4A61A

Parm from plasmid r1 in complex with amppnp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
321
structure length
309
Chain Sequence
b'HHLVFIDDGSTNIKLQWQESDGTIKQHISPNSFKREWAVSFGDKKVFNYTLNGEQYSFDPISPDAVVTTNIAWQYSDVNVVAVHHALLTSGLPVSEVDIVCTLPLTEYYDRNNQPNTENIERKKANFRKKITLNGGDTFTIKDVKVMPESIPAGYEVLQELDERDSLLIIDLGGTTLDISQVMGKLSGISKIYGDSSLGVSLVTSAVKDALSSYLADDIIIHRKDNNYLKQRINSIVTEAMNEALRKLEQRVLNTLNEFSGYTHVMVIGGGAELICDAVKKHTQIRDERFFKTNNSQYDLVNGMYLIGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASMID SEGREGATION PROTEIN PARM
publication title A Bipolar Spindle of Antiparallel Parm Filaments Drives Bacterial Plasmid Segregation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 92
structure length 309
sequence length 321
ec nomenclature
pdb deposition date 2011-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4a61A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4a61A01
5EY4A 2KHOA 1NM1A 1S3XA 3IUCA 3P4IA 3VOVA 4B9QA 1BU6O 3LM2A 1EQYA 2FF3B 3HBTA 4BC2A 3MCPA 3CI5A 1TYQB 5BRFA 2GWKA 5LY3A 4FPAA 5AQPA 4BGAA 5AZIA 3I33A 2I7NA 2ASOA 5AZJB 4BGBA 4BR4A 2YCHA 4FOEA 3ZX2A 4L3QA 3SMSA 3VF2A 2BTFA 1NGCA 3VGLA 1D4XA 3ZX0A 2QW9A 3EO3A 4XH4A 2YHYA 4H5RA 2GTDA 2P9SB 5EVZA 2YHXA 2EWSA 3W0LA 1ATSA 3A5MC 1TYQA 4BRDA 4FWKA 4BC3A 2QM1A 3R8EA 1JCGA 3KHYA 1MWKA 3H46O 2A42A 4H03B 3AARA 3J8AA 1XUPO 3GDQA 4CZMA 2E2QA 1K8KB 2Q36A 2E1YA 2HF4A 4PKGA 3UKUA 4CD3A 2P9IA 4I6MB 4NO7A 1QZ6A 1ZXOA 2YHWA 5AQLA 4H0VB 4H5NA 2V51B 2CGKA 2D4WA 4BR2A 4EIAA 1HJOA 4FL9A 1TUUA 1LOTB 1X3MA 4H0XB 3AY9A 2FLOA 2F9TA 4BQZA 3OHRA 5EOYA 3SMPA 2Q97A 3LDNA 3LDQA 3O1WA 4BG8A 3BP8A 1KAYA 3CJBA 3A5OC 5AQWA 4B1ZA 5F0XA 1NGGA 2J4RA 3VF6A 4RTFD 3R9PA 3DXKA 3WEEA 4I6MA 2QXLA 3A8YA 4H0PA 4ISEA 3ENHA 2P9UB 4IJNA 5BPLA 2QWMA 3GBTA 5E84A 2VYPA 1BOTO 2HOEA 3VEXA 1NGDA 3CJ1A 3L4IA 3LM9A 3QBXA 3CQYA 3GE1A 2I7PA 1Z6RA 1QHAA 4JD2B 3D2EB 1SQKA 3ZX3A 3AAPA 4F9OA 4FWMA 4BVOA 3AAQA 3LDPA 3CIPA 4H0YB 1GLEG 4BC5A 4GNIA 2A6AA 1BG3A 4BR9A 1DKGD 1YVNA 4B1VA 5KPZA 4PKHA 5AQJA 2A5XA 4K25A 2P9UA 5AQRA 1JCFA 5AQSA 2YJEA 1GLBG 1NGHA 4XEIA 2W40A 4MO5A 4A2BA 3DAWA 3GG4A 3CJAA 1H1VA 4BREA 5AFUH 1XC3A 2P9NB 4JD2A 3ZETA 3WXJA 4CZIA 3QDKA 4KBOA 1GLDG 3ULEA 4XH1A 1U6ZA 1SAZA 2QWPA 3VGKA 2W41A 3GL1A 2FXUA 1HUXA 4K42A 1QQNA 2BUPA 5FPNA 2F9WA 3EN9A 5JMVA 4BRGA 3ENOA 4PKIA 2Q0RA 3BEXA 4Z94A 1T44A 2P9KA 4EFHA 3BF1A 1DEJA 1IG8A 1NGJA 2CGJA 3H3NO 1C0GA 4FWRA 4CJ7A 1ATRA 1BO5O 3MDQA 4BRKA 3M3ZA 2V7YA 4YDUA 3S41A 1NMDA 3QB0A 3CETA 2VCPA 2AA4A 3WUHA 1RDWX 5BN9A 2FSNA 3FZHA 3UE5A 3VEZA 3VF4A 1HX1A 1T6CA 3QFPA 1BA0A 2E2OA 4BRPA 5B8HA 5AFUA 5AQXA 1OKJA 4YDUC 3TPQA 4RWTA 4PL8A 3C0BA 4EHUA 1YAGA 1Y64A 3DJCA 3QBWA 4MO4A 4BRCA 4AM6A 5AQTA 5AQZA 3SJHA 3MN9A 3VEVA 5AZJA 1ATNA 3O6WA 1NGEA 5BR9A 5CE3A 3CERA 5AQMA 3TU5A 4IXCA 3A0IX 