4A5XA

Structures of mitd1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
73
structure length
73
Chain Sequence
b'PQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCNLREKISKYMDRAENIKKYLDQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MIT DOMAIN-CONTAINING PROTEIN 1
publication title Escrt-III Binding Protein Mitd1 is Involved in Cytokinesis and Has an Unanticipated Pld Fold that Binds Membranes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 33
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4a5xA00
2CPTA 2LRLA 5CJ5A 4U2YA 2RPAA 4U2ZA 4ZEYA 2MPKA 2JQKA 4NIQA 2W2UA 3ZT5A 1YXRA 2V6XA 4A5XA 4IT4A 2V6YB 5LB7B 2CRBA 1WFDA 2WWVA 1WCRA 3ZSSA 2A9UA 3ZT7A 2JQHA 3K1SA 4CN6A 4U33A 1WR0A 2K3WA 5CGMA 2DL1A 5FVLA 4U7IA 5FVKA 4P1NA 4U31A 2JQ9A 3ZSTA 2V6YA 4U7YA 2XZEA 3ZT6A 4CN4A 4CN1A 3EABA 4U3CA 2LRKA 4WZXA 2WY2A
chains in the Genus database with same CATH superfamily
3RKGA 3ZMZB 2BG9A 4TX5A 3H37A 2A2FX 2W00A 3E0ZA 4EXTA 3RI5A 5FL1A 2JMKA 5L2LA 4PAGA 2V7IA 2BBHA 2VQET 4AQGA 2WZIA 4DV1T 4EEDA 5LGTB 2K24A 3MJXA 4ZI7E 3ONJA 4NIQA 2LHRA 4DMVA 3AECA 4MFRA 3ZT7A 3CX6B 3LK42 3OBVE 4KHZF 3ZYLA 5C3JA 4WNKA 4GKJT 5HEOA 2CLYC 4L5GA 4CI1B 2LOSA 3JAFA 5AQNB 5AQJB 3N2GE 2N2NA 3C4ZA 3T1HT 3UUXB 2LSKA 4Q25A 2X0HA 2ZM0A 2LSYA 2Q9QC 3NKZA 2G0UA 4MHCA 2BS2A 2XQ9A 3KV9A 5FYMA 3PUVF 5DJQC 1ZV4X 1HG2A 5JDFA 1IBLT 2IC6A 4H9OC 3QNUA 3VRBA 4YJ3E 4H9PC 2RA1A 2LHNA 4Z90A 2MAWA 3ZPOA 5JDQA 4DMWA 4DR4T 2BG9E 3I0OA 4DV7T 5FVLA 5KDMC 2E2AA 2LSGA 3ANWA 3HKBE 4N78D 5L3GB 2A3DA 5HYAA 4MALA 3R6NA 2VK9A 2PG8A 1W9RA 2CBJA 1LKXA 3F31A 1T72A 5DABA 2X9XA 4UVBB 1QSDA 4KUMB 4B3TT 3Q5DA 4LFCT 2W61A 1XWMA 4IDOA 2ODUA 5JDGA 5LJMA 5JRCB 4AISA 1L0VA 3AE8A 2LSIA 3LFMA 4P0BA 2FJBA 4UELA 1IBKT 1XZYA 3LBXA 3A8YC 1OWAA 5ABEA 5AQQB 3A5XA 3AVRA 4DV2T 4WZXA 3CQGB 5KXJA 4DR3T 2BKOA 3OVUA 4KBMB 4YFSA 3ZKRA 3AEAA 2H3RA 1IAPA 4U7IA 1MMAA 1D0XA 2RP4A 2BBJA 2MYSA 4ZHQE 4AKIA 2WY2A 1LVFA 3K8PC 1N33T 1D1CA 4TV9E 1XNRT 3RIUA 4EB6E 3AA0B 3UU3A 3C51A 3TLSA 4JYAT 4ZS3A 3NRYA 4IE0A 1HNWT 3RRWA 3LDQB 3NZPA 3AEGA 4ERRA 2UUBT 2XZEA 3CQXC 5AQMB 2XAFB 3UUNA 3P4SA 2IW5B 1I94T 4JUYA 2FJAA 3ZJ1A 4UF0B 3WAJA 1N34T 5LG4A 2YINA 5CGMA 1J1JA 2B1EA 4WBOA 1O3XA 2KWIB 4E7ZA 2PTFA 2W0GA 3AA6B 3FZKB 4M1PA 5LCYA 4HFBA 2J62A 5JDHA 5TAOA 2YK0A 4QH5A 5LMNT 3SFDA 2NW9A 1IZNB 2H7OA 4CXYA 5H6RB 4DR7T 1KF6A 3KINB 4X65T 2X9HA 4GYRA 5IWAT 2LOPA 5HEUA 2WSSV 2QA7A 3JC6C 3B13A 4U2ZA 2F4VT 2QYWA 1N32T 3OYZA 1ZP0A 4ZOLE 2Y48B 4QX8B 4QH1A 3GMIA 2FJEA 3N2OA 4WW0A 2W62A 1FIOA 3AAAB 3FZFB 3KBTA 5LP6E 4DR6T 4LF4T 3NBXX 4UIGA 5FMNA 3BQLA 5CJ5A 3O4XE 4I0UA 5HWYA 2XAHB 1UCUA 5ADXL 5L3DB 2BS4A 5AQSB 2VL0A 4H63V 4HWDA 4H9SE 4B3RT 2K3WA 2XTLA 4AKLA 2J1DG 3RPUA 4I55E 2Z6EA 2A72A 2CPTA 4ILUA 2XPKA 2VASA 3C64A 3I1AA 3RH3A 4AKHA 1OEDB 3LK2B 1M7KA 1M62A 4HWFA 2ZM6T 2V8SV 2YU1A 3D0TA 2L8KA 2NP9A 3OJAA 