 4B6FA 2TIOA 4WMDA 5EQSA 4UFEH 1KRNA 4ABGA 2V0BA 3F1SB 3UQVA 2K13X 1MD8A 1WAYB 5E8EH 5ABWA 3E0PB 1ZYOA 1H8ED 1Z71A 3GCNA 1Z8GA 1GJ9B 3GCTF 4ZUHA 4UV6A 4PROA 2G55A 2TGPZ 3CS0A 5COEA 2G4TA 1C5LH 1BBRK 5K0HA 1HJ9A 1LHDH 1QJ6B 2Y80A 1Q3XA 4Q2KA 4ESTE 4BTIB 3MHWU 1OSSA 1EKBB 4Z1MD 1EZSC 1BMLA 3NRLA 1D3QB 3UREA 3SJ9A 1O2RA 4UEHH 1SMFE 1XX9A 2W3IA 1TRYA 4X8SH 2VIVA 5EPNA 1CEAA 4NG9H 2ZQ1A 1MKXH 2VIDA 1CT4E 1CVWH 2IJOB 3RXKA 5EU8A 1O30A 3A7XA 1HBTH 1O2OA 2PTCE 1ZTKA 5AFZH 1NFXA 2THFB 1AFQC 4Y6DA 1AMHA 4FVBA 4IS5A 1YPMH 3ZV8A 2A31A 3T29A 3RXVA 4CHAC 3UY9A 5GXPA 1FONA 2ZHWH 4WH8A 5CS5A 1XKBC 2EY4C 5L6NH 1TBQH 1NN6A 1NS3A 1J14A 3O8CA 4H6SB 3RXEA 1AIXH 3SOSA 3TJUA 1P3CA 1C1QA 1Q31A 1KXAA 1JRSA 3QZQA 2J98B 1PPCE 1P2OA 1BHTA 1QRZA 2AGEX 5DP4A 5C17A 2OBQA 1EPTC 2ANMH 2QY0B 2Y8RA 4NA9H 1PPHE 1TONA 2AGGX 1QL9A 4OS5A 1WYKA 1K22H 2I9AA 2HWLB 5LPEA 2G4UA 1YPHC 2FODA 4R0IA 4MNYA 2H5DA 1PPZA 1O39A 1O2LA 1C5QA 1VCQA 4BTUB 1CGHA 1TALA 3OTPA 1AB9B 4K8BA 1TGNA 4LXBH 1UTOA 4RT1A 1URKA 1UTNA 2PKSC 4X1SU 2A2XH 3A8DA 2AS9A 2P3UB 1O5CB 1GDNA 1N8OC 3BSQA 1GI9B 8GCHG 1P3EA 4GVUA 2P59A 1RGQA 5C5OA 5EJZA 3SUFA 1C2JA 3S0NA 2ZDMA 1DM4B 3ZV9A 2CXVA 1YKTA 3BTKE 1ETSH 1FAKH 1SVPA 1GL0E 4FOUC 2GCTC 2LELA 4WMFA 2ZDAH 2CV3A 3MNCA 1QY6A 1V2WT 5DSFA 1Y5AT 2BZ6H 2J92A 1ZJDA 3A8CA 1GBEA 3TGJE 2JJ2D 4BTTB 1BHXF 1CE5A 1HIAA 1P2NA 3LH1A 3ENSB 4NIYA 3DD2H 3VB6A 3KQEA 2ANKH 4BAKB 2F9VA 3E90B 2F4LA 4VGCB 4AB8A 2I9BA 2Z8WA 2XBWA 3ZZBA 1QHRB 3ZZ9A 1O31A 1QB1A 4ACAA 1FI8A 1O34A 4Y76A 1DVAH 4LZ1H 1OS8A 2VIOA 4Y7AA 1Y3VA 1LPKB 2FOBA 1HXEH 2PGQB 1TGTA 2YOLA 1SPJA 3PWBA 1BTHH 3DHKH 4Q63A 3QX5H 1KXDA 1O2KA 4IW4E 4YM9A 1LHFH 2BZAA 1DLEA 1QJ1B 1S0RA 3F0PA 1JXPA 3NWUA 1FUJA 4CRDA 2P3FH 1VCWA 1T32A 1TIOA 2A5KA 3RM2H 3DFJA 5HXFA 1C1SA 1L1NA 4JYTA 1E1RD 1YCPH 1AUJA 2VIWA 2WPHS 3OTJE 2BOKA 2Y7ZA 1ZHMA 2ZCHP 3SNEA 1WSSH 5TCCA 1TABE 1TGSZ 2KNFA 1G3BA 1MBQA 3PTNA 4XDEA 1C1OA 5AF9H 3SYJA 1MU6B 1LKBA 3F2GA 4Z0FA 1EASA 2BX3A 1EAIA 1UVTH 2ZCLP 1LVMA 2RFKC 2VVCA 2Q6FA 2Z3DA 2OC8A 3WY8A 2GZ7A 3LC5A 4ABJA 3A83A 4X2YA 1CGIE 1G2MA 4CREA 2BDCA 4QT8C 4X6OA 3RXTA 4CBOA 2BOHB 1PPGE 3KEEA 1GJAB 1MQ6A 2QGRA 3ATKA 1QA7A 1TOCB 1W0YH 1ANEA 1YPKH 2AEIH 4KP0A 5HIYA 4GLYA 2FI4E 3ZZCA 3SU6A 1JMOH 3GICB 1S6HA 3DUXH 3MU0A 1RD3B 3HGPA 5ESTE 2V3HH 1P12E 3VXFH 1GHVH 3IG6B 3KIVA 5C1XA 1MABB 2Y5HA 1A0LA 1ARBA 2ZIQH 4LOYH 1XUIA 1T8OA 2RA0A 5KECA 2GZ9A 4UFGH 1FPHH 1Y3WA 5C1UA 1GBJA 1YLNA 3STJA 2ODYB 1ZPZA 3UR9A 2KAIA 5F6MA 5FCKA 1EFRD 2HVYB 3Q3XA 2PV9B 8GCHF 3UB0A 1E0FD 1MTSA 3S7KB 1ZRBA 1PPEE 2QF4A 3RXHA 1HJAB 1LVOA 1MTVA 1GMDF 1MKWK 2O8TA 4FU9A 3GY3A 1GGDC 2J97A 2Z9JA 2JDID 4DCDA 1IQFA 1ZSLA 2BVSH 1FIZA 2HGTH 