4WQ5C 3H6EA 2VWBA 3FZFA 1MWMA 1LCUA 3WXIA 2E20A 1YUWA 3KVGA 2CH6A 4LC9B 3CJ7A 2P9SA 1YXQA 1ZBSA 1GLLO 3IFRA 1G99A 5F2RA 3H1VX 5EX5A 2QWLA 3KZBA 4CZGA 4FWLA 2IVOA 1NGFA 2Q0UA 4NB4A 5KPTA 1IJJA 2P9LB 4CBWA 3FE1A 3EL2A 3H1QA 4CZKA 4CZJA 3LDOA 5AQNA 5BRHA 3CHWA 4RCHA 3MMVA 1HKCA 3A5LC 3D2FB 3HM8A 4GY2B 3JXUA 1K8KA 5KPRA 3M6GA 3UKRB 4BQLA 3BUZB 4BRNA 3VESA 4BR7A 5KQDA 4C23A 1NWKA 2ASPA 1NBWA 1Q18A 5JLFA 5AR0A 2FSKA 3B8AX 1MDUB 1RFQA 2FSJA 3FLCO 2GEMA 4B1XB 4MLHA 3FZKA 4DQ8A 2P9LA 3UB5A 1GLFO 3WQTA 2D1KA 1WUAA 1E4GT 3F9MA 4BRFA 3IDHA 2D0OA 4H5VA 2HF3A 3D2FA 5AQIA 4ISGA 1ZC6A 3WT0A 4A61A 1GLAG 3CQXA 3HSCA 4JAXA 3WXLA 2DPNA 4JNEA 3EKUA 4H5WA 2E2PA 4M7YA 4PL7A 2P9PB 2IVPA 1ESVA 1E4FT 1XQSC 5ELZA 4ISFA 3ZEUB 5BN8A 3QICA 3A5NC 3U9DA 3VETA 3ATVA 3R6MA 4IWVA 1HKGA 2CH5A 2QWNA 3VERA 3D2EA 2E8AA 2NLXA 5JICA 5AQHA 3VGMA 1BA1A 1WOQA 1Z05A 4BRMA 4B1UB 4FOIA 4FWQA 4WQ4C 5AQYA 3L6QA 4A62A 3O4WA 3ZEUA 5E26A 3U9ZA 4CBXA 1V4SA 3FZMA 5JLHA 1DGKN 2YI1A 2YJFA 3FZLA 1KXPA 3H3OB 5AQQA 4K41A 5FPEA 1GLCG 5AZIB 5BRDA 3MN7A 4BR5A 3VEYA 2P9NA 4WYBA 4BRIA 2ITMA 4FWSA 2GELA 2Q1NA 2E2NA 1QQOA 5TKYA 2V52B 3FR0A 4BRAA 2ASMA 4FWNA 4DB3A 1TUYA 4H0OA 2GUPA 3H45C 3EZWA 3O1BA 3D7EO 2NRHA 3C7NB 4WQ5A 5AQKA 2V7ZA 2Q31A 3O5BA 4JN4A 3IMXA 1KAXA 1NLVA 5F1XA 1X9JA 2UYTA 1HPMA 2Q2RA 3VPZA 4AM7A 3QFUA 3BF3A 2PBDA 3RSEB 3CJCA 2QWQA 4H0TB 4IZ9A 2H3GX 4M63C 3UKUB 2P9IB 3LL3A 4FSVA 2CGLA 2QWOA 1RGIA 3EKSA 4Y0WA 1CZAN 3C7NA 5ADXH 4A2AA 4EAHD 2AP1A 1HLUA 2E88A 4O5FA 2GWJA 1BDGA 4CZEA 1U2VB 2ZGZA 2NZTA 2ZWHA 4CI6A 3SK3A 5BPNA 5FPDA 3I8BA 3O08A 3RSEA 4IO8A 3DXMB 1J6ZA 2E1ZA 3DXKB 3FFKB 3WEEB 2D0PA 1NGBA 2QWRA 4JHDB 3U4LA 4B1WB 1S22A 3W3DA 4HWIA 2IVNA 1KAZA 3M1FA 4BRQA 5AQFA 2A40A 1V4TA 2WUSA 4K43A 3WQUA 4E1JA 5AQOA 4MLEA 4FO0A 2A41A 3JS6A 4QS9A 2OANA 4FWOA 4DHYA 5AQVA 1BWFO 3MN6A 4IJAA 2ZF5O 3GOIA 1U2VA 4QS8A 5FPMA 4BROA 3DXMA 5ADXA 1QZ5A 5AQGA 5LJWA 4JHDA 3UKRA 3CJ9A 3HZ6A 3QMLA 1HKBA 3VEOA 4BRHA 4CZHA 2A3ZA 4BVPA 1T6DA 3O80A 5LJVA 4BC4A 4WQ4A 4DCHA 4BG9A 5BPMA 5I9EB 3G25A 3ATUA 4XH5A 1NGAA 3ZETB 1NGIA 4CBUA 5KQ8A 4CD1A 3ULEB 1JCEA 4BR0A 4EHTA 3L0QA 4HTLA 5EXWA 3SLCA 4QS7A 1GLJO 2PAVA 4CZFA 4BRLA 3FGUA 3O8MA 4FWPA 5AQUA 3HTVA 3DWLA 3VENA 2P9KB 5BREA 3HI0A 2IIRA 4O8KA 2P9PA 2FF6A 3VEWA 1X3NA 3MN5A 1QQMA 4J8FA 4M7XA 3WXKA 1R59O 3LDLA 3MK6A 4H5TA 3U8XA 2HMPA 4FPBA 3ID8A 4CZLA 1C0FA 1P8ZA 1MA9B 4B1YB 1BUPA 1SZ2A 2ZGYA
chains in the Genus database with same CATH superfamily