1E7PA 2KXPB 4IREA 5L4EA 4HWCA 4ZS2A 4IT4A 5IHYA 2FUPA 3EHZA 2EHOB 4LFBT 4OX9T 2XSBA 2IIUA 1IJ5A 2PBIA 4IL4A 2WZHA 1GQEA 1N36T 3P4PA 1XMQT 4IE5A 1UX5A 4L0RA 2V26A 5F8PA 2CBIA 1WLXA 2UXXB 2CXFA 1HTJF 3IA3A 2LEHA 3AEBA 1ZKEA 5AQLB 3TLWA 1BR1A 3OPCA 5HCJA 2B76A 4ZEYA 2VVNA 3QC9A 3ZMUB 3KV4A 4DR1T 1MMGA 2WCAA 3O1JA 4DV6T 5FXWA 4KI0F 2YEVC 2X9WA 4HWIB 1HNZT 4JI7T 2CEAA 3GA8A 2BKNA 4JI0T 4QX7B 3VR9A 2XQ8A 4P0AA 3AAIA 4HFIA 2M6BA 3SOLA 4AKRB 2CM0A 3MACA 2CHNA 4OFZA 3JADA 1IBMT 3ZMVB 5HXHA 1D1AA 1YQ3A 2X9YA 3BK9A 1U4QA 1WR0A 1OEDC 1D0YA 4X66T 3TLUA 3NVOA 1OXZA 3DJBA 1UX4A 5CA1E 4X64T 3CX7B 3N9NA 1MIYA 4O4JE 1E2AA 5C8YE 2UXCT 3UT5E 2EHOC 3QOFA 1D0ZA 5HXCA 2XQ4A 2V7KA 4MBQA 3H3AA 5HEGA 2ODVA 3AAEB 3AXJA 1QLBA 2WAUA 5FXZA 4IDNA 5JDMA 1XNQT 4EIWA 3UULA 4KHPT 4A98A 1U5PA 1E1HB 2WM9A 4YJ2E 2NTXA 3RYCE 4OYJA 1Z0PA 4JI1T 3M3ZB 2CE7A 5BR8T 3AE2A 2MBGA 4X1IE 2YKSA 2XAJB 3K3QC 4UV8B 4YHJA 2H89A 2V6XA 5LJNA 5LBMA 3ZYKA 4ZI2C 2VKOA 2V5CA 3NZQA 4K0UA 4U33A 1Y64B 3ZCIA 3CQCB 4ZI2D 5E0OA 2D9DA 4QH4A 2VWAA 5KX5E 2BS3A 3OTOT 2LRKA 3ETVA 2YDSA 4TWDA 5AQTB 2I0MA 5J2TE 4YTPA 2HHHT 2V1DB 4PJJA 4CI2B 2JQHA 2LKGA 5AQIB 2BG9C 2CWOA 3MKDA 5L3EB 3V5UA 1ZHCA 1QUUA 3CVRA 4CZZB 4TUYE 3RX6A 4PK5A 1MIVA 2MOZA 3VU7H 1T7SA 3RYFE 2Q9QD 4KX6A 4JEUB 3RIFA 3ZMTB 1KNPA 4AIUA 2M6IA 4CXXA 5ABFA 4O8SA 2WDRA 5HXEA 3JAEA 5M4YA 3ZSSA 2CWYA 3NRXA 2BKPA 4GYSA 4ZI3C 5L3BB 4U7YA 2D0UA 2DWKA 5FY7A 1YW0A 4DBRA 2ZLYA 3DP7A 4AQFC 3J9X1 1Z8UA 4X1KE 5KMGP 4DV4T 4GIWA 4DUYT 1SUMB 2D2SA 1MNDA 3L09A 2W4XA 1W0BA 2C0SA 4JI4T 2CMRA 2JRKA 1HX8A 4U3CA 2LSJA 4E7SA 3L8RA 1HG5A 1KK7A 5FXVA 4PFPA 5LXTE 1SHZC 4P09A 3ZC1A 4BJMA 4WBNE 3PUWF 4QXCB 4MLKA 2WDVA 2V6YB 3FZLB 1HX1B 1UGOA 1BR4A 2UUAT 5HXRA 2NW8A 2J4GA 4A97A 3CWZB 4HFVA 3Q5WA 3ZLIA 3UQ4A 4FI5A 4Z91A 3DTOA 3P4RA 4OHFA 3CMLA 3PUZF 2W2UA 1MMNA 3KDSE 1B7TA 5AQFB 5LHIB 1WR6A 4F6RC 3TLVA 3PUYF 2AE9A 2E8IA 4JLEA 1VCTA 3AVSA 1XDOA 2L3LA 4B6XA 4IDPA 5FNVE 5ABGA 4JI8T 3LJCA 4U74A 1EZ3A 2E9XB 3ZEFB 4YTMA 1US7B 4CQIA 4BJNA 2ZMAA 5JRCA 2X51A 5JDNA 4YSZA 2NWBA 4QXBB 3AE1A 3PTRB 2LJLA 3HKEE 4XBFB 4ANJA 2XUEA 3C50A 2WWUA 4JI2T 3UTKA 3C4WA 2HN2A 2IMLA 2P9BA 3IF8B 4EEBA 3RIAA 3EDVA 3PV0F 1FMWA 2BVLA 2L9QA 2QVAA 3IBPA 2NR4A 3RQUA 4TNWA 3GN5B 3JC6D 2I59A 2IAKA 5LBQB 4KMCA 1HCIA 5LA6E 2J47A 3VR8A 3PUGA 4U72A 4ILBA 4ZZBA 5JDLA 4TWFA 2X67A 3IHRA 2KZ7B 4IGUA 3ZYMA 2IDOB 1XMOT 3QB5K 2Y8DA 2XY8B 2QRXA 1V9DA 4G63A 4TV8E 4EZ4A 3N9QA 1JNZA 3FB2A 5JTGA 4UF0A 4ZZCA 2WMNA 2PJQA 4IE7A 3LG7A 2IC9A 2CA5A 4QXHB 3Q9DA 2W66A 2XQ3A 3CK6A 4H63H 2WS3A 5IYZE 3CPZA 3O1HA 2XAQB 5LYJE 1HR0T 2UU9T 2DWGA 4PJNA 2ACZA 5CB4E 5LOVE 5LGNB 2LM2A 4UVCB 5BMVE 2NOXA 1T98A 5HCMA 2XQ7A 2HPLA 2E9XC 3MZKB 4LF6T 4HGAA 3F2EA 3HKCE 4XZCA 5ETWA 2H88A 3RC8A 2UXBT 2DI4A 3MA9A 2YU2A 4J2CA 4TN7B 1FEWA 2VVSA 3PUAA 3A7MA 3PUQA 3KFWX 2KNDA 2D5UA 5HXSA 4HTEA 2QGSA 5CFBA 2RPAA 1X79A 2IUBA 3N9OA 