4A5UB

Turnip yellow mosaic virus proteinase and escherichia coli 30s ribosomal s15
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
80
Chain Sequence
SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFSRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA REPLICASE POLYPROTEIN
publication title A Compact Viral Processing Proteinase/Ubiquitin Hydrolase from the Otu Family.
pubmed doi rcsb
source organism Turnip yellow mosaic virus
molecule tags Transferase/rna binding protein
total genus 28
structure length 80
sequence length 88
ec nomenclature
pdb deposition date 2011-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4a5uB00
4DR6O 4JI0O 4AQYO 1N32O 3JAMN 3T1YO 1DK1A 3F5TA 2UU9O 4GKKO 1R6TA 2UUBO 1XEQA 4LF7O 4LFAO 1N33O 1HNZO 4JI2O 4DR2O 1I94O 1XMQO 1KUQA 2DOSA 2ZM6O 4DR3O 2UXBO 4DV7O 4B3TO 4NXMO 4YY3O 1IBLO 4DR7O 4OX9O 4DR5O 4X62O 4DR1O 4JI5O 5H5NA 4LF6O 1D2DA 1IBKO 5BY1A 2E5LO 2LW7A 4LFBO 2UXCO 4OPHA 2VQEO 4NXNO 3J7AU 2ZKOA 4KHPO 1AB3A 3R66A 4A5UB 4DUYO 4JI6O 2UUAO 4B3RO 1N36O 3RT3C 4LF8O 4B3SO 4K0KO 1FYJA 4B3MO 4LF4O 4X65O 2N74A 1X59A 1HNXO 5A2QN 4DV6O 5IWAO 4DV2O 1A32A 1IBMO 4DR4O 4JI8O 4LF9O 1G1XB 4DV1O 1YZBA 4JV5O 3T1HO 3OTOO 1NS1A 2DJVA 3J80N 4LF5O 2Z0AA 4YHHO 5FLXN 1HR0O 1FJGO 4X64O 4JI1O 4DV5O 5LMNO 4DV0O 4JI4O 1J5EO 2HHHO 5LMUO 4OPAA 4JI3O 4DV3O 4JYAO 1HNWO 3O65A 2JRIA 2AGAA 1N34O 1R1BA 5BR8O 5LL6Y 2UXDO 2UUCO 4DV4O 5IT9N 5BXZA 3M8AA 1F7YA 2F4VO 1AILA 4JI7O 4LFCO 1FKAO 1XNRO 2VQFO 1XNQO 2FKXA 1XMOO 4DUZO 3SDLA 4GKJO 3J81N 4X66O
chains in the Genus database with same CATH superfamily
4CH6A 3ABUA 3H1JH 4IIJB 4CH5A 5DEDA 4WBNB 3SPCA 2ADQB 5B1OA 2ADPA 4X1KB 1XEQA 5JVDB 2Y4UA 4X65B 3ASNC 1WP7A 2EX3A 2R9RB 4DR2O 1HNXB 4AILC 1RM1B 3H1KH 1IXMA 1URFA 1ZWIC 3K5LA 3UO3A 4JV5B 4MVOA 1VF5B 5BY1A 3SR2C 1VQ8V 5TISZ 3H1HH 1PKXA 5KUKA 4DV5B 1S5HC 2OT5A 1LUVA 3A0RA 4R8CA 1NI8A 3NXSA 2NN4A 3OR7C 4EB6A 4H13B 3R66A 4F6RA 2OYQA 4B3RO 1HNWB 3N27A 1NKDA 3L71H 3JALA 4K35A 3ETDA 1WLEA 3DC6A 1N0JA 1XNRB 3MHHC 5A9GA 3B40A 2QWNB 1SRYA 3CRMA 3KCXA 2F1MA 3OAAG 2LGWA 2E74B 3M7MX 1RFYA 1QVFU 2XTAA 4XDLA 2RNBA 2XAGA 3KG2A 1VQ9V 1JFFB 2XT9A 3CCEV 1TAEA 2WAMA 2QKAA 3A8TA 1UJWB 1E1QG 4WFAV 3E22B 1FFXB 5LL6Y 2FB5A 3D36A 3L9DA 1PNLA 2GTAA 4X1IA 2VQFO 3SPGA 5FPRA 1X4TA 4ZI7B 2FTKA 1GAXA 5EZYB 3I55V 3ZRWA 3GVMA 1HP8A 2DMXA 2JVDA 1R6TA 1OCZC 3UO2A 1J5EB 4JASA 1JX9A 1SZTA 1EBOA 3CJHA 5KMGB 2EULA 4MVMA 4JAUA 2ZM6O 4JGSA 3S3WA 1SQBH 1K3EA 4N23A 1YEWA 4DR7O 2QA4V 1AI4A 4BIUA 2YICA 3CYOA 4PA3A 4LF5B 3OGCC 3U11A 1SESA 3MDSA 2AW9A 3J7AU 1SERA 3LDCA 2Z5UA 4WFBV 5J2TB 1KMIZ 3SYAA 4KXRA 3RW0A 4JI3B 1QR9A 1N33B 2A3QA 2XAQA 1I94B 1RSOA 4LF4O 3OUFA 2ZDIA 5J9PC 5B1BB 2RN9A 1Q82W 1GM9A 2ZNIA 5GTIZ 2GV9A 2Q0AA 3U10A 5LHIA 2A79B 1NR1A 2DWDC 4X1YB 4CC6A 5LXTB 2ZQMA 3ZHVA 1K8AW 1KB9F 2WWWA 3E86A 4FFBB 1YSCA 2B1GA 5LMNO 1VMGA 3D3IA 1GRJA 2BSKB 4JTDB 1IBLB 2ZR2A 4MVQA 1VQ6V 1XUQA 4LF6B 1H2LA 3LSQA 4QJFB 2V4DA 4I9QA 5H6RA 1M57C 2GUZA 4H44B 4TQDA 4PDMA 4UFZA 4R6ZA 2B1IA 1TUBA 4YJ3B 2IJJA 3CCLV 1YJWV 2UU9O 3OFNG 5EIBD 2Q8VA 4LF7O 2EINC 2IM9A 2WLLA 1BE3H 1FFTB 1J95A 2YIBA 1KUQA 2GHYA 3CCVV 5C8YB 3R65A 1MG1A 1YI2V 5ITZA 3CPWU 4J9ZB 4F4LA 1DF4A 3OD4A 3CCMV 3T1HB 5CB4A 1KBHA 1AVMA 3UM7A 1G4YB 3E8BA 4Z2WA 2HHHB 5CA0B 1R3JC 4J80A 1SA0B 1WA8B 1ZL8B 4MTOA 1N36O 3RT3C 1QCEA 1QNMA 2AZ2A 4E2LA 1SC5B 3ZN1A 2M7WA 4N21A 1KKDA 4LP8A 3K79A 1BQ0A 1QHTA 3ZHRA 4AQYB 1E79G 2QGNA 3K06A 2HLDG 1YTFD 1SF9A 1Z5VA 2Q69A 5GW7A 4JI4O 1J5EO 3Q4HA 2OCCC 2EJ7A 1QLEB 1Y74B 3FFQA 3ZMSA 1CEZA 3CWBH 4B3TB 5LYJA 4JI5B 5KHJA 3ABMB 1IBKB 1TVKA 4LFBB 4U3JB 4O4LA 2ZR3A 4MT8A 3ZS8C 2YIBD 1CPYA 1XNQO 3TCUA 3JSLA 1YITV 4YJ2A 2Q73A 2PI5A 1XILA 5LP6A 2BOCC 4JI0O 3ZCCA 3QF7A 2VRZA 4OGQB 5JCOC 3AK3A 5B1AC 1EFRG 1SQPH 3OGIB 1N33O 3OE7G 3X2QC 2DQ3A 3AG1B 1B04A 4BW9A 5LOVB 1I94O 3AK1A 3ABLC 4DV2B 1ROPA 4O2AA 1FXKC 2UXBO 3CHXA 4O2BA 4NXMO 5KHIA 2EIMC 3HKDB 3RYCA 1VQOV 3WB1A 3IJ4A 5JWPA 1K4CC 3ZRSA 4UCTA 2LW7A 1Y66A 4FJCC 4CBCA 2UXCO 4MW3A 4WF9V 1I7FA 3RN4A 4TV9A 3P32A 2OCHA 1VQKV 4QPJA 5IJ0B 2ZE8A 3KKYA 3ZJZA 4EB6B 4P9OA 3F7VC 4F6RB 5IYDO 1JQ0A 1MZEA 2VWKA 3UQ8A 4I0XB 1YDXA 3AG2B 1I0HA 2EIJB 4NTWA 4OXSA 5DN6G 1G1XB 3B8MA 5J2UB 1R3LC 1OZ0A 2ATKC 2QM4A 1SETA 2F23A 5FLXN 2WLHA 3JSNA 4QNHB 2JIZG 3D8CA 