5EY4A 2KHOA 3QNOA 3ZT2A 1RBSA 5I42A 3THYA 4YNQA 4FJIA 4DV4K 5HL7L 3CI5A 4LSNA 3KIOA 2GWKA 3CXCM 3K2PA 4JYAK 4NCBA 4DTMA 2Q3SA 3KLGA 4BGAA 4WF9L 2HBMA 4BR4A 1O1WA 1B9FA 4CFBA 4DR7K 1D4XA 1W2BM 2QW9A 1U04A 3VQ6A 4H5RA 4NXNK 3CCRN 2P9SB 1G15A 3SI6A 1VQNN 4FJHA 1ATSA 3TABA 3A5MC 3QEPA 1VSDA 1FKOA 4BRDA 2BH1A 3VTIA 1QSYA 3N4QA 3R8EA 3C6UA 3TSUA 3LPTA 3AARA 1XUPO 3P31A 2RHKA 4KAZA 5C12A 4KH6A 4O55A 1ZXOA 3K5OA 4GVMA 1SL0A 5AQLA 3RWUA 3AY9A 1VQMN 4BQZA 1JLQA 3OHRA 2UUBK 4CF8A 4KHQA 1S9GA 4CGDA 2VGNA 3LDNA 4FK2A 4OPJA 1EO1A 3CJBA 2XO7A 3V9XA 3K0SA 3THVA 3E66A 1EXQA 1VQ4N 2QKKA 3DXKA 4I6MA 4X64K 4EP5A 4CEAA 3ENHA 5FLXO 2QTDA 1SKSA 1WSEA 3GBTA 2VYPA 4KPYA 2HOEA 4BWMA 1NGDA 4M3WA 1BGXT 2NRRA 3L4IA 4LF9K 3QBXA 2X6SA 3L2WA 5CYQA 3ZX3A 1SQKA 1NK9A 3HYFA 3AAPA 4ICLA 2KZMA 1D5AA 1DKGD 4YORA 4K25A 1TL1A 2P9UA 5AQRA 2YJEA 3LP1A 1XMQK 1N33K 4BDPA 2Z1HA 2A1RA 4CW7B 4JI3K 3QINA 4FJJA 3DAWA 1H1VA 4BREA 4FM1A 3LP2A 1T8EA 3T1YK 4CZIA 4NCGA 4CERA 2QWPA 4EP4A 4J2BA 2AJQA 1B9DA 1HUXA 1YIJN 2X6NA 4DF4A 4B9LA 2BUPA 4QCLA 3AVJA 4KV8A 2Q0RA 2GBZA 4DU4A 5JVGL 3AVFA 1OH5A 4FVMA 4C8KA 2ZJRL 3CCQN 3H3NO 4FWRA 4MQ3A 3DRRA 1U47A 4B9NA 1S1WA 3MDQA 4BRKA 1KTQA 4CEDA 4DV2K 5CYMA 4B9SA 2VCPA 4F4KA 2AA4A 5BN9A 1S72N 1NOYA 3OS2A 3VEZA 3FZHA 3VF4A 1T6CA 2ITGA 1NK4A 5B8HA 1NJIO 1OKJA 4YDUC 3TPQA 1YVUA 2ZD1A 4PL8A 4CEOA 4RWTA 1SV5A 5J2MA 4EHUA 1S5JA 3RTVA 2DFHA 3QBWA 3T1HK 4MO4A 1VK0A 5AQZA 3SJHA 1ASUA 3VEVA 5AZJA 4E7KA 4CIGA 3CERA 1T05A 2G8WA 3FZFA 4CHOA 3OYJA 3OYFA 3WXIA 1OH6A 4KTZA 3THWA 1M1KO 1OVQA 3G71N 2G8KA 4BACA 3ITHA 4CIEA 1JL1A 2NNWA 1GLLO 3S9HA 1WNSA 3KZBA 4FJ9A 2IVOA 1NGFA 4CGJA 5KPTA 3MXIA 1JL2A 2P9LB 2FBYA 2WONA 4CJ5A 3LDOA 3VQ7A 5AQNA 3CHWA 4RCHA 2HW3A 3J81O 4IOXA 1QSLA 4LFBK 3BUZB 3THXB 5J1EA 1NBWA 5JLFA 2O8CB 1YITN 4DTJA 2FSJA 1W7AA 3IAYA 4BE0A 2PZSA 2HBLA 3M8PA 4HCCA 4JKGB 2UU9K 4BRFA 5AQIA 5M1PA 1ZC6A 4B9MA 1HNWK 2DPNA 3MCAB 3NGYA 3OYIA 3EKUA 1NNEA 4H5WA 4Z0UA 2E2PA 4M3UA 4CE9A 4L8RB 3WNFA 5C2DA 2IVPA 1ESVA 3KKSA 3MWPA 4HUFA 3PSIA 3A5NC 4E7IA 1HQEA 2WOMA 3U9DA 3R6MA 3LZJA 4CEZA 5HOOA 3K5NA 4AILC 1QQCA 2QWNA 3NF7A 3D2EA 1U48A 1E3MA 2E8AA 5JICA 4GV9A 3VGMA 1VRTA 1WOQA 1Z05A 3K5MA 4JK9A 4FOIA 2YKMA 3K57A 4A62A 1UA0A 4CGGA 3ZEUA 5CY4A 3HSTB 3CYMA 2P5GA 3FZMA 1NOZA 2RE2A 3I8DA 4DTSA 4ELUA 4IFEA 3ZSXA 4CF1A 5HLFA 4N41A 4BR5A 2O8EA 3MXJA 3AA5X 1N6QA 4FWSA 2Q1NA 4AF1A 2A1SA 2E2NA 2V52B 2NUBA 2ASMA 4CJPA 4DB3A 4JRPA 2GUPA 3OS0A 4PY5A 1BQNA 1Q9YA 1HJRA 3VQPA 1OH7A 2HBJA 3LP0A 4DQSA 5AQKA 2V7ZA 4OX9K 4JK7A 3D45A 1KAXA 1RDBA 4FJNA 1X9JA 2IAJA 1P90A 4LF8K 1NK5A 2Q2RA 1WLJA 4AM7A 3BF3A 1L5UA 4YY3K 2QWOA 3G0ZA 1RGIA 1CZAN 4FYDA 3C7NA 1HYZA 4OJRA 4EAHD 2AP1A 2E88A 3V1OA 3HO1A 2GWJA 3DLHA 2HHQA 4LF7K 4CZEA 3NGIA 2NZTA 3K59A 4CI6A 3I8BA 4IO8A 2F8TA 2E1ZA 2OPPA 4I2QA 4A59A 3DXKB 1ZBHA 3NF8A 1O13A 5C42A 3NH0A 4CFCA 3M1FA 2P1JA 3ZT4A 4CJSA 1BISA 3WQUA 1BHLA 5AQOA 3JS6A 3AA3A 2RKIA 1S9EA 2DFFA 2QK9A 1U2VA 5IT9O 3B6OA 3VN5A 4GVEA 4JI8K 3NGZA 5D3GA 3SBGA 4JHDA 3ZT3A 1KLNA 4CGFA 2BE2A 3DLKA 3CM6A 1LAWA 2A3ZA 4RW8A 3LALA 2Z1JA 3O80A 4BC4A 4WQ4A 1GOAA 5BPMA 4IFYA 4WE1A 3DMJA 1NGAA 1NGIA 4NLBA 3TAQA 3O9UA 4EHTA 