3VRAA 1YKHB 2JQKA 5JR9A 3FZMB 2JJ9A 4HE8A 2LM9A 4QHOA 3OKQA 3PUXF 4YHHT 3FBLA 4XAXB 5J0ZA 5DQWA 4JEHB 4X1YE 2LRLA 2VKDA 3K3OA 4F8HA 4PJMA 4O4IE 2UUCT 3U3IA 5LHGB 5J1GA 2W67A 4HN9A 2VKJA 3I9WA 4NUUA 2NTYA 3ZC0A 3HI2A 3RGLA 2WB5A 5AFUL 3PURA 4IIJE 3CX8B 1WRDA 1VOMA 4PFOA 1WCRA 1J5ET 2KMFA 4DNDA 4UV9B 2BG9B 3L39A 5AQUB 5F3JA 3ZT5A 5AQHB 1IJ6A 2XAGB 4EYUA 3Q5EA 2VQFT 3O1IA 5H6QB 5AQKB 4V1Av 4X5TA 2XM2A 4IL9A 4YSYA 4H9NC 3UUBA 4ILCA 1AJ3A 2EHOD 4OYKA 5JQGE 1BR2A 2X0LB 1G73A 2OA5A 4LF7T 4ILAA 1FMVA 4I50E 3QUJA 2V7JA 3S4UA 3E22E 2DNXA 4LMLA 5IUXA 2LLYA 3AE9A 4UR9A 3O9XA 2DLRA 1OEDE 2R6GF 3F57A 4CN6A 5CA0E 4TZ4C 3Q2MA 2GK9A 3ZN0B 1Y01A 3QB5A 1XDPA 5AQGB 3HA4A 2WMOA 4G2AA 4H9QC 4GKKT 5AQPB 2CRBA 3BQIA 5ABFB 3VHLA 1WYCA 4Z8XA 5EK4A 4C90A 2Q9QA 3M65A 4DR5T 2OLTA 3VKGA 3W15B 1ZEEA 5L3CB 2W63A 4EZHA 5EK2A 1DU2A 4HFEA 3KV6A 3ANWB 3CKDA 2OV9A 2WDQA 3K3NA 5FP3A 2DL1A 1G8XA 2V5DA 5JREA 3U78A 5L47A 2XJ7A 5ABHA 5DQVA 3AE4A 1KFYA 4PNIA 4EGWA 3E08A 2KSRA 1LRZA 5FXXA 1JNRA 3RLFF 3KVBA 4AQFA 2FBWA 5A1LA 3KV5A 2ES0A 2FJDA 1UUSA 1CHUA 3LBXB 2YN6A 5F5WA 4X62T 2X68A 3R84B 2CXLA 2VL8A 4BA9A 4YY3T 1UK5A 3IEEA 1D1BA 3K1SA 3P50A 4C91A 3P4WA 3T8OA 1ZOYA 4DVDA 2XQYA 3SS1A 2WU2A 4AKGA 2DHRA 5JH7E 4AXPA 4ZI3D 2C5JA 1NEKA 2E5VA 4HFCA 4DV0T 3UU5A 3I9YA 4CI3B 4AI6A 2V7MA 1H7CA 3UU4A 4JBWF 2UXNB 2KLQA 2JQQA 3MK7C 2WBLA 2IHR1 3UFGA 1KNZA 1YD8G 3AA1B 3G06A 2X0YA 1BR0A 4O4LE 3N5LA 4WYVA 3EAMA 4ZXLA 4DR2T 3ZCJA 3PJAJ 3T1YT 3LK3B 4NUVA 1T8BA 3Q5XA 5FVKA 3KBUA 2H7VC 3EVYA 4IDQA 3HR0A 1J5WA 4YLHA 3FBZA 4PJLA 4LMKA 4A56A 3RC3A 3AEEA 1YKEB 1MNEA 4IE4A 3AE7A 2XSAA 3HL6A 3J7Yq 4ASKA 4P1NA 2WP9A 2I6HA 2KT9A 4YT0A 2M67A 1W09A 3PUSA 2K5BB 2VB6A 3C4XA 1S35A 5LB7B 2WU5A 5LG3A 3RYHE 5FY0A 4EV6A 5HWXA 1VRBA 3RKOA 4YTNA 3P8CD 1MIWA 5J2UE 5AQVB 2VURA 2AXDS 3TKLB 2DCFA 2K9AA 2XQAA 4I43B 3GWHA 1X9BA 1LVKA 3PU8A 3V5SA 3C98B 4NXNT 3N9MA 2KINB 4HWHA 3TLTA 3CIRA 3HKDE 3FZHB 4GK0E 3ZT6A 3ABVA 3EABA 2WQYA 4ADZA 3N2KE 3L3PA 3UU6A 3ETUA 2MTQA 4AQYT 3ESLA 1KEYA 3ONXA 5HAXA 1S94A 4ISSA 4EYYR 5L4HA 2XHEB 2V6YA 3RIUC 1W0AA 3FXEB 3PE0A 4DO0A 4UEMA 4YSXA 5EK3A 1HNXT 3ZN1B 2BDEA 2A9UA 4O2BE 4LF9T 4BAYB 3AA7B 4IE6A 2LE8A 4CN1A 4JI3T 4B3MT 1MMDA 4QWNB 2XQ6A 2HH7A 3B5MA 3WAKA 3AB3B 3PDYA 2WWVA 4GOUA 3FHNA 3UUMA 1I6ZA 1HS7A 4TNVA 4DV3T 2E9XA 4NXMT 4L9IA 4TWHA 5FY1A 4LF8T 1SE7A 4HKAA 2BVMA 5LGUB 3OYXA 1NAFA 4FJOA 5JR9B 4B3ST 2ACXA 3P4QA 2JQ9A 4CN4A 4LF5T 2LKHA 5EZYE 5LMUT 4UVAB 4LMJA 2SPCA 4JI5T 5LNKA 4JV5T 3AEFA 5FL0A 2JIWA 2KWHA 3GN5A 2N1GA 3BQKA 3P7IA 2E9XD 3AE3A 3MXZA 1HFAA 4PW8A 1VCSA 4O4HE 2BZBA 4DBQA 3EDUA 1YQ4A 4HEAA 2NW7A 4DIDB 3SFEA 3SRZA 3PJAA 3RHWA 4H9RC 3PU3A 4O2AE 5GONE 3AE5A 3WI3A 2YDQA 3VKHA 3RF1A 2CHOA 4JI6T 4X20E 2JPFA 4U31A 2V7LA 2PFVA 2CXDA 4UXNB 1OEDA 5C2TA 3H3MA 3UQ7A 1FJGT 3ONLC 4GK5E 2D0TA 2K48A 2E5LT 1WFDA 4NPPA 2UXDT 2HN1A 3AE6A 2XASB 3AXJB 3RRCA 3UU8A 