4A5XA

Structures of mitd1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
73
structure length
73
Chain Sequence
PQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCNLREKISKYMDRAENIKKYLDQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MIT DOMAIN-CONTAINING PROTEIN 1
publication title Escrt-III Binding Protein Mitd1 is Involved in Cytokinesis and Has an Unanticipated Pld Fold that Binds Membranes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 33
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4a5xA00
2RPAA 2W2UA 4U7YA 2CPTA 4U2ZA 3ZT7A 4A5XA 4CN6A 4U2YA 2V6YB 2A9UA 4WZXA 3K1SA 4IT4A 2WWVA 1WFDA 1WCRA 1WR0A 2JQ9A 2JQKA 4ZEYA 5CGMA 3ZT6A 5FVLA 5FVKA 3EABA 5CJ5A 5LB7B 4CN1A 2K3WA 4U33A 2LRKA 2CRBA 2DL1A 4U3CA 2XZEA 2V6YA 2JQHA 2V6XA 2WY2A 4CN4A 4NIQA 2LRLA 4U7IA 4U31A 1YXRA 3ZSTA 2MPKA 3ZSSA 3ZT5A 4P1NA
chains in the Genus database with same CATH superfamily
1YKEB 3RIFA 4QHOA 2IC9A 1IBLT 2W4XA 3H3AA 2XQAA 4DR1T 3O1IA 3IA3A 5FMNA 4IDPA 2WMOA 1IJ6A 1MIYA 5AQOB 3Q5XA 1KEYA 2UXDT 5LA6E 4DNDA 2L8KA 4ADZA 3NWIA 5FXZA 1GQEA 3RGLA 2HN2A 5FVLA 2WDQA 2JIWA 5F8PA 2BKPA 4DV2T 5KXJA 2KXPB 3DJBA 3QK6A 5IHYA 2W00A 1S35A 4A5XA 2V7JA 4UIGA 2IW5B 4PJNA 5HXEA 5LJMA 3WI3A 1R8IA 5F5WA 2XTLA 3L3PA 3I1AA 5FL1A 2W61A 1W9RA 4BA9A 3ONJA 4E7ZA 4EYUA 3UFEA 4HFCA 4HWIB 3BQLA 4EIWA 4A98A 2X9HA 3ZC1A 4UF0B 4DUYT 3QNUA 1X9BA 4JUYA 4EEBA 4L5GA 4EEDA 2OLTA 3FHNA 1WYCA 2LT3A 3AVRA 4AI6A 3Q5WA 4P09A 2Q9QB 2X68A 2M6IA 2WDVA 4A56A 3CK6A 2LSYA 4PFOA 2N9DA 3SOLA 2DCFA 4JLEA 4IE6A 2UXBT 3AECA 3KVAA 3A8YC 3NRYA 1U4QA 2YK0A 3C98B 4B3RT 4HEAA 3AE4A 4PJMA 3EAMA 4PK4A 4ZOLE 4IDOA 4JBWF 3J9X1 2VKJA 2D2SA 2NP9A 3VRAA 2WMNA 2IIUA 1E2AA 2ZM6T 2CHOA 3LSVA 3O4XE 5JH7E 5JR9A 1OEDA 2XM1A 3FBZA 2LRKA 1KNPA 2DL1A 2LKHA 3JADA 3RQWA 5LOVE 1J5ET 3UU8A 3P4RA 2MPKA 1MMDA 5L3CB 4YLHA 1N36T 2XAQB 3ZMTB 3CWZB 4H9QC 1WYBA 1LRZA 4U3CA 1XDPA 2KZ7B 4Q25A 3Q9DA 4QX7B 3I9WA 3NBXX 2H7OA 3EHZA 1YQ4A 4NXMT 4X20E 3JAEA 3B5MA 4ZHQE 3O1JA 5FY0A 4G63A 4O8SA 4U33A 2DHRA 2J62A 1G73A 5AQUB 4ASKA 4I0UA 2W66A 1SE7A 2NW8A 5LYJE 2ZM8A 4XZCA 2NTYA 5J1GA 3UUXB 3LK3B 2WU5A 4IDZA 2H7VC 5FKYA 5JDGA 1I6ZA 3ZYKA 2NW7A 4U74A 2J1DG 2LHRA 2LLYA 3PUQA 2IC6A 2BDEA 4TZ4C 5JDMA 2CHNA 3RPUA 3ONXA 1D0YA 2XAJB 5AQQB 4C90A 2IHR1 4TV9E 1HF8A 3Q5EA 3UUNA 4HFIA 2YOEA 4DBRA 4LF9T 3OYXA 3AE7A 4HE8A 1MMNA 4KMCA 5HXCA 2WB5A 3ZT7A 3P50A 2NW9A 2VL8A 2IUBA 3AE1A 5LG3A 3QB5K 3RYCE 3N2KE 1W0AA 4EOZB 3AA6B 2GK9A 4CXWA 2PJQA 2V6XA 3UU6A 2OA5A 4PK6A 5JDLA 3AB3B 3RC8A 2XY8B 4YTNA 4JI7T 2X0YA 5KDMC 1WRDA 1JNRA 3UU5A 1Y01A 2V7LA 3PE0A 4H9PC 4MHCA 1J5WA 2QVAA 3NRXA 2RPAA 4F8HA 4DR7T 1W09A 4HWDA 1HG2A 5M4YA 4UVAB 2I6HA 4HWHA 2QGSA 3FXEB 3KBTA 5JRCB 2A3DA 4KUMB 4A97A 1MNEA 4AKRB 1UUSA 2KMFA 3UQ7A 3SRZA 5JDQA 3AE3A 1KF6A 4FI5A 4JI8T 4GKKT 2M6BA 2BVLA 2E5VA 2QYWA 3LG7A 4EZHA 3FBLA 2YKSA 4O4IE 3TLWA 4EXTA 