3PX6A 1D8YA 5EXWA 1GLJO 4CZFA 3SAFA 4BRLA 4FWPA 3VQCA 1T03A 3DWLA 4FLXA 3HI0A 2P9PA 5E41A 1D9FA 3SAGA 1K8AO 3S3OA 2OPQA 1QQMA 4DS4A 3AVHA 4M7XA 1R59O 3BY5A 3MK6A 4DU1A 3QEIA 2HMPA 3OBWA 4FPBA 4EZ6A 1C0FA 5T7BA 4B1YB 3PLAA 1SZ2A 3H08A 4JI1K 1NKCA 4B8AB 1WBBA 4WFNL 5C10A 3P4IA 3KLEA 3ZSRA 4DV1K 4FM2A 1BU6O 3LWMA 3HBTA 3OYCA 5LY3A 4Z4FA 3O9TA 5GAGP 3TAGA 1ASVA 3O3GA 3HK2A 4DSFA 1W0HA 3I33A 1YJ9N 5AZJB 2YCHA 1RDAA 4FOEA 3ZX2A 4UY8O 1ITGA 4CFDA 4JKCA 3THWB 5HROA 2GTDA 5EVZA 2OPSA 2YHXA 3W0LA 1KVBA 3TSQA 4YOXA 1CXQA 1TYQA 1WB9A 5C24A 4YOTA 4FWKA 4BC3A 3V9WA 5KRSA 4IFVA 4F2RA 3H46O 1CZBA 2A42A 3DM2A 4FLYA 4FJMA 4H03B 4JV5K 4I2PA 4ILHA 1IO2A 3GDQA 2E2QA 1YI2N 1TKZA 4PKGA 4CD3A 1TL3A 4NO7A 3CCVN 1HYSA 1Y97A 2YHWA 1RDCA 2D4WA 2V51B 1HJOA 4U67L 3DYAA 4Z4CA 4H0XB 3E9LA 2FLOA 1JLCA 2F9TA 4I7FA 3AGRA 3SMPA 4AHCA 1L3VA 5FRNA 3JSMA 1YJNN 3DI6A 3BP8A 2BDPA 3LDSA 4B1ZA 1RT2A 1NK0A 3VF6A 3PUFA 3R9PA 3IG1A 3WEEA 1REVA 2QXLA 1NK8A 4H0PA 3PX0A 1KCFA 2W42A 2VWJA 5BPLA 3EEQA 4A57A 4O8UA 3VEXA 3VQDA 4K8ZA 1NMNA 4DS5A 4KO0A 1B92A 3CQYA 4RW7A 2I7PA 1QHAA 4JD2B 3D2EB 3K58A 1IBLK 3QIPA 1TGOA 4BVOA 1GOBA 4CK2A 2XRIA 4N47A 1GLEG 4BC5A 3SZ2A 4E0DA 1DTTA 3KLHA 3MECA 2A6AA 3VQ4A 3KK1A 2PYLA 4DSLA 4DR3K 3BDPA 2YHBA 1JCFA 1ZBIA 3L2RA 4E7JA 1FXXA 3CMEN 4CJ3A 4OKKA 4NCAA 1SKWA 3PIPL 2W40A 4A2BA 4JRQA 2O8EB 3CJAA 1VRUA 4ID1A 1DT9A 1KLMA 4XH1A 4FJKA 1SAZA 5J2NA 3VGKA 4Z4EA 2W41A 3V9SA 2O8FA 1QQNA 3CCSN 1RBTA 4LF6K 5FPNA 2F9WA 4F3TA 1WSJA 1U49A 4CJTA 4E1MA 4PKIA 3BEXA 3UIQA 4XIUA 4FZYA 4N76A 2IGIA 2CGJA 4CJ7A 4X66K 4GKKK 3ZSZA 4ILJA 2V7YA 4YDUA 1NMDA 1S1TA 3LPUA 2D0BA 1T3VA 3CETA 3P1GA 1RDWX 2FBTA 3AVLA 2E2OA 2OYQA 2FC0A 5AQXA 3M8RA 1KRPA 4DSIA 1YAGA 1Y64A 4FM0A 4WFBL 4Z4GA 2YNFA 3WNEA 3P38A 4AM6A 3AVGA 4NLCA 2B4JA 1ATNA 3O6WA 4N56A 1NGEA 5AQMA 1CZ9A 3O9QA 4WQ5C 3H6EA 3KWIA 2VWKA 4ELTA 5FRMA 3E1YA 1LCUA 3CG7A 1HR0K 2E20A 3G10A 4H4OA 3KVGA 3O4QA 3CJ7A 1S1XA 4HHTA 3LAMA 1YXQA 4PUOA 1JXBA 4M45A 1G99A 2X74A 3FFIA 3H1VX 3ZSVA 5CHIA 3NFAA 4NB4A 3ASMA 2GV9A 3FE1A 4CZKA 3H1QA 5AJ3K 5LMNK 2KTQA 1C1CA 3D2FB 3AVAA 3EE8A 3JXUA 4FZXC 3M6GA 1RNHA 1QVFM 4BR7A 4C23A 3DLBA 4CK1A 1JLBA 2FSKA 1KD1O 2HHVA 1TKTA 3FLCO 2GEMA 4B1XB 4MLHA 4DQ8A 3L3VA 3UB5A 1GLFO 1RT6A 2D1KA 4PQUA 1L3TA 4H5VA 3AVIA 4ISGA 3WT0A 4A61A 1GLAG 4JAXA 3WXLA 3NBPA 2G8VA 2HHSA 3CMAN 3HOSA 4M7YA 3JAMO 4PL7A 4B3RK 1HQUA 2HHTA 2P9PB 5BN8A 4ISFA 1XHZA 3MX2A 1IKVA 2Y1IA 1X9MA 3V1RA 4UQGA 1KVCA 4B3OA 3ZCMA 2NRWA 1TKDA 3CCMN 5KGXA 3NVMA 4Z4HA 3NHGA 5AQHA 4W5RA 4KB1A 4BRMA 4C1NK 3L6QA 2DY4A 1JXEA 4M3YA 4JKDA 3U9ZA 4KREA 4CBXA 1V4SA 5JLHA 1SL1A 2YI1A 2YJFA 4DR2K 4DUZK 3QEWA 1KXPA 3HJFA 4FLVA 4JK8A 5FPEA 3PO5A 1LV5A 5BRDA 3SBTA 1IBMK 1BI4A 3VEYA 1YJWN 1EWRA 2G8UA 2VG5A 1VSKA 4FWNA 1TUYA 3V9ZA 3SCXA 3H45C 1VSLA 3EZWA 4DTUA 4CJUA 1J54A 