2CF8H 4D9RA 4TY6A 2GCHG 3MFJA 1DY9A 1FY5A 3M7QA 1AWFH 2L74A 1IQNA 1JFNA 2AERH 1GJDB 3PLBA 1HYLA 1NFYA 4K3JA 2V6NA 3LGIA 3R3GB 3LGWA 4I8HA 4AOQA 2GJGA 2Y82A 3MU4A 1NROH 3AW1A 1YPGH 2SNWA 3RXBA 1LVBA 2W7SA 4X0WU 1HRTH 4CRGA 4AZ2B 1ZMNA 4INHA 4ZKRU 1ELCA 2P3TB 1ELAA 1JIRA 2OLGA 3RXJA 5L2ZH 1TQ0B 5DK1A 2STAE 1VR1H 2JIZD 2TGTA 3E6PL 3PO1C 4BVDA 1KXBA 1SGIB 2L6OA 2B9LA 4E7NA 4ASHA 2F9PA 1BDAA 1WUNH 2A4OA 4FUJA 4D7FA 5CHAB 1W0ZU 4YLUA 4ZAEA 2ZFQH 1P2IA 4ISHH 1BTWA 2V3OH 3ATLA 1BIOA 1GG6C 5AFYH 5CE1A 1VJ9U 5C20A 1OP8A 2IOTA 1D3TB 4B2AA 1MQ5A 3LC3A 1HIAB 1FAXA 1OXGA 2ALPA 2PHBA 4AB9A 3A8AA 4FUCA 2ZPRA 1UTKA 2Q6DA 1ETTH 2BTCE 3PV5A 2VVVA 1GPZA 1GI8B 1EAWA 3D23A 1TYNA 4HGCA 1HDTH 2P93A 1WOFA 3A7ZA 2PSYA 3BTGE 2BLWA 4ZH8A 1UHBA 2R9PA 2C8ZB 1RRKA 2CMYA 4A7IB 3HMTA 1W10U 4RKOB 5HM9A 5IK2D 2XYAA 4ISNA 4JZIA 4E06H 2B0FA 2HPQH 2WUCA 5CMXH 1KLIH 4RI0A 3T27A 1OWKA 4DG4A 5C94A 1SQOA 4UFDH 1O32A 1SGCA 3MNBA 1E35B 1E1QD 1GMCG 3P70B 3UNQA 2RDLA 1NTPA 5FBEA 3TNTA 2XCNA 1U6QA 2B7DH 3KN2A 3NK8A 4Z09A 2FM2A 1SI5H 1GBHA 1PK4A 3L33A 4OS2A 2Y5GA 3PV4A 1SQRA 4H42U 1V2MT 1ABJH 1BA8B 1AQ7A 1H4WA 1GWAA 1UCYE 1IQHA 1AFEH 1NBME 3O8DA 4CIKA 2F3CE 3RLWH 1F5KU 1MUEB 1DWCH 1GMHG 1FY3A 4K1TA 1Z40A 5A0AE 3MYWA 1HUTH 3GCHB 2VWMA 4UE7H 3SU5A 3Q3KA 3A85A 1L0ZA 2EC9H 2BDGA 4FUEA 3W1EA 1V2TT 2GCHF 1ORFA 1V2RT 1OWIA 2YMSD 1J15A 2ZHFH 3UPEA 2ZO3H 4I8GA 1DLKB 3HN4A 1K1OA 4D3CA 3SJOA 1MKXK 3RC5A 1CO7E 1GHZA 5T6GA 2BM2A 2F43B 1BRCE 1K9OE 4R1BA 2GMTB 1DANH 3LOXA 1GVZA 4GPGA 3ATWA 2PK4A 4BOHA 1HLTH 2I6SA 1BZXE 3FN8A 2ALVA 4BVVA 1ZOMA 2AIQA 3M3TA 1QA0A 3TK9A 3TGKE 1BT7A 1EAXA 1C2IA 2AMDA 5JDUB 2KAIB 1RJXB 1Z7KA 2BXTH 2J4IA 4LZ4B 1LTOA 4AG2A 1I8NA 3LONA 2Y7XA 3UWIA 1H8DH 2ILNA 3CS7A 1HAPH 1P05A 2LL4M 4LK4A 1SHHB 3A7YA 3UOUA 2O8LA 4D76A 2QXJA 4CH2B 2JJ1D 1O2ZA 2ZTYA 1TAWA 1SGNE 1GDQA 1GP9A 3DA9B 1P04A 1GCTC 2XCFA 5EIYA 5GCHF 3T62A 1HAYB 3SO3A 8ESTE 1V2QT 2XWBI 3ZZAA 5CSQA 3ZLEA 3B23B 1P11E 2CHAB 2EI6A 4ASUD 1MU8B 3UNSA 2C93B 4HI3A 2XC5A 1MBMA 1O3OA 2D8WA 4FETA 2ZFSA 4JZ1A 5AHGH 4XBCA 3Q3YA 1JBUH 3OX7U 2QC2A 1FZZA 4I31A 1GHAF 3SBKA 5JBTA 3PMBB 3GY8A 1QJ7B 1T8NA 4K8YA 1NC6A 1O2YA 4X6PA 4K5ZA 2ZHEH 4NCYA 5E0JA 3A84A 5PTPA 3U9AH 4A92A 1CBWC 1GBIA 1OWEA 1TMTH 4AFQA 2ZEBA 2ZDVH 2A4RA 1Y3XA 1C5WB 4ABHA 5CDFE 4I32A 2GTBA 2OINA 3PM3A 1N1LA 4D7GA 1WBGB 2VH0A 3M3VA 3U28C 1RIWC 1OP2A 4CBNA 1EOLA 2QAAA 3WW7A 3BTME 1THRH 2VIQA 4B2BA 3ZYEA 3V13A 3LKWA 3MU5A 1GMHF 3S9CA 1UHBB 5F53A 1GBTA 1GI4A 1D3DB 4IC6A 2KX4A 1QL7A 1HPJA 1O5FH 1UVSH 2TGAA 1BMFD 2W7UA 1UO6A 4NWLA 1DXPA 5CS9A 5A0CA 4AC9A 1A4WH 4B76A 1QGFA 2BD8A 2ZFFH 2Y81A 3SJIA 2BMGB 1YCPK 4BANB 1S6LA 1TNJA 1VITH 1Q2WA 4ABEA 1QQ4A 