2EHOD 4EYYR 3CX6B 2C5IT 5HAXA 3RYIE 2UU9T 1KNRA 3P4SA 3TLTA 1UCUA 4CN1A 2X9XA 3ZEFB 3C4XA 3ZCIA 2MTQA 2XPKA 2YU1A 4NIQA 3ZMUB 3RYFE 3EI0A 2MBGA 4YHHT 2X66A 3UU4A 1VCSA 3ETUA 3ZMVB 2Y8DA 3VRBA 4QKNA 2EHOA 5HWYA 5JREA 3N9QA 4TWHA 2LSIA 4AKLA 4YHJA 3BK9A 2ES0A 4DR2T 4GYRA 1HG5A 3PV0F 4DV5T 2W62A 2G0UA 4GK0E 3RLFF 3KV6A 2BG9E 3ZLIA 1CUNA 4JI3T 4DV6T 4O4JE 1HS7A 2KWIB 2VL0A 3FZHB 2YU2A 5EZYE 4MFRA 2ZM2A 2CXFA 3EVYA 1N34T 4CI1B 3HR0A 4AQFC 3Q2MA 2V26A 2XQ8A 4DO0A 4ZXLA 3I9YA 1JNZA 2XAFB 2WWUA 4DMVA 4QH5A 2ACZA 3AVSA 2X0LB 4X65T 4QXHB 5HEUA 4PAGA 1BR1A 4U7IA 2ZM0A 2VQFT 4O4LE 3B13A 2KWHA 2WM9A 4ZI2C 3P4QA 3N9OA 3ZN0B 3AEEA 5ABFA 4KHPT 5IUXA 2DNXA 1LVFA 1IBKT 3ABVA 2V1DB 1HNZT 5C2TA 1NWMX 4ANJA 1J1JA 2BG9A 2Z6EA 3E22E 3QC9A 2UUAT 4LF7T 1IAPA 3CMLA 5C8YE 1NAFA 2V6YA 2VB6A 5LGUB 1NEKA 2CLYB 5FXWA 5HEGA 2D5UA 4AISA 5LGTB 5FXVA 3CVRA 4O2AE 4JI5T 2ZMAA 4J2CA 3U3IA 2B1EA 2LJLA 2BKNA 1T98A 1M62A 4YSZA 3UU3A 4XAXB 4CN4A 2OV9A 5L3FB 5JR9B 1OEDB 4X66T 2B76A 4UV9B 3JC6C 1D0ZA 4U2YA 2WZHA 2SPCA 3PU8A 3K1SA 3OBVE 2CE7A 2LSJA 3O1HA 3K3QC 1HR0T 1ZKEA 4IDQA 4KBMB 1OEDE 1G8XA 3ZYLA 1EZ3A 5J2UE 2LSGA 4OX9T 5HCJA 2FJDA 5LHHB 3LK2B 3CX7B 3FZFB 4PJJA 4YTMA 3F2EA 1KK7A 5AQSB 2BS2A 5LXTE 2XHEB 2FBWA 3X1DA 3CQCB 4C91A 1FEWA 3PU3A 4IHJE 3ZT6A 5L4HA 4LMKA 4QWNB 5LJNA 3H37A 1H7CA 5DQVA 3KV9A 5LNKA 1V9DA 4L9IA 4TN7B 2AXDS 2BZBA 4JV5T 2WY2A 3AXJA 3RX6A 3UULA 2WQYA 5DABA 3P4PA 5AQNB 2XAHB 3UTKA 5AQLB 3QB5A 4AXPA 2XJ7A 3R6NA 2E8IA 2CLYC 3PJAA 5L2LA 5ADXL 4UVBB 5AQIB 5BR8T 4QXBB 3N9NA 2KT9A 4UR9A 4ILUA 1US7B 4HTEA 3ZCJA 3HI2A 5JR9C 2PBIA 4GKJT 3KDSE 2LRLA 5CA0E 4UVCB 1UX4A 2I0MA 4JI6T 5A1LA 4UEMA 2J4GA 1OXZA 4U2ZA 4P0AA 5F3JA 4QH4A 2LM2A 5FXXA 5ETWA 2JQQA 4JI0T 1VOMA 3SS1A 3MACA 4ISSA 3Q5DA 3UFGA 5HXRA 3EDVA 2JMKA 3RIUC 3T1YT 4LF6T 1NENA 2HPLA 2XQYA 2LSKA 2XQ6A 4YFSA 5J2TE 3QUJA 4Z90A 3RHWA 3LDQB 1D1AA 1D1BA 3B57A 1Z8UA 3KVBA 5J0ZA 3L09A 4UF0A 4IDNA 4ZZBA 1N32T 4DR6T 3LJCA 4DIDB 4KHZF 2VVNA 1ZEEA 4V1Av 2Q9QC 5ABEA 3PUYF 1HCIA 2YDRA 5EK3A 3W15B 3ANWA 4TNWA 3PUZF 3AA7B 2XQ7A 4M1PA 4UELA 3AE9A 2RA1A 3FB2A 4H9NC 2DWGA 1YW0A 4LFBT 2VVSA 4HFVA 1N33T 3S4UA 5C3JA 2H89A 4IL9A 5KX5E 4AQYT 4YY3T 2AE9A 3IHRA 1D1CA 2YEVC 4EB6E 3UQ4A 3HKCE 3BQIA 3TLVA 3D0TA 3MKDA 2CPTA 2E9XB 4OK0A 2UXCT 2BBJA 2PTFA 4DBQA 4WYVA 3N2OA 4N78D 1OWAA 5HXSA 3IEEA 1KFYA 3O9XA 4LF4T 1XWMA 3KV4A 1HFAA 2X0HA 1KNZA 3CX8B 4ZEYA 2V5DA 4U72A 3IF8B 5FY1A 1UX5A 3JCFA 4QXCB 3HL6A 2V7MA 3K3OA 3HKEE 2VKHA 1BR0A 4MBQA 2LOPA 2L9QA 2LHNA 2DLRA 4YJ2E 2DI4A 3ZMZB 4B6XA 1ZV4X 1XMOT 3ONLC 5E0OA 3V5SA 4DR5T 4AKHA 5HWXA 1YKHB 1CHUA 2L3LA 5EK2A 2CBJA 3ZJ2A 2CXLA 2NOXA 3C4ZA 2J47A 3FZMB 2E2AA 3JAFA 4ZI7E 3LBXA 3GWHA 5HEJA 1HX1B 3ETVA 4BAYB 1UK5A 2HH7A 1Z0PA 4CXXA 3CQGB 5LB7B 4HFDA 3SFEA 4PJLA 4KI0F 4CQIA 3ZMSB 4O4HE 3C50A 2PFVA 2E9XC 4CI2B 4YJ3E 2MOZA 1BR4A 4BJMA 4U7YA 5ABFB 2VURA 5LGNB 2D9DA 2JQ9A 