4A5UB

Turnip yellow mosaic virus proteinase and escherichia coli 30s ribosomal s15
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
80
Chain Sequence
SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFSRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA REPLICASE POLYPROTEIN
publication title A Compact Viral Processing Proteinase/Ubiquitin Hydrolase from the Otu Family.
pubmed doi rcsb
source organism Turnip yellow mosaic virus
molecule tags Transferase/rna binding protein
total genus 28
structure length 80
sequence length 88
ec nomenclature
pdb deposition date 2011-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4a5uB00
4DV5O 4NXNO 3R66A 1N32O 2JRIA 4OPHA 4LF6O 2UUBO 2FKXA 4DR7O 4LFBO 1A32A 4AQYO 1FJGO 1R1BA 2DOSA 5H5NA 1IBLO 2N74A 4LF5O 4A5UB 1N34O 2ZM6O 4DV2O 3JAMN 4GKKO 4JV5O 5LL6Y 4JYAO 2HHHO 2VQFO 4K0KO 1IBKO 4DV6O 4LF7O 1HNXO 2UXBO 1HNZO 2UU9O 2Z0AA 4DR3O 1X59A 1I94O 1AB3A 3O65A 2UXCO 2DJVA 5FLXN 4DUZO 5BXZA 4DR2O 1HNWO 3J7AU 1FYJA 1XNRO 1IBMO 4X66O 4JI7O 4DR5O 3SDLA 4DR4O 5BY1A 4JI2O 4DV1O 1G1XB 2AGAA 5IWAO 1HR0O 3J80N 2ZKOA 4LF8O 1XEQA 4KHPO 3OTOO 4DR1O 1KUQA 4NXMO 4DV7O 4OX9O 4DR6O 4JI6O 4X62O 1NS1A 1XMQO 1N36O 4LF9O 2LW7A 4JI3O 4B3RO 4YY3O 1D2DA 3T1YO 1YZBA 2UUAO 4DUYO 1J5EO 4YHHO 4JI1O 3T1HO 4DV4O 4B3TO 3F5TA 5BR8O 1F7YA 4OPAA 5LMUO 1XNQO 3RT3C 4X65O 2UXDO 4GKJO 4B3SO 4LF4O 1XMOO 4X64O 4DV3O 5A2QN 1N33O 4B3MO 4JI8O 4DV0O 2UUCO 1DK1A 3J81N 4JI4O 5IT9N 5LMNO 4JI0O 2F4VO 2VQEO 4LFAO 4LFCO 1R6TA 2E5LO 4JI5O 3M8AA 1AILA 1FKAO
chains in the Genus database with same CATH superfamily
4NXNO 1JVMA 3S3XA 2Y48A 4MW8A 4WFHA 2EIJB 5HFLA 3MDSA 2A3QA 4DR7B 2RMKB 4UB6Z 3H1IH 3JCZA 3ZRXA 3O9OA 3VQYA 4X64B 4DV2O 2PZSA 1N34B 1XBLA 4UCTA 3F5WC 4EFBA 5LA6B 3ZJZA 1QLNA 5H9CA 3D36A 2OTJV 3AG2B 2CTWA 3TXSA 4DW1A 3CMEV 4UVAA 5BMVB 4BR6A 4IYHA 1R73A 4DV1O 5KHIA 1VQMV 4ASUG 5L3GA 4P9OA 4KUMA 4F6RB 2EIMC 3LNMB 1OCOC 5AG2A 2VQFB 2Q7EA 4TWKA 1NVPD 1PNLA 3CSXA 2Y69C 1P7BA 1W0KG 3GB7C 3D3QA 3A0RA 4GX5A 2ARHA 3ABLB 3OE7G 1KQSU 1FXKA 1D2DA 1VQ7V 3SPCA 1K34A 2YEVA 1M57C 4QE9A 4BAYA 5LMUO 1TUBA 2XHBA 3G67A 1PNMA 3AG3B 3FAVA 1E79G 5DN6G 2QKSA 4DV7B 4X64O 4RQEA 1AVMA 3SPHA 2PY5A 1MSWD 4DRXA 1VQLV 2UUAB 1NVPB 3I5DA 2C2AA 4B7EA 3ABKC 2WWWA 4IL6Z 4YJ2A 1SRYA 1K7DA 2YIBD 2HJFC 3K79A 4UB8Z 4B3SB 3FFQA 2HFEC 1FXKB 4RUEA 3K59A 4PJ0Z 2VQFO 3SYCA 1FFXA 3CWBH 1M93A 4KFMA 4LFCB 3K5OA 4LNUB 2YEVB 1AI5A 4TOIA 2CH7A 1TUBB 5FLXN 4LH7A 2PGGA 3FAVB 1BSMA 4FMTA 3RYIA 4UUJC 2ODMA 4IIJA 1TVKA 2CGOA 1EN5A 5J2UA 4I4TA 5J2TA 1RPRA 2EINB 4DRXB 2Q6AA 3FD9A 4G27B 1BHBA 4JYAB 4DV7O 4DV6B 1H2GA 3OT7A 4DR6O 2A0LA 3AK2A 2Q8VA 2P22C 5EYPA 1RPOA 2UXCB 3QVNA 2UUAO 3NR7A 4ZKIA 1R6KA 2X6BA 2ZNJA 4MVUA 1IVSA 2GUZA 4YIPA 1FFXB 2W0XA 2ZE6A 1SZXA 4NKGB 4B3SO 2RJZA 1PNKA 4DXWA 2CH7B 1JOYA 1KYOF 1VQ5V 4C7UA 1FPOA 4NTYA 3RYIB 4BIZA 4IIJB 1TVKB 1PKXA 4LFCO 5J2UB 1H2KA 4I4TB 5J2TB 3CPWU 5FNVA 3I56V 2JK5C 1TAEA 4MVSA 3E86A 4GLXA 3C3TA 1B6QA 1WB7A 3DSQA 2UUBB 5H5NA 4I50A 2DE0X 5EYPB 2Q7GA 2ZM6O 2QM8A 4W4LA 3CD6V 3K06A 4JYAO 4DV6O 1Z5WA 2EIMB 4FLTA 2CTPA 4DO2A 2UXCO 3OD4A 2GUZB 2Y69B 4BIUA 4XDKA 3SDLA 4JYBA 4MW3A 1SC5B 2JEXA 1NTMH 3HB3B 2QWOB 1B04A 1Y74A 4AHCA 3FB7C 2QEXV 5DEDA 3K03A 5FNVB 4F4LA 1U97A 1MG1A 2YXYA 2E76B 3H1KH 5KAIZ 4FZ1A 1V9PA 4I50B 3I55V 1I08A 1CPYA 1DLBA 3K58A 3CEIA 2NLJC 4FLXA 5IY5B 1JMKC 4MTXA 5GW7A 2E75B 3RT3C 2OTLV 5H2FZ 1QVFU 3ABKB 3TETA 1LR1A 1OCRC 3CMAV 3CCMV 4UVBA 4WFBV 4YY3B 1KECA 3ETEA 2JIZG 1Y74B 4FM2A 1RFYA 3C90A 1FS0G 2R70A 3A0HZ 2WLNA 3JAKA 1JX9A 2JDIG 3TGUH 1VEWA 3VQXA 2DW4A 2Z5UA 5BZBA 1SETA 2JJ1G 4JV5O 1YSCA 1AJNA 1D5NA 1H8EG 2ZR3A 1IBKO 1XOUA 4GX2A 4GT1A 5LP6C 4B7KA 2DJVA 4J7ZA 4DR2B 1Q3EA 2Q7HA 1GN4A 1KU9A 1X4TA 3ASOB 2DWDC 2D2CB 1JQ0A 3SJQC 4PI0A 1GM8A 5B1OA 3QTCA 2P5OA 1XDCA 2QE7G 1H38A 1V54B 3K0DA 3IFXA 1B06A 4K3AA 5A9GA 2QM4A 1HNXB 3ABMB 4HAMA 4JZGA 1AP5A 4H13B 1AR1B 4CS3A 4ZOLA 4YY3O 3JAKB 4PDMA 1GM7A 3T1YO 1SQBH 2DQ3A 1K9MW 3BY6A 1L8DA 4JI7B 1ZUQA 4DR5B 1ROPA 2IH1C 4Q20A 4CZZA 3ABUA 2VRZA 4FFKA 4P9PA 1M90W 4CS4A 3RYFA 4LBEC 3HKEA 3U11A 5ITZA 2DYSC 3FB8C 4DR1B 2OYQA 2KB1A 4J41A 1WNSA 1SQVH 5GONA 3RWRD 3SJAC 3M7MX 1R6TA 5EIBD 1PV0A 3A2FA 1EZVH 2BTOA 4LFAB 1Q43A 4JI5B 1IXBA 1Q6HA 3H9VA 1N32O 4OPHA 5E1AC 1TUEB 4DV4B 2IU3A 