4A5UB

Turnip yellow mosaic virus proteinase and escherichia coli 30s ribosomal s15
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
80
Chain Sequence
SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFSRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Compact Viral Processing Proteinase/Ubiquitin Hydrolase from the Otu Family.
pubmed doi rcsb
molecule keywords RNA REPLICASE POLYPROTEIN
source organism Turnip yellow mosaic virus
molecule tags Transferase/rna binding protein
total genus 28
structure length 80
sequence length 88
ec nomenclature
pdb deposition date 2011-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4a5uB00
1XMOO 5IT9N 4LF7O 4OX9O 4DR5O 1N33O 2HHHO 4X66O 3RT3C 4DV2O 4AQYO 2UXCO 2E5LO 1G1XB 1I94O 2ZKOA 4JI3O 3JAMN 4DR1O 4DR2O 3OTOO 4JI0O 4LF4O 4OPHA 1YZBA 4DR4O 1F7YA 5IWAO 1IBKO 1HNXO 4JI2O 4GKJO 1D2DA 1N32O 4B3RO 3J81N 1AILA 5LMNO 1R6TA 3J80N 1IBLO 3SDLA 1N34O 2UXDO 1R1BA 5FLXN 5A2QN 1XMQO 4NXMO 1X59A 3J7AU 4DV6O 2FKXA 4B3SO 3R66A 4DV4O 4JI4O 5BXZA 5LMUO 4JI8O 4B3TO 4JV5O 2UUCO 4X65O 4B3MO 5BY1A 4LFAO 4X64O 5H5NA 2ZM6O 4GKKO 4LF5O 2N74A 4YY3O 2UUAO 1FJGO 4DV0O 1N36O 4DV5O 2UU9O 4LF9O 4JI1O 4JYAO 1IBMO 1FKAO 2UXBO 4LF6O 4K0KO 1DK1A 1XNQO 4JI6O 4LFBO 1HNWO 2VQEO 4JI7O 4LF8O 2Z0AA 5BR8O 5LL6Y 4DUYO 4DUZO 4X62O 4YHHO 1HR0O 4DR7O 1KUQA 3O65A 2JRIA 3M8AA 2VQFO 4DV7O 1XEQA 2DOSA 4DV1O 2DJVA 3T1YO 1FYJA 2LW7A 4NXNO 4DV3O 1XNRO 3T1HO 4OPAA 4DR6O 3F5TA 1NS1A 1HNZO 2AGAA 2UUBO 1AB3A 1A32A 1J5EO 4KHPO 4DR3O 4JI5O 4A5UB 4LFCO 2F4VO
chains in the Genus database with same CATH superfamily
1F23A 5J2TA 2FTKA 3E2EA 2P7TC 1FXKC 1MMMA 3QVNA 1FS0G 4JAUA 2WA3A 3U11A 5LHHA 3L9DA 2DYSB 2KKWA 4JI3O 5B1NA 3K3WA 3OTOB 3JAWA 1D5AA 2CTWA 2EBOA 4I4TA 2BSKB 3K0GA 1DTOA 2ZM6B 3FAVA 5HFLA 3CCLV 2XOKG 1IBLO 4GX5A 5CBFA 4DV6O 1PP9H 2P67A 3A0BZ 5LGNA 2W0XA 4Z2WA 4DYLA 4TV9A 2YEVA 4B3TO 1KB9F 5BR8B 5LOVA 3HKDA 1NI8A 1RP3B 4DO2A 2ITDC 1L8DA 4X1IB 1CPYA 3RYHA 1K7DA 2JVDA 2ZE7A 2XAJA 4TQFA 4JI1O 4TOIA 2WLIB 1PNMA 4X89A 2QE7G 1XNRB 1BGYH 1AJPA 4UXNA 5LYJB 1IXBA 1FXKA 4LFCB 4I9QA 2UXNA 1E1QG 3STLC 1CXZB 4X88A 2Q68A 4ZHQB 3K5MA 3OFNG 3KZIZ 4H33A 1FYJA 4LH6A 5EK0A 3CCUV 3GVMA 2ADPA 4N21A 2P06A 3CRAA 2ZDIA 2OT5A 5B66Z 3B8NA 2E74B 3ZN1A 2UUBB 1LUVA 1IURA 2W0FC 1SQFA 4J41A 4J9ZB 2ZINA 3UT5B 1H2MA 1Q6UA 2CAZC 3ABUA 4YJ3B 1NR1A 3QTCA 5L3DA 2UUCB 3IC9A 3T4ZA 4I7ZB 2AXTZ 5EBWC 1X4TA 1VMGA 4GKJB 2ZIMA 1K9MW 4QPJA 4B3RB 2HG5C 3QO5A 3HKCB 4GZRB 2X6AA 1TUBA 1NBMG 4NTXA 5AG2A 2UU9B 4I55B 5D5QA 5GTHZ 1M1KW 4PA7A 1O9GA 3FKSG 4FLZA 1VIBA 2XTAA 5BY1A 3EXAA 4X64O 4X62B 4RWUA 5JH7A 3A8TA 5E1AC 2Y48A 1KBHA 3CSXA 3LSQA 5KAIZ 2ITCC 2BTOA 4K0KO 3K06A 3QG5A 1KKCA 2B9ZA 1BZKA 1OCOC 2EIJB 2NLJC 4LF8O 4DUZO 4DK0A 3TK1A 2FYUH 5EZYA 4WFHA 4XDJA 4MVOA 4H0LB 1ROPA 4X66B 2ADQB 2OCHA 1Y6XA 3SJCC 2X0LA 4NXNO 3C90A 2GHYA 2Q67A 4UVBA 4F6RB 5FNVA 4QIWF 1VQ4V 1EN4A 1R3LC 4GCZA 2P5OA 4FLYA 4P9PA 2QTSA 4FLWA 2QWOB 5LXTB 1WAZA 2VWKA 5JQGA 2VS0A 4PA3A 1UJWB 4FJCC 1XI1A 2Z3YA 3ABMC 1MA1A 4CC5A 4RQEA 1VQ8V 4FMTA 1V9PA 4DR2O 1KECA 1G4YB 4LF4O 3JD0A 1XQ8A 4CS3A 4B3MB 4FFBB 2ATKC 5IY5B 2IH3C 1HNXO 4FLVA 1V55B 1BSMA 1D5NA 2CTRA 4KXRA 3D3QA 4DV0B 1P84F 2GV9A 4FLTA 5IJ0A 3CRQA 3G71V 1X59A 4NTYA 5B1AB 2WLNA 1WP8A 2XAFA 5CA1B 1UFIA 1NZ6A 2KSDA 3OEHG 2QKSA 5L3GA 2E76B 3BPZA 1TUEB 4UCSA 3T2MA 4GKKO 1DF5A 4CZZA 4I50B 3CYOA 4ZI7A 4L87A 4DV7B 4BW5A 3VOUA 1DK1A 3D36A 1Q86W 3LNMB 5H6RA 3FB8C 4JI7O 1OV9A 3WFVA 2MW2B 3CXCU 2EJ7A 1TAEA 1OCCB 3M99B 4YHHO 4DW1A 1R6KA 2RNBA 4I0XA 2QR4A 1AI6A 1XUQA 1M9NA 4X1KB 1XHXA 4EKWA 3CC7V 1I08A 2PUSA 2LW7A 3T4DA 1Y76B 4JI3B 4QPKA 3APOA 3CRRA 2F1MA 5DECA 2A3QA 2CTPA 5EYPB 2Q7GA 1S5HC 1W0JG 1KC8W 4Q20A 1EFRG 5GW7A 4X1YB 2Y4UA 4I50A 1N33B 1URFA 3VQXA 2NR5A 5H6QA 1IBLB 3ASOB 3G4SV 2RMKB 3N2GA 1FFXB 2MK3A 5KA5A 2EILB 4TV8A 1ENVA 4JI0O 3N2KB 3OR7C 1H38A 1IBKO 1GTOA 1K4CC 1L0LH 3J81N 3OMIB 1HP8A 5LMNO 4TWKA 4MVUA 2AZ2A 1KMIZ 1DLBA 3P3PA 3APQA 3TXSA 1H2KA 2Y0IA 4JI1B 4NXMO 3VQVA 5L3FA 5JJEB 4PJ0Z 1B6QA 1HWYA 1OCRB 4CBCA 1PM9A 2P4VA 3P30A 2JJ2G 4LF5B 2QA4V 4JAAA 2FB5A 1Q6HA 1LUWA 2YUAA 1N36B 3K5OA 3AK1A 5K1PA 4LF6B 2HLDG 3OMNB 2RN9A 2IJHA 3N2KA 2ZIOA 3OGIB 2PI4A 2L35A 4DUYB 3O9OA 3K5NA 3N27A 1JCHA 2Q69A 3HPLC 1NQTA 2IH1C 3H1KH 3QO7A 2LP7A 4WF9V 3K0DA 