4DV5T 2EHOA 1NWMX 1CUNA 2HPJA 1SA0E 3NWIA 3RQWA 4CXWA 2LT3A 3N9LA 3UFEA 5AQOB 5HEJA 2YDRA 5JR9C 1KNRA 2CLYB 4LFAT 4I4TE 2MPKA 4A5XA 4YXDA 2VKHA 4K0KT 1WYBA 2ZM2A 4DUZT 3ZMSB 3I0QA 2C5KT 1NENA 1HF8A 2C5IT 4PK4A 4EAHA 3RYIE 4HFDA 4IHJE 2Q9QB 2X66A 5HEHA 5FKYA 3SWHA 2CCQA 2ZM8A 3JCFA 3B57A 3N9PA 4PK6A 2YOEA 5JVDE 3EI0A 5L3FB 3ZSTA 4QKNA 3ZJ2A 1R8IA 5LHHB 4U2YA 4COFA 3KVAA 4KP3C 2JMHA 4ISTA 2XQ5A 3EUHA 1YXRA 2XM1A 2N9DA 3QK6A 3FXDB 3AEDA 4OK0A 4IDZA 3X1DA 1UURA 5AQRB 4EOZB 4HFHA 2Y6XA 3LSVA
chains in the Genus database with same CATH topology
2CPTA 2LRLA 5CJ5A 4U2YA 2RPAA 4U2ZA 4ZEYA 2MPKA 2JQKA 4NIQA 2W2UA 3ZT5A 1YXRA 2V6XA 4A5XA 4IT4A 2V6YB 5LB7B 2CRBA 1WFDA 2WWVA 1WCRA 3ZSSA 2A9UA 3ZT7A 2JQHA 3K1SA 4CN6A 4U33A 1WR0A 2K3WA 5CGMA 2DL1A 5FVLA 4U7IA 5FVKA 4P1NA 4U31A 2JQ9A 3ZSTA 2V6YA 4U7YA 2XZEA 3ZT6A 4CN4A 4CN1A 3EABA 4U3CA 2LRKA 4WZXA 2WY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CPT A;  2LRL A;  5CJ5 A;  4U2Y A;  2RPA A;  4U2Z A;  4ZEY A;  2MPK A;  2JQK A;  4NIQ A;  2W2U A;  3ZT5 A;  1YXR A;  2V6X A;  4A5X A;  4IT4 A;  2V6Y B;  5LB7 B;  2CRB A;  1WFD A;  2WWV A;  1WCR A;  3ZSS A;  2A9U A;  3ZT7 A;  2JQH A;  3K1S A;  4CN6 A;  4U33 A;  1WR0 A;  2K3W A;  5CGM A;  2DL1 A;  5FVL A;  4U7I A;  5FVK A;  4P1N A;  4U31 A;  2JQ9 A;  3ZST A;  2V6Y A;  4U7Y A;  2XZE A;  3ZT6 A;  4CN4 A;  4CN1 A;  3EAB A;  4U3C A;  2LRK A;  4WZX A;  2WY2 A; 
#chains in the Genus database with same CATH topology
 3RKG A;  3ZMZ B;  2BG9 A;  4TX5 A;  3H37 A;  2A2F X;  2W00 A;  3E0Z A;  4EXT A;  3RI5 A;  5FL1 A;  2JMK A;  5L2L A;  4PAG A;  2V7I A;  2BBH A;  2VQE T;  4AQG A;  2WZI A;  4DV1 T;  4EED A;  5LGT B;  2K24 A;  3MJX A;  4ZI7 E;  3ONJ A;  4NIQ A;  2LHR A;  4DMV A;  3AEC A;  4MFR A;  3ZT7 A;  3CX6 B;  3LK4 2;  3OBV E;  4KHZ F;  3ZYL A;  5C3J A;  4WNK A;  4GKJ T;  5HEO A;  2CLY C;  4L5G A;  4CI1 B;  2LOS A;  3JAF A;  5AQN B;  5AQJ B;  3N2G E;  2N2N A;  3C4Z A;  3T1H T;  3UUX B;  2LSK A;  4Q25 A;  2X0H A;  2ZM0 A;  2LSY A;  2Q9Q C;  3NKZ A;  2G0U A;  4MHC A;  2BS2 A;  2XQ9 A;  3KV9 A;  5FYM A;  3PUV F;  5DJQ C;  1ZV4 X;  1HG2 A;  5JDF A;  1IBL T;  2IC6 A;  4H9O C;  3QNU A;  3VRB A;  4YJ3 E;  4H9P C;  2RA1 A;  2LHN A;  4Z90 A;  2MAW A;  3ZPO A;  5JDQ A;  4DMW A;  4DR4 T;  2BG9 E;  3I0O A;  4DV7 T;  5FVL A;  5KDM C;  2E2A A;  2LSG A;  3ANW A;  3HKB E;  4N78 D;  5L3G B;  2A3D A;  5HYA A;  4MAL A;  3R6N A;  2VK9 A;  2PG8 A;  1W9R A;  2CBJ A;  1LKX A;  3F31 A;  1T72 A;  5DAB A;  2X9X A;  4UVB B;  1QSD A;  4KUM B;  4B3T T;  3Q5D A;  4LFC T;  2W61 A;  1XWM A;  4IDO A;  2ODU A;  5JDG A;  5LJM A;  5JRC B;  4AIS A;  1L0V A;  3AE8 A;  2LSI A;  3LFM A;  4P0B A;  2FJB A;  4UEL A;  1IBK T;  1XZY A;  3LBX A;  3A8Y C;  1OWA A;  5ABE A;  5AQQ B;  3A5X A;  3AVR A;  4DV2 T;  4WZX A;  3CQG B;  5KXJ A;  4DR3 T;  2BKO A;  3OVU A;  4KBM B;  4YFS