4QGPA 1H2SB 4FFBA 1VQ4V 5GTHZ 2R9RB 4ZOLB 4DYLA 3SGIA 3L72H 2UUCB 4UV9A 3JATA 1HNXO 3E35A 4JAUA 2QJ1A 1GN2A 1TA8A 5IJ9A 4R7CA 3O65A 3RYFB 4L8JA 3HKEB 3T4DA 2LFRA 4G28B 1BT8A 3ZEDA 5ITZB 3LDCA 5B3SC 1VF7A 4JI7O 4DR5O 1V55B 2W6JG 3TK1A 4WBNA 2RNBA 3OTFA 3QO7A 1J95A 5GONB 2H8PC 1CXZB 3JD1A 2Q67A 3K9SA 4DR1O 2YIAA 5LP6A 1P84F 3X2QC 4FK5C 1YI2V 1JCHA 2FL4A 4LH6A 3OMNB 4W4KA 1K73W 4J80A 4J11A 4I7ZB 3UT5A 1RM1C 2CK3G 5LXTA 1I0HA 1KP2A 2QTSA 4FFBB 3BABA 3THOA 2KKWA 2YUAA 5IWAB 5CBHA 3UKMA 4DV4O 1M9NA 3F5TA 3STLC 2EILB 3JATB 4GX1A 2BTQB 1RP3B 3S3WA 5IJ9B 1SERA 1AROP 4OX9B 2P06A 2OIGA 4JI6B 3ZHRA 1I5XA 2XAFA 2UUCO 3RW0A 1ZAUA 3F7YC 4WBNB 1MOFA 3KKYA 3ML0A 3ZMZA 4D7TA 1Q86W 3T1HB 1XILA 2Q5ZA 3TJTA 5BR8B 1R3LC 1FXVA 4LFBO 5LP6B 2HG5C 2ZCEA 4HYOA 1KD1W 1WA8A 1YXBA 2OT5A 1QVGU 1R6NA 1Q90D 3UT5B 2P4KA 2A7WA 1VQ9V 4X20A 5LXTB 1N33B 5LHHA 3ZIAG 2F93B 3Q4HA 4JI4B 2HJDA 5KUMA 1QNMA 2HLDG 1Q8IA 4FLYA 2LP7A 2RQ6A 3WG7C 3IC7A 4FM1A 1K92A 3CXCU 4LF6B 3EHBB 3OUSA 1YVWA 3RYCA 5IWAO 1WN7A 4JTAB 5C93A 2Q0OC 2E3CA 3ZMVA 3ETDA 2K9PA 3UO3A 3K04A 4PA4A 3L73H 2CAZC 1VQOV 5E79Z 2EZPA 3L9DA 3OW2U 4OX9O 4MVOA 1HNZB 1KP3A 1QR8A 4JI6O 4X62O 1BHAA 2BSKA 3HPLC 3VOUA 3UM7A 4JYCA 1WA8B 4FLUA 1HDJA 3JCUZ 1YZBA 2CE4A 2QSAA 3ASNB 1R3JC 4X9QA 2HVKC 4ABMA 4O4JA 1JA8A 1XHXA 4X20B 1O9HA 3EFFK 3T1HO 2FYUH 4U3JA 5BR8O 3Q4HB 5KHGA 2EIKC 4UCOA 1XMOO 4JYYA 3OM3B 1U96A 2X6AA 5L3FA 1N33O 3SYAA 2JGUA 3HKCA 3ZRWA 4JI4O 4UXNA 3SPJA 5F2VO 1IDSA 3RYCB 1AILA 1N8RW 4X88A 4LNUA 1ZL8A 2VQEB 2F66C 1Q82W 2ZIMA 3RVYA 3U10A 2B9ZA 2ZE8A 4LF6O 4DR7O 2DQ0A 4I55A 4X65B 2Y0IA 2BSKB 3AG4B 1N34O 3B8MA 5KAFZ 2Q0AA 2F4VB 4LWSA 4O4JB 1HNZO 1BQ0A 2Q69A 4U3JB 4O4IA 3CHXA 4PHZA 1K4DC 1Y76A 1AJQA 3LUTB 4BWAA 1EN4A 1SKVA 3BA8A 3OR7C 3CCVV 1N4CA 5LHIA 4MTGA 3E2EA 3HKCB 3ZRWB 2MW2B 1B3QA 3ZBHA 5EC1C 2YS8A 3EVKA 1UJWB 4JAAA 1KUQA 3IAYA 2HHHB 3T1CA 2ZE7A 4LF7B 1ZL8B 4QPJA 2Y4UA 1OCZB 4QPKA 4YIOA 3ABTA 5L3EA 4I55B 3SYOA 5KUKA 2IJJA 2XTAA 3P30A 1SS3A 1XNRB 4ZBMA 1WJZA 2QWPB 3GVMA 1J5EB 1MABG 2PYJA 5IDJA 1F7YA 1P4RA 4PI2A 4KL1A 3ZRVA 4FLZA 4LWSB 3CRCA 4X65O 1KBHA 5CA0A 1PL4A 4NXMB 4O4IB 4LP8A 1EN6A 2AXTZ 1Y76B 2WLMA 2N04A 5EZYA 2F4VO 3PN1A 1RSOA 5KA6A 4ZI7A 1NU1H 4DUYB 4QIWF 3P32A 2KG7A 5DECA 2L6LA 2BE3A 4UCUA 4WFAV 4HZ3A 2WA3A 3ZN0A 4FZ0A 3LDDA 3N27A 1ZX3A 2QTOA 1K3EA 3QO5A 3SPIA 4B3MB 1LUWA 2OCCC 4J9YB 2P4VA 1XI1A 3W7UA 2HHHO 4LF7O 1PPJH 2JVDA 2X7RB 3EXAA 1T5EA 2Z0AA 3T4ZA 1X59A 1DGSA 1QLEC 3CC7V 2WLKA 3KZIZ 2M6YA 2WLIA 5CA0B 1YHQV 3J7AU 1XNRO 5B1BC 1WAZA 4U3FH 5FPRA 3QG5A 1KMIZ 4X8AA 2N05A 2Y4TA 1THZA 2WPDG 4UFZA 4CH5A 3M99B 5EZYB 3STZC 1QU7A 1XEQA 3OEEG 5EBMC 1ORQC 4UV8A 5LBQA 2LGWA 1H2LA 1RSOB 1S3JA 4ZI7B 1OCOB 4NXMO 2HEPA 2KG7B 4TQDA 2B5UA 4O2BA 4I9WA 3ZMUA 1NS1A 3JASA 5EK0A 4TSFG 3BRCA 1EFRG 1IURA 3P3NA 1M56C 4DUYO 1W2BU 2W6IG 1VQ8V 5EBWC 3MAQA 4CH3A 1Q81W 1M57B 2R9AA 1WP8A 2DYRC 4I5SA 3CCRV 3L71H 4UCSA 5L3CA 3W7WA 5A2QN 3BCCH 1DF5A 4UCRA 1GO3F 5D5PA 4B3MO 2JS3A 2WLIB 4DV3B 1M1KW 1CP9A 3CC4V 2G38A 1JJ2U 2YXLA 3CRMA 5H6QA 2E5LB 4JAVA 2JRIA 3GWOA 2UUBO 4MTOA 2UXXA 1EBOA 4MVRA 4O2BB 4PELA 3JASB 1R3IC 1FJGB 3BPZA 2QDOA 1MSDA 4LCUC 4NVPA 1ZWIC 5LGTA 2GBOA 2PYLA 2GTAA 1FD9A 3CS5A 1NT2B 5EBLC 2ATKC 4NTWA 3K57A 2ZT9B 3BHPA 2IM9A 2UU9B 3PJSK 1I7FA 1XL6A 3FB6C 1BL8A 2Q73A 5BXZA 3W7SA 3CJHA 2ETNA 1FYJA 1AI4A 2E74B 2KQXA 1F4MA 3LDEA 1F23A 1G1XB 2LQTA 1O9GA 3FYIB 3CCSV 4LF5B 4RWUA 4QNHB 2OIEA 2FB5A 2CTRA 2UXBB 4UVCA 4PA9A 2RDCA 3ZHQA 3AG1C 4F6EA 5FL7G 1FXHA 2QWQB 4JI3B 3CX5F 2CGNA 4MSWC 1OHHG 5CA3A 1XUQA 4P30A 1P7GA 2ADPA 2V7QG 1NJIW 1BCCH 3QNEA 2WSSG 4OPAA 3BA9A 1E1RG 5IYCO 4WCEV 4J7JA 4PDRA 3CJHB 3WFVA 1IZ3A 4XBFA 5LGUA 5IYDO 5J9PC 3APQA 5L3DA 1MMMA 5LOVA 1OJHA 4KXRA 4YHHB 5JH7B 4D6TH 4PA3A 1YJWV 2A06H 2EIJC 2XASA 3DC5A 2FKXA 4YXWG 2YDEA 4ZIBA 5TISZ 1BZKA 3K9AA 4Z1MG 4LF5O 1VQ6V 5B66Z 2ADQB 1SA0A 3E8FA 2UXBO 5B1NA 5LYJA 3G80A 4JZ2A 3GWKC 2IH3C 1YTFB 4NR1A 1G4YB 3APOA 4DR2O 1QQCA 1F4NA 1WP7A 1ZTEA 4O4HA 2YI8A 2IJHA 1IBLB 1YDXA 2VWKA 1Q5OA 3H01A 1K4CC 1JJOA 2BTQA 2F23A 5LOVB 1AP6A 2DYRB 3D8CA 1I94B 4TUYA 3E8BA 5IJ0A 4N21A 1S0VA 1NZ6A 4DUZB 4J7KA 1HNWB 2WA4A 5KLVH 4X66B 2YIDA 4YHHO 3KCXA 3KG2A 2HKOA 2WLHA 1SA0B 3SJCC 5LYJB 2R9IA 5JWPA 3D36C 1UPGA 2XNDG 3N2GA 1IXMA 1OCCC 4GUNA 3NXSA 4MVQA 1N36B 1VARA 1OCRB 