2EIMB 2Y0PA 2CGOA 1PKXA 2M6YA 2QWQB 1QVGU 3BHPA 3KCXA 3ETQA 1HNZO 2D3OW 4U3FH 3U10A 3AG1B 4CH6A 4JI5O 1G8MA 5DN6G 2P4KA 4E2LA 2QWNB 1PNKA 1ZLZA 2DWEC 1KKDA 4N23A 1M56B 3CX5F 4DV2B 4FZ0A 1G1XB 2F23A 3OGCC 3FB7C 2LGQA 1GN2A 4DR1B 3MHSC 2R70A 2EZPA 2XNDG 3A0HZ 1WB7A 4JTAB 3HKEA 2ZE6A 2P90A 1M5IA 3CCQV 1Q90D 3UQ8A 2N04A 3AG3C 1AILA 1XHZA 3F7YC 3OW2U 3P32A 1VQ5V 4R6ZA 1XMQB 4K0KB 4B3SO 5B1BC 4LP8A 1QR9A 1OZ0A 5LMUO 2R9IA 4XDKA 4CH5A 4AHCA 3JAKB 3WB0A 4LF8B 4RUFA 4UVCA 4X65B 5CBGA 3E8GA 3VQWA 4DRXB 1ZAUA 1SC5B 4RAIA 1K33A 1MSWD 5LGTA 4OXSA 1JA8A 1IBMO 4JYAB 3RN4A 4NXNB 2Q8VA 2ARHA 1S0VA 2Z5UA 4PDVA 3JALB 5FPOA 2YS8A 1AJNA 3JSNA 2PYLA 2C2AA 1RPRA 5KHJA 1AI7A 2B1GA 3FB6C 2ZR2A 1GM9A 4UUJC 1WPBA 5J9PC 5J2TB 2LQTA 4DR7O 3OTFA 2IM9A 3GWKC 4JZ2A 2HVJC 1YJ9V 1JQ0A 3T1HB 4LF4B 2GTSA 3JAWB 3BA8A 4DRXA 5LP6B 4RUEA 2IW5A 3GB7C 4HNAA 1HNXB 4Q6GA 1XDCA 3FAVB 2HHHO 1Y74B 4OX9B 3E83A 4ICGA 3WB1A 4UB6Z 2ZR3A 1GM8A 4ZOLB 2PYJA 4TV9B 2YEVB 2DQ0A 4HAMA 4OPHA 2OYQA 4CC6A 1K92A 5LOVB 2YIBA 1S5LZ 1V54C 3HKDB 4GKKB 3GWOA 1D2DA 2EINC 1N32B 1F51A 1Z5WA 3RYHB 1Q6IA 5LBQA 1N34O 3ABLC 3RFRA 1SZXA 5KHGA 3C3TA 4PDMA 1Y66A 2OIGA 2P6JA 2ZNJA 3CB2A 2ZD9A 3NR7A 3K5LA 4GYCB 5LP6A 4IIJA 5H5NA 3JASA 1FXKB 3L72H 2N74A 3K58A 1Y74A 5JJJB 1I0HA 1EN6A 3QO8A 3AK2A 1GH6A 4K35A 4MVSA 4DV5B 2EIKC 4O2AA 4ZOLA 3B2EE 1S77D 4LWSB 2QM8A 2HEPA 5JJNB 1SF9A 1VP7A 2WLHA 2QSAA 4PD4F 4KL1A 1AP6A 4BIOA 1THZA 3ASNC 3AG4C 3UO2A 1GN4A 1TA8A 4ZKIA 4DV3B 1GRJA 2JEUA 4JI0B 3OMAB 1JPXA 3L70H 1UPGA 1SRYA 1IBKB 3CXHF 3BAAA 1RSOA 3CC2V 1DF4A 1SQQH 2LGWA 4WFEA 3ZHRA 1GN3A 3SJQC 1TUBB 3CCSV 4NXMB 2E5LO 3CRMA 2OWOA 1I94O 4LWSA 3LUTB 2Y69C 3L71H 4PA4A 2N05A 1BT8A 4GUNA 4NB5A 3BABA 4JI2O 1N0NA 5JH7B 2WPDG 5JCOC 4H13B 2X6CA 1N4CA 3OE7G 2HJFC 4MSWC 3J7AU 4JZGA 3E8HA 4JI4O 2RQ6A 1M4UA 4AI8A 3H01A 4LH7A 1FPOA 2YC0A 4LFAO 3CJHA 2BCCH 2AW9A 2V1DA 4R7CA 4UCTA 2UUAO 1O9HA 5EZYB 1WN7A 4NTWA 4PI0A 1N8RW 3BRCA 4IT5A 5EC1C 1FKAO 2UXBO 4J9YB 1QCEA 1Q3EA 1HNWO 4LFBB 1BQZA 3CCEV 5L3CA 1U96A 2UXXA 5FNVB 2A9HA 3LDEA 4B08A 3RVYA 1K8AW 1IX9A 5CN0A 5JQGB 1SS3A 5GONA 1XEQA 4DV1O 2JDIG 2IJIA 4J7KA 3K9SA 4YIPA 3ZRXA 3MDSA 4GX0A 4DXWA 2GBOA 4OPAA 1OCZC 4J11A 5IYZB 3E86A 2EIJC 3OUFA 4JYBA 1AB3A 2B1IA 2QDOA 1XILA 2ZQMA 4BWAA 1VEWA 2B5UA 4ZBMA 1COWG 5IYDO 2QKCA 5IJ0B 4UVAA 1OCOB 3ZJZA 1RPOA 4AQYB 3AG2C 3OM3B 3PJSK 1YSCA 4I9WA 3JSLA 1AVMA 1F7YA 1BCCH 4TSFG 5IWAO 5CMUA 2AHYA 4RO2A 2R9AA 5GTIZ 4RQFA 4ZI7B 1R1BA 4MVZA 3SPJA 5BXZA 2M7WA 4DV4B 4FM1A 2BOCC 1ZUQA 5C8YA 5IYZA 1J95A 3S3WA 4U7OA 1ORQC 1NJIW 3ZHQA 3ZMZA 1PD3A 1T5EA 1EZJA 4YY3O 4I0XB 1Q81W 1V55C 3H1JH 2KG7B 1VF7A 3ZRWB 1SERA 1IDSA 4HBNA 3L75H 1QQCA 1US6A 5B1AC 2VQEB 2F66C 1P4RA 1ZSPA 1YJNV 3TETA 5LA6A 2CUGA 2JGUA 4O4HB 4BIUA 3KCYA 3O65A 3DC5A 3WG7B 3RBZA 2VQFB 1VQ6V 5KHIA 5D5PA 5IYBO 4U3JB 3N2GB 1SA0A 3DGEA 3C3SA 4TV8B 4DR6O 2GUZA 3H1IH 2H3OA 2WA4A 4HZ3A 5H2FZ 2CE4A 1J5EO 1AROP 2VWJA 1IVSA 3KKYA 1BQ0A 2KG7A 3H1HH 1GK9A 1TGOA 3IFXA 2YICA 3ZRWA 2LFSA 1AR4A 4PDLA 4F6EA 3IC7A 4PELA 3OTOO 3LSUA 2Q6AA 1K4DC 2CDYA 3FD9A 3G80A 4O4HA 1R6TA 2F43G 2OCCB 2H8PC 2YXHA 1YTFB 1K34A 2FKXA 4U3JA 1M93A 4DV6B 4FM0A 4JI8O 4IL6Z 1BL8A 4JV5O 4B3TB 3WU2Z 4CH4A 5KUMA 1MNGA 2QJ1A 2XAQA 3K59A 3JCZA 1W2BU 3B4SA 1NVPB 4IHJA 2WSSG 2H94A 4WCEV 1VARA 4LCUC 2A79B 1BMFG 5CA3A 4GX1A 3A2FA 4JF3A 5EIBD 1XREA 1W59A 1M57C 3CS5A 5KX5A 1VQ9V 2WLLA 1HR0O 1AI5A 4MW8A 2NN4A 4LC1A 2ZXWC 1R6NA 4X8AA 4GT1A 3RYIB 2CH7A 1K3EA 2BE3A 4JTCB 2EULA 3HR0A 3ZHUA 5ITZB 3T1YO 1QVFU 5B3SB 1I94B 2JGDA 4MTXA 4U7NA 1VF6C 3MAQA 4BW9A 2UUBO 3MHHC 4JI2B 3HKEB 5FPRA 4OGQB 4QNHB 3HB3B 4E4EA 3ZHVA 3ZHTA 3SR2C 2KB1A 4NR1A 2LFRA 4JI4B 5IJ9B 2RJZA 5TISZ 3W7WA 5KLVH 2DN9A 4YIOA 4LFAB 3UO3A 3F7VC 1JX9A 4GKJO 3D8CA 4B3RO 3G67A 2DE0X 3TXQA 3RYIA 5BMVA 5ITZA 1Z2GA 2UXDO 1QLEC 4QJFB 2UXBB 1CEZA 1P7GA 3R66A 4IYIA 3CCMV 1M56C 5CA0B 3ABTA 3F5WC 1MG1A 1YVWA 2YXLA 3IJ4A 2ZE8A 3JATA 4L8JA 2XAGA 4X64B 3CC4V 3SYQA 1DGSA 4MTOA 5B5EZ 1M90W 1YIJV 4D6TH 4LF9O 2FL4A 4DV1B 3HKBA 2DWDC 1XNQO 5JVDA 1AI4A 3L73H 5IJ9A 3CWBH 2Z0AA 3EFFK 3ZMSA 1Q7YW 1JFFA 1Q43A 3ABKC 4DUZB 4FIPC 4HNAB 2E3CA 4NKGB 3RVZA 5KMGB 3T1CA 2PZSA 3JD4A 3LNNA 1LNQA 3SJBC 5B1BB 4TUYA 3ZHSA 4LNUB 1Q5OA 5CA0A 3VBBA 4EEQA 1R3JC 3CD6V 2DYRC 2PTMA 2AGAA 5HFMA 4KHPO 4A5UB 1H2GA 3E8BA 3R65A 