3M65A 4LMJA 3AA0B 4H63H 3ESLA 3DP7A 4IE4A 2IMLA 1X79A 4CZZB 4LFAT 2H3RA 2BG9B 2CM0A 2M67A 3ZT5A 3CQXC 5H6RB 2K9AA 2K48A 5FY7A 4PK5A 5AQVB 3KV5A 5JTGA 2V6YB 3T1HT 4H9OC 2D0UA 2P9BA 3PJAJ 5CJ5A 5JDFA 4OYJA 4ZS3A 1T72A 4GIWA 3CKDA 2A2FX 4ZI3C 2MYSA 2XZEA 3OPCA 3OVUA 3KFWX 4GK5E 4ISTA 2WZIA 3AE6A 5FVKA 4WW0A 4HFHA 2K3WA 3FXDB 2XQ4A 5HXHA 2FJAA 4MLKA 1UURA 3EDUA 3FZLB 2WCAA 5LMNT 1QLBA 3P4WA 5AQRB 5HEOA 2KSRA 4ZI2D 4AQFA 3EABA 3N9MA 4DR4T 4ERRA 3AEFA 3E0ZA 4ILBA 4UV8B 5JQGE 5CFBA 3OKQA 3RKOA 2N2NA 4LF8T 1ZHCA 3AE5A 1WR6A 3VHLA 4HKAA 4HWCA 4YT0A 2W67A 5IYZE 3NKZA 3PUSA 1U5PA 5GONE 1SUMB 4TV8E 2V7IA 1FMVA 5JVDE 3N9LA 1MNDA 3AXJB 4DUZT 2QRXA 1I94T 3RKGA 2MAWA 1XZYA 2BG9C 1MIWA 4I55E 3UUMA 3V5UA 1XDOA 2X51A 2UXNB 1D0XA 2CCQA 4DV4T 4ZS2A 3OYZA 3GN5A 2LM9A 3AAEB 1M7KA 2LE8A 3JC6D 4IT4A 4IE7A 2LOSA 4JI1T 2CXDA 2CBIA 1DU2A 3AEAA 1L0VA 2JMHA 3EUHA 1HTJF 2C5KT 2FUPA 4AIUA 1SHZC 3P7IA 5HCMA 1SA0E 4FJOA 3RC3A 5IWAT 5AQFB 4TUYE 3U78A 3H3MA 2X9WA 5LCYA 1BR2A 1HNXT 5L3EB 1UGOA 2YN6A 5TAOA 3KINB 2H88A 2YDSA 1QSDA 2RP4A 2FJBA 5EK4A 1ZOYA 2WBLA 4DV1T 4JYAT 2HPJA 5AQHB 2PG8A 5LBQB 3MJXA 2XQ3A 4HGAA 2F4VT 3N9PA 1O3XA 3AEGA 3ANWB 3FZKB 4WBNE 3PUWF 5ABHA 4IIJE 3RQUA 1IZNB 3ZKRA 4I50E 1WR0A 3C51A 2IDOB 4XBFB 1FIOA 5LBMA 2X67A 2C5JA 2XM2A 3PUGA 3F31A 4IREA 1QUUA 4PFPA 4KX6A 4GYSA 2N1GA 1YQ3A 5L3GB 4X64T 4OYKA 4TNVA 4YTPA 4LF5T 4X1YE 2CMRA 1OEDC 4B3TT 3MXZA 2QA7A 4WZXA 3AAAB 4K0KT 4B3MT 4TX5A 2XSAA 3IBPA 3ZPOA 4DV0T 2BKOA 1YXRA 3TLSA 3SWHA 1MIVA 4B3ST 4ILAA 2Q9QD 3P8CD 2JQKA 3AAIA 3VKGA 2FJEA 3LFMA 3RIUA 4YSXA 4IL4A 3TKLB 3OJAA 5AQGB 4ILCA 2XQ9A 2XSBA 1VRBA 1LVKA 4NXNT 1HNWT 4NUUA 4CXYA 2Q9QA 1Y64B 5FL0A 3AEBA 3LBXB 1S94A 4P0BA 3L39A 2ODVA 2BBHA 5AQJB 2BVMA 2CWOA 3HKBE 3UT5E 1VCTA 2V5CA 1FJGT 3NVOA 2Y48B 3RYHE 2V8SV 2KLQA 2JQHA 2XUEA 4YSYA 2K5BB 3GA8A 4QH1A 2I59A 2XASB 2WDRA 4DV3T 5FNVE 2R6GF 4QX8B 5CB4E 2X9YA 3VU7H 5L3BB 3F57A 4IE0A 3RRWA 2D0TA 2EHOB 4ZZCA 4WBOA 1XMQT 4COFA 4X1IE 4I43B 2ZLYA 1WFDA 3QOFA 3DTOA 5AQPB 3HA4A 2CWYA 2W0GA 2JJ9A 2UUCT 2C0SA 4IGUA 2K24A 1MMAA 4X5TA 4JEHB 4P1NA 2BS4A 5JDHA 3I0QA 5AQKB 4F6RC 4DR3T 2WWVA 4EZ4A 4JI2T 1W0BA 2VQET 2UXXB 4KP3C 4AKGA 4K0UA 2JPFA 4Z8XA 3ZC0A 2YINA 2VWAA 1T7SA 1E7PA 2Y6XA 4PNIA 2YDQA 2IAKA 3ZSTA 5AFUL 5LHGB 3TLUA 4E7SA 4IE5A 1YD8G 1B7TA 4O2BE 5L3DB 4AKIA 5DQWA 3BQKA 2W63A 3PUXF 3AE2A 3K3NA 3MA9A 3AEDA 3PDYA 3AE8A 4EGWA 2E9XD 2W2UA 4TWDA 4HFEA 3LK42 2VK9A 3SFDA 4H9SE 4X1KE 4L0RA 4NPPA 3RI5A 3HKDE 5CA1E 2WAUA 4X62T 4CI3B 2LKGA 3C4WA 3A5XA 5HYAA 1XNRT 3AA1B 2A9UA 5HEHA 2BS3A 4GOUA 4EV6A 5LMUT 1IBMT 1WLXA 2DWKA 2KINB 2E9XA 2VKOA 4TWFA 4DVDA 2CRBA 5KMGP 2ACXA 2EHOC 4ZI3D 4DMWA 2LEHA 1LKXA 3OTOT 3R84B 4HWFA 3J7Yq 2WS3A 4JEUB 5CGMA 5DJQC 3MK7C 5H6QB 3GN5B 3C64A 3N2GE 2HHHT 3NZQA 3MZKB 4Z91A 2UUBT 4NUVA 4LMLA 2ODUA 2WP9A 5ABGA 3G06A 3E08A 4JI4T 3VR9A 2A72A 3CIRA 4YXDA 3K8PC 1MMGA 4OHFA 