1HWYA 4O4HB 3SPGA 4LFAO 4JI5O 4MVZA 1S5JA 4RO2A 3ZHSA 3MHSC 3CXHF 4YJ3A 4JI1B 3TXQA 1H2MA 3WU2Z 4WFEA 1AJPA 1GMGA 1WPXA 4NTXA 3AEIA 5L3BA 1XNQB 1A32A 2QA4V 2P6JA 2DOSA 1NTKH 1NH2B 1IBLO 5JQGA 1QCEA 1MZFA 3JARA 1FXKC 4TUYB 5IJ0B 2PUSA 3IJ4A 4PV1B 3AG7A 2EZOA 2P90A 3JD4A 1I94O 3CRQA 3ZCCA 3E83A 3LSQA 4DUZO 4DV5B 1HNWO 4PDVA 3G4SV 3JD0A 3JD3A 4X66O 3AG1B 4PA7A 1WLEA 3N2GB 2V1DA 2LW1A 3JAWA 1OV9A 4BW9A 1YCIA 2JS5A 2WLJA 3SYQA 2B1IA 2IJIA 4GKKB 2AZ0A 1VF5B 4G2KA 2ZXWC 3LSSA 1SZTA 1VQNV 3CP1A 4YJ3B 2XAHA 3ZMSA 3ZHUA 3G6BA 1N36O 2XAQA 1YF2A 2W0FC 2BOBC 1W0JG 1SQGA 5JQGB 1GN3A 2MK3A 3JARB 4JI1O 5JCOC 4EKWA 2CUGA 1XNQO 5KHJA 2X0LA 4I9QA 3ETGA 4XDLA 4QJFB 5LMUB 3R65A 4X89A 3CCQV 2DYSB 3WB1A 3VBBA 3CCEV 2QWNB 4IHJA 2JJ2G 5IYBO 2AW9A 4UCVA 4LF9B 4GZRB 5IT9N 2HVJC 3JSLA 1GTOA 4NB5A 4AI8A 3JAWB 3DXRA 1L1FA 1S77D 2NN4A 1FKAO 4DV5O 4NYKA 4EEQA 3R66A 4K8XA 1QHTA 4Z1VA 2NR5A 3BEHA 3OGIB 1P49A 1Q6IA 1GM9A 4GKJB 3L70H 3P3PA 4A5UB 1BE3H 1K33A 1Y66A 1IX9A 4GKKO 1Q6UA 2ITCC 2P67A 5LL6Y 2RCVA 4DV0B 5KHKA 2Y0PA 3CCJV 4X1KA 1N0NA 2NNUA 3MD0A 3BFRA 1AB3A 4FVMA 4CC5A 3OMAB 2VS0A 4J9ZB 2A9HA 2EULA 5KA5A 1S5LZ 1Y67A 3L74H 5B3SB 1BMFG 5KHHA 5K1PA 4IHJB 1EZJA 2XAJA 4Q6GA 3J80N 1NTZH 3OGCC 1Y4MA 4R6ZA 3SR2C 1KKCA 3DXRB 3K3WA 3X2QB 4DR3B 2EJ7A 4WFGA 4LF9O 4DR6B 1RM1B 2ZD9A 1OCCB 4GX0A 3VQWA 3MHHC 4JTDB 1IBMB 5CB4A 3C3SA 1PD3A 5CN0A 4DR4B 4R8CA 3FX7A 2JGDA 2P7TC 5IY5C 4GCZA 2YIBA 4LF8B 3CCLV 3ZHTA 4X1KB 5CBFA 4CBCA 4GKJO 4L87A 1URFA 2ITDC 3WB2A 2LGQA 2EJRA 2FMLA 3QO8A 2D3OW 3A8TA 3L75H 4DV0O 5H6RA 1DF4A 1HW7A 3B40A 5JCOA 4CC6A 2VQEO 2Z3YA 4OGQB 1N0JA 2FTKA 4O4LA 2GSMB 1WPBA 1HP8A 4D7SA 2K1EA 4FM0A 3K5MA 2VWJA 2UXDB 2A79B 2N74A 4FIPC 1GKFA 3ZMTA 1G6UA 1YITV 2R72A 2ZM6B 1VF6C 5CB4B 4JI0B 4HNAA 4OXSA 5DM6V 4X1IA 2JGDB 3UO2A 4DR3O 4BW5A 2ZXWB 4DW0A 5FPOA 4JASA 3LNNA 3OR6C 1GRJA 1OZ0A 4YJ2B 2IJKA 1IBMO 3WG7B 3ASOC 3OEHG 4DR4O 4AQYB 3OMIB 2ZKOA 4LF8O 1Y6XA 1V54C 1SF9A 1VIBA 1K5SA 1GH6A 2LJ2A 1PP9H 2V4DA 3ABMC 1BQZA 2AHZA 3N2KA 4J10A 3B2EE 3CB2A 4O4LB 1YJ9V 2B1GA 2LW7A 2XOKG 2XAGA 2XT9A 3HR0A 1VQPV 1YJNV 4PD4F 2JEUA 1UFIA 3CRAA 1J5EO 4JI2B 3B09A 3F7VC 2EBOA 1XREA 3FB5C 2ZQMA 1XL4A 4H33A 3W7TA 3U0ZA 4HNAB 4XDJA 4X1IB 3QF7A 2UXDO 1Q7YW 2EIKB 1Z5VA 4TQFA 1L0NH 4LC1A 3K5NA 3HKBA 1YEWA 4N23A 1WB8A 1SQQH 4B3RB 4JI0O 1MZEA 2HP8A 3G6EV 1BGYH 1KB9F 2YC0A 5C8YA 4X1YA 2CTQA 4K35A 3BVOA 2ZDIC 4R50A 3DTUB 4AILC 3T2MA 4B3TB 3BAAA 1NBMG 2O57A 4DK1A 2M7WA 1R3KC 3E22A 3N2KB 1AI7A 4AQYO 2YXHA 1R1BA 3RGBA 1AI6A 2QM7A 5KMGA 4E2LA 4LF4B 2HR3A 4TV8A 1PM9A 4U7NA 4JI8B 2Q9LA 2ZE5A 4HBNA 4JV5B 1FFTB 1ZSPA 1IBKB 1NI8A 1EM1A 1XHZA 2LO1A 1SQPH 2QWRB 1GK9A 5GTIZ 3K5LA 3CYOA 1GN6A 2ILMA 1V55C 2ZR2A 4JI2O 1JPXA 5EIBC 2AGAA 3HKBB 2EX3A 5KX5A 1VF6A 3RVZA 1H8HG 1M5IA 1K5QA 3ETQA 5B1AC 1SESA 1AR4A 5C8YB 4X1YB 1MA1A 2YICA 2BCCH 2KSDA 4JGSA 2Q4PA 4B3RO 1Z2GA 2GDSA 3G71V 1I5YA 3E22B 3IGAC 3RBZA 4QE7A 5JVDA 5KMGB 1SQXH 4O2AA 2AHYA 2GTSA 3T1YB 2IBZH 4PDLA 4TV8B 5JH7A 1HR0B 4B3TO 2EILC 5JJNB 1YIJV 4MS2A 4FLWA 1SQFA 1F51A 1S72V 5JJEB 4LF4O 3RN4A 1QBZA 4DV3O 1LNQA 2RN9A 3H1HH 4GYCB 4JI8O 1XMQB 3B8NA 4RQFA 2F43G 1AR5A 1JFFA 3OAAG 4JTCB 5KX5B 2E5LO 3OFNG 3ZS8C 3VQVA 4H0LB 5EC2C 2GHYA 3H1JH 2L35A 4H44B 3ICXA 1VMGA 1N32B 3ZN1A 1FJGO 1CEZA 4MT8A 2UXNA 1YTFD 3B4SA 3JALA 3CE2A 3CCUV 4FPPA 1K8AW 3JAMN 5JVDB 3A0BZ 4O2AB 2OCCB 2ZDIA 3TCUA 5LMNB 4MTFA 4EB6A 2UU9O 1NQTA 2AZ2A 1ENVA 3E8HA 4CH6A 5IYZA 2PI5A 2X6CA 1QLEB 2QKAA 2H94A 3WB0A 1PL0A 1K97A 4IT5A 5BY1A 5B1BB 5LHGA 4TT3G 4LR3A 4RUFA 1HR0O 3RFRA 1H2NA 4JPRA 4Z2WA 1JFFB 3UCSC 2YSUB 2DWEC 2QGNA 4CS2A 3AK3A 4K0KB 3B77A 2OWOA 1FAFA 3AG2C 5K1XA 1ZLZA 3JD2A 1XMQO 2PTMA 4DK0A 2QR4A 4WF9V 3JSNA 4JI3O 5IE9A 1GAXA 1D5AA 1NR7A 3ASNC 1W59A 2WLLA 3JALB 1M56B 1KC8W 5CBGA 2F1MA 3SYPA 5B5EZ 2WAMA 4KHPB 2ZINA 3JYCA 4EB6B 3ZHVA 2PI4A 3OTOB 3K0GA 5IYZB 1NR1A 1S76D 2CDYA 4CH4A 3ABLC 3AK1A 1BS3A 3ZRSA 1VP7A 1QR9A 2F95B 1VQKV 4WFFA 1M4UA 5D5QA 5LMNO 5CMUA 1TGOA 1NH2D 3E89A 3AG3C 3E8GA 3KCYA 1LUVA 1COWG 4ICGA 2IU0A 2ZIOA 4I0XA 4LFBB 4TV9A 2Q68A 1NKDA 3AG4C 1S5HC 4FJCC 3RYHA 3CC2V 2DMXA 3D3IA 2WLLB 4K0KO 2IW5A 1JR9A 5B1AB 4KP4A 1KKDA 2YI9A 4IGGA 1E1QG 4NXNB 3CRRA 4RAIA 5LGNA 4P2ZA 3HKDA 3SJBC 4MVMA 4ZHQA 3ZX6A 1DTOA 4EFEA 4KHPO 1XQ8A 4PA6A 5CA1A 4DV2B 3OTOO 2DN9A 4B08A 3W7XA 2GV9A 1MNGA 5JJJB 4IYIA 1OCZC 2BOCC 2PF4E 3H1LH 4X62B 2OCHA 3FKSG 4BIOA 1US6A 4I0XB 4TV9B 3IC9A 2LFSA 3RYHB 3OUFA 2QKCA 2H3OA 3FYEB 2EINC 4DV1B 5LA6A 4K8ZA 4H37A 4JF3A 4U7OA 4FLVA 5BMVA 3DGEA 2ZNIA 2XUMA 4E4EA 1XMOB 1DK1A 3J81N 3UQ8A 4F6RA 1L0LH 5HFMA 1G8MA 3HKDB 3K08A 3LSUA 4J42A 3M8AA 4ZHQB 3DC6A 5CA1B