2FOCA 4XSKU 2YMSC 4X2VA 2V3MA 4X8VH 1Y3YA 3P8GA 1RTKA 3SI3H 5EOKA 1UK4A 1DDJA 1O3HA 1TPPA 4H6TA 3LT3A 2QIQA 3BTDE 3GCOA 3P95A 1GMOA 2NU3E 1K1IA 3MTYA 5DP7A 3GY6A 1IHTH 1ELFA 2ZGCA 4RKJB 1C1TA 1GHXH 5A0BA 2R3YA 1ZSJA 1C5OH 4NA8A 2FIRH 3MI4A 5C3NA 2WV5A 5A8ZA 1EJAA 2BDHA 3LGVA 3HMRA 2FXRA 1Z6EA 4BV5A 4WXVA 5HYOA 3VB3A 3MWIU 1G32B 4NSYA 5DN6D 3GYLB 1C9TA 1TNLA 3F68H 1K0HA 4CR9A 2K1QA 2KCYA 4I33A 4I7YH 1O3GA 1D4PB 1O3PB 1TX7A 2YNAA 1NESE 2FO9A 1BTUA 3QN7A 1BOQA 2OP9A 1PPBH 3EE7A 3ZWZA 1W3CA 3RP2A 4ZKOU 1RTFB 3KQ5A 2UUFB 6CHAB 5HM2A 3SZEA 2K51A 1O3BA 4B2CA 2FDAA 5E2OA 2QJ2A 2QXGA 5CT2A 1SG8B 4GUXA 2J8JA 4IMQA 2D1JA 4ZHLU 1DSTA 2YNBA 3PTBA 1SGFG 3PMJA 1NL1A 4J2YB 2Z7FE 4F55A 4Q7YA 3SV7A 1MTNC 4DW2U 2YILA 2QF0A 3FANA 4MDSA 1HGTH 1G9IE 1GJCB 3V3MA 2H9EH 3ZZ5A 3BEUA 1LPZB 2HLDD 4K1EA 2H5CA 2FEBA 4HZHA 4GAWA 3SUDA 1NRNH 1FX0B 4XBBA 1A5HA 5B6OA 2A0QB 5C67A 1CHGA 1XM1A 1AD8H 1NY22 1P2JA 1UTQA 1LHEH 2WINI 4O03A 3SUGA 4DT4A 1K1JA 4OGXA 1RXPA 2WSSD 3TLOA 7GCHG 1F0RA 5K7RA 3TH4H 4DOQA 1SB1H 3UQOA 1DWBH 1K2I1 1BTXA 3K65A 2F9BH 1ELEE 1W0JD 1PYTD 2P8OC 1C2KA 2KCOA 4Q7ZA 3D62A 4BXWA 3U69H 2G00A 1EP6A 4ACBA 3K6ZA 4XBDA 2XBVA 5FX6A 1UJ1A 1YLCA 1V2LT 1PPFE 2OD3B 1WTGH 1CA0B 2TBSA 2FYQA 2FOGA 2ZU3A 2VU8E 3BEIB 5JBAS 3F9EA 3KIDU 2Q1JA 3RXRA 1EZUC 4INKA 1K21H 2AMQA 2ZU2A 3OFND 1SGFA 4GHTA 1S0QA 1TA6A 1ELTA 1T4VH 3TGIE 1PMKA 2ZHDA 3L3TA 2A32A 3EA9A 3M5MA 2P95A 2KJ4A 2QJ4A 1G2LA 1Y59T 1DWEH 3U8TH 1P8VC 1SR5C 1BB0B 3GDUA 1LHGH 4RSPA 4NSVA 1Z1JA 3ZVDA 1Y5BT 3NZIA 3W94A 1TE0A 1TPSA 3I78A 1GMDG 2TPIZ 1PFXC 1HAHH 2SFAA 1FY1A 2VB0A 3SGAE 1NPMA 3U98H 2G8TA 1NRQH 4BXSA 4D9QA 2FI5E 1W13U 1ZZZA 3Q00A 3LPRA 5DP9A 2GDEH 2Z9KA 4WWYA 5DGJA 4Q7XA 5EODA 5DJ7A 3RXQA 2WPMS 1CSOE 3MO3A 3RUOA 4FUDA 4U30A 1WCZA 1A61H 3JZ2B 4CRFA 3PV2A 2F91A 2OTVA 1KSNA 3FZDA 4YOGA 1LMWB 1GBDA 3TH3H 1NT1A 2ULLA 4I8JA 1D6RA 2AFQB 2HVXA 1QCPA 2B5TB 2NU2E 3U1IB 2UWOA 1I71A 1O3LA 1O3EA 1QBOA 1GI1A 1LPGB 1EXFA 1NRRH 3I29A 1SOTA 2K8IA 2PF2A 1UCYK 3K9XB 4X1NU 2ZI2H 2VWLA 5BRRE 3M35A 3SQEE 2EEKA 1ZMLA 2ASUB 3O8BA 1K28D 2XTTB 3BIVH 3UUZA 1HFDA 3GY4A 2Z6BD 1J8AA 3SRJA 2BDAA 3RM0H 4RN6A 1MAXA 2A2QH 5T3HA 2PFEA 1L4ZA 1QTFA 4TYDA 3ZZ3A 1IOEA 2RG3A 1C2DA 4I86A 2FMJA 3SGBE 2VGCC 1JOUB 3FP7E 1VGCC 4R1AA 3KGPA 3UAIC 3UR6A 3FFGA 2C4FH 1A5GH 3OY5U 3EGKH 7GCHF 2QXHA 4DURA 1AKSA 3HGNA 3SW2B 4DGJA 1V6DA 1O36A 1ESBA 3FZZA 4OM9A 2A4GA 3HPTB 1GJBB 2FS8A 2PUXB 1H9HE 3QGNB 3HATH 3VGCB 1GHBG 3BTQE 2QF5A 4B71A 2FX4A 1TMBH 1SGQE 1B7XB 3OYPA 3Q76A 4CRCA 1ZGIA 2XXLA 1IQGA 3ODFA 4ZKNU 1PYTC 4FUFA 1LCYA 1N6YA 4JCNA 3LGTA 3QTOH 4Y10E 3F2FA 4DY7B 1VCPA 2ZCKP 1Y3UA 5EJ1A 1TB6H 1XXDA 4ISIH 5GPIB 3SRIA 3TJNA 5FHTA 8KME2 