5AQMB 3M3ZB 3ZN1B 4HFBA 3WAJA 3VR8A 3ZJ1A 4PW8A 2NR4A 2E5LT 1XNQT 5FYMA 2WU2A 4U31A 4LFCT 4H63V 3A7MA 4CN6A 1FMWA 4H9RC 1E1HB 2VKDA 5BMVE 4I4TE 1WCRA 3RH3A 3ZYMA 4G2AA 1T8BA 5JRCA 2WSSV 2VASA 2CEAA 1AJ3A 4AQGA 5LHIB 3PTRB 1HX8A 5LP6E 1ZP0A 2HN1A 3PURA 3CPZA 5JDNA 4MALA 2V7KA 5FP3A 3WAKA 3RRCA 3N5LA 3L8RA 3GMIA 3VKHA 4OFZA 2XAGB 4DV7T 3PUAA 5L47A 3RF1A 2KNDA 2JRKA 3NZPA 2CA5A 2NTXA 2XQ5A 2NWBA 3UUBA 3I0OA 4BJNA 5L4EA 5LG4A 4WNKA 3T8OA 5AQTB 3KBUA 3RIAA 4EAHA 3ZSSA 1IJ5A 4HN9A 4UXNB 3PUVF
chains in the Genus database with same CATH topology
2RPAA 2W2UA 4U7YA 2CPTA 4U2ZA 3ZT7A 4A5XA 4CN6A 4U2YA 2V6YB 2A9UA 4WZXA 3K1SA 4IT4A 2WWVA 1WFDA 1WCRA 1WR0A 2JQ9A 2JQKA 4ZEYA 5CGMA 3ZT6A 5FVLA 5FVKA 3EABA 5CJ5A 5LB7B 4CN1A 2K3WA 4U33A 2LRKA 2CRBA 2DL1A 4U3CA 2XZEA 2V6YA 2JQHA 2V6XA 2WY2A 4CN4A 4NIQA 2LRLA 4U7IA 4U31A 1YXRA 3ZSTA 2MPKA 3ZSSA 3ZT5A 4P1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RPA A;  2W2U A;  4U7Y A;  2CPT A;  4U2Z A;  3ZT7 A;  4A5X A;  4CN6 A;  4U2Y A;  2V6Y B;  2A9U A;  4WZX A;  3K1S A;  4IT4 A;  2WWV A;  1WFD A;  1WCR A;  1WR0 A;  2JQ9 A;  2JQK A;  4ZEY A;  5CGM A;  3ZT6 A;  5FVL A;  5FVK A;  3EAB A;  5CJ5 A;  5LB7 B;  4CN1 A;  2K3W A;  4U33 A;  2LRK A;  2CRB A;  2DL1 A;  4U3C A;  2XZE A;  2V6Y A;  2JQH A;  2V6X A;  2WY2 A;  4CN4 A;  4NIQ A;  2LRL A;  4U7I A;  4U31 A;  1YXR A;  3ZST A;  2MPK A;  3ZSS A;  3ZT5 A;  4P1N A; 
#chains in the Genus database with same CATH topology
 1YKE B;  3RIF A;  4QHO A;  2IC9 A;  1IBL T;  2W4X A;  3H3A A;  2XQA A;  4DR1 T;  3O1I A;  3IA3 A;  5FMN A;  4IDP A;  2WMO A;  1IJ6 A;  1MIY A;  5AQO B;  3Q5X A;  1KEY A;  2UXD T;  5LA6 E;  4DND A;  2L8K A;  4ADZ A;  3NWI A;  5FXZ A;  1GQE A;  3RGL A;  2HN2 A;  5FVL A;  2WDQ A;  2JIW A;  5F8P A;  2BKP A;  4DV2 T;  5KXJ A;  2KXP B;  3DJB A;  3QK6 A;  5IHY A;  2W00 A;  1S35 A;  4A5X A;  2V7J A;  4UIG A;  2IW5 B;  4PJN A;  5HXE A;  5LJM A;  3WI3 A;  1R8I A;  5F5W A;  2XTL A;  3L3P A;  3I1A A;  5FL1 A;  2W61 A;  1W9R A;  4BA9 A;  3ONJ A;  4E7Z A;  4EYU A;  3UFE A;  4HFC A;  4HWI B;  3BQL A;  4EIW A;  4A98 A;  2X9H A;  3ZC1 A;  4UF0 B;  4DUY T;  3QNU A;  1X9B A;  4JUY A;  4EEB A;  4L5G A;  4EED A;  2OLT A;  3FHN A;  1WYC A;  2LT3 A;  3AVR A;  4AI6 A;  3Q5W A;  4P09 A;  2Q9Q B;  2X68 A;  2M6I A;  2WDV A;  4A56 A;  3CK6 A;  2LSY A;  4PFO A;  2N9D A;  3SOL A;  2DCF A;  4JLE A;  4IE6 A;  2UXB T;  3AEC A;  3KVA A;  3A8Y C;  3NRY A;  1U4Q A;  2YK0 A;  3C98 B;  4B3R T;  4HEA A;  3AE4 A;  4PJM A;  3EAM A;  4PK4 A;  4ZOL E;  4IDO A;  4JBW F;  3J9X 1;  2VKJ A;  2D2S A;  2NP9 A;  3VRA A;  2WMN A;  2IIU A;  1E2A A;  2ZM6 T;  2CHO A;  3LSV A;  3O4X E;  5JH7 E;  5JR9 A;  1OED A;  2XM1 A;  3FBZ A;  2LRK A;  1KNP A;  2DL1 A;  2LKH A;  3JAD A;  3RQW A;  5LOV E;  1J5E T;  3UU8 A;  3P4R A;  2MPK A;  1MMD A;  5L3C B;  4YLH A;  1N36 T;  2XAQ B;  3ZMT B;  3CWZ B;  4H9Q C;  1WYB A;  1LRZ A;  4U3C A;  1XDP A;  2KZ7 B;  4Q25 A;  3Q9D A;  4QX7 B;  3I9W A;  3NBX X;  2H7O A;  3EHZ A;  1YQ4 A;  4NXM T;  4X20 E;  3JAE A;  3B5M A;  4ZHQ E;  3O1J A;  5FY0 A;  4G63 A;  4O8S A;  4U33 A;  2DHR A;  2J62 A;  1G73 A;  5AQU B;  4ASK A;  4I0U A;  2W66 A;  1SE7 A;  2NW8 A;  5LYJ E;  2ZM8 A;  4XZC A;  2NTY A;  5J1G A;  3UUX B;  3LK3 B;  2WU5 A;  4IDZ A;  2H7V C;  5FKY A;  5JDG A;  1I6Z A;  3ZYK A;  2NW7 A;  4U74 A;  2J1D G;  2LHR A;  2LLY A;  3PUQ A;  2IC6 A;  2BDE A;  4TZ4 C;  5JDM A;  2CHN A;  3RPU A;  3ONX A;  1D0Y A;  2XAJ B;  5AQQ B;  4C90 A;  2IHR 1;  4TV9 E;  1HF8 A;  3Q5E A;  3UUN A;  4HFI A;  2YOE A;  4DBR A;  4LF9 T;  3OYX A;  3AE7 A;  4HE8 A;  1MMN A;  4KMC A;  5HXC A;  2WB5 A;  3ZT7 A;  3P50 A;  2NW9 A;  2VL8 A;  2IUB A;  3AE1 A;  5LG3 A;  3QB5 K;  3RYC E;  3N2K E;  1W0A A;  4EOZ B;  3AA6 B;  2GK9 A;  4CXW A;  2PJQ A;  2V6X A;  3UU6 A;  2OA5 A;  4PK6 A;  5JDL A;  3AB3 B;  3RC8 A;  2XY8 B;  4YTN A;  4JI7 T;  2X0Y A;  5KDM C;  1WRD A;  1JNR A;  3UU5 A;  1Y01 A;  2V7L A;  3PE0 A;  4H9P C;  4MHC A;  1J5W A;  2QVA A;  3NRX A;  2RPA A;  4F8H A;  4DR7 T;  1W09 A;  4HWD A;  1HG2 A;  5M4Y A;  4UVA B;  2I6H A;  4HWH A;  2QGS A;  3FXE B;  3KBT A;  5JRC B;  2A3D A;  4KUM B;  4A97 A;  1MNE A;  4AKR B;  1UUS A;  2KMF A;  3UQ7 A;  3SRZ A;  5JDQ A;  3AE3 A;  1KF6 A;  4FI5 A;  4JI8 T;  4GKK T;  2M6B A;  2BVL A;  2E5V A;  2QYW A;  3LG7 A;  4EZH A;  3FBL A;  2YKS A;  4O4I E;  3TLW A;  4EXT A;  2EHO D;  4EYY R;  3CX6 B;  2C5I T;  5HAX A;  3RYI E;  2UU9 T;  1KNR A;  3P4S A;  3TLT A;  1UCU A;  4CN1 A;  2X9X A;  3ZEF B;  3C4X A;  3ZCI A;  2MTQ A;  2XPK A;  2YU1 A;  4NIQ A;  3ZMU B;  3RYF E;  3EI0 A;  2MBG A;  4YHH T;  2X66 A;  3UU4 A;  1VCS A;  3ETU A;  3ZMV B;  2Y8D A;  3VRB A;  4QKN A;  2EHO A;  5HWY A;  5JRE A;  3N9Q A;  4TWH A;  2LSI A;  4AKL A;  4YHJ A;  3BK9 A;  2ES0 A;  4DR2 T;  4GYR A;  1HG5 A;  3PV0 F;  4DV5 T;  2W62 A;  2G0U A;  4GK0 E;  3RLF F;  3KV6 A;  2BG9 E;  3ZLI A;  1CUN A;  4JI3 T;  4DV6 T;  4O4J E;  1HS7 A;  2KWI B;  2VL0 A;  3FZH B;  2YU2 A;  5EZY E;  4MFR A;  2ZM2 A;  2CXF A;  3EVY A;  1N34 T;  4CI1 B;  3HR0 A;  4AQF C;  3Q2M A;  2V26 A;  2XQ8 A;  4DO0 A;  4ZXL A;  3I9Y A;  1JNZ A;  2XAF B;  2WWU A;  4DMV A;  4QH5 A;  2ACZ A;  3AVS A;  2X0L B;  4X65 T;  4QXH B;  5HEU A;  4PAG A;  1BR1 A;  4U7I A;  2ZM0 A;  2VQF T;  4O4L E;  3B13 A;  2KWH A;  2WM9 A;  4ZI2 C;  3P4Q A;  3N9O A;  3ZN0 B;  3AEE A;  5ABF A;  4KHP T;  5IUX A;  2DNX A;  1LVF A;  1IBK T;  3ABV A;  2V1D B;  1HNZ T;  5C2T A;  1NWM X;  4ANJ A;  1J1J A;  2BG9 A;  2Z6E A;  3E22 E;  3QC9 A;  2UUA T;  4LF7 T;  1IAP A;  3CML A;  5C8Y E;  1NAF A;  2V6Y A;  2VB6 A;  5LGU B;  1NEK A;  2CLY B;  5FXW A;  5HEG A;  2D5U A;  4AIS A;  5LGT B;  5FXV A;  3CVR A;  4O2A E;  4JI5 T;  2ZMA A;  4J2C A;  3U3I A;  