2CTQA 4HYOA 3B2EE 2LFRA 4BR6A 4MW8A 4CS3A 5EBMC 4D7TA 4GT1A 4JYAO 3UT5B 1Q86W 1AJNA 4FM2A 4RQEA 4DV4O 4X89A 2YS8A 3M8AA 2F4VO 3JARA 2EIKC 4GUNA 1E1RG 2K1EA 3STZC 3IC9A 2E3CA 1O9GA 1YJNV 4B3RB 3SYCA 4Q20A 1Q8IA 3ABKB 3ETGA 3W7TA 3RVYA 1GN4A 2CTPA 4QE7A 2EZOA 2GDSA 3LSSA 2KKWA 2Y4TA 2XUMA 1IURA 1VQLV 3FX7A 3RYIA 4H33A 3BHPA 4DK0A 1NQTA 1PD3A 2QWOB 3CJHB 2R9IA 1S72V 1NVPB 3EVKA 4C7UA 2LO1A 4GYCB 3N2KA 2W6IG 4HNAB 1ZTEA 4XDJA 3BA9A 2WLIA 4YXWG 3CCQV 2OIEA 5L3CA 1MNGA 4W4LA 4NXNO 4X20B 1OCRB 3QO5A 4UVCA 3A0BZ 4DUYO 2ZIOA 4LNUA 1S0VA 5IY5C 4LF8O 1M56B 4G27B 2PYLA 5CMUA 5DECA 2QSAA 2Q0OC 1N8RW 4O4IB 2ITCC 4MTXA 2VQFB 3JAKB 4DV6O 1S76D 2CGOA 2JJ1G 3E8HA 4IGGA 3TK1A 1Q6UA 4DV1O 2Q5ZA 2DQ0A 1ZUQA 5C93A 2Q6AA 4JF3A 2IH1C 2F66C 2E76B 1RM1C 3SJCC 3SJAC 4PJ0Z 3EHBB 4IHJA 3MAQA 3FKSG 3ZHQA 1G6UA 2EBOA 3BAAA 4P2ZA 2ZM6B 3BRCA 3STLC 3BFRA 3DGEA 4DR7B 1P49A 2R9AA 3ZIAG 1EN6A 1IVSA 1WPBA 2UXDO 1GTOA 5FL7G 1PM9A 3K04A 4NR1A 1AR4A 3OM3B 5LHHA 1OCCB 3VQVA 2ETNA 2GSMB 2IH3C 3SDLA 1OCOB 4JAAA 3JAMN 1MMMA 3ICXA 1AR5A 4IT5A 4LF4B 2BTQA 1KP2A 5B3SB 4UCRA 2DOSA 5B5EZ 2WLNA 5IYCO 3QVNA 2PF4E 4FM0A 5LGUA 2DYRC 4MSWC 2Q67A 4I5SA 4RQFA 3ASOC 1NTKH 2Y69C 1Q81W 3FB6C 3K9SA 5LMNB 1AJPA 2NR5A 5GONB 1RPOA 1KKCA 2Y0PA 3A0HZ 2JEUA 3W7XA 1XL6A 2M6YA 4JPRA 4MVRA 2Q68A 4B3SO 5JH7B 2B5UA 2ZXWC 1K97A 2CUGA 1H8EG 4TV8B 1XI1A 4NTXA 2QTOA 2PY5A 2X6BA 1AR1B 1XHZA 1VP7A 2XAHA 1JPXA 1AP6A 3ZMZA 4O4HA 3JYCA 2UU9B 1GN2A 2DJVA 3WU2Z 4YHHO 3I56V 4LF7B 1HR0O 4LCUC 2ILMA 4PI2A 1NZ6A 1Q90D 5K1PA 2QTSA 4BW5A 3PN1A 3E89A 5LYJB 3JD2A 3QTCA 2CH7A 3CRCA 1AILA 1NH2B 4B7EA 4QIWF 4Q6GA 5D5PA 1VF7A 1GMGA 4GKJO 4O4LB 4XDKA 1HDJA 3HKEA 1H2SB 3WB2A 1R3IC 2PZSA 3CC7V 3CSXA 2KG7B 4PA7A 1N36B 5JQGA 2YUAA 4I55B 4JYYA 4ZKIA 4ICGA 3BY6A 4HZ3A 2CDYA 3JASA 1TA8A 1Y76A 1N34B 1ZX3A 5JCOA 4DYLA 5F2VO 1BT8A 2Q4PA 3FAVA 4UXNA 1VF6C 2RMKB 4DR5O 4L8JA 4X62O 4KUMA 5H2FZ 1DF5A 2HJDA 3BCCH 2GTSA 1PL4A 2YI8A 3H1IH 1GN3A 1FXKA 1V9PA 1YF2A 3HKCA 4FZ0A 2JGDB 4JZ2A 4JI4B 4LH6A 5JJEB 2A9HA 1OHHG 2WA4A 4WFHA 4CZZA 4EKWA 5H9CA 1Q6HA 4X8AA 3CEIA 5CA1A 3JATA 4CC5A 3RYHA 2JK5C 3RGBA 1EN5A 1RPRA 1XNQB 4BIOA 1D5AA 4LC1A 4NTYA 4J7JA 2Q7GA 4R50A 4JI0B 1P4RA 4AI8A 3AG4C 5L3GA 3J80N 2DE0X 4DRXB 1QU7A 4X64O 2QWPB 3L72H 4JAVA 1L0NH 2AZ0A 2UXBB 3G80A 3RWRD 4NXMB 3CCJV 3G6EV 1F51A 1FS0G 1WAZA 2CTWA 2UUCO 3JD4A 1B6QA 4GLXA 4FZ1A 2HEPA 2EILB 3FYIB 1KU9A 4JI7O 2VWJA 2UXCB 5LHGA 5JJJB 4P30A 1GKFA 2PTMA 4NYKA 4DUZO 4X66O 3E2EA 2P4KA 1TUEB 3CCSV 3CRRA 4RUEA 2GBOA 1Z2GA 3AG7A 3L75H 5IJ9A 1COWG 2ZE6A 2X7RB 4FLXA 1VQPV 4ZOLA 3ETEA 1V55B 3JAWA 3RYIB 1H2MA 3B8NA 4JYCA 3SYPA 2LW1A 4K8XA 1XQ8A 3LDDA 2P4VA 4O4JB 4RUFA 1SKVA 3G4SV 4XBFA 2DN9A 1QLEC 2YEVB 3K9AA 1M90W 3LSUA 2VQEO 2NLJC 1Q7YW 1DLBA 2ZKOA 4IL6Z 2LP7A 4L87A 2HR3A 5KX5A 3P3PA 4JYAB 4DO2A 3APOA 3ABMC 4I4TA 1S3JA 4DV4B 3TJTA 2LJ2A 2F4VB 4KFMA 2YXHA 4PD4F 3IFXA 2HFEC 4IYIA 1Y67A 1IBMO 4DR4O 2QEXV 1Q43A 3DTUB 1B3QA 2IJKA 5BZBA 4ZHQA 2CAZC 2BCCH 4RWUA 3C3SA 3CS5A 4FFKA 4IIJA 1V54B 5LA6A 4WBNA 1QLNA 3QO7A 3OEHG 4X1KA 2Z3YA 2Y48A 1YIJV 5JVDA 5FNVA 3CRAA 4BWAA 3SYOA 1N34O 3THOA 3N2GB 2C2AA 3B77A 5EC1C 3FYEB 1BGYH 1XMOO 3ZRXA 4NXNB 3VOUA 1NR7A 2G38A 1BCCH 4DUYB 1P84F 3L74H 2Q7EA 4LF8B 3RYFB 1M5IA 3AG2C 5BMVB 1I5XA 4PELA 3W7SA 5EYPB 2EIJC 1Y4MA 4DV6B 3NR7A 1W2BU 5KHHA 3D3QA 4DV1B 5IYZB 4UV8A 1NTZH 5H5NA 1D5NA 1PV0A 3APQA 3OMAB 2X6CA 4OPHA 4W4KA 1VQ4V 1YCIA 3ZHSA 1UFIA 5LGTA 4J9YB 2UUAO 1F23A 4MTGA 2BTOA 2OTJV 3CE2A 2UXDB 4YIOA 5L3EA 5D5QA 4QGPA 2H3OA 2L6LA 3ZMTA 3A2FA 4WFEA 1I08A 1FFXA 3E22A 2VS0A 4YY3B 4DK1A 3SJQC 3LNMB 1QR8A 2JDIG 3P30A 5IYBO 4ZI7A 3M99B 2ZINA 4DXWA 2K9PA 4O4HB 3W7UA 3VQXA 4D6TH 3H9VA 1K33A 3JALB 1S5LZ 2DYSC 3K5NA 3G67A 3ZX6A 1MSWD 4GX1A 1NU1H 5IE9A 2QKCA 3G6BA 2YIDA 5IWAB 2IBZH 1YHQV 1OCRC 2JS3A 1GM8A 3T1CA 3JD3A 2OWOA 2F43G 1M56C 1N32O 2W0FC 3BEHA 1AJQA 2DWEC 3OR6C 4B3SB 4FLTA 2QWRB 4B7KA 3FB7C 1VIBA 3AG3B 5FPOA 1VQ7V 4UCSA 5KHKA 1BZKA 1XOUA 1XBLA 3VQYA 4DV7O 1Y76B 4X1IB 1JA8A 1P7GA 5B1AB 1MABG 4WFFA 4PDVA 4GCZA 2HKOA 5CA3A 2E5LO 2OTLV 1VQNV 4YHHB 2YIAA 1HR0B 3ZRWB 5LXTA 3ABLB 3RVZA 2XOKG 4DR6B 1XL4A 1THZA 1FXKB 2XASA 2QM7A 1VF6A 4KP4A 3VQWA 4A5UB 4JI6O 1P7BA 2P7TC 1U97A 3BA8A 1NBMG 3E8GA 1FYJA 1OCCC 5KA6A 1VARA 2BSKA 3TGUH 1JOYA 2QR4A 4CS2A 4LR3A 1OCOC 3HB3B 1K73W 3SPHA 3JATB 3RYHB 4GKJB 1F4NA 2A7WA 3CRQA 4F6EA 3ZMVA 4JI8O 4EFBA 3WG7B 1HW7A 1NS1A 1US6A 4YJ3A 4J42A 4PI0A 5B3SC 3HKBA 3JD0A 4KHPB 4DV0O 3K08A 2CTRA 3BVOA 1RSOB 3CC4V 3GB7C 2HVKC 2AGAA 1W59A 2W6JG 4JTCB 4DR5B 5C8YA 4X62B 5IT9N 3IAYA 2WLJA 3HR0A 1K5QA 2FMLA 3OW2U 3OT7A 3DXRA 1VQMV 4FVMA 3ZEDA 4GKKO 2UUBO 4TT3G 4LFAO 2OIGA 1SA0A 1WA8A 2JEXA 4JI2O 1M1KW 1XMQO 2ODMA 2PYJA 1YTFB 1VEWA 4ZOLB 3JCZA 1ORQC 3JAWB 4YY3O 2GUZB 5KAFZ 2LGQA 3K3WA 5B1NA 4LFCB 3K59A 4QE9A 1TUBB 3CCUV 3WB0A 1Y6XA 4X64B 2F95B 4J11A 1WB7A 3CD6V 1IX9A 2FL4A 1PL0A 3RBZA 2WLLB 4TWKA 1OV9A 1ENVA 2R72A 2UUCB 4GX2A 2WA3A 5ITZB 4JI7B 1K7DA 1GK9A 2HJFC 3ML0A 5KHGA 5IWAO 5CB4B 4FK5C 4DUZB 5L3BA 4GZRB 4LF9O 4X66B 3T4ZA 4U3JA 4ASUG 4LWSA 1JMKC 5K1XA 4FLWA 4U7NA 4R7CA 1GH6A 2P06A 3H01A 4TUYA 3MD0A 5LA6B 5L3DA 4HAMA 2JRIA 5FNVB 4TSFG 5LOVA 3ZN0A 1R1BA 5BR8O 3UCSC 2WSSG 1FXVA 4UV9A 1F7YA 3CC2V 3RFRA 4AHCA 2Q7HA 3HKDA 2VQEB 3QNEA 3C90A 3CB2A 1M9NA 4Z1VA 4DR6O 4PHZA 1NJIW 2EJRA 2YC0A 3KCYA 4FLUA 3TXQA 1WPXA 2EZPA 3Q4HB 4UCVA 5IJ0A 3LNNA 1EM1A 4ABMA 4DR3O 2N05A 1NT2B 1IBMB 4DR4B 1TVKB 4I0XA 4PA9A 4OX9O 4G28B 3ZHTA 1AROP 1QVGU 4DR1O 5LBQA 5L3FA 2QE7G 1UPGA 4YJ2B 2AXTZ 5LP6B 5J2UA 3JD1A 1XHXA 5B1BC 3AK2A 1RP3B 3PJSK 4KHPO 5GTHZ 4LH7A 2Y0IA 1K92A 2A0LA 2EILC 2DYRB 1Z5WA 5DM6V 3CMEV 2H94A 4B3MO 3U0ZA 4K0KO 1K9MW 4O2AB 1CP9A 3ASOB 2ARHA 3K0DA 2Y69B 2CK3G 3IGAC 4O2BB 1X59A 3UT5A 1L0LH 2XNDG 3G71V 5E79Z 2FYUH 3ZMUA 3RYCB 1XMOB 3ASNB 1BQZA 3H1LH 1MOFA 1YZBA 3K58A 2ZE5A 5EC2C 2ZXWB 4TV9B 3SPJA 1V55C 4I50A 1LUWA 2BE3A 1MZFA 1FJGO 4JI1O 3K5MA 2P22C 4UUJC 1WNSA 2QM8A 1H2NA 3LUTB 5LMUO 2XAJA 1VQ5V 1M4UA 3GWOA 4CH4A 2BOBC 4BAYA 2YDEA 4DV3O 3O65A 4MS2A 3CP1A 1WN7A 1FD9A 4IYHA 2IJHA 1EN4A 4J10A 4FIPC 2P90A 4PA4A 1T5EA 3JCUZ 1W0KG 1U96A 4LFCO 2YSUB 1L1FA 3B4SA 2FKXA 3HPLC 3GWKC 4HNAA 2AHYA 4HBNA 3BABA 2UUAB 3F5TA 4X20A 2MK3A 1O9HA 1I5YA 2L35A 4KL1A 1HNZO 1AP5A 1FAFA 1R73A 4U7OA 2IU3A 4MVZA 4O4IA 3JARB 4J7ZA 3OMNB 3JAKA 3K0GA 4MVSA 4LBEC 2O57A 1V54C 1S77D 1D2DA 4JZGA 4PV1B 4DW0A 2YXYA 2YI9A 2KQXA 5IDJA 4G2KA 3T1YB 3S3XA 5JJNB 1AB3A 3F5WC 1XREA 3ZBHA 1GO3F 3L70H 1SQQH 4UCUA 3UKMA 1PNMA 4X65O 1WP8A 2N74A 1HWYA 1QBZA 4TOIA 1OCZB 1QQCA 1HNXO 1SQFA 4WFGA 2ZCEA 3N2KB 2WLIB 2PUSA 1N32B 2RQ6A 2JS5A 4JV5O 2WLKA 5CBGA 1AI5A 1H2KA 1NVPD 1Q3EA 3BPZA 4U3FH 1K4DC 4LNUB 3HKBB 4DV5O 3DC5A 1PP9H 2PI4A 4DV7B 1HNWO 2ZIMA 1R6KA 3ZHUA 5KA5A 3AG4B 2HVJC 3T4DA 2E5LB 1MA1A 1NTMH 1XNRO 4J7KA 5B66Z 1SQGA 3AG1C 3KZIZ 3I5DA 1DTOA 1FPOA 2QWQB 4JI6B 2JGUA 4IHJB 3MHSC 5GONA 3DXRB 3QO8A 3FD9A 1YJ9V 1W0JG 3EFFK 5JH7A 1SZXA 4TQFA 3TXSA 4JI8B 4TV8A 2NNUA 3F7YC 1N4CA 3IC7A 3SGIA 3L73H 1IZ3A 3T2MA 4DV0B 2WLMA 1M57B 2D3OW 2X0LA 2QJ1A 2IU0A 5LGNA 3LDEA 2BTQB 2PGGA 2A06H 4CS4A 4PDRA 3TETA 4H0LB 1EZVH 1WB8A 2UXNA 4UB6Z 4H37A 5CBHA 1BS3A 3W7WA 1SQXH 2EINB 2V1DA 2X6AA 1Q6IA 5EBWC 1KECA 1YXBA 3AEIA 1H2GA 1SS3A 2YXLA 3AG3C 4WCEV 4GKKB 2UUBB 4LF5O 2Z0AA 4LFAB 4LWSB 1JFFA 2KG7A 4JI2B 4X88A 2HG5C 3D36C 1XMQB 1KQSU 4I55A 3CX5F 4TUYB 5H6QA 1F4MA 4JYBA 4JI3O 3ABKC 3SJBC 2RJZA 2RDCA 5BXZA 1BHAA 4NVPA 2JJ2G 4BIZA 2IJIA 2H8PC 5EZYA 3OTOB 1ZSPA 1S5JA 1FXHA 2JGDA 3T1YO 2ZD9A 3K5OA 3OEEG 3ETQA 3K03A 2V7QG 1KP3A 5KMGA 1IXBA 2ZE7A 2IW5A 3DSQA 1KD1W 3CMAV 4FMTA 1IDSA 5EIBC 4FPPA 1LR1A 1PPJH 1XDCA 4EEQA 3WG7C 4LF9B 2CH7B 2OCCB 4K8ZA 1IBLO 2CE4A 3VBBA 4GX5A 2P67A 4LF6O 1H38A 2UXXA 4NB5A 3E83A 3HKEB 5EK0A 2QDOA 1BHBA 1JVMA 2ITDC 1CXZB 1K5SA 5J2TA 5JQGB 2ZDIC 4JTAB 4DRXA 4ZIBA 1NH2D 1BMFG 3O9OA 3FB8C 5CN0A 3QG5A 3C3TA 1GM7A 5BR8B 3JASB 4PA6A 4X9QA 4DW1A 1BSMA 1TGOA 4DR2B 4P9PA 3E35A 2LFSA 3OMIB 1JR9A 1SQVH 2B9ZA 3FAVB 5A2QN 1R3KC 5EBLC 2Q9LA 3X2QB 4FLYA 1A32A 4X1YA 2P5OA 1JCHA 3HKCB 4RO2A 3T1HO 1R6NA 2WPDG 1LNQA 2KSDA 4UCOA 2N04A 4FFBA 3K57A 2EIMB 2ZNJA 2DW4A 2AHZA 1ZAUA 1AI6A 4I50B 1L8DA 2HHHO 4OPAA 4DR3B 2HP8A 4MVUA 1K34A 3EXAA 5KUMA 5CA1B 4OX9B 3ABTA 1MSDA 2CGNA 1OJHA 3SPIA 4DR1B 4UB8Z 3ZRVA 1WJZA 1FKAO 2QKSA 4O4JA 2DYSB 2ZT9B 3OUSA 2R70A 4NKGB 2YEVA 4AQYO 4YIPA 4B08A 5CBFA 1DK1A 1BL8A 4K0KB 4B3MB 5KLVH 4Z1MG 4QPKA 4MTFA 5HFMA 4J41A 4RAIA 1EZJA 3CCRV 4GX0A 1B06A 4I7ZB 4FLZA 4B3TO 1YVWA 1PNKA 4FLVA 1DGSA 4UVAA 3E8FA 4JI5O 1IBKO 1JJ2U 5E1AC 4LFBO 2XAFA 1FJGB 4FM1A 4JI1B 5HFLA 5CA0A 4E4EA 4I9WA 4D7SA 4UVBA 1ZL8A 5LMUB 2EIKB 1GN6A 1JJOA 4EFEA 5IJ9B 4DV3B 1M93A 1KC8W 3P3NA 2MW2B 1G8MA 1ZLZA 3N2GA 1Q5OA 4DV2O 3CXCU 4CH3A 3OTOO 1N0NA 5KAIZ 5KX5B 1Y74A 1HNZB 3OTFA 3RYFA 3SYQA 3FB5C 1AI7A 2P6JA 5BMVA 4I4TB 3CXHF 2XHBA 2F93B 2W0XA 5EYPA 1H8HG 3WFVA 4ZBMA 1KYOF 2KB1A 4PDLA 2RCVA 4K3AA 5LP6C 2E75B 5IY5B 5IYZA 2LQTA 4ZHQB 2D2CB 3B09A 3J81N 5AG2A