A;  3ZKR A;  3AEA A;  2H3R A;  1IAP A;  4U7I A;  1MMA A;  1D0X A;  2RP4 A;  2BBJ A;  2MYS A;  4ZHQ E;  4AKI A;  2WY2 A;  1LVF A;  3K8P C;  1N33 T;  1D1C A;  4TV9 E;  1XNR T;  3RIU A;  4EB6 E;  3AA0 B;  3UU3 A;  3C51 A;  3TLS A;  4JYA T;  4ZS3 A;  3NRY A;  4IE0 A;  1HNW T;  3RRW A;  3LDQ B;  3NZP A;  3AEG A;  4ERR A;  2UUB T;  2XZE A;  3CQX C;  5AQM B;  2XAF B;  3UUN A;  3P4S A;  2IW5 B;  1I94 T;  4JUY A;  2FJA A;  3ZJ1 A;  4UF0 B;  3WAJ A;  1N34 T;  5LG4 A;  2YIN A;  5CGM A;  1J1J A;  2B1E A;  4WBO A;  1O3X A;  2KWI B;  4E7Z A;  2PTF A;  2W0G A;  3AA6 B;  3FZK B;  4M1P A;  5LCY A;  4HFB A;  2J62 A;  5JDH A;  5TAO A;  2YK0 A;  4QH5 A;  5LMN T;  3SFD A;  2NW9 A;  1IZN B;  2H7O A;  4CXY A;  5H6R B;  4DR7 T;  1KF6 A;  3KIN B;  4X65 T;  2X9H A;  4GYR A;  5IWA T;  2LOP A;  5HEU A;  2WSS V;  2QA7 A;  3JC6 C;  3B13 A;  4U2Z A;  2F4V T;  2QYW A;  1N32 T;  3OYZ A;  1ZP0 A;  4ZOL E;  2Y48 B;  4QX8 B;  4QH1 A;  3GMI A;  2FJE A;  3N2O A;  4WW0 A;  2W62 A;  1FIO A;  3AAA B;  3FZF B;  3KBT A;  5LP6 E;  4DR6 T;  4LF4 T;  3NBX X;  4UIG A;  5FMN A;  3BQL A;  5CJ5 A;  3O4X E;  4I0U A;  5HWY A;  2XAH B;  1UCU A;  5ADX L;  5L3D B;  2BS4 A;  5AQS B;  2VL0 A;  4H63 V;  4HWD A;  4H9S E;  4B3R T;  2K3W A;  2XTL A;  4AKL A;  2J1D G;  3RPU A;  4I55 E;  2Z6E A;  2A72 A;  2CPT A;  4ILU A;  2XPK A;  2VAS A;  3C64 A;  3I1A A;  3RH3 A;  4AKH A;  1OED B;  3LK2 B;  1M7K A;  1M62 A;  4HWF A;  2ZM6 T;  2V8S V;  2YU1 A;  3D0T A;  2L8K A;  2NP9 A;  3OJA A;  1E7P A;  2KXP B;  4IRE A;  5L4E A;  4HWC A;  4ZS2 A;  4IT4 A;  5IHY A;  2FUP A;  3EHZ A;  2EHO B;  4LFB T;  4OX9 T;  2XSB A;  2IIU A;  1IJ5 A;  2PBI A;  4IL4 A;  2WZH A;  1GQE A;  1N36 T;  3P4P A;  1XMQ T;  4IE5 A;  1UX5 A;  4L0R A;  2V26 A;  5F8P A;  2CBI A;  1WLX A;  2UXX B;  2CXF A;  1HTJ F;  3IA3 A;  2LEH A;  3AEB A;  1ZKE A;  5AQL B;  3TLW A;  1BR1 A;  3OPC A;  5HCJ A;  2B76 A;  4ZEY A;  2VVN A;  3QC9 A;  3ZMU B;  3KV4 A;  4DR1 T;  1MMG A;  2WCA A;  3O1J A;  4DV6 T;  5FXW A;  4KI0 F;  2YEV C;  2X9W A;  4HWI B;  1HNZ T;  4JI7 T;  2CEA A;  3GA8 A;  2BKN A;  4JI0 T;  4QX7 B;  3VR9 A;  2XQ8 A;  4P0A A;  3AAI A;  4HFI A;  2M6B A;  3SOL A;  4AKR B;  2CM0 A;  3MAC A;  2CHN A;  4OFZ A;  3JAD A;  1IBM T;  3ZMV B;  5HXH A;  1D1A A;  1YQ3 A;  2X9Y A;  3BK9 A;  1U4Q A;  1WR0 A;  1OED C;  1D0Y A;  4X66 T;  3TLU A;  3NVO A;  1OXZ A;  3DJB A;  1UX4 A;  5CA1 E;  4X64 T;  3CX7 B;  3N9N A;  1MIY A;  4O4J E;  1E2A A;  5C8Y E;  2UXC T;  3UT5 E;  2EHO C;  3QOF A;  1D0Z A;  5HXC A;  2XQ4 A;  2V7K A;  4MBQ A;  3H3A A;  5HEG A;  2ODV A;  3AAE B;  3AXJ A;  1QLB A;  2WAU A;  5FXZ A;  4IDN A;  5JDM A;  1XNQ T;  4EIW A;  3UUL A;  4KHP T;  4A98 A;  1U5P A;  1E1H B;  2WM9 A;  4YJ2 E;  2NTX A;  3RYC E;  4OYJ A;  1Z0P A;  4JI1 T;  3M3Z B;  2CE7 A;  5BR8 T;  3AE2 A;  2MBG A;  4X1I E;  2YKS A;  2XAJ B;  3K3Q C;  