2B1E A;  2LJL A;  2BKN A;  1T98 A;  1M62 A;  4YSZ A;  3UU3 A;  4XAX B;  4CN4 A;  2OV9 A;  5L3F B;  5JR9 B;  1OED B;  4X66 T;  2B76 A;  4UV9 B;  3JC6 C;  1D0Z A;  4U2Y A;  2WZH A;  2SPC A;  3PU8 A;  3K1S A;  3OBV E;  2CE7 A;  2LSJ A;  3O1H A;  3K3Q C;  1HR0 T;  1ZKE A;  4IDQ A;  4KBM B;  1OED E;  1G8X A;  3ZYL A;  1EZ3 A;  5J2U E;  2LSG A;  4OX9 T;  5HCJ A;  2FJD A;  5LHH B;  3LK2 B;  3CX7 B;  3FZF B;  4PJJ A;  4YTM A;  3F2E A;  1KK7 A;  5AQS B;  2BS2 A;  5LXT E;  2XHE B;  2FBW A;  3X1D A;  3CQC B;  4C91 A;  1FEW A;  3PU3 A;  4IHJ E;  3ZT6 A;  5L4H A;  4LMK A;  4QWN B;  5LJN A;  3H37 A;  1H7C A;  5DQV A;  3KV9 A;  5LNK A;  1V9D A;  4L9I A;  4TN7 B;  2AXD S;  2BZB A;  4JV5 T;  2WY2 A;  3AXJ A;  3RX6 A;  3UUL A;  2WQY A;  5DAB A;  3P4P A;  5AQN B;  2XAH B;  3UTK A;  5AQL B;  3QB5 A;  4AXP A;  2XJ7 A;  3R6N A;  2E8I A;  2CLY C;  3PJA A;  5L2L A;  5ADX L;  4UVB B;  5AQI B;  5BR8 T;  4QXB B;  3N9N A;  2KT9 A;  4UR9 A;  4ILU A;  1US7 B;  4HTE A;  3ZCJ A;  3HI2 A;  5JR9 C;  2PBI A;  4GKJ T;  3KDS E;  2LRL A;  5CA0 E;  4UVC B;  1UX4 A;  2I0M A;  4JI6 T;  5A1L A;  4UEM A;  2J4G A;  1OXZ A;  4U2Z A;  4P0A A;  5F3J A;  4QH4 A;  2LM2 A;  5FXX A;  5ETW A;  2JQQ A;  4JI0 T;  1VOM A;  3SS1 A;  3MAC A;  4ISS A;  3Q5D A;  3UFG A;  5HXR A;  3EDV A;  2JMK A;  3RIU C;  3T1Y T;  4LF6 T;  1NEN A;  2HPL A;  2XQY A;  2LSK A;  2XQ6 A;  4YFS A;  5J2T E;  3QUJ A;  4Z90 A;  3RHW A;  3LDQ B;  1D1A A;  1D1B A;  3B57 A;  1Z8U A;  3KVB A;  5J0Z A;  3L09 A;  4UF0 A;  4IDN A;  4ZZB A;  1N32 T;  4DR6 T;  3LJC A;  4DID B;  4KHZ F;  2VVN A;  1ZEE A;  4V1A v;  2Q9Q C;  5ABE A;  3PUY F;  1HCI A;  2YDR A;  5EK3 A;  3W15 B;  3ANW A;  4TNW A;  3PUZ F;  3AA7 B;  2XQ7 A;  4M1P A;  4UEL A;  3AE9 A;  2RA1 A;  3FB2 A;  4H9N C;  2DWG A;  1YW0 A;  4LFB T;  2VVS A;  4HFV A;  1N33 T;  3S4U A;  5C3J A;  2H89 A;  4IL9 A;  5KX5 E;  4AQY T;  4YY3 T;  2AE9 A;  3IHR A;  1D1C A;  2YEV C;  4EB6 E;  3UQ4 A;  3HKC E;  3BQI A;  3TLV A;  3D0T A;  3MKD A;  2CPT A;  2E9X B;  4OK0 A;  2UXC T;  2BBJ A;  2PTF A;  4DBQ A;  4WYV A;  3N2O A;  4N78 D;  1OWA A;  5HXS A;  3IEE A;  1KFY A;  3O9X A;  4LF4 T;  1XWM A;  3KV4 A;  1HFA A;  2X0H A;  1KNZ A;  3CX8 B;  4ZEY A;  2V5D A;  4U72 A;  3IF8 B;  5FY1 A;  1UX5 A;  3JCF A;  4QXC B;  3HL6 A;  2V7M A;  3K3O A;  3HKE E;  2VKH A;  1BR0 A;  4MBQ A;  2LOP A;  2L9Q A;  2LHN A;  2DLR A;  4YJ2 E;  2DI4 A;  3ZMZ B;  4B6X A;  1ZV4 X;  1XMO T;  3ONL C;  5E0O A;  3V5S A;  4DR5 T;  4AKH A;  5HWX A;  1YKH B;  1CHU A;  2L3L A;  5EK2 A;  2CBJ A;  3ZJ2 A;  2CXL A;  2NOX A;  3C4Z A;  2J47 A;  3FZM B;  2E2A A;  3JAF A;  4ZI7 E;  3LBX A;  3GWH A;  5HEJ A;  1HX1 B;  3ETV A;  4BAY B;  1UK5 A;  2HH7 A;  1Z0P A;  4CXX A;  3CQG B;  5LB7 B;  4HFD A;  3SFE A;  4PJL A;  4KI0 F;  4CQI A;  3ZMS B;  4O4H E;  3C50 A;  2PFV A;  2E9X C;  4CI2 B;  4YJ3 E;  2MOZ A;  1BR4 A;  4BJM A;  4U7Y A;  5ABF B;  2VUR A;  5LGN B;  2D9D A;  2JQ9 A;  3M65 A;  4LMJ A;  3AA0 B;  4H63 H;  3ESL A;  3DP7 A;  4IE4 A;  2IML A;  1X79 A;  4CZZ B;  4LFA T;  2H3R A;  2BG9 B;  2CM0 A;  2M67 A;  3ZT5 A;  3CQX C;  5H6R B;  2K9A A;  2K48 A;  5FY7 A;  4PK5 A;  5AQV B;  3KV5 A;  5JTG A;  2V6Y B;  3T1H T;  4H9O C;  2D0U A;  2P9B A;  3PJA J;  5CJ5 A;  5JDF A;  4OYJ A;  4ZS3 A;  1T72 A;  4GIW A;  3CKD A;  2A2F X;  4ZI3 C;  2MYS A;  2XZE A;  3OPC A;  3OVU A;  3KFW X;  4GK5 E;  4IST A;  2WZI A;  3AE6 A;  5FVK A;  4WW0 A;  4HFH A;  2K3W A;  3FXD B;  2XQ4 A;  5HXH A;  2FJA A;  4MLK A;  1UUR A;  3EDU A;  3FZL B;  2WCA A;  5LMN T;  1QLB A;  3P4W A;  5AQR B;  5HEO A;  2KSR A;  4ZI2 D;  4AQF A;  3EAB A;  3N9M A;  4DR4 T;  4ERR A;  3AEF A;  3E0Z A;  4ILB A;  4UV8 B;  5JQG E;  5CFB A;  3OKQ A;  3RKO A;  2N2N A;  4LF8 T;  1ZHC A;  3AE5 A;  1WR6 A;  3VHL A;  4HKA A;  4HWC A;  4YT0 A;  2W67 A;  5IYZ E;  3NKZ A;  3PUS A;  1U5P A;  5GON E;  1SUM B;  4TV8 E;  2V7I A;  1FMV A;  5JVD E;  3N9L A;  1MND A;  3AXJ B;  4DUZ T;  2QRX A;  1I94 T;  3RKG A;  2MAW A;  1XZY A;  2BG9 C;  1MIW A;  4I55 E;  3UUM A;  3V5U A;  1XDO A;  2X51 A;  2UXN B;  1D0X A;  2CCQ A;  4DV4 T;  4ZS2 A;  3OYZ A;  3GN5 A;  2LM9 A;  3AAE B;  1M7K A;  2LE8 A;  3JC6 D;  4IT4 A;  4IE7 A;  2LOS A;  4JI1 T;  2CXD A;  2CBI A;  1DU2 A;  3AEA A;  1L0V A;  2JMH A;  3EUH A;  1HTJ F;  2C5K T;  2FUP A;  4AIU A;  1SHZ C;  3P7I A;  5HCM A;  1SA0 E;  4FJO A;  3RC3 A;  5IWA T;  5AQF B;  4TUY E;  3U78 A;  3H3M A;  2X9W A;  5LCY A;  1BR2 A;  1HNX T;  5L3E B;  1UGO A;  2YN6 A;  5TAO A;  3KIN B;  2H88 A;  2YDS A;  1QSD A;  2RP4 A;  2FJB A;  5EK4 A;  1ZOY A;  2WBL A;  4DV1 T;  4JYA T;  2HPJ A;  5AQH B;  2PG8 A;  5LBQ B;  3MJX A;  2XQ3 A;  4HGA A;  2F4V T;  3N9P A;  1O3X A;  3AEG A;  3ANW B;  3FZK B;  4WBN E;  3PUW F;  5ABH A;  4IIJ E;  3RQU A;  1IZN B;  3ZKR A;  4I50 E;  1WR0 A;  3C51 A;  2IDO B;  4XBF B;  1FIO A;  5LBM A;  2X67 A;  2C5J A;  2XM2 A;  3PUG A;  3F31 A;  4IRE A;  1QUU A;  4PFP A;  4KX6 A;  4GYS A;  2N1G A;  1YQ3 A;  5L3G B;  4X64 T;  4OYK A;  4TNV A;  4YTP A;  4LF5 T;  4X1Y E;  2CMR A;  1OED C;  4B3T T;  3MXZ A;  2QA7 A;  4WZX A;  3AAA B;  4K0K T;  4B3M T;  4TX5 A;  2XSA A;  3IBP A;  3ZPO A;  4DV0 T;  2BKO A;  1YXR A;  3TLS A;  3SWH A;  1MIV A;  4B3S T;  4ILA A;  2Q9Q D;  3P8C D;  2JQK A;  3AAI A;  3VKG A;  2FJE A;  3LFM A;  3RIU A;  4YSX A;  4IL4 A;  3TKL B;  3OJA A;  5AQG B;  4ILC A;  2XQ9 A;  2XSB A;  1VRB A;  1LVK A;  4NXN T;  1HNW T;  4NUU A;  4CXY A;  2Q9Q A;  1Y64 B;  5FL0 A;  3AEB A;  3LBX B;  1S94 A;  4P0B A;  3L39 A;  2ODV A;  2BBH A;  5AQJ B;  2BVM A;  2CWO A;  3HKB E;  3UT5 E;  1VCT A;  2V5C A;  1FJG T;  3NVO A;  2Y48 B;  3RYH E;  2V8S V;  2KLQ A;  2JQH A;  2XUE A;  4YSY A;  2K5B B;  3GA8 A;  4QH1 A;  2I59 A;  2XAS B;  2WDR A;  4DV3 T;  