chains in the Genus database with same CATH topology
4DR6O 4JI0O 4AQYO 1N32O 3JAMN 3T1YO 1DK1A 3F5TA 2UU9O 4GKKO 1R6TA 2UUBO 1XEQA 4LF7O 4LFAO 1N33O 1HNZO 4JI2O 4DR2O 1I94O 1XMQO 1KUQA 2DOSA 2ZM6O 4DR3O 2UXBO 4DV7O 4B3TO 4NXMO 4YY3O 1IBLO 4DR7O 4OX9O 4DR5O 4X62O 4DR1O 4JI5O 5H5NA 4LF6O 1D2DA 1IBKO 5BY1A 2E5LO 2LW7A 4LFBO 2UXCO 4OPHA 2VQEO 4NXNO 3J7AU 2ZKOA 4KHPO 1AB3A 3R66A 4A5UB 4DUYO 4JI6O 2UUAO 4B3RO 1N36O 3RT3C 4LF8O 4B3SO 4K0KO 1FYJA 4B3MO 4LF4O 4X65O 2N74A 1X59A 1HNXO 5A2QN 4DV6O 5IWAO 4DV2O 1A32A 1IBMO 4DR4O 4JI8O 4LF9O 1G1XB 4DV1O 1YZBA 4JV5O 3T1HO 3OTOO 1NS1A 2DJVA 3J80N 4LF5O 2Z0AA 4YHHO 5FLXN 1HR0O 1FJGO 4X64O 4JI1O 4DV5O 5LMNO 4DV0O 4JI4O 1J5EO 2HHHO 5LMUO 4OPAA 4JI3O 4DV3O 4JYAO 1HNWO 3O65A 2JRIA 2AGAA 1N34O 1R1BA 5BR8O 5LL6Y 2UXDO 2UUCO 4DV4O 5IT9N 5BXZA 3M8AA 1F7YA 2F4VO 1AILA 4JI7O 4LFCO 1FKAO 1XNRO 2VQFO 1XNQO 2FKXA 1XMOO 4DUZO 3SDLA 4GKJO 3J81N 4X66O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR6 O;  4JI0 O;  4AQY O;  1N32 O;  3JAM N;  3T1Y O;  1DK1 A;  3F5T A;  2UU9 O;  4GKK O;  1R6T A;  2UUB O;  1XEQ A;  4LF7 O;  4LFA O;  1N33 O;  1HNZ O;  4JI2 O;  4DR2 O;  1I94 O;  1XMQ O;  1KUQ A;  2DOS A;  2ZM6 O;  4DR3 O;  2UXB O;  4DV7 O;  4B3T O;  4NXM O;  4YY3 O;  1IBL O;  4DR7 O;  4OX9 O;  4DR5 O;  4X62 O;  4DR1 O;  4JI5 O;  5H5N A;  4LF6 O;  1D2D A;  1IBK O;  5BY1 A;  2E5L O;  2LW7 A;  4LFB O;  2UXC O;  4OPH A;  2VQE O;  4NXN O;  3J7A U;  2ZKO A;  4KHP O;  1AB3 A;  3R66 A;  4A5U B;  4DUY O;  4JI6 O;  2UUA O;  4B3R O;  1N36 O;  3RT3 C;  4LF8 O;  4B3S O;  4K0K O;  1FYJ A;  4B3M O;  4LF4 O;  4X65 O;  2N74 A;  1X59 A;  1HNX O;  5A2Q N;  4DV6 O;  5IWA O;  4DV2 O;  1A32 A;  1IBM O;  4DR4 O;  4JI8 O;  4LF9 O;  1G1X B;  4DV1 O;  1YZB A;  4JV5 O;  3T1H O;  3OTO O;  1NS1 A;  2DJV A;  3J80 N;  4LF5 O;  2Z0A A;  4YHH O;  5FLX N;  1HR0 O;  1FJG O;  4X64 O;  4JI1 O;  4DV5 O;  5LMN O;  4DV0 O;  4JI4 O;  1J5E O;  2HHH O;  5LMU O;  4OPA A;  4JI3 O;  4DV3 O;  4JYA O;  1HNW O;  3O65 A;  2JRI A;  2AGA A;  1N34 O;  1R1B A;  5BR8 O;  5LL6 Y;  2UXD O;  2UUC O;  4DV4 O;  5IT9 N;  5BXZ A;  3M8A A;  1F7Y A;  2F4V O;  1AIL A;  4JI7 O;  4LFC O;  1FKA O;  1XNR O;  2VQF O;  1XNQ O;  2FKX A;  1XMO O;  4DUZ O;  3SDL A;  4GKJ O;  3J81 N;  4X66 O; 
#chains in the Genus database with same CATH topology
 4CH6 A;  3ABU A;  3H1J H;  4IIJ B;  4CH5 A;  5DED A;  4WBN B;  3SPC A;  2ADQ B;  5B1O A;  2ADP A;  4X1K B;  1XEQ A;  5JVD B;  2Y4U A;  4X65 B;  3ASN C;  1WP7 A;  2EX3 A;  2R9R B;  4DR2 O;  1HNX B;  4AIL C;  1RM1 B;  3H1K H;  1IXM A;  1URF A;  1ZWI C;  3K5L A;  3UO3 A;  4JV5 B;  4MVO A;  1VF5 B;  5BY1 A;  3SR2 C;  1VQ8 V;  5TIS Z;  3H1H H;  1PKX A;  5KUK A;  4DV5 B;  1S5H C;  2OT5 A;  1LUV A;  3A0R A;  4R8C A;  1NI8 A;  3NXS A;  2NN4 A;  3OR7 C;  4EB6 A;  4H13 B;  3R66 A;  4F6R A;  2OYQ A;  4B3R O;  1HNW B;  3N27 A;  1NKD A;  3L71 H;  3JAL A;  4K35 A;  3ETD A;  1WLE A;  3DC6 A;  1N0J A;  1XNR B;  3MHH C;  5A9G A;  3B40 A;  2QWN B;  1SRY A;  3CRM A;  3KCX A;  2F1M A;  3OAA G;  2LGW A;  2E74 B;  3M7M X;  1RFY A;  1QVF U;  2XTA A;  4XDL A;  2RNB A;  2XAG A;  3KG2 A;  1VQ9 V;  1JFF B;  2XT9 A;  3CCE V;  1TAE A;  2WAM A;  2QKA A;  3A8T A;  1UJW B;  1E1Q G;  4WFA V;  3E22 B;  1FFX B;  5LL6 Y;  2FB5 A;  3D36 A;  3L9D A;  1PNL A;  2GTA A;  4X1I A;  2VQF O;  3SPG A;  5FPR A;  1X4T A;  4ZI7 B;  2FTK A;  1GAX A;  5EZY B;  3I55 V;  3ZRW A;  3GVM A;  1HP8 A;  2DMX A;  2JVD A;  1R6T A;  1OCZ C;  3UO2 A;  1J5E B;  4JAS A;  1JX9 A;  1SZT A;  1EBO A;  3CJH A;  5KMG B;  2EUL A;  4MVM A;  4JAU A;  2ZM6 O;  4JGS A;  3S3W A;  1SQB H;  1K3E A;  4N23 A;  1YEW A;  4DR7 O;  2QA4 V;  1AI4 A;  4BIU A;  2YIC A;  3CYO A;  4PA3 A;  4LF5 B;  3OGC C;  3U11 A;  1SES A;  3MDS A;  2AW9 A;  3J7A U;  1SER A;  3LDC A;  2Z5U A;  4WFB V;  5J2T B;  1KMI Z;  3SYA A;  4KXR A;  3RW0 A;  4JI3 B;  1QR9 A;  1N33 B;  2A3Q A;  2XAQ A;  1I94 B;  1RSO A;  4LF4 O;  3OUF A;  2ZDI