1G3CA 5BPEA 3QUMP 2H9TH 5LGOA 3P17H 3PLKA 2WPDD 3U73A 2SGFE 5T1VA 1O0DH 4K60A 3NPSA 1PJPA 1EPTA 3QLPH 3LDXH 1BHXB 2X2ZA 3A7VA 2ZPQA 1GJ4H 2OC1A 3K65B 3MH5A 1O2NA 4BNRA 4MPUA 2ZQ2A 4YIZA 3KQCA 1ZPCA 2W26A 1C2FA 4MNWA 1LO6A 2BD2A 2HNTC 2K0QA 4I8LA 1NK1A 5HMAA 3UIRA 3STIA 1L1GA 1XMNB 4O9VA 1GVLA 1XVMA 2HALA 3A81A 1I5KA 2ZFPH 1C9PA 1KXCA 4AFSA 1ZTLA 1ID5H 3BG4B 2OCVB 5JBBS 2IPQX 2VBCA 1XKAC 2R0LA 2BVRH 2FS9A 2GDDA 4R8TB 1W7XH 2ZTZA 1IHSH 3E3TA 2ZGHA 1FXYA 2G51A 3ZVCA 1ZHPA 1IQMA 5KEDA 4BV7A 4MNXA 4Y71A 2BXUH 5C5NA 4X2WA 1BMNH 1B0FA 3GYMA 5C0TA 1HAXB 1SGRE 1A46H 2P16A 1QBVH 4NZQA 1P57B 2JETB 1C4Y2 1TA2A 1T4UH 1GBFA 2QN5T 5FAHA 3SU2A 4YT7H 1OHHD 2GKVE 1UTMA 3MNXA 4HG6A 2ZPSA 1PMLA 1TNIA 1B0EA 3OU0A 3SV6A 1SQAA 4XRNA 2Q8AA 1BJUA 5GCHG 2QA9E 1E36B 2XBYA 2C8WB 3PMAB 9ESTA 1YPHE 4AX9H 2W5EA 4WXIA 3ZVEA 5L30H 1YBWA 4YESB 1GHBF 3DFLA 4WF8A 1E34B 1EAUA 1P9UA 4IGDA 2GP9B 3VPKA 1N6XA 4FU7A 1YF4A 5KGOA 3SUEA 2BY9X 2ZZUH 4OS6A 2A5AA 2EI8A 1S5SA 1GHAG 4A6LA 2ZA5A 1A0HB 3A86A 4FVDA 4U32A 1C1UH 1TGCA 1LQEA 1KMHB 1ANBA 3E16B 1O2JA 2SGPE 1LQDB 1WQVH 3KQBA 4WMEA 1TPKA 2KR7A 1P10A 2Z9GA 1L2EA 2HRVA 6LPRA 2CJIA 4OS1A 1Y8TA 4TT3D 3SNBA 4KELA 3RU4E 1FY4A 2BD4A 1C5SA 2GZ8A 4AN7A 2VWOA 1VJAU 4YOJA 1HKYA 2GD4B 1AB9C 1OP0A 1O2SA 1YM0A 3HK3B 4JZEH 1OPHB 1F2SE 1WTHD 2BVXH 4NIWA 1O2PA 2ZGJA 1MTUA 2PR3A 1F7ZA 1AKSB 2BDIA 3RXDA 1QL8A 4MVNA 3G01A 2OC0A 4F49A 1H9IE 1EQ9A 1UCYH 2H6MA 1G37A 3EE0B 3MH7A 5FPTA 1AFQB 1JWTA 3A7TA 1NRPH 2NWNA 3MOCA 3TNSA 1O5GH 2ESTE 2FEQH 5JPMH 2G52A 1TFXA 4CHAB 1IQLA 3GY5A 2NU1E 4XOJA 1FY8E 3N99A 4INLA 4UONA 1IQJA 2R2MB 4KTCA 1GDUA 3AASA 2YIOA 2WV4A 1BMMH 1W2KH 3BTWE 5B6LA 3A80A 2J34A 1O2VA 4DIIH 4VGCC 1C1VH 2IJD1 1J17T 2DUCA 1GL1A 2PW8H 1FMGA 1AVWA 2RA3A 1UVOA 2OXSA 1DT2A 3K6YA 1YC0A 1SC8U 2VIPA 1EPTB 1ELDE 1TPOA 4YO9A 4CH8B 5JB9S 1QNJA 1M9UA 2QE7D 1JRTA 1X7AC 2LP6A 1O2IA 1DPOA 1BRAA 1YPJH 4Y7BA 5E0GA 1XUHA 1CQQA 1CA8B 4MNVA 1YPEH 1XUFA 3E8LA 2EQNA 2QF3A 4A1VA 2YIPA 4APLA 3KYGA 1DXWA 2HLCA 2PKSB 3SU0A 3T2NA 4ABDA 2BLVA 2F9UA 1P2KA 1GBKA 1N8OB 3RC6A 4Z6AH 3GDVA 3RXFA 3BT1A 2XWAA 1SGPE 4AGKA 1UVPA 2H9HA 4O97A 1INCA 1BCUH 1O5DH 2M2AA 1SSXA 2GCTB 4GCHG 3PMHB 1W81A 4R1CA 3F9HA 3N7OA 3T28A 2IN2A 2ZKSA 1O33A 3B9FH 1XVOA 4TSFD 4XE4A 1H8IH 1COWD 4AYYB 4Z0KA 1OOKB 5E2PA 1ESAA 3KYFA 3BIUH 3CENA 1NZQH 3LH3A 4X8TH 3E0NB 2UWLA 3OEED 1DY8A 1EUFA 4WJG2 1O3IA 1P0SH 1FDPA 1W14U 1KDQA 3R0FA 1EP5A 4NIVA 5C1YA 2H2ZA 3SHAH 1V2PT 1AN1E 2FTLE 3PROA 4JK6A 2HNTF 5HKKD 5ETXA 4B73A 1TOMH 3ATIA 1TX8A 1YP9A 1A2CH 2HPQP 1C5NH 2R3UA 4UFFH 4AFZA 4U2WA 2C8YB 3GOVB 3LGYA 2ANWA 1KXEA 4JK5A 1GI6A 3SV8A 3UWJH 4BAQB 5EXLA 1WDIA 2NU4E 1AU8A 4YTAA 1SGYE 3VFEA 