4UV8 B;  4YHJ A;  2H89 A;  2V6X A;  5LJN A;  5LBM A;  3ZYK A;  4ZI2 C;  2VKO A;  2V5C A;  3NZQ A;  4K0U A;  4U33 A;  1Y64 B;  3ZCI A;  3CQC B;  4ZI2 D;  5E0O A;  2D9D A;  4QH4 A;  2VWA A;  5KX5 E;  2BS3 A;  3OTO T;  2LRK A;  3ETV A;  2YDS A;  4TWD A;  5AQT B;  2I0M A;  5J2T E;  4YTP A;  2HHH T;  2V1D B;  4PJJ A;  4CI2 B;  2JQH A;  2LKG A;  5AQI B;  2BG9 C;  2CWO A;  3MKD A;  5L3E B;  3V5U A;  1ZHC A;  1QUU A;  3CVR A;  4CZZ B;  4TUY E;  3RX6 A;  4PK5 A;  1MIV A;  2MOZ A;  3VU7 H;  1T7S A;  3RYF E;  2Q9Q D;  4KX6 A;  4JEU B;  3RIF A;  3ZMT B;  1KNP A;  4AIU A;  2M6I A;  4CXX A;  5ABF A;  4O8S A;  2WDR A;  5HXE A;  3JAE A;  5M4Y A;  3ZSS A;  2CWY A;  3NRX A;  2BKP A;  4GYS A;  4ZI3 C;  5L3B B;  4U7Y A;  2D0U A;  2DWK A;  5FY7 A;  1YW0 A;  4DBR A;  2ZLY A;  3DP7 A;  4AQF C;  3J9X 1;  1Z8U A;  4X1K E;  5KMG P;  4DV4 T;  4GIW A;  4DUY T;  1SUM B;  2D2S A;  1MND A;  3L09 A;  2W4X A;  1W0B A;  2C0S A;  4JI4 T;  2CMR A;  2JRK A;  1HX8 A;  4U3C A;  2LSJ A;  4E7S A;  3L8R A;  1HG5 A;  1KK7 A;  5FXV A;  4PFP A;  5LXT E;  1SHZ C;  4P09 A;  3ZC1 A;  4BJM A;  4WBN E;  3PUW F;  4QXC B;  4MLK A;  2WDV A;  2V6Y B;  3FZL B;  1HX1 B;  1UGO A;  1BR4 A;  2UUA T;  5HXR A;  2NW8 A;  2J4G A;  4A97 A;  3CWZ B;  4HFV A;  3Q5W A;  3ZLI A;  3UQ4 A;  4FI5 A;  4Z91 A;  3DTO A;  3P4R A;  4OHF A;  3CML A;  3PUZ F;  2W2U A;  1MMN A;  3KDS E;  1B7T A;  5AQF B;  5LHI B;  1WR6 A;  4F6R C;  3TLV A;  3PUY F;  2AE9 A;  2E8I A;  4JLE A;  1VCT A;  3AVS A;  1XDO A;  2L3L A;  4B6X A;  4IDP A;  5FNV E;  5ABG A;  4JI8 T;  3LJC A;  4U74 A;  1EZ3 A;  2E9X B;  3ZEF B;  4YTM A;  1US7 B;  4CQI A;  4BJN A;  2ZMA A;  5JRC A;  2X51 A;  5JDN A;  4YSZ A;  2NWB A;  4QXB B;  3AE1 A;  3PTR B;  2LJL A;  3HKE E;  4XBF B;  4ANJ A;  2XUE A;  3C50 A;  2WWU A;  4JI2 T;  3UTK A;  3C4W A;  2HN2 A;  2IML A;  2P9B A;  3IF8 B;  4EEB A;  3RIA A;  3EDV A;  3PV0 F;  1FMW A;  2BVL A;  2L9Q A;  2QVA A;  3IBP A;  2NR4 A;  3RQU A;  4TNW A;  3GN5 B;  3JC6 D;  2I59 A;  2IAK A;  5LBQ B;  4KMC A;  1HCI A;  5LA6 E;  2J47 A;  3VR8 A;  3PUG A;  4U72 A;  4ILB A;  4ZZB A;  5JDL A;  4TWF A;  2X67 A;  3IHR A;  2KZ7 B;  4IGU A;  3ZYM A;  2IDO B;  1XMO T;  3QB5 K;  2Y8D A;  2XY8 B;  2QRX A;  1V9D A;  4G63 A;  4TV8 E;  4EZ4 A;  3N9Q A;  1JNZ A;  3FB2 A;  5JTG A;  4UF0 A;  4ZZC A;  2WMN A;  2PJQ A;  4IE7 A;  3LG7 A;  2IC9 A;  2CA5 A;  4QXH B;  3Q9D A;  2W66 A;  2XQ3 A;  3CK6 A;  4H63 H;  2WS3 A;  5IYZ E;  3CPZ A;  3O1H A;  2XAQ B;  5LYJ E;  1HR0 T;  2UU9 T;  2DWG A;  4PJN A;  2ACZ A;  5CB4 E;  5LOV E;  5LGN B;  2LM2 A;  4UVC B;  5BMV E;  2NOX A;  1T98 A;  5HCM A;  2XQ7 A;  2HPL A;  2E9X C;  3MZK B;  4LF6 T;  4HGA A;  3F2E A;  3HKC E;  4XZC A;  5ETW A;  2H88 A;  3RC8 A;  2UXB T;  2DI4 A;  3MA9 A;  2YU2 A;  4J2C A;  4TN7 B;  1FEW A;  2VVS A;  3PUA A;  3A7M A;  3PUQ A;  3KFW X;  2KND A;  2D5U