chains in the Genus database with same CATH topology
4DV5O 4NXNO 3R66A 1N32O 2JRIA 4OPHA 4LF6O 2UUBO 2FKXA 4DR7O 4LFBO 1A32A 4AQYO 1FJGO 1R1BA 2DOSA 5H5NA 1IBLO 2N74A 4LF5O 4A5UB 1N34O 2ZM6O 4DV2O 3JAMN 4GKKO 4JV5O 5LL6Y 4JYAO 2HHHO 2VQFO 4K0KO 1IBKO 4DV6O 4LF7O 1HNXO 2UXBO 1HNZO 2UU9O 2Z0AA 4DR3O 1X59A 1I94O 1AB3A 3O65A 2UXCO 2DJVA 5FLXN 4DUZO 5BXZA 4DR2O 1HNWO 3J7AU 1FYJA 1XNRO 1IBMO 4X66O 4JI7O 4DR5O 3SDLA 4DR4O 5BY1A 4JI2O 4DV1O 1G1XB 2AGAA 5IWAO 1HR0O 3J80N 2ZKOA 4LF8O 1XEQA 4KHPO 3OTOO 4DR1O 1KUQA 4NXMO 4DV7O 4OX9O 4DR6O 4JI6O 4X62O 1NS1A 1XMQO 1N36O 4LF9O 2LW7A 4JI3O 4B3RO 4YY3O 1D2DA 3T1YO 1YZBA 2UUAO 4DUYO 1J5EO 4YHHO 4JI1O 3T1HO 4DV4O 4B3TO 3F5TA 5BR8O 1F7YA 4OPAA 5LMUO 1XNQO 3RT3C 4X65O 2UXDO 4GKJO 4B3SO 4LF4O 1XMOO 4X64O 4DV3O 5A2QN 1N33O 4B3MO 4JI8O 4DV0O 2UUCO 1DK1A 3J81N 4JI4O 5IT9N 5LMNO 4JI0O 2F4VO 2VQEO 4LFAO 4LFCO 1R6TA 2E5LO 4JI5O 3M8AA 1AILA 1FKAO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 O;  4NXN O;  3R66 A;  1N32 O;  2JRI A;  4OPH A;  4LF6 O;  2UUB O;  2FKX A;  4DR7 O;  4LFB O;  1A32 A;  4AQY O;  1FJG O;  1R1B A;  2DOS A;  5H5N A;  1IBL O;  2N74 A;  4LF5 O;  4A5U B;  1N34 O;  2ZM6 O;  4DV2 O;  3JAM N;  4GKK O;  4JV5 O;  5LL6 Y;  4JYA O;  2HHH O;  2VQF O;  4K0K O;  1IBK O;  4DV6 O;  4LF7 O;  1HNX O;  2UXB O;  1HNZ O;  2UU9 O;  2Z0A A;  4DR3 O;  1X59 A;  1I94 O;  1AB3 A;  3O65 A;  2UXC O;  2DJV A;  5FLX N;  4DUZ O;  5BXZ A;  4DR2 O;  1HNW O;  3J7A U;  1FYJ A;  1XNR O;  1IBM O;  4X66 O;  4JI7 O;  4DR5 O;  3SDL A;  4DR4 O;  5BY1 A;  4JI2 O;  4DV1 O;  1G1X B;  2AGA A;  5IWA O;  1HR0 O;  3J80 N;  2ZKO A;  4LF8 O;  1XEQ A;  4KHP O;  3OTO O;  4DR1 O;  1KUQ A;  4NXM O;  4DV7 O;  4OX9 O;  4DR6 O;  4JI6 O;  4X62 O;  1NS1 A;  1XMQ O;  1N36 O;  4LF9 O;  2LW7 A;  4JI3 O;  4B3R O;  4YY3 O;  1D2D A;  3T1Y O;  1YZB A;  2UUA O;  4DUY O;  1J5E O;  4YHH O;  4JI1 O;  3T1H O;  4DV4 O;  4B3T O;  3F5T A;  5BR8 O;  1F7Y A;  4OPA A;  5LMU O;  1XNQ O;  3RT3 C;  4X65 O;  2UXD O;  4GKJ O;  4B3S O;  4LF4 O;  1XMO O;  4X64 O;  4DV3 O;  5A2Q N;  1N33 O;  4B3M O;  4JI8 O;  4DV0 O;  2UUC O;  1DK1 A;  3J81 N;  4JI4 O;  5IT9 N;  5LMN O;  4JI0 O;  2F4V O;  2VQE O;  4LFA O;  4LFC O;  1R6T A;  2E5L O;  4JI5 O;  3M8A A;  1AIL A;  1FKA O; 
#chains in the Genus database with same CATH topology
 4NXN O;  1JVM A;  3S3X A;  2Y48 A;  4MW8 A;  4WFH A;  2EIJ B;  5HFL A;  3MDS A;  2A3Q A;  4DR7 B;  2RMK B;  4UB6 Z;  3H1I H;  3JCZ A;  3ZRX A;  3O9O A;  3VQY A;  4X64 B;  4DV2 O;  2PZS A;  1N34 B;  1XBL A;  4UCT A;  3F5W C;  4EFB A;  5LA6 B;  3ZJZ A;  1QLN A;  5H9C A;  3D36 A;  2OTJ V;  3AG2 B;  2CTW A;  3TXS A;  4DW1 A;  3CME V;  4UVA A;  5BMV B;  4BR6 A;  4IYH A;  1R73 A;  4DV1 O;  5KHI A;  1VQM V;  4ASU G;  5L3G A;  4P9O A;  4KUM A;  4F6R B;  2EIM C;  3LNM B;  1OCO C;  5AG2 A;  2VQF B;  2Q7E A;  4TWK A;  1NVP D;  1PNL A;  3CSX A;  2Y69 C;  1P7B A;  1W0K G;  3GB7 C;  3D3Q A;  3A0R A;  4GX5 A;  2ARH A;  3ABL B;  3OE7 G;  1KQS U;  1FXK A;  1D2D A;  1VQ7 V;  3SPC A;  1K34 A;  2YEV A;  1M57 C;  4QE9 A;  4BAY A;  5LMU O;  1TUB A;  2XHB A;  3G67 A;  1PNM A;  3AG3 B;  3FAV A;  1E79 G;  5DN6 G;  2QKS A;  4DV7 B;  4X64 O;  4RQE A;  1AVM A;  3SPH A;  2PY5 A;  1MSW D;  4DRX A;  1VQL V;  2UUA B;  1NVP B;  3I5D A;  2C2A A;  4B7E A;  3ABK C;  2WWW A;  4IL6 Z;  4YJ2 A;  1SRY A;  1K7D A;  2YIB D;  2HJF C;  3K79 A;  4UB8 Z;  4B3S B;  3FFQ A;  2HFE C;  1FXK B;  4RUE A;  3K59 A;  4PJ0 Z;  2VQF O;  3SYC A;  1FFX A;  3CWB H;  1M93 A;  4KFM A;  4LFC B;  3K5O A;  4LNU B;  2YEV B;  1AI5 A;  4TOI A;  2CH7 A;  1TUB B;  5FLX N;  4LH7 A;  2PGG A;  3FAV B;  1BSM A;  4FMT A;  3RYI A;  4UUJ C;  2ODM A;  4IIJ A;  1TVK A;  2CGO A;  1EN5 A;  5J2U A;  4I4T A;  5J2T A;  1RPR A;  2EIN B;  4DRX B;  2Q6A A;  3FD9 A;  4G27 B;  1BHB A;  4JYA B;  4DV7 O;  4DV6 B;  1H2G A;  3OT7 A;  4DR6 O;  2A0L A;  3AK2 A;  2Q8V A;  2P22 C;  5EYP A;  1RPO A;  2UXC B;  3QVN A;  2UUA