2CGAA 3ATMA 1YLDA 1C2MA 5EW2H 1KIVA 3URCA 3D49H 3FO8D 2PGBB 2FX6A 1SOZA 2J9NA 4B6EA 5IYTA 1HAGE 2A7JA 3EA7A 5DP6A 6GCHF 1XUGA 2ODPA 3NCLA 2ZFRH 2DOHX 4K69A 1HJAC 1SGDE 3RLYH 3TK5A 2A4QA 3ODDA 1TLDA 3JZ1B 2Z3CA 2J5UA 1MD7A 1THPB 5JB8S 2OBOA 1UTLM 2DE8A 3LJJA 3PRBA 3BTTE 2W6JD 4X8UH 1GVKB 1QRXA 2WZQA 1G3EA 1GJ5H 3SU1A 3P6ZB 4ABFA 3M36A 2G5NA 3MKPA 3MO6A 5H4IB 3LAQA 2XC0A 1HB0B 1TX6A 1C5ZB 1OYQA 2WPKS 3FOAA 2OK5A 1F0UA 1HAIH 4F48B 4RT0A 9LPRA 6ESTA 1CT0E 3P8NA 1J16A 1KTSB 1C1PA 1CHOG 1KIGH 1RFNA 1OYTH 4ZHMU 3SHCH 2J2UA 3F9GA 1WV7H 1KXFA 4ZXXH 2A7HA 3DSOA 3U8RH 1O2TA 1TNHA 2BDYA 1KDUA 5EGMA 3P8FA 3MU1A 2FTMA 1A7SA 4NA7A 2XW9A 1ZRKA 2FP7B 1A0JA 1QIXB 5CHAC 1C5YB 3KCGH 4MLFB 1KI0A 1GI2A 3RXCA 4UDWH 3NXPA 1TPAE 5FBIA 3S7HB 1EJNA 3KL6A 2BD3A 2UUKB 1O38A 5CS1A 4BVWA 3B8JA 4SGBE 4BAMB 3CNRA 5A09A 3SU4A 2JH5D 2AHME 4J1YA 1F5LA 1E79D 3KF2A 3QGJA 1SLWB 4IC5A 2FOMB 5EQQA 3LIWA 2Z94A 1FQ3A 1GBCA 1C1WH 2VWNA 1GGDB 1TMUH 4GCHF 3UOPA 1C5VA 2WUBA 1NO9H 1NBMD 2UUJB 4MQAA 1OKXA 1BJVA 4WY3A 2KCPA 4UD9H 3U8OH 4I8KA 5A8YA 3M7UA 1NU9A 1DOJA 3V12A 1O3KA 4AYVB 4JZFH 3ZZ4A 1CT2E 5E0HA 5FL7D 1O2HA 2ZDNA 4YT6H 2J94A 4FXGH 3LU9B 3SZNA 1SLUB 3S69A 1P02A 1Z8JB 3W95A 3S9AA 3URDA 2GVFA 4NIXA 3BTHE 4A1TA 2A5IA 1ZPBA 3SQHE 1C2GA 4XD7D 3HMSA 3QDZB 4K1SA 3UFAA 3HKIB 4E05H 1P9SA 1O2MA 1LVYA 2PF1A 2ZTXA 3A88A 3PO1B 3ZZDA 3FKSD 4IN2A 1PQ7A 2ZU1A 2BD9A 4Y0YE 4AFUA 4WVPE 5DP3A 5F8XA 2ODQA 3BTFE 1GG6B 4OS7A 1O5BB 1V2VT 7LPRA 4KKDA 1PQAA 1GBMA 4M7GA 1P01A 3FP6E 1GHWH 1VZQH 3HKJB 4MPVA 3GCHC 1SGEE 3MMGA 3RXUA 3ZZ7A 2LNCA 1KDQB 2KCAA 1GJ6A 1CGJE 1ETRH 1XXFA 1AVGH 1Y5UT 4A1XA 4ISLA 1WXRA 2C90B 1NU7B 2L0SA 4XFQA 5F03A 5AVDA 5J4SA 1C1RA 3N7DA 1SL3A 2JH6D 1C5RA 3QO6A 1ZJKA 1RTLA 2P94A 2FLRH 1TRMA 4O3UA 2G81E 1QB6A 4DT7B 1EZQA 1P03A 1DX5M 1O5EH 2GMTC 2WPJS 1V2NT 2WHXA 2QCYA 1GBBA 1CHOF 5FXLA 2GT8A 3LJOA 5F8TA 1ANDA 4WH6A 5GDSH 4NFEA 5TCAA 4ZCNA 4Y8YA 2ZP0H 3H7OA 4H4FA 1ZTJA 3VB4A 3C27B 2BD5A 1O3FA 3QTVH 1C5XB 1O3AA 1LKAA 2SGDE 1G3DA 2EI7A 2WYJA 1C5UA 3H7TA 4X6MA 1GI0A 1OWJA 3TU7H 4JYVH 3KHVA 1EATA 1AWHB 1QQUA 5GWZA 1DS2E 1SLVB 1SLXB 1O3DA 2FOHA 2ZGXH 3E1XB 3BTEE 4U01A 1ZLRA 2GT7A 5FPYA 4CRAA 1K1PA 1FN8A 2A45B 2QV1A 1O3CA 2XOKD 1BRBE 3TH2H 5DPAA 4OS4A 3I77A 1H8HD 2F83A 3A8BA 3SJKA 2PKAA 1BITA 1QURH 2ZG0H 1Z8IB 4THNH 2V35A 2CHAC 2KM0A 4YZUA 4HTCH 4Y79A 3UTUH 2BYAX 1DFPA 3M5NA 3WWFA 1ZSKA 4Y0ZE 2K4RA 4Y11E 3F9FA 1BTPA 3ITIA 3BT2A 4O3TA 4X1RU 3PLPA 3ZYDA 2PTNA 4NGAH 1YGCH 4FUGA 1P2MA 5EW1H 3H09A 1YXEA 1UK2A 2J95A 2AGIX 2W6ID 1W0KD 1A0HA 2V7QD 4JZDH 1TNGA 2A7CA 1AGJA 1TBRH 3PWCA 1EB1H 1G30B 1O5AB 3MO9A 3DCLA 4TY7A 1QFKH 4E7RG 2LPRA 1GBAA 2FPZA 2AYWA 1O2WA 3M5LA 4YLQH 