5MLCQ 1RT1A 5DMRA 3O5BA 3AGKA 1FJGK 4FLUA 2IOCA 4LSLA 2OZMA 4DUYK 1NLVA 2UYTA 2UXBK 3VQQA 4E89A 2BANA 4AHTA 3OBYA 2W6LA 3RSEB 2PBDA 2E4LA 2QWQA 3LAKA 1S6PA 2O8DA 4M63C 4A5AA 3SPYA 4CF9A 5KTQA 5ADXH 4M3RA 3F73A 3ALYA 4CIFA 3NDKA 4KI6A 4Y1CA 1RT4A 4M3TA 1MU2A 4O5FA 2O8BA 3QESA 4J2DA 5FROA 3TAEA 2ZGZA 3MEDA 3LANA 3SK3A 3O08A 4JKFA 3QIOA 4DV7K 3WEEB 2ZE2A 1NGBA 2QWRA 4B1WB 1WAFA 3W3DA 4HWIA 4BRQA 5AQFA 2A40A 1V4TA 2WUSA 4YOWA 4CHPA 4E1JA 2YX6A 4CJLA 4W5TA 4DV0K 1WBDA 4RW4A 4B08A 2G8HA 4ID5A 5AQVA 1BWFO 3PX4A 3ZT0A 3AA2A 2ZF5O 5FPMA 2KFZA 2PFUA 4DFJA 4BROA 2O4IA 3DXMA 4KH5A 2KQ2A 5ADXA 2OCEA 4W5QA 5LJWA 3UKRA 4HUEA 2QI2A 1HYVA 3HZ6A 2UXDK 3QMLA 3RMBA 4CJVA 4JEPA 3OA9A 3NMUA 4CZHA 4BVPA 1T6DA 5LJVA 3KJVA 1NU0A 1RDUA 4AHSA 2E6LA 5KQ8A 4JI2K 4DTRA 4Q0BA 1JCEA 3VTHA 2XY6A 1C1AA 1IG9A 1VSHA 2XY8A 3CD6N 2HHUA 2PAVA 2O8FB 2F4VK 3TR8A 4R79A 1HRHA 3L2VA 3U6FA 4FJ7A 3HOTA 1YHQN 3THYB 3VQ5A 2JWKA 3O3FA 4OLAA 1TAUA 3TANA 3CCUN 3R3LA 5IWAK 1TAQA 3CC4N 4CJFA 1XHXA 1YTUA 1VAZA 4DTXA 1P8ZA 1MA9B 1RBVA 3HPOA 1BUPA 3M8QA 2ZGYA 3RMAA 4CEQA 1NM1A 1S3XA 3IUCA 3VOVA 2ETJA 4DV5K 1TKXA 4PWDA 3SUPA 3ZLJA 3P83D 3E01A 5GAHP 3OYLA 2ATQA 3P5JA 2ZJQL 4GMJB 3SPZA 3SQ2A 4OO1J 5AQPA 5AZIA 3BZKA 4C1NI 2ASOA 5C0YA 5HBMA 4BGBA 1RILA 3SMSA 3TTFA 3VF2A 2BTFA 3KWGA 4CF0A 1LW0A 3VGLA 3ZX0A 3EO3A 4LY7A 4CEBA 3HVTA 1ILYA 4PHTX 4KHPK 2XHBA 3VA0A 2EWSA 3S3MA 4KHSA 1J5OA 4B8CA 4X65K 3OYHA 1D9DA 2HMIA 3AVBA 1JCGA 3TTDA 4I9LA 1MWKA 2X78A 2OPRA 4JLHA 3V6DA 3L4QA 2F8SA 2E1YA 2HF4A 3UKUA 4I6MB 1UWBA 4YOVA 2CGKA 4J2AA 3C6HA 2XY5A 4FL9A 1LOTB 4R5PA 3EY1A 4I9QA 1Q82O 4QOZB 1BIUA 5EOYA 4CESA 3CFRA 3K9KA 3O1WA 4OPAA 1KAYA 4WFAL 3A5OC 5JS2A 4DTPA 2F7TA 2J4RA 4IEIA 1BCMA 1C0TA 3PV8A 3A8YA 4IEEA 3ZSOA 4ISEA 2P9UB 2VG6A 4IJNA 3ULDA 4FCYA 2QWMA 2LSNA 3Q7BA 4H8KA 5HP1A 1EKEA 3KLFA 4HTUA 2G8IA 1Z6RA 3OJUA 1IH7A 4CK3A 4B9UA 4F9OA 3LWLA 1J9AA 4J2EA 4FWMA 1VQ7N 3VQ8A 4DMNA 1X1PA 5J2QA 3CIPA 4H0YB 4GNIA 2UUCK 4RG8A 4BR9A 4IG0A 4K0KK 4F2SA 1ZBFA 5KPZA 4B1VA 2A5XA 5DK5A 5CZ2A 1SKRA 4JKHA 2OZSA 1GLBG 3WNGA 1NGHA 4MO5A 3GG4A 1XC3A 3OYMA 3S3NA 4KH4A 4C8MA 3SQ0A 3WXJA 5BR8K 3KK2A 3QDKA 4KBOA 1GLDG 2VG7A 3ULEA 1JLFA 1U6ZA 3K9JA 4DTNA 1WSGA 4CCHA 4K42A 1J53A 1EETA 2O4GA 5JMVA 4BRGA 3ENOA 1T44A 2P9KA 5GINA 5KI6A 4KI4A 1IG8A 1I3AA 1C0GA 1ATRA 5HRRA 1BO5O 4N5SA 3SUNA 4DQRA 4DSJA 1WSFA 3AO4A 1DTQA 4FVUA 2UXCK 3QB0A 1Q9XA 2O8DB 4LD0A 2OTJN 4ZTFA 4FW2A 5DM7L 3PIOL 1BA0A 1SS6A 3G6EN 1RT7A 4C8NA 5JS1A 4OKJA 2FBXA 4OPHA 3SV3A 2R7YA 5I3UA 4Z4IA 5AQTA 3QLHA 3TU5A 4IXCA 3A0IX 3KK3A 4CHYA 5M1FA 2VWBA 4ILGB 3CC7N 4B3TK 1WSHA 1LWFA 1XMOK 4JI4K 1YUWA 2CH6A 4LC9B 2ZQBA 4E3SA 2P51A 3OTOK 3CFPA 5GAEP 4CGIA 2HVHA 3IFRA 2QWLA 4CZGA 4IO9L 4H4MA 4DLEA 1IJJA 3EL2A 2VQFK 1XI1A 4CZJA 1YF5L 5M1OA 5BRHA 4FJLA 3HM8A 3DOLA 3G4SN 4MDAA 1K8KA 2WBNA 5KPRA 3L2QA 3UKRB 2DTUA 4U7BA 1Q7YO 4CECA 4AHVA 4KHWA 2HNYA 3RR7A 4BWJA 1NWKA 2IC3A 5SWMA 4DV3K 1MDUB 1RFQA 1RBRA 3C65A 4NYFA 3TTCA 1EX4A 3A2FA 3MEEA 3JYTA 3TAFA 1IKYA 4WCEL 2P9LA 4DR5K 4O44A 1RTJA 2RPIA 3I56N 2NRZA 4C8OA 3CQXA 3HSCA 4GV3A 3HP6A 2IDOA 4O4GA 3THXA 4K8XA 2YNGA 3ZEUB 1T7PA 1E4FT 1TV6A 4CVNE 3QICA 3MEGA 3AVNA 4MFBA 4KTQA 4KTWA 1QVGM 3AVKA 1HKGA 4CJKA 4JKGA 2CH5A 4LH5A 1OVYA 4JS5A 3TARA 4FLZA 1A5VA 3V9UA 1TK8A 1BIZA 1Q81O 4GW6A 4B1UB 4WQ4C 4FWQA 5AQYA 2QXFA 1ASWA 1IKWA 5E26A 2YNIA 3OYAA 3FZLA 5M1NA 2WFBA 3F9KA 4HCBA 3AO2A 4JI0K 3RVCA 3HRGA 5AZIB 3MN7A 4CFAA 4B9TA 4NYNA 2P9NA 4WYBA 4BRIA 2ITMA 1JKHA 1QHTA 3ENBA 2YHAA 1QQOA 3FR0A 4BRAA 3CPWM 2PYJA 1LWEA 4H0OA 4JI7K 3NF9A 3V4IA 3T69A 3D7EO 2NRHA 2HNZA 3C7NB 1KQSM 1CLQA 5C2FA 4CEFA 2P5OA 4JN4A 5KGWA 2EHGA 3OJSA 3IMXA 5LMUK 5H1SQ 4KHNA 1L3SA 3VPZA 1K73O 3QFUA 3CCEN 4FXDA 3DRPA 4F3OA 1RTIA 4E7HA 2H3GX 4YOUA 3UKUB 3IRXA 4DR4K 1EP4A 4BE2A 3AVMA 4FZZA 2PY5A 3EKSA 4CF2A 1HLUA 1RT5A 4DQQA 4RW6A 3KLIA 3WXMB 1BDGA 4AQYK 1U2VB 2ZWHA 4DWIA 3OYNA 5BPNA 5FPDA 3AO3A 4JS4A 4KFBA 1VQON 4ZHRA 1SL2A 1J6ZA 3FFKB 3CQ8A 2D0PA 4JHDB 3OY9A 3I55N 1S22A 2Y1JA 4DR1K 1KAZA 3CPEA 3RMCA 4MLEA 4FO0A 1VQKN 3RMDA 1QS4A 4DHYA 3RR8A 3MN6A 4IJAA 1J5EK 3GOIA 3PSFA 4QS8A 5CZ1A 3OYDA 4DU3A 1S1UA 3OS1A 4IOCL 1KFSA 4F8RA 3TSPA 1QZ5A 5K14A 2FBVA 3RRHA 2QKBA 3ZSQA 2D0AA 1HKBA 3VEOA 4BRHA 2B6AA 1KVAA 4W5OA 1C1BA 3LZIA 3E9OA 3G25A 3SUQA 3KD1E 3D6RA 1VSMA 1NJZA 1NK6A 4CD1A 3ULEB 3AO1A 4BR0A 3I0SA 3MX5A 4HTLA 4IKFA 3SLCA 4QS7A 4FJ8A 3SQ4A 3FGUA 2NRTA 4E7LA 2YKNA 4AH9A 3HTVA 1HMVA 4CGHA 4M3ZA 4LH4A 4CJEA 3VENA 2P9KB 5BREA 4O8KA 5C15A 1X3NA 1QTMA 3MN5A 4M3XA 2QEXN 5M1KA 1HNZK 4J8FA 1JLGA 2HVIA 2ZM6K 3LDLA 1ZBUA 5KRTA 4H5TA 3U8XA 3QEXA 4FW1A 3ID8A 4CZLA 3VA3A 3J7ZO 4EZ9A 4GKJK 1RDDA 1RTDA 2NRVA 3VETA 1ZYQA 1QSSA 2YNHA 3HPGA 3R1XA 2WC9A 1XNQK 1X9WA 2HHHK 1LW2A 4LF5K 4B9QA 3MXMA 3MWTA 3LM2A 3O4NA 1SUQA 1EQYA 2FF3B 4B3MK 1HNIA 4BC2A 1EWQA 3MCPA 1TYQB 5BRFA 4OGEA 4B3SK 2IS3A 3VQEA 4FPAA 4RW9A 3CM5A 1BL3A 2I7NA 1VHXA 2UUAK 4L3QA 4CJRA 3DOKA 4LF4K 1NGCA 4MDBA 4FLWA 4XH4A 3HVRA 4M42A 1IKXA 2YHYA 4HUGA 3O9RA 1VQ6N 3J7AP 4IDKA 1A5WA 3NCIA 4O0IA 1GOCA 3VQAA 2OA8A 2QM1A 1FKPA 3KHYA 1JLEA 4CHQA 4KRFA 1W97L 3QETA 2RN2A 1VQ8N 3J8AA 3DLGA 4DFPA 4W5NA 4CZMA 5CR4A 4LFCK 1K8KB 2Q36A 2NRXA 4CHZA 2P9IA 1UAXA 4DF8A 1QZ6A 3DRSA 4CHNA 4H0VB 4H5NA 4EIAA 2HHXA 4BR2A 1VSJA 5LL6Z 2RF2A 3OVNA 1TUUA 1X3MA 2KLAA 1KSPA 1IBKK 4DSEA 1VQ9N 5HRSA 2Q97A 3LDQA 5A2QO 3TWHA 4BG8A 4B9VA 4IBNA 5SZTA 1FK9A 5AQWA 3AO5A 5F0XA 1NGGA 4RTFD 1BCOA 1Q86O 3J7YP 1K6YA 5FDLA 1WSIA 5E84A 1F21A 3U3YA 1W9HA 1BOTO 4LFAK 2JLEA 4BE1A 3CJ1A 1YTAA 3LM9A 3GE1A 3BZCA 3SAHA 1QE1A 4DQIA 2E6MA 3ZSYA 3AAQA 3LDPA 2HB5A 4JKEA 4YHHK 1UA1A 1FW6A 4FJXA 1N36K 1BG3A 4FJ5A 1YVNA 4CJWA 4PKHA 5AQJA 