4O4IA 1N0JA 4FLXA 2CGNA 1SESA 1AR1B 2YI8A 1R73A 1S76D 1OHHG 4LR3A 2IJJA 1JVMA 3K9AA 1HW7A 1K5QA 3FYEB 1SZTA 4DR2B 3CHXA 4MT8A 4YJ2A 3X2QC 3E22A 4K8XA 1WJZA 4ASUG 3OUSA 4MVRA 3SPCA 2EJRA 2HVKC 4IIJB 3JASB 1RM1C 5CB4A 3SGIA 4YY3B 5KMGA 2Y4TA 4FK5C 1Q82W 1FAFA 4G28B 2JS5A 2V4DA 2JS3A 4O2AB 3JCUZ 4LNUA 1KU9A 3CEIA 2W6JG 1SKVA 2QM4A 2X7RB 3JARB 5J2UA 2O57A 2JJ1G 3I56V 1MZFA 1H2LA 4R50A 1YHQV 2GDSA 1FJGO 2AZ0A 1ZL8A 1OJHA 4WBNA 1NH2B 1B06A 4QE9A 4EB6A 5L3BA 2DYSC 4JI7B 4DR6B 1XBLA 4CS4A 2EINB 3JD2A 4GX2A 3UKMA 4FM2A 2QKAA 4YHHB 4W4LA 1P7BA 1WP7A 3ABLB 4IYHA 1RSOB 3CRCA 3M8AA 2DOSA 4P9OA 2GTAA 3ZX6A 3K57A 1JOYA 2JK5C 3LSSA 4P2ZA 1VQMV 3JYCA 3JARA 4EFBA 1QNMA 2CTQA 1QR8A 1VQ7V 1PL4A 2ZDIC 4PI2A 2F4VO 1XMOO 3Q4HA 4XDLA 4Z1VA 2YI9A 1N33O 1VQNV 2EIKB 5KHKA 1JR9A 1F4NA 3RWRD 1VQPV 4PDRA 4HYOA 3SPGA 2RDCA 4JI8B 4MVQA 4BR6A 4JV5B 5FL7G 3AK3A 1NKDA 2Q0AA 2XT9A 3CMEV 3CJHB 3E89A 1VF5B 2FMLA 1XL6A 3ASNB 3AG4B 1TVKB 5C93A 3J80N 2YIBD 3NXSA 5B1OA 5LMNB 1SETA 5A2QN 1MSDA 1H8HG 3TCUA 4D7TA 2DMXA 2QM7A 3BVOA 3BA9A 2ZCEA 4KUMA 2BSKA 4BAYA 2JIZG 4MTFA 1HR0B 4LF5O 1SQVH 5LHGA 2EX3A 3K08A 1E79G 3SYAA 1FXVA 1N36O 2ODMA 5GONB 2XUMA 2Y69B 4LF6O 3T1YB 1GMGA 3ZBHA 3FYIB 2YXYA 1FXHA 2Q7EA 4DUYO 2Q4PA 5K1XA 4TQDA 3BFRA 4UCVA 1YXBA 4X1IA 1TVKA 1NU1H 2LW1A 4WFAV 1KUQA 2JRIA 3FB5C 3TGUH 1XOUA 2XASA 4G27B 3DTUB 4JAVA 2WLIA 4UV8A 4K3AA 2A0LA 3JD3A 3IGAC 3CP1A 1NH2D 3OAAG 5LYJA 2X6BA 2JEXA 1HNZB 4DR3O 1KYOF 4H37A 2Q0OC 4JYYA 2YSUB 3UM7A 4JI5B 4DR5O 2Q5ZA 4ZHQA 2XHBA 1EBOA 1K73W 3FFQA 2UXDB 1PV0A 4DV2O 1WLEA 4CH3A 2G38A 2PI5A 2WLKA 3ETGA 4DR1O 1WB8A 1ZWIC 3SPIA 4F4LA 2LJ2A 3B8MA 4JGSA 4DR4O 5C8YB 5JCOA 4IGGA 3S3XA 5BZBA 1W0KG 3UT5A 2F95B 2BOBC 1YJWV 3WB2A 4LF9B 1I7FA 3U0ZA 1XMQO 3ZEDA 4YJ3A 4W4KA 1AP5A 3QNEA 1OCZB 2IU0A 3BY6A 1XNQB 4B3SB 1PPJH 4NYKA 4MTGA 5LMUB 1BHAA 4X65O 1BS3A 5DEDA 1E1RG 2YIAA 2RCVA 3UCSC 5LA6B 3HKCA 3M7MX 3AG2B 4I55A 4UCUA 4ABMA 4JYAO 1Y4MA 1HDJA 1IBMB 1YDXA 1NT2B 4JI6O 1SA0B 5JWPA 1K5SA 1WA8B 2R72A 3D36C 5EIBC 4J42A 2GUZB 2YIDA 4FVMA 2NNUA 4KHPB 1WNSA 2E75B 2PGGA 3B40A 5IY5C 1KP3A 4X9QA 1SQBH 3OD4A 4DR7B 3ABMB 1YITV 3LDCA 3ZN0A 2DJVA 4CS2A 2WLJA 4I5SA 2L6LA 3W7SA 4MVMA 4C7UA 1KD1W 1KP2A 2LO1A 3QF7A 3DXRB 3T1HO 2IJKA 5IDJA 2R9RB 1MOFA 2Q9LA 4FLUA 1AR5A 3L74H 3OEEG 3VQYA 1JJ2U 1SQPH 4PV1B 4LF7O 1G6UA 4OX9O 2VRZA 2HHHB 4Z1MG 1H2NA 3WG7C 2UXCO 1FFTB 3DSQA 1WA8A 4F6RA 3A0RA 4EFEA 3JD1A 4G2KA 2DW4A 1QU7A 4XBFA 5LXTA 3THOA 5LGUA 1N32O 1CP9A 1OCCC 5LHIA 5CBHA 2QWRB 4MW3A 1FJGB 3SDLA 4IHJB 1N34B 2QGNA 3SPHA 5FLXN 2K1EA 2WAMA 1I5YA 3DXRA 1VQLV 1GM7A 2Q73A 3RYCB 3DC6A 4FFBA 5DM6V 3ZMUA 1PL0A 5KX5B 2ZM6O 2HKOA 5E79Z 4B7EA 2WLLB 2CK3G 4JASA 1MZEA 2HFEC 2CH7B 4DV5O 4O4JB 3TJTA 3ZRVA 2OTJV 1Q8IA 2OCCC 3ASOC 5CA1A 2XAHA 4J7JA 3ICXA 3RYFB 2PY5A 4O4LB 2JGDB 5EBMC 5BR8O 4WFGA 2EILC 2A06H 2F4VB 1XMOB 5H9CA 1LR1A 1S72V 1YCIA 4DV3O 4QE7A 1XNRO 2F93B 1VQKV 4J80A 3RYCA 2GSMB 4J7ZA 2WWWA 1NTZH 3CE2A 1A32A 2HR3A 3B77A 3MD0A 4LFCO 1WPXA 4AILC 1OCRC 1YI2V 4X1KA 4D7SA 3ZRSA 4O4JA 1ZTEA 5BMVB 2DQ3A 1L0NH 1GN6A 1EZVH 1Y76A 2E5LB 3RYFA 1M57B 4O4LA 2A7WA 4DK1A 3ZS8C 5B3SC 2AHZA 5EYPA 1YZBA 4FFKA 2ZXWB 1YF2A 1FD9A 3JATB 4X1YA 1I5XA 3K04A 2D2CB 3SYOA 1BHBA 1GO3F 3ZCCA 3CCVV 1FFXA 4JPRA 4NVPA 4YXWG 4KP4A 2EIMC 3HKBB 2QEXV 5JVDB 3SYPA 2UUCO 2WLMA 1KQSU 1GKFA 3G6EV 1JFFB 4QGPA 1P49A 3ETEA 5IYCO 3AG1C 2PF4E 4P30A 3K03A 1F4MA 2UUAB 1R3KC 2ILMA 5KA6A 2UU9O 4KFMA 4TUYB 3ML0A 1SQGA 3FX7A 1S3JA 4LFBO 1IXMA 3KG2A 1QBZA 3BCCH 1HNWB 1QLNA 1NTKH 3ZMTA 3P3NA 3LDDA 3CCRV 4DW0A 4X62O 3SYCA 4DR3B 3RGBA 3CCJV 1B3QA 1Y67A 3ZMVA 4O4IB 4DR5B 1EN5A 3G6BA 1QLEB 2W6IG 4H44B 1RFYA 3D3IA 1BE3H 1H2SB 3EHBB 4O2BB 3SJAC 1YTFD 2BTQB 4WFFA 1VF6A 3STZC 1H8EG 4UB8Z 4GLXA 2V7QG 1R3IC 1L1FA 1GAXA 3F5TA 3CMAV 1MABG 3ZIAG 4DR4B 4LBEC 1IZ3A 4YJ2B 3AG3B 3E22B 3RW0A 3W7UA 3AEIA 5A9GA 5EC2C 5IT9N 1VQOV 3PN1A 4FPPA 5CB4B 4X66O 4FZ1A 3RT3C 4K8ZA 5IE9A 2ETNA 1NVPD 2Q7HA 4AQYO 4UV9A 4J10A 2ZKOA 3OT7A 4PA6A 1S5JA 3ABKB 3JAMN 4BIZA 5J2UB 3CPWU 1PNLA 2KQXA 5IWAB 4MS2A 1NR7A 5KUKA 2QTOA 1ZX3A 1AJQA 1EM1A 2QWPB 2ZE5A 1YEWA 4UCOA 2OIEA 3W7TA 2P22C 3H1LH 1ZL8B 4X20B 5EBLC 2K9PA 1B04A 3BEHA 2IBZH 4O2BA 1JMKC 4PHZA 3EVKA 4DV4O 2BTQA 4JI6B 2DYRB 4WBNB 5F2VO 3E35A 4EB6B 1K97A 3IAYA 1NTMH 5L3EA 4B3MO 4JTDB 1QHTA 3AG7A 3OR6C 3I5DA 4WFBV 5LP6C 1Z5VA 2EZOA 2ZNIA 3B09A 4DV0O 5KHHA 4UCRA 2YDEA 2HP8A 3I55V 4TT3G 3X2QB 2VQEO 2OTLV 1JJOA 3JAKA 2HJDA 1RM1B 5LL6Y 4B7KA 4I4TB 4R8CA 4JYCA 5KAFZ 4LF7B 3Q4HB 3W7XA 4UFZA 2ZT9B 2VQFO 4DV7O 1SQXH 3K79A 4X20A 1XL4A 1U97A 2UXCB 3JALA 4ZIBA 2IU3A 3H9VA 3E8FA 4PA9A 3ETDA 1NS1A 1V54B 1J5EB