3RDZA 3EYDA 4ABIA 1NL2A 3SORA 5HIZA 2ZGBH 2ZWLH 1ZHRA 5DP8A 5T6DA 2BY8X 1XUJA 1MZDA 2SPTA 3VB5A 1F92A 5CT1A 3FP8E 4B75A 1T8LA 2OQUA 1TGBA 1C5MD 3E91A 1GCTB 3H5CB 3GS9A 2FOEA 1MAYA 3SNCA 2O8WA 2Y5FA 1T8MA 3BEFB 3BV9B 2XNIA 4MPXA 4A5TS 1FPCH 1ELVA 2KL5A 1SFIA 2SGQE 1LDTT 1PK2A 1O3NA 5HGGA 2D26C 5LPFA 3OEHD 2OUAA 3M5OA 3O8RA 3EDXB 1W11U 2QYIA 2FOAA 1Z6JH 2J8LA 1AY6H 5EG4A 4KTSA 1SFQB 3K2UA 1AVXA 1CU1A 3L6PA 1BBRE 1FIWA 4Q4LA 3ZZ6A 1EJMA 4BAOB 3OE7D 1L4DA 1CBWB 3RXAA 4D8NA 1V2JT 1A3BH 2NU0E 4X2XA 1V2UT 2ZDKA 3TJVA 3RXGA 2CK3D 1C5PA 4BAHB 1BBRH 1HCGA 1PQ8A 3DSGA 1D9IA 1SBWA 3M61U 3SP8A 3ZVAA 1RIWB 1GHYH 1MH0A 4TPIZ 2OQ5A 2RCEA 4YOIA 1SGTA 1Z1IA 1ARCA 1BUIA 4YIVA 3TK6A 2XBXA 1AUTC 3P92A 5I25A 3SGQE 3ZVFA 3V7TA 1OWHA 3TVJB 3SV9A 1ESTA 2VINA 2BY6X 1HV7A 1DICA 1WU1A 3AW0A 2BY5X 3EA8A 1YY3A 1IQKA 1P06A 3KNXA 1GI7B 1C5TA 1A5IA 3TITA 3VXEH 1UTJA 1V2KT 3Q77A 2J38A 1NFWA 3EQ0H 2G5VA 2O9QA 1CEBA 6CHAC 7KMEH 1DE7H 5LH8A 1K1MA 2UUYA 1QRWA 4JYUH 1YWUA 1KTTB 3RMNH 1SQTA 4ABBA 3AAUA 4CRBA 2JH0D 1HPGA 5IDKA 2F9NA 2R2WU 2YMSB 5T6FA 1YPLH 3FAOA 3A89A 1T31A 3FVFB 1AI8H 3OSYA 3MNSA 2BQ6B 1B2IA 2HGFA 4IMZA 5HPGA 3PRDA 3F0OA 5L2YH 1AHTH 1FLEE 1E37B 3SN8A 1AZ8A 1HAZB 2BLQA 1HAOH 4SGAE 1PQ5A 1S81A 1IAUA 1ABIH 2LL3A 2PKAB 3AAVA 1YYY1 1RS0A 1EOJA 2BDBA 5EQRA 3QWCH 3HK6B 1GI5A 1MMJN 1D6WA 3OY6U 3RXIA 5CS3A 1W12U 4MTBA 2OC7A 2HPPH 1FN6A 1ANCA 1IQEA 4TPYA 4GHQA 3RXOA 3RXLA 2KZ4A 2SGAA 4TWWA 4ZROA 2BB4A 1MTWA 5G4BA 1S6FA 2AMPA 1QZ8A 5GIBA 2WV9A 1O37A 3F6UH 4X1PU 2TGDA 1ZR0A 1MCVA 1QR3E 4IUAA 5DP5A 1S82A 2XRCA 1CA0C 2Z9IA 3EAJA 3NKKA 1MZAA 1TNKA 2GV6A 2FD6A 1KLJH 1W7GH 2Q6GA 4HFPB 3AK5A 3C1KA 2I6QA 1TWXB 1GMNA 1MCTA 3SI4H 3SU3A
chains in the Genus database with same CATH topology
4Y8XA 1O2QA 4ZKSU 1OWDA 2WPLS 1GJ8B 5C2ZA 5CP9A 1LHCH 2QXIA 2ZF0H 3P8OA 1E38B 1QBNA 5A8XA 3SV2H 4APMA 1BTZA 2BQWB 4DVAU 5DO4H 3RMOH 4Z0DA 1MTNB 3MU8A 1ELGA 1TBZH 2Y6TA 2IPHA 3M7TA 1BRUP 4KGAA 1BQYA 3CP7A 2Z3EA 1BTYA 6GCHG 1GBLA 2A1DB 1AE8H 3A87A 1SHYA 1IQIA 4MPWA 3QK1A 3RXSA 4R19A 4FU8A 2STBE 5FX5A 2BQ7B 1J9CH 3BG8A 1XUKA 1V2ST 3SJ8A 3BN9A 5ESBA 3RC4A 8LPRA 3TJOA 1H9LB 1ELBA 1GI3A 5FCRA 1FV9A 1VITG 3SNAA 3M3SA 1HJ8A 2P8OB 2Z9LA 1HAVA 3DT0H 3LGUA 4FUBA 3A82A 4UAOA 3MH6A 1KY9A 4X1QU 1DITH 1HXFH 1K1NA 1OX1A 2ZHQH 2Q8BA 1C1MA 1O2GH 2BD7A 4MG3A 4AG1A 2ANYA 4AGJA 4ISOA 3PB1E 3RMMH 3T25A 1O3JA 1D3PB 1C2EA 5EXNA 4ABAA 1S84A 1EB2A 1UK3A 2ZDLA 2AIPA 1FJSA 2FI3E 1F0SA 3VEQB 5CT3A 3VB7A 4NFFA 5EPYA 1C1NA 3PYHA 3RU4T 2SGEE 1F0TA 4DIHH 3A7WA 1ACBE 2ZNKH 3RMLH 4KTUA 2Z8VA 2BHGA 1Z8RA 3M37A 1ZGVA 4Z0EA 2JKHA 4IBLH 2R0KA 4FUIA 1O3MA 3ZZ8A 2VNTA 2D2DA 4IN1A 1AZZA 1T7CA 1WQSA 2GV7A 2PUQH 