A;  5HXS A;  4HTE A;  2QGS A;  5CFB A;  2RPA A;  1X79 A;  2IUB A;  3N9O A;  3VRA A;  1YKH B;  2JQK A;  5JR9 A;  3FZM B;  2JJ9 A;  4HE8 A;  2LM9 A;  4QHO A;  3OKQ A;  3PUX F;  4YHH T;  3FBL A;  4XAX B;  5J0Z A;  5DQW A;  4JEH B;  4X1Y E;  2LRL A;  2VKD A;  3K3O A;  4F8H A;  4PJM A;  4O4I E;  2UUC T;  3U3I A;  5LHG B;  5J1G A;  2W67 A;  4HN9 A;  2VKJ A;  3I9W A;  4NUU A;  2NTY A;  3ZC0 A;  3HI2 A;  3RGL A;  2WB5 A;  5AFU L;  3PUR A;  4IIJ E;  3CX8 B;  1WRD A;  1VOM A;  4PFO A;  1WCR A;  1J5E T;  2KMF A;  4DND A;  4UV9 B;  2BG9 B;  3L39 A;  5AQU B;  5F3J A;  3ZT5 A;  5AQH B;  1IJ6 A;  2XAG B;  4EYU A;  3Q5E A;  2VQF T;  3O1I A;  5H6Q B;  5AQK B;  4V1A v;  4X5T A;  2XM2 A;  4IL9 A;  4YSY A;  4H9N C;  3UUB A;  4ILC A;  1AJ3 A;  2EHO D;  4OYK A;  5JQG E;  1BR2 A;  2X0L B;  1G73 A;  2OA5 A;  4LF7 T;  4ILA A;  1FMV A;  4I50 E;  3QUJ A;  2V7J A;  3S4U A;  3E22 E;  2DNX A;  4LML A;  5IUX A;  2LLY A;  3AE9 A;  4UR9 A;  3O9X A;  2DLR A;  1OED E;  2R6G F;  3F57 A;  4CN6 A;  5CA0 E;  4TZ4 C;  3Q2M A;  2GK9 A;  3ZN0 B;  1Y01 A;  3QB5 A;  1XDP A;  5AQG B;  3HA4 A;  2WMO A;  4G2A A;  4H9Q C;  4GKK T;  5AQP B;  2CRB A;  3BQI A;  5ABF B;  3VHL A;  1WYC A;  4Z8X A;  5EK4 A;  4C90 A;  2Q9Q A;  3M65 A;  4DR5 T;  2OLT A;  3VKG A;  3W15 B;  1ZEE A;  5L3C B;  2W63 A;  4EZH A;  5EK2 A;  1DU2 A;  4HFE A;  3KV6 A;  3ANW B;  3CKD A;  2OV9 A;  2WDQ A;  3K3N A;  5FP3 A;  2DL1 A;  1G8X A;  2V5D A;  5JRE A;  3U78 A;  5L47 A;  2XJ7 A;  5ABH A;  5DQV A;  3AE4 A;  1KFY A;  4PNI A;  4EGW A;  3E08 A;  2KSR A;  1LRZ A;  5FXX A;  1JNR A;  3RLF F;  3KVB A;  4AQF A;  2FBW A;  5A1L A;  3KV5 A;  2ES0 A;  2FJD A;  1UUS A;  1CHU A;  3LBX B;  2YN6 A;  5F5W A;  4X62 T;  2X68 A;  3R84 B;  2CXL A;  2VL8 A;  4BA9 A;  4YY3 T;  1UK5 A;  3IEE A;  1D1B A;  3K1S A;  3P50 A;  4C91 A;  3P4W A;  3T8O A;  1ZOY A;  4DVD A;  2XQY A;  3SS1 A;  2WU2 A;  4AKG A;  2DHR A;  5JH7 E;  4AXP A;  4ZI3 D;  2C5J A;  1NEK A;  2E5V A;  4HFC A;  4DV0 T;  3UU5 A;  3I9Y A;  4CI3 B;  4AI6 A;  2V7M A;  1H7C A;  3UU4 A;  4JBW F;  2UXN B;  2KLQ A;  2JQQ A;  3MK7 C;  2WBL A;  2IHR 1;  3UFG A;  1KNZ A;  1YD8 G;  3AA1 B;  3G06 A;  2X0Y A;  1BR0 A;  4O4L E;  3N5L A;  4WYV A;  3EAM A;  4ZXL A;  4DR2 T;  3ZCJ A;  3PJA J;  3T1Y T;  3LK3 B;  4NUV A;  1T8B A;  3Q5X A;  5FVK A;  3KBU A;  2H7V C;  3EVY A;  4IDQ A;  3HR0 A;  1J5W A;  4YLH A;  3FBZ A;  4PJL A;  4LMK A;  4A56 A;  3RC3 A;  3AEE A;  1YKE B;  1MNE A;  4IE4 A;  3AE7 A;  2XSA A;  3HL6 A;  3J7Y q;  4ASK A;  4P1N A;  2WP9 A;  2I6H A;  2KT9 A;  4YT0 A;  2M67 A;  1W09 A;  3PUS A;  2K5B B;  2VB6 A;  3C4X A;  1S35 A;  5LB7 B;  2WU5 A;  5LG3 A;  3RYH E;  5FY0 A;  4EV6 A;  5HWX A;  1VRB A;  3RKO A;  4YTN A;  3P8C D;  1MIW A;  5J2U E;  5AQV B;  2VUR A;  2AXD S;  3TKL B;  2DCF A;  2K9A A;  2XQA A;  4I43 B;  3GWH A;  1X9B A;  1LVK A;  3PU8 A;  