chains in the Genus database with same CATH topology
1XMOO 5IT9N 4LF7O 4OX9O 4DR5O 1N33O 2HHHO 4X66O 3RT3C 4DV2O 4AQYO 2UXCO 2E5LO 1G1XB 1I94O 2ZKOA 4JI3O 3JAMN 4DR1O 4DR2O 3OTOO 4JI0O 4LF4O 4OPHA 1YZBA 4DR4O 1F7YA 5IWAO 1IBKO 1HNXO 4JI2O 4GKJO 1D2DA 1N32O 4B3RO 3J81N 1AILA 5LMNO 1R6TA 3J80N 1IBLO 3SDLA 1N34O 2UXDO 1R1BA 5FLXN 5A2QN 1XMQO 4NXMO 1X59A 3J7AU 4DV6O 2FKXA 4B3SO 3R66A 4DV4O 4JI4O 5BXZA 5LMUO 4JI8O 4B3TO 4JV5O 2UUCO 4X65O 4B3MO 5BY1A 4LFAO 4X64O 5H5NA 2ZM6O 4GKKO 4LF5O 2N74A 4YY3O 2UUAO 1FJGO 4DV0O 1N36O 4DV5O 2UU9O 4LF9O 4JI1O 4JYAO 1IBMO 1FKAO 2UXBO 4LF6O 4K0KO 1DK1A 1XNQO 4JI6O 4LFBO 1HNWO 2VQEO 4JI7O 4LF8O 2Z0AA 5BR8O 5LL6Y 4DUYO 4DUZO 4X62O 4YHHO 1HR0O 4DR7O 1KUQA 3O65A 2JRIA 3M8AA 2VQFO 4DV7O 1XEQA 2DOSA 4DV1O 2DJVA 3T1YO 1FYJA 2LW7A 4NXNO 4DV3O 1XNRO 3T1HO 4OPAA 4DR6O 3F5TA 1NS1A 1HNZO 2AGAA 2UUBO 1AB3A 1A32A 1J5EO 4KHPO 4DR3O 4JI5O 4A5UB 4LFCO 2F4VO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMO O;  5IT9 N;  4LF7 O;  4OX9 O;  4DR5 O;  1N33 O;  2HHH O;  4X66 O;  3RT3 C;  4DV2 O;  4AQY O;  2UXC O;  2E5L O;  1G1X B;  1I94 O;  2ZKO A;  4JI3 O;  3JAM N;  4DR1 O;  4DR2 O;  3OTO O;  4JI0 O;  4LF4 O;  4OPH A;  1YZB A;  4DR4 O;  1F7Y A;  5IWA O;  1IBK O;  1HNX O;  4JI2 O;  4GKJ O;  1D2D A;  1N32 O;  4B3R O;  3J81 N;  1AIL A;  5LMN O;  1R6T A;  3J80 N;  1IBL O;  3SDL A;  1N34 O;  2UXD O;  1R1B A;  5FLX N;  5A2Q N;  1XMQ O;  4NXM O;  1X59 A;  3J7A U;  4DV6 O;  2FKX A;  4B3S O;  3R66 A;  4DV4 O;  4JI4 O;  5BXZ A;  5LMU O;  4JI8 O;  4B3T O;  4JV5 O;  2UUC O;  4X65 O;  4B3M O;  5BY1 A;  4LFA O;  4X64 O;  5H5N A;  2ZM6 O;  4GKK O;  4LF5 O;  2N74 A;  4YY3 O;  2UUA O;  1FJG O;  4DV0 O;  1N36 O;  4DV5 O;  2UU9 O;  4LF9 O;  4JI1 O;  4JYA O;  1IBM O;  1FKA O;  2UXB O;  4LF6 O;  4K0K O;  1DK1 A;  1XNQ O;  4JI6 O;  4LFB O;  1HNW O;  2VQE O;  4JI7 O;  4LF8 O;  2Z0A A;  5BR8 O;  5LL6 Y;  4DUY O;  4DUZ O;  4X62 O;  4YHH O;  1HR0 O;  4DR7 O;  1KUQ A;  3O65 A;  2JRI A;  3M8A A;  2VQF O;  4DV7 O;  1XEQ A;  2DOS A;  4DV1 O;  2DJV A;  3T1Y O;  1FYJ A;  2LW7 A;  4NXN O;  4DV3 O;  1XNR O;  3T1H O;  4OPA A;  4DR6 O;  3F5T A;  1NS1 A;  1HNZ O;  2AGA A;  2UUB O;  1AB3 A;  1A32 A;  1J5E O;  4KHP O;  4DR3 O;  4JI5 O;  4A5U B;  4LFC O;  2F4V O; 
#chains in the Genus database with same CATH topology
 1F23 A;  5J2T A;  2FTK A;  3E2E A;  2P7T C;  1FXK C;  1MMM A;  3QVN A;  1FS0 G;  4JAU A;  2WA3 A;  3U11 A;  5LHH A;  3L9D A;  2DYS B;  2KKW A;  4JI3 O;  5B1N A;  3K3W A;  3OTO B;  3JAW A;  1D5A A;  2CTW A;  2EBO A;  4I4T A;  2BSK B;  3K0G A;  1DTO A;  2ZM6 B;  3FAV A;  5HFL A;  3CCL V;  2XOK G;  1IBL O;  4GX5 A;  5CBF A;  4DV6 O;  1PP9 H;  2P67 A;  3A0B Z;  5LGN A;  2W0X A;  4Z2W A;  4DYL A;  4TV9 A;  2YEV A;  4B3T O;  1KB9 F;  5BR8 B;  5LOV A;  3HKD A;  1NI8 A;  1RP3 B;  4DO2 A;  2ITD C;  1L8D A;  4X1I B;  1CPY A;  3RYH A;  1K7D A;  2JVD A;  2ZE7 A;  2XAJ A;  4TQF A;  4JI1 O;  4TOI A;  2WLI B;  1PNM A;  4X89 A;  2QE7 G;  1XNR B;  1BGY H;  1AJP A;  4UXN A;  5LYJ B;  1IXB A;  1FXK A;  4LFC B;  4I9Q A;  2UXN A;  1E1Q G;  3STL C;  1CXZ B;  4X88 A;  2Q68 A;  4ZHQ B;  3K5M A;  3OFN G;  3KZI Z;  4H33 A;  1FYJ A;  4LH6 A;  5EK0 A;  3CCU V;  3GVM A;  2ADP A;  4N21 A;  2P06 A;  3CRA A;  2ZDI A;  2OT5 A;  5B66 Z;  3B8N A;  2E74 B;  3ZN1 A;  2UUB B;  1LUV A;  1IUR A;  2W0F C;  1SQF A;  4J41 A;  4J9Z B;  2ZIN A;  3UT5 B;  1H2M A;  1Q6U A;  2CAZ C;  3ABU A;  4YJ3 B;  1NR1 A;  3QTC A;  5L3D A;  2UUC B;  3IC9 A;  3T4Z A;  4I7Z B;  2AXT Z;  5EBW C;  1X4T A;  1VMG A;  4GKJ B;  2ZIM A;  1K9M W;  4QPJ A;  4B3R B;  2HG5 C;  3QO5 A;  3HKC B;  4GZR B;  2X6A A;  1TUB A;  1NBM G;  4NTX A;  5AG2 A;  2UU9 B;  4I55 B;  5D5Q A;  5GTH Z;  1M1K W;  4PA7 A;  1O9G A;  3FKS G;  4FLZ A;  1VIB A;  2XTA A;  5BY1 A;  3EXA A;  4X64 O;  4X62 B;  4RWU A;  5JH7 A;  3A8T A;  5E1A C;  2Y48 A;  1KBH A;  3CSX A;  3LSQ A;  5KAI Z;  2ITC C;  2BTO A;  4K0K O;  3K06 A;  3QG5 