3SV4A 3V1QA 3NH1A 5AQSA 3NH2A 1VSIA 4FK4A 4XEIA 1JLAA 1OH8A 3PY8A 5AFUH 3T1AA 2P9NB 4JD2A 1U45A 3ZETA 4ZTJA 1ZBLA 1WAJA 5TKWA 1HPZA 3SQ1A 3BGRA 3HM9A 3GL1A 2KZZA 2FXUA 4KHYA 3EN9A 2ZJPL 4DFMA 3OW2M 4Z94A 3OYBA 1XWLA 2KFNA 1JJ2M 4EFHA 3BF1A 3MAQA 1DEJA 3O3HA 3RRGA 4CJQA 1XC9A 1NGJA 1N5YA 5M1QA 3M3ZA 4OGCA 3TI0A 3J80O 2GX9A 3S41A 1HNVA 3F2KA 4IOAL 3CCJN 3WUHA 3P39A 2FSNA 3UE5A 4A5BA 2QA4N 5GIPA 1HX1A 3QFPA 3TAMA 3OYEA 4KB0A 4BRPA 3QNNA 4DG1A 3M5RA 5AFUA 2HSTA 3C0BA 1I94K 1KC8O 3AA4A 3DJCA 3M8SA 1NKEA 3DLEA 2D0CA 4BRCA 2E5LK 1C0UA 3MN9A 5BR9A 5CE3A 1TVRA 1UOCA 1MWMA 3ZT1A 4OLBA 1VQLN 3C95A 1A5XA 1Z25A 2P9SA 3C6TA 2HNDA 1ZBSA 1Z26A 4DTOA 3C6AA 1VQ5N 5F2RA 1NJWA 5EX5A 4E1NA 5EU7A 4FWLA 2Q0UA 4CBWA 1N34K 3SYZA 4BY9C 4Y1DA 3MMVA 1HKCA 3A5LC 4GY2B 4QAGA 4BQLA 3HP9A 5JVHL 4BRNA 3VESA 5KQDA 3F5TA 4JKAA 2ASPA 1VSEA 1Q18A 2XY7A 5AR0A 3B8AX 1S1VA 1M90O 4FJGA 4KHUA 4DQPA 1RCHA 3V81A 3FZKA 3LP3A 1VQPN 3KK7A 3WQTA 1RT3A 1WUAA 2HBKA 1E4GT 1RBUA 3F9MA 4IG3A 1R0AA 1C0MA 2D0OA 3IDHA 5J2PA 2HF3A 3D2FA 3AV9A 3NAEA 1KFDA 1Q8IA 2JGUA 3ID6A 4JNEA 4PA1A 3T7ZA 5HRPA 4DFKA 4CEEA 2W6KA 1XQSC 5ELZA 5HRNA 4KKOA 3T3FA 3ATVA 3VQBA 4NXMK 3U3GA 1NJYA 4IWVA 4Q5VA 4TSXA 1NG9A 1BI4B 2Z1IA 1C6VA 3VERA 3VMFB 2NLXA 2GUIA 2G8FA 1BA1A 3WNHA 4YOYA 4DSKA 1NKBA 3O4WA 4E19A 4OPKA 3EZ5A 3NE6A 3L8BA 3DLLL 1DGKN 4BDZA 4FK0A 3IS9A 3H3OB 5AQQA 4K41A 1GLCG 3L2UA 3PO4A 2GELA 4V19S 3L3UA 5TKYA 3OYGA 4O5BA 2I5JA 1NK7A 1K9MO 3O1BA 3VQ9A 3TAPA 3CF5L 4WQ5A 4GV6A 4DLGA 2Q31A 1NJXA 5GIOA 3EE9A 1N8RO 3KKRA 5C25A 4G9ZA 1I39A 4CJ4A 2O8BB 5F1XA 3SNNA 1HPMA 3N4PA 1XNRK 1DLOA 1VSFA 4JI5K 1BQMA 3CJCA 2EX3A 4H0TB 4IZ9A 2P9IB 3LL3A 4FSVA 2CGLA 3QO9A 4YFUA 3ZYYX 3D0PA 4OKEA 4Y0WA 3NVKA 4A2AA 1TK0A 3QEVA 4G1QA 3OYKA 3NF6A 1L3UA 5DM6L 3IKMA 3T19A 4DV6K 3SUOA 2HHWA 4AHUA 3KD5E 4BDYA 1TK5A 3RSEA 1LAVA 3DXMB 3ISNC 4DKWA 3QERA 3HXMA 5GADP 3U4LA 3SJJA 4HVJA 2IVNA 4K43A 4IDHA 3KTQA 3HL8A 3HT3A 2A41A 3C94A 4QS9A 1U4BA 2OANA 1CXUA 3AVCA 4FWOA 1IV0A 2KKZA 4JKBA 3DLRA 2KW4A 3CCLN 3EYZA 3B6PA 3ZSWA 4FLTA 3Q7CA 3O9SA 5AQGA 4AHRA 2WTUA 1HNXK 3CJ9A 3K5LA 4X62K 4ELVA 2BGGA 2O8CA 2B5JA 4DR6K 4JI6K 4DCHA 4BG9A 5I9EB 3HPHA 3ATUA 4XH5A 4M41A 3ZETB 4CBUA 2OTLN 4C8LA 3L0QA 1WN7A 2YV0X 1RTHA 1S6QA 3O8MA 5AQUA 1X9SA 1N32K 2VGMA 1LWCA 1YT3A 2IIRA 3CC2N 2FF6A 3E9PA 3VEWA 4OVLA 2F96A 2D5RA 2VQEK 4O0JA 3I0RA 3WXKA 2DFEA 3CFOA 2Z1GA 2JWLA
chains in the Genus database with same CATH topology