3V5S A;  3C98 B;  4NXN T;  3N9M A;  2KIN B;  4HWH A;  3TLT A;  3CIR A;  3HKD E;  3FZH B;  4GK0 E;  3ZT6 A;  3ABV A;  3EAB A;  2WQY A;  4ADZ A;  3N2K E;  3L3P A;  3UU6 A;  3ETU A;  2MTQ A;  4AQY T;  3ESL A;  1KEY A;  3ONX A;  5HAX A;  1S94 A;  4ISS A;  4EYY R;  5L4H A;  2XHE B;  2V6Y A;  3RIU C;  1W0A A;  3FXE B;  3PE0 A;  4DO0 A;  4UEM A;  4YSX A;  5EK3 A;  1HNX T;  3ZN1 B;  2BDE A;  2A9U A;  4O2B E;  4LF9 T;  4BAY B;  3AA7 B;  4IE6 A;  2LE8 A;  4CN1 A;  4JI3 T;  4B3M T;  1MMD A;  4QWN B;  2XQ6 A;  2HH7 A;  3B5M A;  3WAK A;  3AB3 B;  3PDY A;  2WWV A;  4GOU A;  3FHN A;  3UUM A;  1I6Z A;  1HS7 A;  4TNV A;  4DV3 T;  2E9X A;  4NXM T;  4L9I A;  4TWH A;  5FY1 A;  4LF8 T;  1SE7 A;  4HKA A;  2BVM A;  5LGU B;  3OYX A;  1NAF A;  4FJO A;  5JR9 B;  4B3S T;  2ACX A;  3P4Q A;  2JQ9 A;  4CN4 A;  4LF5 T;  2LKH A;  5EZY E;  5LMU T;  4UVA B;  4LMJ A;  2SPC A;  4JI5 T;  5LNK A;  4JV5 T;  3AEF A;  5FL0 A;  2JIW A;  2KWH A;  3GN5 A;  2N1G A;  3BQK A;  3P7I A;  2E9X D;  3AE3 A;  3MXZ A;  1HFA A;  4PW8 A;  1VCS A;  4O4H E;  2BZB A;  4DBQ A;  3EDU A;  1YQ4 A;  4HEA A;  2NW7 A;  4DID B;  3SFE A;  3SRZ A;  3PJA A;  3RHW A;  4H9R C;  3PU3 A;  4O2A E;  5GON E;  3AE5 A;  3WI3 A;  2YDQ A;  3VKH A;  3RF1 A;  2CHO A;  4JI6 T;  4X20 E;  2JPF A;  4U31 A;  2V7L A;  2PFV A;  2CXD A;  4UXN B;  1OED A;  5C2T A;  3H3M A;  3UQ7 A;  1FJG T;  3ONL C;  4GK5 E;  2D0T A;  2K48 A;  2E5L T;  1WFD A;  4NPP A;  2UXD T;  2HN1 A;  3AE6 A;  2XAS B;  3AXJ B;  3RRC A;  3UU8 A;  4DV5 T;  2EHO A;  1NWM X;  1CUN A;  2HPJ A;  1SA0 E;  3NWI A;  3RQW A;  4CXW A;  2LT3 A;  3N9L A;  3UFE A;  5AQO B;  5HEJ A;  2YDR A;  5JR9 C;  1KNR A;  2CLY B;  4LFA T;  4I4T E;  2MPK A;  4A5X A;  4YXD A;  2VKH A;  4K0K T;  1WYB A;  2ZM2 A;  4DUZ T;  3ZMS B;  3I0Q A;  2C5K T;  1NEN A;  1HF8 A;  2C5I T;  4PK4 A;  4EAH A;  3RYI E;  4HFD A;  4IHJ E;  2Q9Q B;  2X66 A;  5HEH A;  5FKY A;  3SWH A;  2CCQ A;  2ZM8 A;  3JCF A;  3B57 A;  3N9P A;  4PK6 A;  2YOE A;  5JVD E;  3EI0 A;  5L3F B;  3ZST A;  4QKN A;  3ZJ2 A;  1R8I A;  5LHH B;  4U2Y A;  4COF A;  3KVA A;  4KP3 C;  2JMH A;  4IST A;  2XQ5 A;  3EUH A;  1YXR A;  2XM1 A;  2N9D A;  3QK6 A;  3FXD B;  3AED A;  4OK0 A;  4IDZ A;  3X1D A;  1UUR A;  5AQR B;  4EOZ B;  4HFH A;  2Y6X A;  3LSV A; 
#chains in the Genus database with same CATH homology
 2CPT A;  2LRL A;  5CJ5 A;  4U2Y A;  2RPA A;  4U2Z A;  4ZEY A;  2MPK A;  2JQK A;  4NIQ A;  2W2U A;  3ZT5 A;  1YXR A;  2V6X A;  4A5X A;  4IT4 A;  2V6Y B;  5LB7 B;  2CRB A;  1WFD A;  2WWV A;  1WCR A;  3ZSS A;  2A9U A;  3ZT7 A;  2JQH A;  3K1S A;  4CN6 A;  4U33 A;  1WR0 A;  2K3W A;  5CGM A;  2DL1 A;  5FVL A;  4U7I A;  5FVK A;  4P1N A;  4U31 A;  2JQ9 A;  3ZST A;  2V6Y A;  4U7Y A;  2XZE A;  3ZT6 A;  4CN4 A;  4CN1 A;  3EAB A;  4U3C A;  2LRK A;  4WZX A;  2WY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...