A;  1KKC A;  2B9Z A;  1BZK A;  1OCO C;  2EIJ B;  2NLJ C;  4LF8 O;  4DUZ O;  4DK0 A;  3TK1 A;  2FYU H;  5EZY A;  4WFH A;  4XDJ A;  4MVO A;  4H0L B;  1ROP A;  4X66 B;  2ADQ B;  2OCH A;  1Y6X A;  3SJC C;  2X0L A;  4NXN O;  3C90 A;  2GHY A;  2Q67 A;  4UVB A;  4F6R B;  5FNV A;  4QIW F;  1VQ4 V;  1EN4 A;  1R3L C;  4GCZ A;  2P5O A;  4FLY A;  4P9P A;  2QTS A;  4FLW A;  2QWO B;  5LXT B;  1WAZ A;  2VWK A;  5JQG A;  2VS0 A;  4PA3 A;  1UJW B;  4FJC C;  1XI1 A;  2Z3Y A;  3ABM C;  1MA1 A;  4CC5 A;  4RQE A;  1VQ8 V;  4FMT A;  1V9P A;  4DR2 O;  1KEC A;  1G4Y B;  4LF4 O;  3JD0 A;  1XQ8 A;  4CS3 A;  4B3M B;  4FFB B;  2ATK C;  5IY5 B;  2IH3 C;  1HNX O;  4FLV A;  1V55 B;  1BSM A;  1D5N A;  2CTR A;  4KXR A;  3D3Q A;  4DV0 B;  1P84 F;  2GV9 A;  4FLT A;  5IJ0 A;  3CRQ A;  3G71 V;  1X59 A;  4NTY A;  5B1A B;  2WLN A;  1WP8 A;  2XAF A;  5CA1 B;  1UFI A;  1NZ6 A;  2KSD A;  3OEH G;  2QKS A;  5L3G A;  2E76 B;  3BPZ A;  1TUE B;  4UCS A;  3T2M A;  4GKK O;  1DF5 A;  4CZZ A;  4I50 B;  3CYO A;  4ZI7 A;  4L87 A;  4DV7 B;  4BW5 A;  3VOU A;  1DK1 A;  3D36 A;  1Q86 W;  3LNM B;  5H6R A;  3FB8 C;  4JI7 O;  1OV9 A;  3WFV A;  2MW2 B;  3CXC U;  2EJ7 A;  1TAE A;  1OCC B;  3M99 B;  4YHH O;  4DW1 A;  1R6K A;  2RNB A;  4I0X A;  2QR4 A;  1AI6 A;  1XUQ A;  1M9N A;  4X1K B;  1XHX A;  4EKW A;  3CC7 V;  1I08 A;  2PUS A;  2LW7 A;  3T4D A;  1Y76 B;  4JI3 B;  4QPK A;  3APO A;  3CRR A;  2F1M A;  5DEC A;  2A3Q A;  2CTP A;  5EYP B;  2Q7G A;  1S5H C;  1W0J G;  1KC8 W;  4Q20 A;  1EFR G;  5GW7 A;  4X1Y B;  2Y4U A;  4I50 A;  1N33 B;  1URF A;  3VQX A;  2NR5 A;  5H6Q A;  1IBL B;  3ASO B;  3G4S V;  2RMK B;  3N2G A;  1FFX B;  2MK3 A;  5KA5 A;  2EIL B;  4TV8 A;  1ENV A;  4JI0 O;  3N2K B;  3OR7 C;  1H38 A;  1IBK O;  1GTO A;  1K4C C;  1L0L H;  3J81 N;  3OMI B;  1HP8 A;  5LMN O;  4TWK A;  4MVU A;  2AZ2 A;  1KMI Z;  1DLB A;  3P3P A;  3APQ A;  3TXS A;  1H2K A;  2Y0I A;  4JI1 B;  4NXM O;  3VQV A;  5L3F A;  5JJE B;  4PJ0 Z;  1B6Q A;  1HWY A;  1OCR B;  4CBC A;  1PM9 A;  2P4V A;  3P30 A;  2JJ2 G;  4LF5 B;  2QA4 V;  4JAA A;  2FB5 A;  1Q6H A;  1LUW A;  2YUA A;  1N36 B;  3K5O A;  3AK1 A;  5K1P A;  4LF6 B;  2HLD G;  3OMN B;  2RN9 A;  2IJH A;  3N2K A;  2ZIO A;  3OGI B;  2PI4 A;  2L35 A;  4DUY B;  3O9O A;  3K5N A;  3N27 A;  1JCH A;  2Q69 A;  3HPL C;  1NQT A;  2IH1 C;  3H1K H;  3QO7 A;  2LP7 A;  4WF9 V;  3K0D A;  2EIM B;  2Y0P A;  2CGO A;  1PKX A;  2M6Y A;  2QWQ B;  1QVG U;  3BHP A;  3KCX A;  3ETQ A;  1HNZ O;  2D3O W;  4U3F H;  3U10 A;  3AG1 B;  4CH6 A;  4JI5 O;  1G8M A;  5DN6 G;  2P4K A;  4E2L A;  2QWN B;  1PNK A;  1ZLZ A;  2DWE C;  1KKD A;  4N23 A;  1M56 B;  3CX5 F;  4DV2 B;  4FZ0 A;  1G1X B;  2F23 A;  3OGC C;  3FB7 C;  2LGQ A;  1GN2 A;  4DR1 B;  3MHS C;  2R70 A;  2EZP A;  2XND G;  3A0H Z;  1WB7 A;  4JTA B;  3HKE A;  2ZE6 A;  2P90 A;  1M5I A;  3CCQ V;  1Q90 D;  3UQ8 A;  2N04 A;  3AG3 C;  1AIL A;  1XHZ A;  3F7Y C;  3OW2 U;  3P32 A;  1VQ5 V;  4R6Z A;  1XMQ B;  4K0K B;  4B3S O;  5B1B C;  4LP8 A;  1QR9 A;  1OZ0 A;  5LMU O;  2R9I A;  4XDK A;  4CH5 A;  4AHC A;  3JAK B;  3WB0 A;  4LF8 B;  4RUF A;  4UVC A;  4X65 B;  5CBG A;  3E8G A;  3VQW A;  4DRX B;  1ZAU A;  1SC5 B;  4RAI A;  1K33 A;  1MSW D;  5LGT A;  4OXS A;  1JA8 A;  1IBM O;  4JYA B;  3RN4 A;  4NXN B;  2Q8V A;  2ARH A;  1S0V A;  2Z5U A;  4PDV A;  3JAL B;  5FPO A;  2YS8 A;  1AJN A;  3JSN A;  2PYL A;  2C2A A;  1RPR A;  5KHJ A;  1AI7 A;  2B1G A;  3FB6 C;  2ZR2 A;  1GM9 A;  4UUJ C;  1WPB A;  5J9P C;  5J2T B;  2LQT A;  4DR7 O;  3OTF A;  2IM9 A;  3GWK C;  4JZ2 A;  2HVJ C;  1YJ9 V;  1JQ0 A;  3T1H B;  4LF4 B;  2GTS A;  3JAW B;  3BA8 A;  4DRX A;  5LP6 B;  4RUE A;  2IW5 A;  3GB7 C;  4HNA A;  1HNX B;  4Q6G A;  1XDC A;  3FAV B;  2HHH O;  1Y74 B;  4OX9 B;  3E83 A;  4ICG A;  3WB1 A;  4UB6 Z;  2ZR3 A;  1GM8 A;  4ZOL B;  2PYJ A;  4TV9 B;  2YEV B;  2DQ0 A;  4HAM A;  4OPH A;  2OYQ A;  4CC6 A;  1K92 A;  5LOV B;  2YIB A;  1S5L Z;  1V54 C;  3HKD B;  4GKK B;  3GWO A;  1D2D A;  2EIN C;  1N32 B;  1F51 A;  1Z5W A;  3RYH B;  1Q6I A;  5LBQ A;  1N34 O;  3ABL C;  3RFR A;  1SZX A;  5KHG A;  3C3T A;  4PDM A;  1Y66 A;  2OIG A;  2P6J A;  2ZNJ A;  3CB2 A;  2ZD9 A;  3NR7 A;  3K5L A;  4GYC B;  5LP6 A;  4IIJ A;  5H5N A;  3JAS A;  1FXK B;  3L72 H;  2N74 A;  3K58 A;  1Y74 A;  5JJJ B;  1I0H A;  1EN6 A;  3QO8 A;  3AK2 A;  1GH6 A;  4K35 A;  4MVS A;  4DV5 B;  2EIK C;  4O2A A;  4ZOL A;  3B2E E;  1S77 D;  4LWS B;  2QM8 A;  2HEP A;  5JJN B;  1SF9 A;  1VP7 A;  2WLH A;  2QSA A;  4PD4 F;  4KL1 A;  1AP6 A;  4BIO A;  1THZ A;  3ASN C;  3AG4 C;  3UO2 A;  1GN4 A;  1TA8 A;  4ZKI A;  4DV3 B;  1GRJ A;  2JEU A;  4JI0 B;  3OMA B;  1JPX A;  3L70 H;  1UPG A;  1SRY A;  1IBK B;  3CXH F;  3BAA A;  1RSO A;  3CC2 V;  1DF4 A;  1SQQ H;  2LGW A;  4WFE A;  3ZHR A;  1GN3 A;  3SJQ C;  1TUB B;  3CCS V;  4NXM B;  2E5L O;  3CRM A;  2OWO A;  1I94 O;  4LWS A;  3LUT B;  2Y69 C;  3L71 H;  4PA4 A;  2N05 A;  1BT8 A;  4GUN A;  4NB5 A;  3BAB A;  4JI2 O;  1N0N A;  5JH7 B;  2WPD G;  5JCO C;  4H13 B;  2X6C A;  1N4C A;  3OE7 G;  2HJF C;  4MSW C;  3J7A U;  4JZG A;  3E8H A;  4JI4 O;  2RQ6 A;  1M4U A;  4AI8 A;  3H01 A;  4LH7 A;  1FPO A;  2YC0 A;  4LFA O;  3CJH A;  2BCC H;  2AW9 A;  2V1D A;  4R7C A;  4UCT A;  2UUA O;  1O9H A;  5EZY B;  1WN7 A;  4NTW A;  4PI0 A;  1N8R W;  3BRC A;  4IT5 A;  5EC1 C;  1FKA O;  2UXB O;  4J9Y B;  1QCE A;  1Q3E A;  1HNW O;  4LFB B;  1BQZ A;  3CCE V;  5L3C A;  1U96 A;  2UXX A;  5FNV B;  2A9H A;  3LDE A;  4B08 A;  3RVY A;  1K8A W;  1IX9 A;  5CN0 A;  5JQG B;  1SS3 A;  5GON A;  1XEQ A;  4DV1 O;  2JDI G;  2IJI A;  4J7K A;  3K9S A;  4YIP A;  3ZRX A;  3MDS A;  4GX0 A;  4DXW A;  2GBO A;  4OPA A;  1OCZ C;  4J11 A;  5IYZ B;  3E86 A;  2EIJ C;  3OUF A;  4JYB A;  1AB3 A;  2B1I A;  2QDO A;  1XIL A;  2ZQM A;  4BWA A;  1VEW A;  2B5U A;  4ZBM A;  1COW G;  5IYD O;  2QKC A;  5IJ0 B;  4UVA A;  1OCO B;  3ZJZ A;  1RPO A;  4AQY B;  3AG2 C;  3OM3 B;  3PJS K;  1YSC A;  4I9W A;  3JSL A;  1AVM A;  1F7Y A;  1BCC H;  4TSF G;  5IWA O;  5CMU A;  2AHY A;  4RO2 A;  2R9A A;  5GTI Z;  4RQF A;  4ZI7 B;  1R1B A;  4MVZ A;  3SPJ A;  5BXZ A;  2M7W A;  4DV4 B;  4FM1 A;  2BOC C;  1ZUQ A;  5C8Y A;  5IYZ A;  1J95 A;  3S3W A;  4U7O A;  1ORQ C;  1NJI W;  3ZHQ A;  3ZMZ A;  1PD3 A;  1T5E A;  1EZJ A;  4YY3 O;  4I0X B;  1Q81 W;  1V55 C;  3H1J H;  2KG7 B;  1VF7 A;  3ZRW B;  1SER A;  1IDS A;  4HBN A;  3L75 H;  1QQC A;  1US6 A;  5B1A C;  2VQE B;  2F66 C;  1P4R A;  1ZSP A;  1YJN V;  3TET A;  5LA6 A;  2CUG A;  2JGU A;  4O4H B;  4BIU A;  3KCY A;  3O65 A;  3DC5 A;  3WG7 B;  3RBZ A;  2VQF B;  1VQ6 V;  5KHI A;  5D5P A;  5IYB O;  4U3J B;  3N2G B;  1SA0 A;  3DGE A;  3C3S A;  4TV8 B;  4DR6 O;  2GUZ A;  3H1I H;  2H3O A;  2WA4 A;  4HZ3 A;  5H2F Z;  2CE4 A;  1J5E O;  1ARO P;  2VWJ A;  1IVS A;  3KKY A;  1BQ0 A;  2KG7 A;  3H1H H;  1GK9 A;  1TGO A;  3IFX A;  2YIC A;  3ZRW A;  2LFS A;  1AR4 A;  4PDL A;  4F6E A;  3IC7 A;  4PEL A;  3OTO O;  3LSU A;  2Q6A A;  1K4D C;  2CDY A;  3FD9 A;  3G80 A;  4O4H A;  1R6T A;  2F43 G;  2OCC B;  2H8P C;  2YXH A;  1YTF B;  1K34 A;  2FKX A;  4U3J A;  1M93 A;  4DV6 B;  4FM0 A;  4JI8 O;  4IL6 Z;  1BL8 A;  4JV5 O;  4B3T B;  3WU2 Z;  4CH4 A;  5KUM A;  1MNG A;  2QJ1 A;  2XAQ A;  3K59 A;  3JCZ A;  1W2B U;  3B4S A;  1NVP B;  4IHJ A;  2WSS G;  2H94 A;  4WCE V;  1VAR A;  4LCU C;  2A79 B;  1BMF G;  5CA3 A;  4GX1 A;  3A2F A;  4JF3 A;  5EIB D;  1XRE A;  1W59 A;  1M57 C;  3CS5 A;  5KX5 A;  1VQ9 V;  2WLL A;  1HR0 O;  1AI5 A;  4MW8 A;  2NN4 A;  4LC1 A;  2ZXW C;  1R6N A;  4X8A A;  4GT1 A;  3RYI B;  2CH7 A;  1K3E A;  2BE3 A;  4JTC B;  2EUL A;  3HR0 A;  3ZHU A;  5ITZ B;  3T1Y O;  1QVF U;  5B3S B;  1I94 B;  2JGD A;  4MTX A;  4U7N A;  1VF6 C;  3MAQ A;  4BW9 A;  2UUB O;  3MHH C;  4JI2 B;  3HKE B;  5FPR A;  4OGQ B;  4QNH B;  3HB3 B;  4E4E A;  3ZHV A;  3ZHT A;  3SR2 C;  2KB1 A;  4NR1 A;  2LFR A;  4JI4 B;  5IJ9 B;  2RJZ A;  5TIS Z;  3W7W A;  5KLV H;  2DN9 A;  4YIO A;  4LFA B;  3UO3 A;  3F7V C;  1JX9 A;  4GKJ O;  3D8C A;  4B3R O;  3G67 A;  2DE0 X;  3TXQ A;  3RYI A;  5BMV A;  5ITZ A;  1Z2G A;  2UXD O;  1QLE C;  4QJF B;  2UXB B;  1CEZ A;  1P7G A;  3R66 A;  4IYI A;  3CCM V;  1M56 C;  5CA0 B;  3ABT A;  3F5W C;  1MG1 A;  1YVW A;  2YXL A;  3IJ4 A;  2ZE8 A;  3JAT A;  4L8J A;  2XAG A;  4X64 B;  3CC4 V;  3SYQ A;  1DGS A;  4MTO A;  5B5E Z;  1M90 W;  1YIJ V;  4D6T H;  4LF9 O;  2FL4 A;  4DV1 B;  3HKB A;  2DWD C;  1XNQ O;  5JVD A;  1AI4 A;  3L73 H;  5IJ9 A;  3CWB H;  2Z0A A;  3EFF K;  3ZMS A;  1Q7Y W;  1JFF A;  1Q43 A;  3ABK C;  4DUZ B;  4FIP C;  4HNA B;  2E3C A;  4NKG B;  3RVZ A;  