A;  5J9P C;  5B1B B;  2RN9 A;  1Q82 W;  1GM9 A;  2ZNI A;  5GTI Z;  2GV9 A;  2Q0A A;  3U10 A;  5LHI A;  2A79 B;  1NR1 A;  2DWD C;  4X1Y B;  4CC6 A;  5LXT B;  2ZQM A;  3ZHV A;  1K8A W;  1KB9 F;  2WWW A;  3E86 A;  4FFB B;  1YSC A;  2B1G A;  5LMN O;  1VMG A;  3D3I A;  1GRJ A;  2BSK B;  4JTD B;  1IBL B;  2ZR2 A;  4MVQ A;  1VQ6 V;  1XUQ A;  4LF6 B;  1H2L A;  3LSQ A;  4QJF B;  2V4D A;  4I9Q A;  5H6R A;  1M57 C;  2GUZ A;  4H44 B;  4TQD A;  4PDM A;  4UFZ A;  4R6Z A;  2B1I A;  1TUB A;  4YJ3 B;  2IJJ A;  3CCL V;  1YJW V;  2UU9 O;  3OFN G;  5EIB D;  2Q8V A;  4LF7 O;  2EIN C;  2IM9 A;  2WLL A;  1BE3 H;  1FFT B;  1J95 A;  2YIB A;  1KUQ A;  2GHY A;  3CCV V;  5C8Y B;  3R65 A;  1MG1 A;  1YI2 V;  5ITZ A;  3CPW U;  4J9Z B;  4F4L A;  1DF4 A;  3OD4 A;  3CCM V;  3T1H B;  5CB4 A;  1KBH A;  1AVM A;  3UM7 A;  1G4Y B;  3E8B A;  4Z2W A;  2HHH B;  5CA0 B;  1R3J C;  4J80 A;  1SA0 B;  1WA8 B;  1ZL8 B;  4MTO A;  1N36 O;  3RT3 C;  1QCE A;  1QNM A;  2AZ2 A;  4E2L A;  1SC5 B;  3ZN1 A;  2M7W A;  4N21 A;  1KKD A;  4LP8 A;  3K79 A;  1BQ0 A;  1QHT A;  3ZHR A;  4AQY B;  1E79 G;  2QGN A;  3K06 A;  2HLD G;  1YTF D;  1SF9 A;  1Z5V A;  2Q69 A;  5GW7 A;  4JI4 O;  1J5E O;  3Q4H A;  2OCC C;  2EJ7 A;  1QLE B;  1Y74 B;  3FFQ A;  3ZMS A;  1CEZ A;  3CWB H;  4B3T B;  5LYJ A;  4JI5 B;  5KHJ A;  3ABM B;  1IBK B;  1TVK A;  4LFB B;  4U3J B;  4O4L A;  2ZR3 A;  4MT8 A;  3ZS8 C;  2YIB D;  1CPY A;  1XNQ O;  3TCU A;  3JSL A;  1YIT V;  4YJ2 A;  2Q73 A;  2PI5 A;  1XIL A;  5LP6 A;  2BOC C;  4JI0 O;  3ZCC A;  3QF7 A;  2VRZ A;  4OGQ B;  5JCO C;  3AK3 A;  5B1A C;  1EFR G;  1SQP H;  3OGI B;  1N33 O;  3OE7 G;  3X2Q C;  2DQ3 A;  3AG1 B;  1B04 A;  4BW9 A;  5LOV B;  1I94 O;  3AK1 A;  3ABL C;  4DV2 B;  1ROP A;  4O2A A;  1FXK C;  2UXB O;  3CHX A;  4O2B A;  4NXM O;  5KHI A;  2EIM C;  3HKD B;  3RYC A;  1VQO V;  3WB1 A;  3IJ4 A;  5JWP A;  1K4C C;  3ZRS A;  4UCT A;  2LW7 A;  1Y66 A;  4FJC C;  4CBC A;  2UXC O;  4MW3 A;  4WF9 V;  1I7F A;  3RN4 A;  4TV9 A;  3P32 A;  2OCH A;  1VQK V;  4QPJ A;  5IJ0 B;  2ZE8 A;  3KKY A;  3ZJZ A;  4EB6 B;  4P9O A;  3F7V C;  4F6R B;  5IYD O;  1JQ0 A;  1MZE A;  2VWK A;  3UQ8 A;  4I0X B;  1YDX A;  3AG2 B;  1I0H A;  2EIJ B;  4NTW A;  4OXS A;  5DN6 G;  1G1X B;  3B8M A;  5J2U B;  1R3L C;  1OZ0 A;  2ATK C;  2QM4 A;  1SET A;  2F23 A;  5FLX N;  2WLH A;  3JSN A;  4QNH B;  2JIZ G;  3D8C A;  2CTQ A;  4HYO A;  3B2E E;  2LFR A;  4BR6 A;  4MW8 A;  4CS3 A;  5EBM C;  4D7T A;  4GT1 A;  4JYA O;  3UT5 B;  1Q86 W;  1AJN A;  4FM2 A;  4RQE A;  4DV4 O;  4X89 A;  2YS8 A;  3M8A A;  2F4V O;  3JAR A;  2EIK C;  4GUN A;  1E1R G;  2K1E A;  3STZ C;  3IC9 A;  2E3C A;  1O9G A;  1YJN V;  4B3R B;  3SYC A;  4Q20 A;  1Q8I A;  3ABK B;  3ETG A;  3W7T A;  3RVY A;  1GN4 A;  2CTP A;  4QE7 A;  2EZO A;  2GDS A;  3LSS A;  2KKW A;  2Y4T A;  2XUM A;  1IUR A;  1VQL V;  3FX7 A;  3RYI A;  4H33 A;  3BHP A;  4DK0 A;  1NQT A;  1PD3 A;  2QWO B;  3CJH B;  2R9I A;  1S72 V;  1NVP B;  3EVK A;  4C7U A;  2LO1 A;  4GYC B;  3N2K A;  2W6I G;  4HNA B;  1ZTE A;  4XDJ A;  3BA9 A;  2WLI A;  4YXW G;  3CCQ V;  2OIE A;  5L3C A;  1MNG A;  4W4L A;  4NXN O;  4X20 B;  1OCR B;  3QO5 A;  4UVC A;  3A0B Z;  4DUY O;  2ZIO A;  4LNU A;  1S0V A;  5IY5 C;  4LF8 O;  1M56 B;  4G27 B;  2PYL A;  5CMU A;  5DEC A;  2QSA A;  2Q0O C;  1N8R W;  4O4I B;  2ITC C;  4MTX A;  2VQF B;  3JAK B;  4DV6 O;  1S76 D;  2CGO A;  2JJ1 G;  3E8H A;  4IGG A;  3TK1 A;  1Q6U A;  4DV1 O;  2Q5Z A;  2DQ0 A;  1ZUQ A;  5C93 A;  2Q6A A;  4JF3 A;  2IH1 C;  2F66 C;  2E76 B;  1RM1 C;  3SJC C;  3SJA C;  4PJ0 Z;  3EHB B;  4IHJ A;  3MAQ A;  3FKS G;  3ZHQ A;  1G6U A;  2EBO A;  3BAA A;  4P2Z A;  2ZM6 B;  3BRC A;  3STL C;  3BFR A;  3DGE A;  4DR7 B;  1P49 A;  2R9A A;  3ZIA G;  1EN6 A;  1IVS A;  1WPB A;  2UXD O;  1GTO A;  5FL7 G;  1PM9 A;  3K04 A;  4NR1 A;  1AR4 A;  3OM3 B;  5LHH A;  1OCC B;  3VQV A;  2ETN A;  2GSM B;  2IH3 C;  3SDL A;  1OCO B;  4JAA A;  3JAM N;  1MMM A;  3ICX A;  1AR5 A;  4IT5 A;  4LF4 B;  2BTQ A;  1KP2 A;  5B3S B;  4UCR A;  2DOS A;  5B5E Z;  2WLN A;  5IYC O;  3QVN A;  2PF4 E;  4FM0 A;  5LGU A;  2DYR C;  4MSW C;  2Q67 A;  4I5S A;  4RQF A;  3ASO C;  1NTK H;  2Y69 C;  1Q81 W;  3FB6 C;  3K9S A;  5LMN B;  1AJP A;  2NR5 A;  5GON B;  1RPO A;  1KKC A;  2Y0P A;  3A0H Z;  