O;  3NR7 A;  4ZKI A;  1R6K A;  2X6B A;  2ZNJ A;  4MVU A;  1IVS A;  2GUZ A;  4YIP A;  1FFX B;  2W0X A;  2ZE6 A;  1SZX A;  4NKG B;  4B3S O;  2RJZ A;  1PNK A;  4DXW A;  2CH7 B;  1JOY A;  1KYO F;  1VQ5 V;  4C7U A;  1FPO A;  4NTY A;  3RYI B;  4BIZ A;  4IIJ B;  1TVK B;  1PKX A;  4LFC O;  5J2U B;  1H2K A;  4I4T B;  5J2T B;  3CPW U;  5FNV A;  3I56 V;  2JK5 C;  1TAE A;  4MVS A;  3E86 A;  4GLX A;  3C3T A;  1B6Q A;  1WB7 A;  3DSQ A;  2UUB B;  5H5N A;  4I50 A;  2DE0 X;  5EYP B;  2Q7G A;  2ZM6 O;  2QM8 A;  4W4L A;  3CD6 V;  3K06 A;  4JYA O;  4DV6 O;  1Z5W A;  2EIM B;  4FLT A;  2CTP A;  4DO2 A;  2UXC O;  3OD4 A;  2GUZ B;  2Y69 B;  4BIU A;  4XDK A;  3SDL A;  4JYB A;  4MW3 A;  1SC5 B;  2JEX A;  1NTM H;  3HB3 B;  2QWO B;  1B04 A;  1Y74 A;  4AHC A;  3FB7 C;  2QEX V;  5DED A;  3K03 A;  5FNV B;  4F4L A;  1U97 A;  1MG1 A;  2YXY A;  2E76 B;  3H1K H;  5KAI Z;  4FZ1 A;  1V9P A;  4I50 B;  3I55 V;  1I08 A;  1CPY A;  1DLB A;  3K58 A;  3CEI A;  2NLJ C;  4FLX A;  5IY5 B;  1JMK C;  4MTX A;  5GW7 A;  2E75 B;  3RT3 C;  2OTL V;  5H2F Z;  1QVF U;  3ABK B;  3TET A;  1LR1 A;  1OCR C;  3CMA V;  3CCM V;  4UVB A;  4WFB V;  4YY3 B;  1KEC A;  3ETE A;  2JIZ G;  1Y74 B;  4FM2 A;  1RFY A;  3C90 A;  1FS0 G;  2R70 A;  3A0H Z;  2WLN A;  3JAK A;  1JX9 A;  2JDI G;  3TGU H;  1VEW A;  3VQX A;  2DW4 A;  2Z5U A;  5BZB A;  1SET A;  2JJ1 G;  4JV5 O;  1YSC A;  1AJN A;  1D5N A;  1H8E G;  2ZR3 A;  1IBK O;  1XOU A;  4GX2 A;  4GT1 A;  5LP6 C;  4B7K A;  2DJV A;  4J7Z A;  4DR2 B;  1Q3E A;  2Q7H A;  1GN4 A;  1KU9 A;  1X4T A;  3ASO B;  2DWD C;  2D2C B;  1JQ0 A;  3SJQ C;  4PI0 A;  1GM8 A;  5B1O A;  3QTC A;  2P5O A;  1XDC A;  2QE7 G;  1H38 A;  1V54 B;  3K0D A;  3IFX A;  1B06 A;  4K3A A;  5A9G A;  2QM4 A;  1HNX B;  3ABM B;  4HAM A;  4JZG A;  1AP5 A;  4H13 B;  1AR1 B;  4CS3 A;  4ZOL A;  4YY3 O;  3JAK B;  4PDM A;  1GM7 A;  3T1Y O;  1SQB H;  2DQ3 A;  1K9M W;  3BY6 A;  1L8D A;  4JI7 B;  1ZUQ A;  4DR5 B;  1ROP A;  2IH1 C;  4Q20 A;  4CZZ A;  3ABU A;  2VRZ A;  4FFK A;  4P9P A;  1M90 W;  4CS4 A;  3RYF A;  4LBE C;  3HKE A;  3U11 A;  5ITZ A;  2DYS C;  3FB8 C;  4DR1 B;  2OYQ A;  2KB1 A;  4J41 A;  1WNS A;  1SQV H;  5GON A;  3RWR D;  3SJA C;  3M7M X;  1R6T A;  5EIB D;  1PV0 A;  3A2F A;  1EZV H;  2BTO A;  4LFA B;  1Q43 A;  4JI5 B;  1IXB A;  1Q6H A;  3H9V A;  1N32 O;  4OPH A;  5E1A C;  1TUE B;  4DV4 B;  2IU3 A;  4QGP A;  1H2S B;  4FFB A;  1VQ4 V;  5GTH Z;  2R9R B;  4ZOL B;  4DYL A;  3SGI A;  3L72 H;  2UUC B;  4UV9 A;  3JAT A;  1HNX O;  3E35 A;  4JAU A;  2QJ1 A;  1GN2 A;  1TA8 A;  5IJ9 A;  4R7C A;  3O65 A;  3RYF B;  4L8J A;  3HKE B;  3T4D A;  2LFR A;  4G28 B;  1BT8 A;  3ZED A;  5ITZ B;  3LDC A;  5B3S C;  1VF7 A;  4JI7 O;  4DR5 O;  1V55 B;  2W6J G;  3TK1 A;  4WBN A;  2RNB A;  3OTF A;  3QO7 A;  1J95 A;  5GON B;  2H8P C;  1CXZ B;  3JD1 A;  2Q67 A;  3K9S A;  4DR1 O;  2YIA A;  5LP6 A;  1P84 F;  3X2Q C;  4FK5 C;  1YI2 V;  1JCH A;  2FL4 A;  4LH6 A;  3OMN B;  4W4K A;  1K73 W;  4J80 A;  4J11 A;  4I7Z B;  3UT5 A;  1RM1 C;  2CK3 G;  5LXT A;  1I0H A;  1KP2 A;  2QTS A;  4FFB B;  3BAB A;  3THO A;  2KKW A;  2YUA A;  5IWA B;  5CBH A;  3UKM A;  4DV4 O;  1M9N A;  3F5T A;  3STL C;  2EIL B;  3JAT B;  4GX1 A;  2BTQ B;  1RP3 B;  3S3W A;  5IJ9 B;  1SER A;  1ARO P;  4OX9 B;  2P06 A;  2OIG A;  4JI6 B;  3ZHR A;  1I5X A;  2XAF A;  2UUC O;  3RW0 A;  1ZAU A;  3F7Y C;  4WBN B;  1MOF A;  3KKY A;  3ML0 A;  3ZMZ A;  4D7T A;  1Q86 W;  3T1H B;  1XIL A;  2Q5Z A;  3TJT A;  5BR8 B;  1R3L C;  1FXV A;  4LFB O;  5LP6 B;  2HG5 C;  2ZCE A;  4HYO A;  1KD1 W;  1WA8 A;  1YXB A;  2OT5 A;  1QVG U;  1R6N A;  1Q90 D;  3UT5 B;  2P4K A;  2A7W A;  1VQ9 V;  4X20 A;  5LXT B;  1N33 B;  5LHH A;  3ZIA G;  2F93 B;  3Q4H A;  4JI4 B;  2HJD A;  5KUM A;  1QNM A;  2HLD G;  1Q8I A;  4FLY A;  2LP7 A;  2RQ6 A;  3WG7 C;  3IC7 A;  4FM1 A;  1K92 A;  3CXC U;  4LF6 B;  3EHB B;  3OUS A;  1YVW A;  3RYC A;  5IWA O;  1WN7 A;  4JTA B;  5C93 A;  2Q0O C;  2E3C A;  3ZMV A;  3ETD A;  2K9P A;  3UO3 A;  3K04 A;  4PA4 A;  3L73 H;  2CAZ C;  1VQO V;  5E79 Z;  2EZP A;  3L9D A;  3OW2 U;  4OX9 O;  4MVO A;  1HNZ B;  1KP3 A;  1QR8 A;  4JI6 O;  4X62 O;  1BHA A;  2BSK A;  3HPL C;  3VOU A;  3UM7 A;  4JYC A;  1WA8 B;  4FLU A;  1HDJ A;  3JCU Z;  1YZB A;  2CE4 A;  2QSA A;  3ASN B;  1R3J