4ZMAH 2H1UA 1EZXC 4Y8ZA 3ELAH 3SNDA 1P09A 2FOFA 2HPPP 3VGCC 1THSH 2DOIA 2VJ1A 4X6NA 1NFUA 1O35A 1F5RA 3GCTG 3T26A 1FNIA 5F8ZA 2FWWA 3UNRA 1HPKA 2FYRA 2HOBA 2WPIS 3IWMA 5EXMA 4KIVA 1UVUH 1YCPM 1C4V2 1EX3A 3TPIZ 1C2LA 2ZU5A 3AVZA 1BMAA 2DE9A 2M5TA 5J4QA 2PLXA 1C2HA 2HNTE 3GDSA 2FESH 1MKWH 1DUAA 3IITA 2C8XB 1NRSH 2WYGA 3TIUA 3RXPA 5JYIA 1AE5A 1H1BA 2PSXA 1GMCF 2SNVA 2FZZA 1KYNA 3ESTA 5SGAE 4FUHA 1B5GH 2C3SA 4ZXYH 1ZMJA 5DKMA 4Q80A 1S85A 3BF6H 1TQ7B 2PWXA 1G36A 1DSUA 5DG6A 4OGYA 3GY2A 2FLBH 2UWPA 4B74A 5TJXA 4ZHAA 2EA3A 5GJ4B 5A2MH 2VGCB 3GY7A 1V2OT 2XC4A 1VGCB 1W8BH 2ZC9H 2BX4A 2BY7X 5I46H 3V0XA 1VITF 2VH6A 1TRNA 1JIMA 1QB9A 3ZVGA 2CF9H 1UMAH 3QZRA 5FPSA 1A1RA 3T5FH 1W8KA 1NM6A 3E6PH 1S83A 4NWKA 3BG4C 1DWDH 4K2YA 2BLOA 1GJ7B 2GGVB 4GSOA 3NUMA 1L1JA 2O8UA 3KQDA 1O2XA 1UTPA 2ZECA 3U1JB 1V3XA 2F9OA 3D65E 3ZVBA 2VVUA 4TWYA 4AORA 5JBCS 4JMYA 1K1LA 1O2UA 2AH4X 2O8MA 2W3KA 2TRMA 2ZFTA 1AO5A 1C4U2 1P2QA 2CN0H 1HNEE 2JETC 4BVCA 1PKRA 4F4OC 3GISB 7ESTE 2B8OH 3RXMA 4NZLA 3MH4A 3S9BA 5LPRA 3RU4D 1DUEA 4CR5A 2ZU4A 1KLTA 4B1TA 1GCDA 1A3EH 2GX4A 4DJZB 1HAVB 2TIOA 4WMDA 5EQSA 4UFEH 1KRNA 4ABGA 2V0BA 3F1SB 3UQVA 2K13X 1MD8A 1WAYB 5E8EH 5ABWA 3E0PB 1ZYOA 1Z71A 3GCNA 1Z8GA 1GJ9B 3GCTF 4ZUHA 4UV6A 4PROA 2G55A 2TGPZ 3CS0A 5COEA 2G4TA 1C5LH 1BBRK 5K0HA 1HJ9A 1LHDH 1QJ6B 2Y80A 1Q3XA 4Q2KA 4ESTE 4BTIB 3MHWU 1OSSA 1EKBB 1EZSC 1BMLA 1D3QB 3UREA 3SJ9A 1O2RA 4UEHH 1SMFE 1XX9A 2W3IA 1TRYA 4X8SH 2VIVA 5EPNA 1CEAA 4NG9H 2ZQ1A 1MKXH 2VIDA 1CT4E 1CVWH 2IJOB 3RXKA 5EU8A 1O30A 3A7XA 1HBTH 1O2OA 2PTCE 1ZTKA 5AFZH 1NFXA 2THFB 1AFQC 4Y6DA 1AMHA 4FVBA 4IS5A 1YPMH 3ZV8A 2A31A 3T29A 3RXVA 4CHAC 3UY9A 5GXPA 1FONA 2ZHWH 4WH8A 5CS5A 1XKBC 5L6NH 1TBQH 1NN6A 1NS3A 1J14A 3O8CA 4H6SB 3RXEA 1AIXH 3SOSA 3TJUA 1P3CA 1C1QA 1Q31A 1KXAA 1JRSA 3QZQA 1PPCE 1P2OA 1BHTA 1QRZA 2AGEX 5DP4A 2OBQA 1EPTC 2ANMH 2QY0B 2Y8RA 4NA9H 1PPHE 1TONA 2AGGX 1QL9A 4OS5A 1WYKA 1K22H 2I9AA 2HWLB 5LPEA 2G4UA 1YPHC 2FODA 4R0IA 4MNYA 2H5DA 1PPZA 1O39A 1O2LA 1C5QA 1VCQA 4BTUB 1CGHA 1TALA 1AB9B 4K8BA 1TGNA 4LXBH 1UTOA 1URKA 1UTNA 2PKSC 4X1SU 2A2XH 3A8DA 2AS9A 2P3UB 1O5CB 1GDNA 1N8OC 3BSQA 1GI9B 8GCHG 1P3EA 4GVUA 2P59A 1RGQA 5C5OA 3SUFA 1C2JA 3S0NA 2ZDMA 1DM4B 3ZV9A 2CXVA 1YKTA 3BTKE 1ETSH 1FAKH 1SVPA 1GL0E 2GCTC 4WMFA 2ZDAH 2CV3A 3MNCA 1QY6A 1V2WT 1Y5AT 2BZ6H 2J92A 1ZJDA 3A8CA 1GBEA 3TGJE 4BTTB 1BHXF 1CE5A 1HIAA 1P2NA 3LH1A 3ENSB 4NIYA 3DD2H 3VB6A 3KQEA 2ANKH 4BAKB 2F9VA 3E90B 4AB8A 4VGCB 2I9BA 2Z8WA 2XBWA 3ZZBA 1QHRB 3ZZ9A 1O31A 1QB1A 1FI8A 1O34A 4Y76A 1DVAH 4LZ1H 1OS8A 2VIOA 4Y7AA 1Y3VA 1LPKB 2FOBA 2PGQB 1HXEH 1TGTA 2YOLA 1SPJA 3PWBA 1BTHH 3DHKH 3QX5H 1KXDA 1O2KA 4IW4E 4YM9A 1LHFH 2BZAA 1DLEA 1QJ1B 