2JEU A;  3W7X A;  1XL6 A;  2M6Y A;  4JPR A;  4MVR A;  2Q68 A;  4B3S O;  5JH7 B;  2B5U A;  2ZXW C;  1K97 A;  2CUG A;  1H8E G;  4TV8 B;  1XI1 A;  4NTX A;  2QTO A;  2PY5 A;  2X6B A;  1AR1 B;  1XHZ A;  1VP7 A;  2XAH A;  1JPX A;  1AP6 A;  3ZMZ A;  4O4H A;  3JYC A;  2UU9 B;  1GN2 A;  2DJV A;  3WU2 Z;  4YHH O;  3I56 V;  4LF7 B;  1HR0 O;  4LCU C;  2ILM A;  4PI2 A;  1NZ6 A;  1Q90 D;  5K1P A;  2QTS A;  4BW5 A;  3PN1 A;  3E89 A;  5LYJ B;  3JD2 A;  3QTC A;  2CH7 A;  3CRC A;  1AIL A;  1NH2 B;  4B7E A;  4QIW F;  4Q6G A;  5D5P A;  1VF7 A;  1GMG A;  4GKJ O;  4O4L B;  4XDK A;  1HDJ A;  3HKE A;  1H2S B;  3WB2 A;  1R3I C;  2PZS A;  3CC7 V;  3CSX A;  2KG7 B;  4PA7 A;  1N36 B;  5JQG A;  2YUA A;  4I55 B;  4JYY A;  4ZKI A;  4ICG A;  3BY6 A;  4HZ3 A;  2CDY A;  3JAS A;  1TA8 A;  1Y76 A;  1N34 B;  1ZX3 A;  5JCO A;  4DYL A;  5F2V O;  1BT8 A;  2Q4P A;  3FAV A;  4UXN A;  1VF6 C;  2RMK B;  4DR5 O;  4L8J A;  4X62 O;  4KUM A;  5H2F Z;  1DF5 A;  2HJD A;  3BCC H;  2GTS A;  1PL4 A;  2YI8 A;  3H1I H;  1GN3 A;  1FXK A;  1V9P A;  1YF2 A;  3HKC A;  4FZ0 A;  2JGD B;  4JZ2 A;  4JI4 B;  4LH6 A;  5JJE B;  2A9H A;  1OHH G;  2WA4 A;  4WFH A;  4CZZ A;  4EKW A;  5H9C A;  1Q6H A;  4X8A A;  3CEI A;  5CA1 A;  3JAT A;  4CC5 A;  3RYH A;  2JK5 C;  3RGB A;  1EN5 A;  1RPR A;  1XNQ B;  4BIO A;  1D5A A;  4LC1 A;  4NTY A;  4J7J A;  2Q7G A;  4R50 A;  4JI0 B;  1P4R A;  4AI8 A;  3AG4 C;  5L3G A;  3J80 N;  2DE0 X;  4DRX B;  1QU7 A;  4X64 O;  2QWP B;  3L72 H;  4JAV A;  1L0N H;  2AZ0 A;  2UXB B;  3G80 A;  3RWR D;  4NXM B;  3CCJ V;  3G6E V;  1F51 A;  1FS0 G;  1WAZ A;  2CTW A;  2UUC O;  3JD4 A;  1B6Q A;  4GLX A;  4FZ1 A;  2HEP A;  2EIL B;  3FYI B;  1KU9 A;  4JI7 O;  2VWJ A;  2UXC B;  5LHG A;  5JJJ B;  4P30 A;  1GKF A;  2PTM A;  4NYK A;  4DUZ O;  4X66 O;  3E2E A;  2P4K A;  1TUE B;  3CCS V;  3CRR A;  4RUE A;  2GBO A;  1Z2G A;  3AG7 A;  3L75 H;  5IJ9 A;  1COW G;  2ZE6 A;  2X7R B;  4FLX A;  1VQP V;  4ZOL A;  3ETE A;  1V55 B;  3JAW A;  3RYI B;  1H2M A;  3B8N A;  4JYC A;  3SYP A;  2LW1 A;  4K8X A;  1XQ8 A;  3LDD A;  2P4V A;  4O4J B;  4RUF A;  1SKV A;  3G4S V;  4XBF A;  2DN9 A;  1QLE C;  2YEV B;  3K9A A;  1M90 W;  3LSU A;  2VQE O;  2NLJ C;  1Q7Y W;  1DLB A;  2ZKO A;  4IL6 Z;  2LP7 A;  4L87 A;  2HR3 A;  5KX5 A;  3P3P A;  4JYA B;  4DO2 A;  3APO A;  3ABM C;  4I4T A;  1S3J A;  4DV4 B;  3TJT A;  2LJ2 A;  2F4V B;  4KFM A;  2YXH A;  4PD4 F;  3IFX A;  2HFE C;  4IYI A;  1Y67 A;  1IBM O;  4DR4 O;  2QEX V;  1Q43 A;  3DTU B;  1B3Q A;  2IJK A;  5BZB A;  4ZHQ A;  2CAZ C;  2BCC H;  4RWU A;  3C3S A;  3CS5 A;  4FFK A;  4IIJ A;  1V54 B;  5LA6 A;  4WBN A;  1QLN A;  3QO7 A;  3OEH G;  4X1K A;  2Z3Y A;  2Y48 A;  1YIJ V;  5JVD A;  5FNV A;  3CRA A;  4BWA A;  3SYO A;  1N34 O;  3THO A;  3N2G B;  2C2A A;  3B77 A;  5EC1 C;  3FYE B;  1BGY H;  1XMO O;  3ZRX A;  4NXN B;  3VOU A;  1NR7 A;  2G38 A;  1BCC H;  4DUY B;  1P84 F;  3L74 H;  2Q7E A;  4LF8 B;  3RYF B;  1M5I A;  3AG2 C;  5BMV B;  1I5X A;  4PEL A;  3W7S A;  5EYP B;  2EIJ C;  1Y4M A;  4DV6 B;  3NR7 A;  1W2B U;  5KHH A;  3D3Q A;  4DV1 B;  5IYZ B;  4UV8 A;  1NTZ H;  5H5N A;  1D5N A;  1PV0 A;  3APQ A;  3OMA B;  2X6C A;  4OPH A;  4W4K A;  1VQ4 V;  1YCI A;  3ZHS A;  1UFI A;  5LGT A;  4J9Y B;  2UUA O;  1F23 A;  4MTG A;  2BTO A;  2OTJ V;  3CE2 A;  2UXD B;  4YIO A;  5L3E A;  5D5Q A;  4QGP A;  2H3O A;  2L6L A;  3ZMT A;  3A2F A;  4WFE A;  1I08 A;  1FFX A;  3E22 A;  2VS0 A;  4YY3 B;  4DK1 A;  3SJQ C;  3LNM B;  1QR8 A;  2JDI G;  3P30 A;  5IYB O;  4ZI7 A;  3M99 B;  2ZIN A;  4DXW A;  2K9P A;  4O4H B;  3W7U A;  3VQX A;  4D6T H;  3H9V A;  1K33 A;  3JAL B;  1S5L Z;  2DYS C;  3K5N A;  3G67 A;  3ZX6 A;  1MSW D;  4GX1 A;  1NU1 H;  5IE9 A;  2QKC A;  3G6B A;  2YID A;  5IWA B;  2IBZ H;  1YHQ V;  1OCR C;  2JS3 A;  1GM8 A;  3T1C A;  3JD3 A;  2OWO A;  2F43 G;  1M56 C;  1N32 O;  2W0F C;  3BEH A;  1AJQ A;  2DWE C;  3OR6 C;  4B3S B;  4FLT A;  2QWR B;  4B7K A;  3FB7 C;  1VIB A;  3AG3 B;  5FPO A;  1VQ7 V;  4UCS A;  5KHK A;  1BZK A;  1XOU A;  1XBL A;  3VQY A;  4DV7 O;  1Y76 B;  4X1I B;  1JA8 A;  1P7G A;  5B1A B;  1MAB G;  4WFF A;  4PDV A;  4GCZ A;  2HKO A;  5CA3 A;  2E5L O;  2OTL V;  1VQN V;  4YHH B;  2YIA A;  1HR0 B;  3ZRW B;  5LXT A;  3ABL B;  3RVZ A;  2XOK G;  4DR6 B;  1XL4 A;  1THZ A;  1FXK B;  2XAS A;  2QM7 A;  1VF6 A;  4KP4 A;  3VQW A;  4A5U B;  4JI6 O;  1P7B A;  2P7T C;  1U97 A;  3BA8 A;  1NBM G;  3E8G A;  1FYJ A;  1OCC C;  5KA6 A;  1VAR A;  2BSK A;  3TGU H;  1JOY A;  2QR4 A;  4CS2 A;  4LR3 A;  1OCO C;  3HB3 B;  1K73 W;  3SPH A;  3JAT B;  3RYH B;  4GKJ B;  1F4N A;  2A7W A;  3CRQ A;  4F6E A;  3ZMV A;  4JI8 O;  4EFB A;  3WG7 B;  1HW7 A;  1NS1 A;  1US6 A;  4YJ3 A;  4J42 A;  4PI0 A;  5B3S C;  3HKB A;  3JD0 A;  4KHP B;  4DV0 O;  3K08 A;  2CTR A;  3BVO A;  1RSO B;  3CC4 V;  3GB7 C;  2HVK C;  2AGA A;  1W59 A;  2W6J G;  4JTC B;  4DR5 B;  5C8Y A;  4X62 B;  5IT9 N;  3IAY A;  2WLJ A;  3HR0 A;  1K5Q A;  2FML A;  3OW2 U;  3OT7 A;  3DXR A;  1VQM V;  4FVM A;  3ZED A;  4GKK O;  2UUB O;  4TT3 G;  4LFA O;  2OIG A;  1SA0 A;  1WA8 A;  2JEX A;  4JI2 O;  1M1K W;  1XMQ O;  2ODM A;  2PYJ A;  1YTF B;  1VEW A;  4ZOL B;  3JCZ A;  1ORQ C;  3JAW B;  4YY3 O;  2GUZ B;  5KAF Z;  2LGQ A;  3K3W A;  5B1N A;  4LFC B;  3K59 A;  4QE9 A;  1TUB B;  3CCU V;  3WB0 A;  1Y6X A;  4X64 B;  2F95 B;  4J11 A;  1WB7 A;  3CD6 V;  1IX9 A;  2FL4 A;  1PL0 A;  3RBZ A;  2WLL B;  4TWK A;  1OV9 A;  1ENV A;  2R72 A;  2UUC B;  4GX2 A;  2WA3 A;  5ITZ B;  4JI7 B;  1K7D A;  1GK9 A;  2HJF C;  3ML0 A;  5KHG A;  5IWA O;  5CB4 B;  4FK5 C;  4DUZ B;  5L3B A;  4GZR B;  4LF9 O;  4X66 B;  3T4Z A;  4U3J A;  4ASU G;  4LWS A;  1JMK C;  5K1X A;  4FLW A;  4U7N A;  4R7C A;  1GH6 A;  2P06 A;  3H01 A;  4TUY A;  3MD0 A;  5LA6 B;  5L3D A;  4HAM A;  2JRI A;  5FNV B;  4TSF G;  5LOV A;  3ZN0 A;  1R1B A;  5BR8 O;  3UCS C;  2WSS G;  1FXV A;  4UV9 A;  1F7Y A;  3CC2 V;  3RFR A;  4AHC A;  2Q7H A;  3HKD A;  2VQE B;  3QNE A;  3C90 A;  3CB2 A;  1M9N A;  4Z1V A;  4DR6 O;  4PHZ A;  1NJI W;  2EJR A;  2YC0 A;  3KCY A;  4FLU A;  3TXQ A;  1WPX A;  2EZP A;  3Q4H B;  4UCV A;  5IJ0 A;  3LNN A;  1EM1 A;  4ABM A;  4DR3 O;  2N05 A;  1NT2 B;  1IBM B;  4DR4 B;  1TVK B;  4I0X A;  4PA9 A;  4OX9 O;  4G28 B;  3ZHT A;  1ARO P;  1QVG U;  4DR1 O;  5LBQ A;  5L3F A;  2QE7 G;  1UPG A;  4YJ2 B;  2AXT Z;  5LP6 B;  5J2U A;  3JD1 A;  1XHX A;  5B1B C;  3AK2 A;  1RP3 B;  3PJS K;  4KHP O;  5GTH Z;  4LH7 A;  2Y0I A;  1K92 A;  2A0L A;  2EIL C;  2DYR B;  1Z5W A;  5DM6 V;  3CME V;  2H94 A;  4B3M O;  3U0Z A;  4K0K O;  1K9M W;  4O2A B;  1CP9 A;  3ASO B;  2ARH A;  3K0D A;  2Y69 B;  2CK3 G;  3IGA C;  4O2B B;  1X59 A;  3UT5 A;  1L0L H;  2XND G;  3G71 V;  5E79 Z;  2FYU H;  3ZMU A;  3RYC B;  1XMO B;  3ASN B;  1BQZ A;  3H1L H;  1MOF A;  1YZB A;  3K58 A;  2ZE5 A;  5EC2 C;  2ZXW B;  4TV9 B;  3SPJ A;  1V55 C;  4I50 A;  1LUW A;  2BE3 A;  1MZF A;  1FJG O;  4JI1 O;  3K5M A;  2P22 C;  4UUJ C;  1WNS A;  2QM8 A;  1H2N A;  3LUT B;  5LMU O;  2XAJ A;  1VQ5 V;  1M4U A;  3GWO A;  4CH4 A;  2BOB C;  4BAY A;  2YDE A;  4DV3 O;  3O65 A;  4MS2 A;  3CP1 A;  1WN7 A;  1FD9 A;  4IYH A;  2IJH A;  1EN4 A;  4J10 A;  4FIP C;  2P90 A;  4PA4 A;  1T5E A;  3JCU Z;  1W0K G;  1U96 A;  4LFC O;  2YSU B;  1L1F A;  3B4S A;  2FKX A;  3HPL C;  3GWK C;  4HNA A;  2AHY A;  4HBN A;  3BAB A;  2UUA B;  3F5T A;  4X20 A;  2MK3 A;  1O9H A;  1I5Y A;  2L35 A;  4KL1 A;  1HNZ O;  1AP5 A;  1FAF A;  1R73 A;  4U7O A;  2IU3 A;  4MVZ A;  4O4I A;  3JAR B;  4J7Z A;  3OMN B;  3JAK A;  3K0G A;  4MVS A;  4LBE C;  2O57 A;  1V54 C;  1S77 D;  1D2D A;  4JZG A;  4PV1 B;  4DW0 A;  2YXY A;  2YI9 A;  2KQX A;  5IDJ A;  4G2K A;  3T1Y B;  3S3X A;  5JJN B;  1AB3 A;  3F5W C;  1XRE A;  3ZBH A;  1GO3 F;  3L70 H;  1SQQ H;  4UCU A;  3UKM A;  1PNM A;  4X65 O;  1WP8 A;  2N74 A;  1HWY A;  1QBZ A;  4TOI A;  1OCZ B;  1QQC A;  1HNX O;  1SQF A;  4WFG A;  2ZCE A;  3N2K B;  2WLI B;  2PUS A;  1N32 B;  2RQ6 A;  2JS5 A;  4JV5 O;  2WLK A;  5CBG A;  1AI5 A;  1H2K A;  1NVP D;  1Q3E A;  3BPZ A;  4U3F H;  1K4D C;  4LNU B;  3HKB B;  4DV5 O;  3DC5 A;  1PP9 H;  2PI4 A;  4DV7 B;  1HNW O;  2ZIM A;  1R6K A;  3ZHU A;  5KA5 A;  3AG4 B;  2HVJ C;  3T4D A;  2E5L B;  1MA1 A;  1NTM H;  1XNR O;  4J7K A;  5B66 Z;  1SQG A;  3AG1 C;  3KZI Z;  3I5D A;  1DTO A;  1FPO A;  2QWQ B;  4JI6 B;  2JGU A;  4IHJ B;  3MHS C;  5GON A;  3DXR B;  3QO8 A;  3FD9 A;  1YJ9 V;  1W0J G;  3EFF K;  5JH7 A;  1SZX A;  4TQF A;  3TXS A;  4JI8 B;  4TV8 A;  2NNU A;  3F7Y C;  1N4C A;  3IC7 A;  3SGI A;  3L73 H;  1IZ3 A;  3T2M A;  4DV0 B;  2WLM A;  1M57 B;  2D3O W;  