C;  4X9Q A;  2HVK C;  4ABM A;  4O4J A;  1JA8 A;  1XHX A;  4X20 B;  1O9H A;  3EFF K;  3T1H O;  2FYU H;  4U3J A;  5BR8 O;  3Q4H B;  5KHG A;  2EIK C;  4UCO A;  1XMO O;  4JYY A;  3OM3 B;  1U96 A;  2X6A A;  5L3F A;  1N33 O;  3SYA A;  2JGU A;  3HKC A;  3ZRW A;  4JI4 O;  4UXN A;  3SPJ A;  5F2V O;  1IDS A;  3RYC B;  1AIL A;  1N8R W;  4X88 A;  4LNU A;  1ZL8 A;  2VQE B;  2F66 C;  1Q82 W;  2ZIM A;  3RVY A;  3U10 A;  2B9Z A;  2ZE8 A;  4LF6 O;  4DR7 O;  2DQ0 A;  4I55 A;  4X65 B;  2Y0I A;  2BSK B;  3AG4 B;  1N34 O;  3B8M A;  5KAF Z;  2Q0A A;  2F4V B;  4LWS A;  4O4J B;  1HNZ O;  1BQ0 A;  2Q69 A;  4U3J B;  4O4I A;  3CHX A;  4PHZ A;  1K4D C;  1Y76 A;  1AJQ A;  3LUT B;  4BWA A;  1EN4 A;  1SKV A;  3BA8 A;  3OR7 C;  3CCV V;  1N4C A;  5LHI A;  4MTG A;  3E2E A;  3HKC B;  3ZRW B;  2MW2 B;  1B3Q A;  3ZBH A;  5EC1 C;  2YS8 A;  3EVK A;  1UJW B;  4JAA A;  1KUQ A;  3IAY A;  2HHH B;  3T1C A;  2ZE7 A;  4LF7 B;  1ZL8 B;  4QPJ A;  2Y4U A;  1OCZ B;  4QPK A;  4YIO A;  3ABT A;  5L3E A;  4I55 B;  3SYO A;  5KUK A;  2IJJ A;  2XTA A;  3P30 A;  1SS3 A;  1XNR B;  4ZBM A;  1WJZ A;  2QWP B;  3GVM A;  1J5E B;  1MAB G;  2PYJ A;  5IDJ A;  1F7Y A;  1P4R A;  4PI2 A;  4KL1 A;  3ZRV A;  4FLZ A;  4LWS B;  3CRC A;  4X65 O;  1KBH A;  5CA0 A;  1PL4 A;  4NXM B;  4O4I B;  4LP8 A;  1EN6 A;  2AXT Z;  1Y76 B;  2WLM A;  2N04 A;  5EZY A;  2F4V O;  3PN1 A;  1RSO A;  5KA6 A;  4ZI7 A;  1NU1 H;  4DUY B;  4QIW F;  3P32 A;  2KG7 A;  5DEC A;  2L6L A;  2BE3 A;  4UCU A;  4WFA V;  4HZ3 A;  2WA3 A;  3ZN0 A;  4FZ0 A;  3LDD A;  3N27 A;  1ZX3 A;  2QTO A;  1K3E A;  3QO5 A;  3SPI A;  4B3M B;  1LUW A;  2OCC C;  4J9Y B;  2P4V A;  1XI1 A;  3W7U A;  2HHH O;  4LF7 O;  1PPJ H;  2JVD A;  2X7R B;  3EXA A;  1T5E A;  2Z0A A;  3T4Z A;  1X59 A;  1DGS A;  1QLE C;  3CC7 V;  2WLK A;  3KZI Z;  2M6Y A;  2WLI A;  5CA0 B;  1YHQ V;  3J7A U;  1XNR O;  5B1B C;  1WAZ A;  4U3F H;  5FPR A;  3QG5 A;  1KMI Z;  4X8A A;  2N05 A;  2Y4T A;  1THZ A;  2WPD G;  4UFZ A;  4CH5 A;  3M99 B;  5EZY B;  3STZ C;  1QU7 A;  1XEQ A;  3OEE G;  5EBM C;  1ORQ C;  4UV8 A;  5LBQ A;  2LGW A;  1H2L A;  1RSO B;  1S3J A;  4ZI7 B;  1OCO B;  4NXM O;  2HEP A;  2KG7 B;  4TQD A;  2B5U A;  4O2B A;  4I9W A;  3ZMU A;  1NS1 A;  3JAS A;  5EK0 A;  4TSF G;  3BRC A;  1EFR G;  1IUR A;  3P3N A;  1M56 C;  4DUY O;  1W2B U;  2W6I G;  1VQ8 V;  5EBW C;  3MAQ A;  4CH3 A;  1Q81 W;  1M57 B;  2R9A A;  1WP8 A;  2DYR C;  4I5S A;  3CCR V;  3L71 H;  4UCS A;  5L3C A;  3W7W A;  5A2Q N;  3BCC H;  1DF5 A;  4UCR A;  1GO3 F;  5D5P A;  4B3M O;  2JS3 A;  2WLI B;  4DV3 B;  1M1K W;  1CP9 A;  3CC4 V;  2G38 A;  1JJ2 U;  2YXL A;  3CRM A;  5H6Q A;  2E5L B;  4JAV A;  2JRI A;  3GWO A;  2UUB O;  4MTO A;  2UXX A;  1EBO A;  4MVR A;  4O2B B;  4PEL A;  3JAS B;  1R3I C;  1FJG B;  3BPZ A;  2QDO A;  1MSD A;  4LCU C;  4NVP A;  1ZWI C;  5LGT A;  2GBO A;  2PYL A;  2GTA A;  1FD9 A;  3CS5 A;  1NT2 B;  5EBL C;  2ATK C;  4NTW A;  3K57 A;  2ZT9 B;  3BHP A;  2IM9 A;  2UU9 B;  3PJS K;  1I7F A;  1XL6 A;  3FB6 C;  1BL8 A;  2Q73 A;  5BXZ A;  3W7S A;  3CJH A;  2ETN A;  1FYJ A;  1AI4 A;  2E74 B;  2KQX A;  1F4M A;  3LDE A;  1F23 A;  1G1X B;  2LQT A;  1O9G A;  3FYI B;  3CCS V;  4LF5 B;  4RWU A;  4QNH B;  2OIE A;  2FB5 A;  2CTR A;  2UXB B;  4UVC A;  4PA9 A;  2RDC A;  3ZHQ A;  3AG1 C;  4F6E A;  5FL7 G;  1FXH A;  2QWQ B;  4JI3 B;  3CX5 F;  2CGN A;  4MSW C;  1OHH G;  5CA3 A;  1XUQ A;  4P30 A;  1P7G A;  2ADP A;  2V7Q G;  1NJI W;  1BCC H;  3QNE A;  2WSS G;  4OPA A;  3BA9 A;  1E1R G;  5IYC O;  4WCE V;  4J7J A;  4PDR A;  3CJH B;  3WFV A;  1IZ3 A;  4XBF A;  5LGU A;  5IYD O;  5J9P C;  3APQ A;  5L3D A;  1MMM A;  5LOV A;  1OJH A;  4KXR A;  4YHH B;  5JH7 B;  4D6T H;  4PA3 A;  1YJW V;  2A06 H;  2EIJ C;  2XAS A;  3DC5 A;  2FKX A;  4YXW G;  2YDE A;  4ZIB A;  5TIS Z;  1BZK A;  3K9A A;  4Z1M G;  4LF5 O;  1VQ6 V;  5B66 Z;  2ADQ B;  1SA0 A;  3E8F A;  2UXB O;  5B1N A;  5LYJ A;  3G80 A;  4JZ2 A;  3GWK C;  2IH3 C;  1YTF B;  4NR1 A;  1G4Y B;  3APO A;  4DR2 O;  1QQC A;  1F4N A;  1WP7 A;  1ZTE A;  4O4H A;  2YI8 A;  2IJH A;  1IBL B;  1YDX A;  2VWK A;  1Q5O A;  3H01 A;  1K4C C;  1JJO A;  2BTQ A;  2F23 A;  5LOV B;  1AP6 A;  2DYR B;  3D8C A;  1I94 B;  4TUY A;  3E8B A;  5IJ0 A;  4N21 A;  1S0V A;  1NZ6 A;  4DUZ B;  4J7K A;  1HNW B;  