5KMG B;  3T1C A;  2PZS A;  3JD4 A;  3LNN A;  1LNQ A;  3SJB C;  5B1B B;  4TUY A;  3ZHS A;  4LNU B;  1Q5O A;  5CA0 A;  3VBB A;  4EEQ A;  1R3J C;  3CD6 V;  2DYR C;  2PTM A;  2AGA A;  5HFM A;  4KHP O;  4A5U B;  1H2G A;  3E8B A;  3R65 A;  4O4I A;  1N0J A;  4FLX A;  2CGN A;  1SES A;  1AR1 B;  2YI8 A;  1R73 A;  1S76 D;  1OHH G;  4LR3 A;  2IJJ A;  1JVM A;  3K9A A;  1HW7 A;  1K5Q A;  3FYE B;  1SZT A;  4DR2 B;  3CHX A;  4MT8 A;  4YJ2 A;  3X2Q C;  3E22 A;  4K8X A;  1WJZ A;  4ASU G;  3OUS A;  4MVR A;  3SPC A;  2EJR A;  2HVK C;  4IIJ B;  3JAS B;  1RM1 C;  5CB4 A;  3SGI A;  4YY3 B;  5KMG A;  2Y4T A;  4FK5 C;  1Q82 W;  1FAF A;  4G28 B;  2JS5 A;  2V4D A;  2JS3 A;  4O2A B;  3JCU Z;  4LNU A;  1KU9 A;  3CEI A;  2W6J G;  1SKV A;  2QM4 A;  2X7R B;  3JAR B;  5J2U A;  2O57 A;  2JJ1 G;  3I56 V;  1MZF A;  1H2L A;  4R50 A;  1YHQ V;  2GDS A;  1FJG O;  2AZ0 A;  1ZL8 A;  1OJH A;  4WBN A;  1NH2 B;  1B06 A;  4QE9 A;  4EB6 A;  5L3B A;  2DYS C;  4JI7 B;  4DR6 B;  1XBL A;  4CS4 A;  2EIN B;  3JD2 A;  4GX2 A;  3UKM A;  4FM2 A;  2QKA A;  4YHH B;  4W4L A;  1P7B A;  1WP7 A;  3ABL B;  4IYH A;  1RSO B;  3CRC A;  3M8A A;  2DOS A;  4P9O A;  2GTA A;  3ZX6 A;  3K57 A;  1JOY A;  2JK5 C;  3LSS A;  4P2Z A;  1VQM V;  3JYC A;  3JAR A;  4EFB A;  1QNM A;  2CTQ A;  1QR8 A;  1VQ7 V;  1PL4 A;  2ZDI C;  4PI2 A;  2F4V O;  1XMO O;  3Q4H A;  4XDL A;  4Z1V A;  2YI9 A;  1N33 O;  1VQN V;  2EIK B;  5KHK A;  1JR9 A;  1F4N A;  3RWR D;  1VQP V;  4PDR A;  4HYO A;  3SPG A;  2RDC A;  4JI8 B;  4MVQ A;  4BR6 A;  4JV5 B;  5FL7 G;  3AK3 A;  1NKD A;  2Q0A A;  2XT9 A;  3CME V;  3CJH B;  3E89 A;  1VF5 B;  2FML A;  1XL6 A;  3ASN B;  3AG4 B;  1TVK B;  5C93 A;  3J80 N;  2YIB D;  3NXS A;  5B1O A;  5LMN B;  1SET A;  5A2Q N;  1MSD A;  1H8H G;  3TCU A;  4D7T A;  2DMX A;  2QM7 A;  3BVO A;  3BA9 A;  2ZCE A;  4KUM A;  2BSK A;  4BAY A;  2JIZ G;  4MTF A;  1HR0 B;  4LF5 O;  1SQV H;  5LHG A;  2EX3 A;  3K08 A;  1E79 G;  3SYA A;  1FXV A;  1N36 O;  2ODM A;  5GON B;  2XUM A;  2Y69 B;  4LF6 O;  3T1Y B;  1GMG A;  3ZBH A;  3FYI B;  2YXY A;  1FXH A;  2Q7E A;  4DUY O;  2Q4P A;  5K1X A;  4TQD A;  3BFR A;  4UCV A;  1YXB A;  4X1I A;  1TVK A;  1NU1 H;  2LW1 A;  4WFA V;  1KUQ A;  2JRI A;  3FB5 C;  3TGU H;  1XOU A;  2XAS A;  4G27 B;  3DTU B;  4JAV A;  2WLI A;  4UV8 A;  4K3A A;  2A0L A;  3JD3 A;  3IGA C;  3CP1 A;  1NH2 D;  3OAA G;  5LYJ A;  2X6B A;  2JEX A;  1HNZ B;  4DR3 O;  1KYO F;  4H37 A;  2Q0O C;  4JYY A;  2YSU B;  3UM7 A;  4JI5 B;  4DR5 O;  2Q5Z A;  4ZHQ A;  2XHB A;  1EBO A;  1K73 W;  3FFQ A;  2UXD B;  1PV0 A;  4DV2 O;  1WLE A;  4CH3 A;  2G38 A;  2PI5 A;  2WLK A;  3ETG A;  4DR1 O;  1WB8 A;  1ZWI C;  3SPI A;  4F4L A;  2LJ2 A;  3B8M A;  4JGS A;  4DR4 O;  5C8Y B;  5JCO A;  4IGG A;  3S3X A;  5BZB A;  1W0K G;  3UT5 A;  2F95 B;  2BOB C;  1YJW V;  3WB2 A;  4LF9 B;  1I7F A;  3U0Z A;  1XMQ O;  3ZED A;  4YJ3 A;  4W4K A;  1AP5 A;  3QNE A;  1OCZ B;  2IU0 A;  3BY6 A;  1XNQ B;  4B3S B;  1PPJ H;  4NYK A;  4MTG A;  5LMU B;  1BHA A;  4X65 O;  1BS3 A;  5DED A;  1E1R G;  2YIA A;  2RCV A;  3UCS C;  5LA6 B;  3HKC A;  3M7M X;  3AG2 B;  4I55 A;  4UCU A;  4ABM A;  4JYA O;  1Y4M A;  1HDJ A;  1IBM B;  1YDX A;  1NT2 B;  4JI6 O;  1SA0 B;  5JWP A;  1K5S A;  1WA8 B;  2R72 A;  3D36 C;  5EIB C;  4J42 A;  2GUZ B;  2YID A;  4FVM A;  2NNU A;  4KHP B;  1WNS A;  2E75 B;  2PGG A;  3B40 A;  5IY5 C;  1KP3 A;  4X9Q A;  1SQB H;  3OD4 A;  4DR7 B;  3ABM B;  1YIT V;  3LDC A;  3ZN0 A;  2DJV A;  4CS2 A;  2WLJ A;  4I5S A;  2L6L A;  3W7S A;  4MVM A;  4C7U A;  1KD1 W;  1KP2 A;  2LO1 A;  3QF7 A;  3DXR B;  3T1H O;  2IJK A;  5IDJ A;  2R9R B;  1MOF A;  2Q9L A;  4FLU A;  1AR5 A;  3L74 H;  3OEE G;  3VQY A;  1JJ2 U;  1SQP H;  4PV1 B;  4LF7 O;  1G6U A;  4OX9 O;  2VRZ A;  2HHH B;  4Z1M G;  1H2N A;  3WG7 C;  2UXC O;  1FFT B;  3DSQ A;  1WA8 A;  4F6R A;  3A0R A;  4EFE A;  3JD1 A;  4G2K A;  2DW4 A;  1QU7 A;  4XBF A;  5LXT A;  3THO A;  5LGU A;  1N32 O;  1CP9 A;  1OCC C;  5LHI A;  5CBH A;  2QWR B;  4MW3 A;  1FJG B;  3SDL A;  4IHJ B;  1N34 B;  2QGN A;  3SPH A;  5FLX N;  2K1E A;  2WAM A;  1I5Y A;  3DXR A;  1VQL V;  1GM7 A;  2Q73 A;  3RYC B;  3DC6 A;  4FFB A;  5DM6 V;  3ZMU A;  1PL0 A;  5KX5 B;  2ZM6 O;  2HKO A;  5E79 Z;  4B7E A;  2WLL B;  2CK3 G;  4JAS A;  1MZE A;  2HFE C;  