2X0L A;  2QJ1 A;  2IU0 A;  5LGN A;  3LDE A;  2BTQ B;  2PGG A;  2A06 H;  4CS4 A;  4PDR A;  3TET A;  4H0L B;  1EZV H;  1WB8 A;  2UXN A;  4UB6 Z;  4H37 A;  5CBH A;  1BS3 A;  3W7W A;  1SQX H;  2EIN B;  2V1D A;  2X6A A;  1Q6I A;  5EBW C;  1KEC A;  1YXB A;  3AEI A;  1H2G A;  1SS3 A;  2YXL A;  3AG3 C;  4WCE V;  4GKK B;  2UUB B;  4LF5 O;  2Z0A A;  4LFA B;  4LWS B;  1JFF A;  2KG7 A;  4JI2 B;  4X88 A;  2HG5 C;  3D36 C;  1XMQ B;  1KQS U;  4I55 A;  3CX5 F;  4TUY B;  5H6Q A;  1F4M A;  4JYB A;  4JI3 O;  3ABK C;  3SJB C;  2RJZ A;  2RDC A;  5BXZ A;  1BHA A;  4NVP A;  2JJ2 G;  4BIZ A;  2IJI A;  2H8P C;  5EZY A;  3OTO B;  1ZSP A;  1S5J A;  1FXH A;  2JGD A;  3T1Y O;  2ZD9 A;  3K5O A;  3OEE G;  3ETQ A;  3K03 A;  2V7Q G;  1KP3 A;  5KMG A;  1IXB A;  2ZE7 A;  2IW5 A;  3DSQ A;  1KD1 W;  3CMA V;  4FMT A;  1IDS A;  5EIB C;  4FPP A;  1LR1 A;  1PPJ H;  1XDC A;  4EEQ A;  3WG7 C;  4LF9 B;  2CH7 B;  2OCC B;  4K8Z A;  1IBL O;  2CE4 A;  3VBB A;  4GX5 A;  2P67 A;  4LF6 O;  1H38 A;  2UXX A;  4NB5 A;  3E83 A;  3HKE B;  5EK0 A;  2QDO A;  1BHB A;  1JVM A;  2ITD C;  1CXZ B;  1K5S A;  5J2T A;  5JQG B;  2ZDI C;  4JTA B;  4DRX A;  4ZIB A;  1NH2 D;  1BMF G;  3O9O A;  3FB8 C;  5CN0 A;  3QG5 A;  3C3T A;  1GM7 A;  5BR8 B;  3JAS B;  4PA6 A;  4X9Q A;  4DW1 A;  1BSM A;  1TGO A;  4DR2 B;  4P9P A;  3E35 A;  2LFS A;  3OMI B;  1JR9 A;  1SQV H;  2B9Z A;  3FAV B;  5A2Q N;  1R3K C;  5EBL C;  2Q9L A;  3X2Q B;  4FLY A;  1A32 A;  4X1Y A;  2P5O A;  1JCH A;  3HKC B;  4RO2 A;  3T1H O;  1R6N A;  2WPD G;  1LNQ A;  2KSD A;  4UCO A;  2N04 A;  4FFB A;  3K57 A;  2EIM B;  2ZNJ A;  2DW4 A;  2AHZ A;  1ZAU A;  1AI6 A;  4I50 B;  1L8D A;  2HHH O;  4OPA A;  4DR3 B;  2HP8 A;  4MVU A;  1K34 A;  3EXA A;  5KUM A;  5CA1 B;  4OX9 B;  3ABT A;  1MSD A;  2CGN A;  1OJH A;  3SPI A;  4DR1 B;  4UB8 Z;  3ZRV A;  1WJZ A;  1FKA O;  2QKS A;  4O4J A;  2DYS B;  2ZT9 B;  3OUS A;  2R70 A;  4NKG B;  2YEV A;  4AQY O;  4YIP A;  4B08 A;  5CBF A;  1DK1 A;  1BL8 A;  4K0K B;  4B3M B;  5KLV H;  4Z1M G;  4QPK A;  4MTF A;  5HFM A;  4J41 A;  4RAI A;  1EZJ A;  3CCR V;  4GX0 A;  1B06 A;  4I7Z B;  4FLZ A;  4B3T O;  1YVW A;  1PNK A;  4FLV A;  1DGS A;  4UVA A;  3E8F A;  4JI5 O;  1IBK O;  1JJ2 U;  5E1A C;  4LFB O;  2XAF A;  1FJG B;  4FM1 A;  4JI1 B;  5HFL A;  5CA0 A;  4E4E A;  4I9W A;  4D7S A;  4UVB A;  1ZL8 A;  5LMU B;  2EIK B;  1GN6 A;  1JJO A;  4EFE A;  5IJ9 B;  4DV3 B;  1M93 A;  1KC8 W;  3P3N A;  2MW2 B;  1G8M A;  1ZLZ A;  3N2G A;  1Q5O A;  4DV2 O;  3CXC U;  4CH3 A;  3OTO O;  1N0N A;  5KAI Z;  5KX5 B;  1Y74 A;  1HNZ B;  3OTF A;  3RYF A;  3SYQ A;  3FB5 C;  1AI7 A;  2P6J A;  5BMV A;  4I4T B;  3CXH F;  2XHB A;  2F93 B;  2W0X A;  5EYP A;  1H8H G;  3WFV A;  4ZBM A;  1KYO F;  2KB1 A;  4PDL A;  2RCV A;  4K3A A;  5LP6 C;  2E75 B;  5IY5 B;  5IYZ A;  2LQT A;  4ZHQ B;  2D2C B;  3B09 A;  3J81 N;  5AG2 A; 
#chains in the Genus database with same CATH homology
 4DR6 O;  4JI0 O;  4AQY O;  1N32 O;  3JAM N;  3T1Y O;  1DK1 A;  3F5T A;  2UU9 O;  4GKK O;  1R6T A;  2UUB O;  1XEQ A;  4LF7 O;  4LFA O;  1N33 O;  1HNZ O;  4JI2 O;  4DR2 O;  1I94 O;  1XMQ O;  1KUQ A;  2DOS A;  2ZM6 O;  4DR3 O;  2UXB O;  4DV7 O;  4B3T O;  4NXM O;  4YY3 O;  1IBL O;  4DR7 O;  4OX9 O;  4DR5 O;  4X62 O;  4DR1 O;  4JI5 O;  5H5N A;  4LF6 O;  1D2D A;  1IBK O;  5BY1 A;  2E5L O;  2LW7 A;  4LFB O;  2UXC O;  4OPH A;  2VQE O;  4NXN O;  3J7A U;  2ZKO A;  4KHP O;  1AB3 A;  3R66 A;  4A5U B;  4DUY O;  4JI6 O;  2UUA O;  4B3R O;  1N36 O;  3RT3 C;  4LF8 O;  4B3S O;  4K0K O;  1FYJ A;  4B3M O;  4LF4 O;  4X65 O;  2N74 A;  1X59 A;  1HNX O;  5A2Q N;  4DV6 O;  5IWA O;  4DV2 O;  1A32 A;  1IBM O;  4DR4 O;  4JI8 O;  4LF9 O;  1G1X B;  4DV1 O;  1YZB A;  4JV5 O;  3T1H O;  3OTO O;  1NS1 A;  2DJV A;  3J80 N;  4LF5 O;  2Z0A A;  4YHH O;  5FLX N;  1HR0 O;  1FJG O;  4X64 O;  4JI1 O;  4DV5 O;  5LMN O;  4DV0 O;  4JI4 O;  1J5E O;  2HHH O;  5LMU O;  4OPA A;  4JI3 O;  4DV3 O;  4JYA O;  1HNW O;  3O65 A;  2JRI A;  2AGA A;  1N34 O;  1R1B A;  5BR8 O;  5LL6 Y;  2UXD O;  2UUC O;  4DV4 O;  5IT9 N;  5BXZ A;  3M8A A;  1F7Y A;  2F4V O;  1AIL A;  4JI7 O;  4LFC O;  1FKA O;  1XNR O;  2VQF O;  1XNQ O;  2FKX A;  1XMO O;  4DUZ O;  3SDL A;  4GKJ O;  3J81 N;  4X66 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...