2WA4 A;  5KLV H;  4X66 B;  2YID A;  4YHH O;  3KCX A;  3KG2 A;  2HKO A;  2WLH A;  1SA0 B;  3SJC C;  5LYJ B;  2R9I A;  5JWP A;  3D36 C;  1UPG A;  2XND G;  3N2G A;  1IXM A;  1OCC C;  4GUN A;  3NXS A;  4MVQ A;  1N36 B;  1VAR A;  1OCR B;  1HWY A;  4O4H B;  3SPG A;  4LFA O;  4JI5 O;  4MVZ A;  1S5J A;  4RO2 A;  3ZHS A;  3MHS C;  3CXH F;  4YJ3 A;  4JI1 B;  3TXQ A;  1H2M A;  3WU2 Z;  4WFE A;  1AJP A;  1GMG A;  1WPX A;  4NTX A;  3AEI A;  5L3B A;  1XNQ B;  1A32 A;  2QA4 V;  2P6J A;  2DOS A;  1NTK H;  1NH2 B;  1IBL O;  5JQG A;  1QCE A;  1MZF A;  3JAR A;  1FXK C;  4TUY B;  5IJ0 B;  2PUS A;  3IJ4 A;  4PV1 B;  3AG7 A;  2EZO A;  2P90 A;  3JD4 A;  1I94 O;  3CRQ A;  3ZCC A;  3E83 A;  3LSQ A;  4DUZ O;  4DV5 B;  1HNW O;  4PDV A;  3G4S V;  3JD0 A;  3JD3 A;  4X66 O;  3AG1 B;  4PA7 A;  1WLE A;  3N2G B;  2V1D A;  2LW1 A;  3JAW A;  1OV9 A;  4BW9 A;  1YCI A;  2JS5 A;  2WLJ A;  3SYQ A;  2B1I A;  2IJI A;  4GKK B;  2AZ0 A;  1VF5 B;  4G2K A;  2ZXW C;  3LSS A;  1SZT A;  1VQN V;  3CP1 A;  4YJ3 B;  2XAH A;  3ZMS A;  3ZHU A;  3G6B A;  1N36 O;  2XAQ A;  1YF2 A;  2W0F C;  2BOB C;  1W0J G;  1SQG A;  5JQG B;  1GN3 A;  2MK3 A;  3JAR B;  4JI1 O;  5JCO C;  4EKW A;  2CUG A;  1XNQ O;  5KHJ A;  2X0L A;  4I9Q A;  3ETG A;  4XDL A;  4QJF B;  5LMU B;  3R65 A;  4X89 A;  3CCQ V;  2DYS B;  3WB1 A;  3VBB A;  3CCE V;  2QWN B;  4IHJ A;  2JJ2 G;  5IYB O;  2AW9 A;  4UCV A;  4LF9 B;  4GZR B;  5IT9 N;  2HVJ C;  3JSL A;  1GTO A;  4NB5 A;  4AI8 A;  3JAW B;  3DXR A;  1L1F A;  1S77 D;  2NN4 A;  1FKA O;  4DV5 O;  4NYK A;  4EEQ A;  3R66 A;  4K8X A;  1QHT A;  4Z1V A;  2NR5 A;  3BEH A;  3OGI B;  1P49 A;  1Q6I A;  1GM9 A;  4GKJ B;  3L70 H;  3P3P A;  4A5U B;  1BE3 H;  1K33 A;  1Y66 A;  1IX9 A;  4GKK O;  1Q6U A;  2ITC C;  2P67 A;  5LL6 Y;  2RCV A;  4DV0 B;  5KHK A;  2Y0P A;  3CCJ V;  4X1K A;  1N0N A;  2NNU A;  3MD0 A;  3BFR A;  1AB3 A;  4FVM A;  4CC5 A;  3OMA B;  2VS0 A;  4J9Z B;  2A9H A;  2EUL A;  5KA5 A;  1S5L Z;  1Y67 A;  3L74 H;  5B3S B;  1BMF G;  5KHH A;  5K1P A;  4IHJ B;  1EZJ A;  2XAJ A;  4Q6G A;  3J80 N;  1NTZ H;  3OGC C;  1Y4M A;  4R6Z A;  3SR2 C;  1KKC A;  3DXR B;  3K3W A;  3X2Q B;  4DR3 B;  2EJ7 A;  4WFG A;  4LF9 O;  4DR6 B;  1RM1 B;  2ZD9 A;  1OCC B;  4GX0 A;  3VQW A;  3MHH C;  4JTD B;  1IBM B;  5CB4 A;  3C3S A;  1PD3 A;  5CN0 A;  4DR4 B;  4R8C A;  3FX7 A;  2JGD A;  2P7T C;  5IY5 C;  4GCZ A;  2YIB A;  4LF8 B;  3CCL V;  3ZHT A;  4X1K B;  5CBF A;  4CBC A;  4GKJ O;  4L87 A;  1URF A;  2ITD C;  3WB2 A;  2LGQ A;  2EJR A;  2FML A;  3QO8 A;  2D3O W;  3A8T A;  3L75 H;  4DV0 O;  5H6R A;  1DF4 A;  1HW7 A;  3B40 A;  5JCO A;  4CC6 A;  2VQE O;  2Z3Y A;  4OGQ B;  1N0J A;  2FTK A;  4O4L A;  2GSM B;  1WPB A;  1HP8 A;  4D7S A;  2K1E A;  4FM0 A;  3K5M A;  2VWJ A;  2UXD B;  2A79 B;  2N74 A;  4FIP C;  1GKF A;  3ZMT A;  1G6U A;  1YIT V;  2R72 A;  2ZM6 B;  1VF6 C;  5CB4 B;  4JI0 B;  4HNA A;  4OXS A;  5DM6 V;  4X1I A;  2JGD B;  3UO2 A;  4DR3 O;  4BW5 A;  2ZXW B;  4DW0 A;  5FPO A;  4JAS A;  3LNN A;  3OR6 C;  1GRJ A;  1OZ0 A;  4YJ2 B;  2IJK A;  1IBM O;  3WG7 B;  3ASO C;  3OEH G;  4DR4 O;  4AQY B;  3OMI B;  2ZKO A;  4LF8 O;  1Y6X A;  1V54 C;  1SF9 A;  1VIB A;  1K5S A;  1GH6 A;  2LJ2 A;  1PP9 H;  2V4D A;  3ABM C;  1BQZ A;  2AHZ A;  3N2K A;  4J10 A;  3B2E E;  3CB2 A;  4O4L B;  1YJ9 V;  2B1G A;  2LW7 A;  2XOK G;  2XAG A;  2XT9 A;  3HR0 A;  1VQP V;  1YJN V;  4PD4 F;  2JEU A;  1UFI A;  3CRA A;  1J5E O;  4JI2 B;  3B09 A;  3F7V C;  2EBO A;  1XRE A;  3FB5 C;  2ZQM A;  1XL4 A;  4H33 A;  3W7T A;  3U0Z A;  4HNA B;  4XDJ A;  4X1I B;  3QF7 A;  2UXD O;  1Q7Y W;  2EIK B;  1Z5V A;  4TQF A;  1L0N H;  4LC1 A;  3K5N A;  3HKB A;  1YEW A;  4N23 A;  1WB8 A;  1SQQ H;  4B3R B;  4JI0 O;  1MZE A;  2HP8 A;  3G6E V;  1BGY H;  1KB9 F;  2YC0 A;  5C8Y A;  4X1Y A;  2CTQ A;  4K35 A;  3BVO A;  2ZDI C;  4R50 A;  3DTU B;  4AIL C;  3T2M A;  4B3T B;  3BAA A;  1NBM G;  2O57 A;  4DK1 A;  2M7W A;  1R3K C;  3E22 A;  3N2K B;  1AI7 A;  4AQY O;  2YXH A;  1R1B A;  3RGB A;  1AI6 A;  2QM7 A;  5KMG A;  4E2L A;  4LF4 B;  2HR3 A;  4TV8 A;  1PM9 A;  4U7N A;  4JI8 B;  2Q9L A;  2ZE5 A;  4HBN A;  4JV5 B;  1FFT B;  1ZSP A;  1IBK B;  1NI8 A;  1EM1 A;  1XHZ A;  2LO1 A;  1SQP H;  2QWR B;  1GK9 A;  5GTI Z;  3K5L A;  3CYO A;  1GN6 A;  2ILM A;  1V55 C;  