5FNV E;  2R6G F;  4QX8 B;  5CB4 E;  2X9Y A;  3VU7 H;  5L3B B;  3F57 A;  4IE0 A;  3RRW A;  2D0T A;  2EHO B;  4ZZC A;  4WBO A;  1XMQ T;  4COF A;  4X1I E;  4I43 B;  2ZLY A;  1WFD A;  3QOF A;  3DTO A;  5AQP B;  3HA4 A;  2CWY A;  2W0G A;  2JJ9 A;  2UUC T;  2C0S A;  4IGU A;  2K24 A;  1MMA A;  4X5T A;  4JEH B;  4P1N A;  2BS4 A;  5JDH A;  3I0Q A;  5AQK B;  4F6R C;  4DR3 T;  2WWV A;  4EZ4 A;  4JI2 T;  1W0B A;  2VQE T;  2UXX B;  4KP3 C;  4AKG A;  4K0U A;  2JPF A;  4Z8X A;  3ZC0 A;  2YIN A;  2VWA A;  1T7S A;  1E7P A;  2Y6X A;  4PNI A;  2YDQ A;  2IAK A;  3ZST A;  5AFU L;  5LHG B;  3TLU A;  4E7S A;  4IE5 A;  1YD8 G;  1B7T A;  4O2B E;  5L3D B;  4AKI A;  5DQW A;  3BQK A;  2W63 A;  3PUX F;  3AE2 A;  3K3N A;  3MA9 A;  3AED A;  3PDY A;  3AE8 A;  4EGW A;  2E9X D;  2W2U A;  4TWD A;  4HFE A;  3LK4 2;  2VK9 A;  3SFD A;  4H9S E;  4X1K E;  4L0R A;  4NPP A;  3RI5 A;  3HKD E;  5CA1 E;  2WAU A;  4X62 T;  4CI3 B;  2LKG A;  3C4W A;  3A5X A;  5HYA A;  1XNR T;  3AA1 B;  2A9U A;  5HEH A;  2BS3 A;  4GOU A;  4EV6 A;  5LMU T;  1IBM T;  1WLX A;  2DWK A;  2KIN B;  2E9X A;  2VKO A;  4TWF A;  4DVD A;  2CRB A;  5KMG P;  2ACX A;  2EHO C;  4ZI3 D;  4DMW A;  2LEH A;  1LKX A;  3OTO T;  3R84 B;  4HWF A;  3J7Y q;  2WS3 A;  4JEU B;  5CGM A;  5DJQ C;  3MK7 C;  5H6Q B;  3GN5 B;  3C64 A;  3N2G E;  2HHH T;  3NZQ A;  3MZK B;  4Z91 A;  2UUB T;  4NUV A;  4LML A;  2ODU A;  2WP9 A;  5ABG A;  3G06 A;  3E08 A;  4JI4 T;  3VR9 A;  2A72 A;  3CIR A;  4YXD A;  3K8P C;  1MMG A;  4OHF A;  5AQM B;  3M3Z B;  3ZN1 B;  4HFB A;  3WAJ A;  3VR8 A;  3ZJ1 A;  4PW8 A;  2NR4 A;  2E5L T;  1XNQ T;  5FYM A;  2WU2 A;  4U31 A;  4LFC T;  4H63 V;  3A7M A;  4CN6 A;  1FMW A;  4H9R C;  1E1H B;  2VKD A;  5BMV E;  4I4T E;  1WCR A;  3RH3 A;  3ZYM A;  4G2A A;  1T8B A;  5JRC A;  2WSS V;  2VAS A;  2CEA A;  1AJ3 A;  4AQG A;  5LHI B;  3PTR B;  1HX8 A;  5LP6 E;  1ZP0 A;  2HN1 A;  3PUR A;  3CPZ A;  5JDN A;  4MAL A;  2V7K A;  5FP3 A;  3WAK A;  3RRC A;  3N5L A;  3L8R A;  3GMI A;  3VKH A;  4OFZ A;  2XAG B;  4DV7 T;  3PUA A;  5L47 A;  3RF1 A;  2KND A;  2JRK A;  3NZP A;  2CA5 A;  2NTX A;  2XQ5 A;  2NWB A;  3UUB A;  3I0O A;  4BJN A;  5L4E A;  5LG4 A;  4WNK A;  3T8O A;  5AQT B;  3KBU A;  3RIA A;  4EAH A;  3ZSS A;  1IJ5 A;  4HN9 A;  4UXN B;  3PUV F; 
#chains in the Genus database with same CATH homology
 2RPA A;  2W2U A;  4U7Y A;  2CPT A;  4U2Z A;  3ZT7 A;  4A5X A;  4CN6 A;  4U2Y A;  2V6Y B;  2A9U A;  4WZX A;  3K1S A;  4IT4 A;  2WWV A;  1WFD A;  1WCR A;  1WR0 A;  2JQ9 A;  2JQK A;  4ZEY A;  5CGM A;  3ZT6 A;  5FVL A;  5FVK A;  3EAB A;  5CJ5 A;  5LB7 B;  4CN1 A;  2K3W A;  4U33 A;  2LRK A;  2CRB A;  2DL1 A;  4U3C A;  2XZE A;  2V6Y A;  2JQH A;  2V6X A;  2WY2 A;  4CN4 A;  4NIQ A;  2LRL A;  4U7I A;  4U31 A;  1YXR A;  3ZST A;  2MPK A;  3ZSS A;  3ZT5 A;  4P1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...