2CH7 B;  4DV5 O;  4O4J B;  3TJT A;  3ZRV A;  2OTJ V;  1Q8I A;  2OCC C;  3ASO C;  5CA1 A;  2XAH A;  4J7J A;  3ICX A;  3RYF B;  2PY5 A;  4O4L B;  2JGD B;  5EBM C;  5BR8 O;  4WFG A;  2EIL C;  2A06 H;  2F4V B;  1XMO B;  5H9C A;  1LR1 A;  1S72 V;  1YCI A;  4DV3 O;  4QE7 A;  1XNR O;  2F93 B;  1VQK V;  4J80 A;  3RYC A;  2GSM B;  4J7Z A;  2WWW A;  1NTZ H;  3CE2 A;  1A32 A;  2HR3 A;  3B77 A;  3MD0 A;  4LFC O;  1WPX A;  4AIL C;  1OCR C;  1YI2 V;  4X1K A;  4D7S A;  3ZRS A;  4O4J A;  1ZTE A;  5BMV B;  2DQ3 A;  1L0N H;  1GN6 A;  1EZV H;  1Y76 A;  2E5L B;  3RYF A;  1M57 B;  4O4L A;  2A7W A;  4DK1 A;  3ZS8 C;  5B3S C;  2AHZ A;  5EYP A;  1YZB A;  4FFK A;  2ZXW B;  1YF2 A;  1FD9 A;  3JAT B;  4X1Y A;  1I5X A;  3K04 A;  2D2C B;  3SYO A;  1BHB A;  1GO3 F;  3ZCC A;  3CCV V;  1FFX A;  4JPR A;  4NVP A;  4YXW G;  4KP4 A;  2EIM C;  3HKB B;  2QEX V;  5JVD B;  3SYP A;  2UUC O;  2WLM A;  1KQS U;  1GKF A;  3G6E V;  1JFF B;  4QGP A;  1P49 A;  3ETE A;  5IYC O;  3AG1 C;  2PF4 E;  4P30 A;  3K03 A;  1F4M A;  2UUA B;  1R3K C;  2ILM A;  5KA6 A;  2UU9 O;  4KFM A;  4TUY B;  3ML0 A;  1SQG A;  3FX7 A;  1S3J A;  4LFB O;  1IXM A;  3KG2 A;  1QBZ A;  3BCC H;  1HNW B;  1QLN A;  1NTK H;  3ZMT A;  3P3N A;  3LDD A;  3CCR V;  4DW0 A;  4X62 O;  3SYC A;  4DR3 B;  3RGB A;  3CCJ V;  1B3Q A;  1Y67 A;  3ZMV A;  4O4I B;  4DR5 B;  1EN5 A;  3G6B A;  1QLE B;  2W6I G;  4H44 B;  1RFY A;  3D3I A;  1BE3 H;  1H2S B;  3EHB B;  4O2B B;  3SJA C;  1YTF D;  2BTQ B;  4WFF A;  1VF6 A;  3STZ C;  1H8E G;  4UB8 Z;  4GLX A;  2V7Q G;  1R3I C;  1L1F A;  1GAX A;  3F5T A;  3CMA V;  1MAB G;  3ZIA G;  4DR4 B;  4LBE C;  1IZ3 A;  4YJ2 B;  3AG3 B;  3E22 B;  3RW0 A;  3W7U A;  3AEI A;  5A9G A;  5EC2 C;  5IT9 N;  1VQO V;  3PN1 A;  4FPP A;  5CB4 B;  4X66 O;  4FZ1 A;  3RT3 C;  4K8Z A;  5IE9 A;  2ETN A;  1NVP D;  2Q7H A;  4AQY O;  4UV9 A;  4J10 A;  2ZKO A;  3OT7 A;  4PA6 A;  1S5J A;  3ABK B;  3JAM N;  4BIZ A;  5J2U B;  3CPW U;  1PNL A;  2KQX A;  5IWA B;  4MS2 A;  1NR7 A;  5KUK A;  2QTO A;  1ZX3 A;  1AJQ A;  1EM1 A;  2QWP B;  2ZE5 A;  1YEW A;  4UCO A;  2OIE A;  3W7T A;  2P22 C;  3H1L H;  1ZL8 B;  4X20 B;  5EBL C;  2K9P A;  1B04 A;  3BEH A;  2IBZ H;  4O2B A;  1JMK C;  4PHZ A;  3EVK A;  4DV4 O;  2BTQ A;  4JI6 B;  2DYR B;  4WBN B;  5F2V O;  3E35 A;  4EB6 B;  1K97 A;  3IAY A;  1NTM H;  5L3E A;  4B3M O;  4JTD B;  1QHT A;  3AG7 A;  3OR6 C;  3I5D A;  4WFB V;  5LP6 C;  1Z5V A;  2EZO A;  2ZNI A;  3B09 A;  4DV0 O;  5KHH A;  4UCR A;  2YDE A;  2HP8 A;  3I55 V;  4TT3 G;  3X2Q B;  2VQE O;  2OTL V;  1JJO A;  3JAK A;  2HJD A;  1RM1 B;  5LL6 Y;  4B7K A;  4I4T B;  4R8C A;  4JYC A;  5KAF Z;  4LF7 B;  3Q4H B;  3W7X A;  4UFZ A;  2ZT9 B;  2VQF O;  4DV7 O;  1SQX H;  3K79 A;  4X20 A;  1XL4 A;  1U97 A;  2UXC B;  3JAL A;  4ZIB A;  2IU3 A;  3H9V A;  3E8F A;  4PA9 A;  3ETD A;  1NS1 A;  1V54 B;  1J5E B; 
#chains in the Genus database with same CATH homology
 1XMO O;  5IT9 N;  4LF7 O;  4OX9 O;  4DR5 O;  1N33 O;  2HHH O;  4X66 O;  3RT3 C;  4DV2 O;  4AQY O;  2UXC O;  2E5L O;  1G1X B;  1I94 O;  2ZKO A;  4JI3 O;  3JAM N;  4DR1 O;  4DR2 O;  3OTO O;  4JI0 O;  4LF4 O;  4OPH A;  1YZB A;  4DR4 O;  1F7Y A;  5IWA O;  1IBK O;  1HNX O;  4JI2 O;  4GKJ O;  1D2D A;  1N32 O;  4B3R O;  3J81 N;  1AIL A;  5LMN O;  1R6T A;  3J80 N;  1IBL O;  3SDL A;  1N34 O;  2UXD O;  1R1B A;  5FLX N;  5A2Q N;  1XMQ O;  4NXM O;  1X59 A;  3J7A U;  4DV6 O;  2FKX A;  4B3S O;  3R66 A;  4DV4 O;  4JI4 O;  5BXZ A;  5LMU O;  4JI8 O;  4B3T O;  4JV5 O;  2UUC O;  4X65 O;  4B3M O;  5BY1 A;  4LFA O;  4X64 O;  5H5N A;  2ZM6 O;  4GKK O;  4LF5 O;  2N74 A;  4YY3 O;  2UUA O;  1FJG O;  4DV0 O;  1N36 O;  4DV5 O;  2UU9 O;  4LF9 O;  4JI1 O;  4JYA O;  1IBM O;  1FKA O;  2UXB O;  4LF6 O;  4K0K O;  1DK1 A;  1XNQ O;  4JI6 O;  4LFB O;  1HNW O;  2VQE O;  4JI7 O;  4LF8 O;  2Z0A A;  5BR8 O;  5LL6 Y;  4DUY O;  4DUZ O;  4X62 O;  4YHH O;  1HR0 O;  4DR7 O;  1KUQ A;  3O65 A;  2JRI A;  3M8A A;  2VQF O;  4DV7 O;  1XEQ A;  2DOS A;  4DV1 O;  2DJV A;  3T1Y O;  1FYJ A;  2LW7 A;  4NXN O;  4DV3 O;  1XNR O;  3T1H O;  4OPA A;  4DR6 O;  3F5T A;  1NS1 A;  1HNZ O;  2AGA A;  2UUB O;  1AB3 A;  1A32 A;  1J5E O;  4KHP O;  4DR3 O;  4JI5 O;  4A5U B;  4LFC O;  2F4V O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...