2ZR2 A;  4JI2 O;  1JPX A;  5EIB C;  2AGA A;  3HKB B;  2EX3 A;  5KX5 A;  1VF6 A;  3RVZ A;  1H8H G;  1M5I A;  1K5Q A;  3ETQ A;  5B1A C;  1SES A;  1AR4 A;  5C8Y B;  4X1Y B;  1MA1 A;  2YIC A;  2BCC H;  2KSD A;  4JGS A;  2Q4P A;  4B3R O;  1Z2G A;  2GDS A;  3G71 V;  1I5Y A;  3E22 B;  3IGA C;  3RBZ A;  4QE7 A;  5JVD A;  5KMG B;  1SQX H;  4O2A A;  2AHY A;  2GTS A;  3T1Y B;  2IBZ H;  4PDL A;  4TV8 B;  5JH7 A;  1HR0 B;  4B3T O;  2EIL C;  5JJN B;  1YIJ V;  4MS2 A;  4FLW A;  1SQF A;  1F51 A;  1S72 V;  5JJE B;  4LF4 O;  3RN4 A;  1QBZ A;  4DV3 O;  1LNQ A;  2RN9 A;  3H1H H;  4GYC B;  4JI8 O;  1XMQ B;  3B8N A;  4RQF A;  2F43 G;  1AR5 A;  1JFF A;  3OAA G;  4JTC B;  5KX5 B;  2E5L O;  3OFN G;  3ZS8 C;  3VQV A;  4H0L B;  5EC2 C;  2GHY A;  3H1J H;  2L35 A;  4H44 B;  3ICX A;  1VMG A;  1N32 B;  3ZN1 A;  1FJG O;  1CEZ A;  4MT8 A;  2UXN A;  1YTF D;  3B4S A;  3JAL A;  3CE2 A;  3CCU V;  4FPP A;  1K8A W;  3JAM N;  5JVD B;  3A0B Z;  4O2A B;  2OCC B;  2ZDI A;  3TCU A;  5LMN B;  4MTF A;  4EB6 A;  2UU9 O;  1NQT A;  2AZ2 A;  1ENV A;  3E8H A;  4CH6 A;  5IYZ A;  2PI5 A;  2X6C A;  1QLE B;  2QKA A;  2H94 A;  3WB0 A;  1PL0 A;  1K97 A;  4IT5 A;  5BY1 A;  5B1B B;  5LHG A;  4TT3 G;  4LR3 A;  4RUF A;  1HR0 O;  3RFR A;  1H2N A;  4JPR A;  4Z2W A;  1JFF B;  3UCS C;  2YSU B;  2DWE C;  2QGN A;  4CS2 A;  3AK3 A;  4K0K B;  3B77 A;  2OWO A;  1FAF A;  3AG2 C;  5K1X A;  1ZLZ A;  3JD2 A;  1XMQ O;  2PTM A;  4DK0 A;  2QR4 A;  4WF9 V;  3JSN A;  4JI3 O;  5IE9 A;  1GAX A;  1D5A A;  1NR7 A;  3ASN C;  1W59 A;  2WLL A;  3JAL B;  1M56 B;  1KC8 W;  5CBG A;  2F1M A;  3SYP A;  5B5E Z;  2WAM A;  4KHP B;  2ZIN A;  3JYC A;  4EB6 B;  3ZHV A;  2PI4 A;  3OTO B;  3K0G A;  5IYZ B;  1NR1 A;  1S76 D;  2CDY A;  4CH4 A;  3ABL C;  3AK1 A;  1BS3 A;  3ZRS A;  1VP7 A;  1QR9 A;  2F95 B;  1VQK V;  4WFF A;  1M4U A;  5D5Q A;  5LMN O;  5CMU A;  1TGO A;  1NH2 D;  3E89 A;  3AG3 C;  3E8G A;  3KCY A;  1LUV A;  1COW G;  4ICG A;  2IU0 A;  2ZIO A;  4I0X A;  4LFB B;  4TV9 A;  2Q68 A;  1NKD A;  3AG4 C;  1S5H C;  4FJC C;  3RYH A;  3CC2 V;  2DMX A;  3D3I A;  2WLL B;  4K0K O;  2IW5 A;  1JR9 A;  5B1A B;  4KP4 A;  1KKD A;  2YI9 A;  4IGG A;  1E1Q G;  4NXN B;  3CRR A;  4RAI A;  5LGN A;  4P2Z A;  3HKD A;  3SJB C;  4MVM A;  4ZHQ A;  3ZX6 A;  1DTO A;  4EFE A;  4KHP O;  1XQ8 A;  4PA6 A;  5CA1 A;  4DV2 B;  3OTO O;  2DN9 A;  4B08 A;  3W7X A;  2GV9 A;  1MNG A;  5JJJ B;  4IYI A;  1OCZ C;  2BOC C;  2PF4 E;  3H1L H;  4X62 B;  2OCH A;  3FKS G;  4BIO A;  1US6 A;  4I0X B;  4TV9 B;  3IC9 A;  2LFS A;  3RYH B;  3OUF A;  2QKC A;  2H3O A;  3FYE B;  2EIN C;  4DV1 B;  5LA6 A;  4K8Z A;  4H37 A;  4JF3 A;  4U7O A;  4FLV A;  5BMV A;  3DGE A;  2ZNI A;  2XUM A;  4E4E A;  1XMO B;  1DK1 A;  3J81 N;  3UQ8 A;  4F6R A;  1L0L H;  5HFM A;  1G8M A;  3HKD B;  3K08 A;  3LSU A;  4J42 A;  3M8A A;  4ZHQ B;  3DC6 A;  5CA1 B; 
#chains in the Genus database with same CATH homology
 4DV5 O;  4NXN O;  3R66 A;  1N32 O;  2JRI A;  4OPH A;  4LF6 O;  2UUB O;  2FKX A;  4DR7 O;  4LFB O;  1A32 A;  4AQY O;  1FJG O;  1R1B A;  2DOS A;  5H5N A;  1IBL O;  2N74 A;  4LF5 O;  4A5U B;  1N34 O;  2ZM6 O;  4DV2 O;  3JAM N;  4GKK O;  4JV5 O;  5LL6 Y;  4JYA O;  2HHH O;  2VQF O;  4K0K O;  1IBK O;  4DV6 O;  4LF7 O;  1HNX O;  2UXB O;  1HNZ O;  2UU9 O;  2Z0A A;  4DR3 O;  1X59 A;  1I94 O;  1AB3 A;  3O65 A;  2UXC O;  2DJV A;  5FLX N;  4DUZ O;  5BXZ A;  4DR2 O;  1HNW O;  3J7A U;  1FYJ A;  1XNR O;  1IBM O;  4X66 O;  4JI7 O;  4DR5 O;  3SDL A;  4DR4 O;  5BY1 A;  4JI2 O;  4DV1 O;  1G1X B;  2AGA A;  5IWA O;  1HR0 O;  3J80 N;  2ZKO A;  4LF8 O;  1XEQ A;  4KHP O;  3OTO O;  4DR1 O;  1KUQ A;  4NXM O;  4DV7 O;  4OX9 O;  4DR6 O;  4JI6 O;  4X62 O;  1NS1 A;  1XMQ O;  1N36 O;  4LF9 O;  2LW7 A;  4JI3 O;  4B3R O;  4YY3 O;  1D2D A;  3T1Y O;  1YZB A;  2UUA O;  4DUY O;  1J5E O;  4YHH O;  4JI1 O;  3T1H O;  4DV4 O;  4B3T O;  3F5T A;  5BR8 O;  1F7Y A;  4OPA A;  5LMU O;  1XNQ O;  3RT3 C;  4X65 O;  2UXD O;  4GKJ O;  4B3S O;  4LF4 O;  1XMO O;  4X64 O;  4DV3 O;  5A2Q N;  1N33 O;  4B3M O;  4JI8 O;  4DV0 O;  2UUC O;  1DK1 A;  3J81 N;  4JI4 O;  5IT9 N;  5LMN O;  4JI0 O;  2F4V O;  2VQE O;  4LFA O;  4LFC O;  1R6T A;  2E5L O;  4JI5 O;  3M8A A;  1AIL A;  1FKA O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...