1S0RA 1JXPA 3NWUA 1FUJA 4CRDA 2P3FH 1VCWA 1T32A 1TIOA 2A5KA 3RM2H 3DFJA 5HXFA 1C1SA 1L1NA 4JYTA 1YCPH 1AUJA 2VIWA 2WPHS 3OTJE 2BOKA 2Y7ZA 1ZHMA 2ZCHP 3SNEA 1WSSH 5TCCA 1TABE 1TGSZ 2KNFA 1G3BA 1MBQA 3PTNA 4XDEA 1C1OA 5AF9H 1MU6B 1LKBA 4Z0FA 1EASA 2BX3A 1EAIA 1UVTH 2ZCLP 1LVMA 2VVCA 2Q6FA 2Z3DA 2OC8A 3WY8A 2GZ7A 3LC5A 4ABJA 3A83A 4X2YA 1CGIE 1G2MA 4CREA 2BDCA 4QT8C 4X6OA 3RXTA 4CBOA 2BOHB 1PPGE 3KEEA 1GJAB 1MQ6A 2QGRA 3ATKA 1QA7A 1TOCB 1W0YH 1ANEA 1YPKH 2AEIH 4KP0A 4GLYA 2FI4E 3ZZCA 3SU6A 1JMOH 3GICB 1S6HA 3DUXH 3MU0A 1RD3B 3HGPA 5ESTE 2V3HH 1P12E 3VXFH 1GHVH 3IG6B 3KIVA 5C1XA 2Y5HA 1A0LA 1ARBA 2ZIQH 4LOYH 1XUIA 1T8OA 2RA0A 2GZ9A 4UFGH 1FPHH 1Y3WA 5C1UA 1GBJA 3STJA 2ODYB 1ZPZA 3UR9A 2KAIA 5F6MA 5FCKA 3Q3XA 2PV9B 8GCHF 1E0FD 1MTSA 3S7KB 1ZRBA 1PPEE 3RXHA 1HJAB 1LVOA 1MTVA 1GMDF 1MKWK 2O8TA 4FU9A 3GY3A 1GGDC 2Z9JA 4DCDA 1IQFA 1ZSLA 2BVSH 1FIZA 2HGTH 2CF8H 4D9RA 4TY6A 2GCHG 3MFJA 1DY9A 1FY5A 3M7QA 1AWFH 1IQNA 1JFNA 2AERH 1GJDB 3PLBA 1HYLA 1NFYA 4K3JA 2V6NA 3LGIA 3R3GB 3LGWA 4I8HA 4AOQA 2Y82A 3MU4A 1NROH 3AW1A 1YPGH 2SNWA 3RXBA 1LVBA 2W7SA 4X0WU 1HRTH 4CRGA 4AZ2B 1ZMNA 4INHA 4ZKRU 1ELCA 2P3TB 1ELAA 1JIRA 2OLGA 3RXJA 5L2ZH 1TQ0B 5DK1A 2STAE 1VR1H 2TGTA 3E6PL 3PO1C 4BVDA 1KXBA 1SGIB 2B9LA 4E7NA 4ASHA 2F9PA 1BDAA 1WUNH 2A4OA 4FUJA 4D7FA 5CHAB 1W0ZU 4YLUA 4ZAEA 2ZFQH 1P2IA 4ISHH 1BTWA 2V3OH 3ATLA 1BIOA 1GG6C 5AFYH 5CE1A 1VJ9U 5C20A 1OP8A 2IOTA 1D3TB 4B2AA 1MQ5A 3LC3A 1HIAB 1FAXA 1OXGA 2ALPA 2PHBA 4AB9A 3A8AA 4FUCA 2ZPRA 1UTKA 2Q6DA 1ETTH 2BTCE 2VVVA 1GPZA 1GI8B 1EAWA 3D23A 1TYNA 4HGCA 1HDTH 2P93A 1WOFA 3A7ZA 2PSYA 3BTGE 2BLWA 4ZH8A 1UHBA 2R9PA 2C8ZB 1RRKA 2CMYA 4A7IB 3HMTA 1W10U 4RKOB 5HM9A 2XYAA 4ISNA 4JZIA 4E06H 2B0FA 2HPQH 2WUCA 5CMXH 1KLIH 3T27A 1OWKA 4DG4A 1SQOA 4UFDH 1O32A 1SGCA 3MNBA 1E35B 1GMCG 3P70B 3UNQA 2RDLA 1NTPA 5FBEA 3TNTA 2XCNA 1U6QA 2B7DH 3KN2A 3NK8A 4Z09A 2FM2A 1SI5H 1GBHA 1PK4A 3L33A 4OS2A 2Y5GA 3PV4A 4H42U 1V2MT 1ABJH 1BA8B 1AQ7A 1H4WA 1GWAA 1UCYE 1IQHA 1AFEH 3O8DA 4CIKA 2F3CE 3RLWH 1F5KU 1MUEB 1DWCH 1GMHG 1FY3A 4K1TA 1Z40A 5A0AE 3MYWA 1HUTH 3GCHB 2VWMA 4UE7H 3SU5A 3Q3KA 3A85A 1L0ZA 2EC9H 2BDGA 4FUEA 1V2TT 2GCHF 1ORFA 1V2RT 1OWIA 1J15A 2ZHFH 3UPEA 2ZO3H 4I8GA 1DLKB 3HN4A 1K1OA 4D3CA 3SJOA 1MKXK 3RC5A 1CO7E 1GHZA 5T6GA 2BM2A 1BRCE 1K9OE 4R1BA 2GMTB 1DANH 3LOXA 1GVZA 4GPGA 3ATWA 2PK4A 4BOHA 1HLTH 2I6SA 1BZXE 2ALVA 4BVVA 1ZOMA 2AIQA 3M3TA 1QA0A 3TK9A 3TGKE 1BT7A 1EAXA 1C2IA 2AMDA 5JDUB 2KAIB 1RJXB 1Z7KA 2BXTH 2J4IA 4LZ4B 1LTOA 4AG2A 1I8NA 3LONA 2Y7XA 3UWIA 1H8DH 2ILNA 3CS7A 1HAPH 1P05A 2LL4M 4LK4A 1SHHB 3A7YA 3UOUA 2O8LA 4D76A 2QXJA 4CH2B 1O2ZA 2ZTYA 1TAWA 1SGNE 1GDQA 1GP9A 3DA9B 1P04A 1GCTC 2XCFA 5GCHF