5EY4A 2KHOA 4WFNL 1NM1A 1S3XA 2WC9A 3R1XA 3IUCA 5C10A 3P4IA 3VOVA 4B9QA 1BU6O 3MWTA 3LM2A 1EQYA 2FF3B 3HBTA 4BC2A 3MCPA 1SZ2A 3CI5A 5HL7L 1TYQB 5BRFA 2GWKA 5LY3A 5GAHP 3O9TA 5GAGP 3CXCM 2ZJQL 4OO1J 4FPAA 5AQPA 4BGAA 4WF9L 2HBMA 5AZIA 3I33A 1YJ9N 2I7NA 4C1NI 2ASOA 5AZJB 5C0YA 4BGBA 4BR4A 2YCHA 4FOEA 3ZX2A 4UY8O 4L3QA 3SMSA 3TTFA 3VF2A 2BTFA 1NGCA 3KWGA 4MDBA 3VGLA 1D4XA 3ZX0A 2QW9A 3EO3A 4XH4A 1W2BM 4JKCA 1ILYA 2YHYA 4H5RA 4PHTX 2GTDA 3CCRN 2P9SB 5EVZA 3O9RA 1VQ6N 2YHXA 2EWSA 3W0LA 1VQNN 1ATSA 3TSQA 4YOXA 3A5MC 1TYQA 4BRDA 4YOTA 4FWKA 2BH1A 4BC3A 3VTIA 2QM1A 3N4QA 3R8EA 3TTDA 1JCGA 3KHYA 1MWKA 3H46O 1W97L 3TSUA 2A42A 4H03B 3AARA 1VQ8N 3J8AA 1XUPO 3P31A 2RHKA 4ILHA 3GDQA 4CZMA 5C12A 2E2QA 5CR4A 1YI2N 1K8KB 3L4QA 2Q36A 2E1YA 4KH6A 2NRXA 2HF4A 4PKGA 3UKUA 4CD3A 2P9IA 4I6MB 4NO7A 1QZ6A 1ZXOA 3CCVN 4YOVA 2YHWA 5AQLA 4H0VB 4H5NA 2V51B 2CGKA 2D4WA 4BR2A 4EIAA 1HJOA 3C6HA 4FL9A 1TUUA 1LOTB 1X3MA 4U67L 2KLAA 3E9LA 3AY9A 4H0XB 2FLOA 1Q82O 1VQ9N 2F9TA 1VQMN 4BQZA 3OHRA 3AGRA 5EOYA 3SMPA 2Q97A 2VGNA 3LDNA 3LDQA 3K9KA 3O1WA 4BG8A 3BP8A 4OPAA 1YJNN 1KAYA 4WFAL 1EO1A 3CJBA 3A5OC 5AQWA 4B1ZA 2F7TA 1NGGA 2J4RA 4IEIA 3VF6A 4RTFD 5F0XA 3E66A 1VQ4N 3R9PA 1Q86O 3DXKA 3WEEA 4I6MA 2QXLA 3A8YA 4IEEA 4YOWA 4H0PA 4ISEA 3ENHA 2P9UB 4IJNA 2QTDA 5BPLA 2QWMA 3GBTA 5E84A 2VYPA 4A57A 1BOTO 4O8UA 2HOEA 3Q7BA 3VEXA 1NGDA 3CJ1A 2NRRA 3L4IA 3LM9A 3QBXA 3CQYA 3GE1A 2I7PA 1Z6RA 1QHAA 4JD2B 3D2EB 1SQKA 3ZX3A 3AAPA 4F9OA 3SAHA 4FWMA 4BVOA 1VQ7N 3AAQA 3LDPA 3CIPA 4JKEA 4H0YB 1GLEG 4BC5A 4GNIA 2A6AA 1BG3A 4BR9A 1DKGD 1YVNA 4B1VA 5KPZA 4PKHA 5AQJA 2A5XA 4YORA 4K25A 2P9UA 5AQRA 1JCFA 5AQSA 4JKHA 3CMEN 2YJEA 1GLBG 1NGHA 4XEIA 3PIPL 2W40A 4MO5A 4A2BA 3DAWA 3GG4A 3CJAA 1H1VA 4BREA 5AFUH 1XC3A 2P9NB 4JD2A 3ZETA 4KH4A 3WXJA 1DT9A 4CZIA 3QDKA 4KBOA 5TKWA 1GLDG 3ULEA 4XH1A 1U6ZA 1SAZA 2QWPA 3K9JA 3VGKA 2W41A 3GL1A 2FXUA 1HUXA 1YIJN 4K42A 1QQNA 2BUPA 3CCSN 5FPNA 2F9WA 3EN9A 5JMVA 4BRGA 2ZJPL 3ENOA 4PKIA 2Q0RA 3BEXA 4Z94A 1T44A 3OW2M 2P9KA 5JVGL 1JJ2M 4EFHA 3BF1A 5GINA 1DEJA 1IG8A 2ZJRL 3CCQN 1NGJA 2CGJA 3H3NO 1C0GA 5M1QA 4FWRA 4CJ7A 1ATRA 1BO5O 3MDQA 4BRKA 3M3ZA 4ILJA 2GX9A 2V7YA 4YDUA 1NMDA 3S41A 4FVUA 3QB0A 1T3VA 3CETA 2VCPA 3F2KA 4IOAL 2AA4A 3CCJN 3WUHA 1RDWX 5BN9A 1S72N 2OTJN 3P39A 2FSNA 3FZHA 3UE5A 3VEZA 3VF4A 4A5BA 5GIPA 2QA4N 1HX1A 1T6CA 3QFPA 5DM7L 3PIOL 1BA0A 2E2OA 4BRPA 5B8HA 3M5RA 5AFUA 2HSTA 5AQXA 1NJIO 1OKJA 1SS6A 4YDUC 3TPQA 4RWTA 3G6EN 4PL8A 4OPHA 3C0BA 4EHUA 1YAGA 1Y64A 1KC8O 4WFBL 3DJCA 3QBWA 3P38A 4MO4A 4BRCA 4AM6A 5AQTA 5AQZA 3SJHA 3MN9A 3VEVA 4NLCA 5AZJA 1ATNA 3O6WA 1NGEA 5BR9A 5CE3A 3CERA 5AQMA 3TU5A 4IXCA 3A0IX 3O9QA 4WQ5C 3H6EA 3KWIA 2VWBA 4ILGB 5M1FA 3FZFA 1MWMA 3CC7N 3E1YA 1LCUA 3WXIA 2E20A 1VQLN 1YUWA 3KVGA 2CH6A 4LC9B 3CJ7A 1M1KO 3G71N 2P9SA 1YXQA 5GAEP 1ZBSA 2NNWA 1VQ5N 1GLLO 3C6AA 1G99A 3IFRA 5F2RA 3H1VX 5EX5A 2QWLA 3KZBA 5CHIA 4CZGA 4FWLA 2IVOA 1NGFA 2Q0UA 4NB4A 4IO9L 5KPTA 1IJJA 2P9LB 4CBWA 3FE1A 3EL2A 3H1QA 4CZKA 4CZJA 1YF5L 3LDOA 5M1OA 4BY9C 5AQNA 5BRHA 3CHWA 4RCHA 3MMVA 1HKCA 3A5LC 3D2FB 3HM8A 3EE8A 3G4SN 4GY2B 4MDAA 3JXUA 1K8KA 2WBNA 4IOXA 5KPRA 3M6GA 3UKRB 4BQLA 3BUZB 4U7BA 4BRNA 5JVHL 1Q7YO 3VESA 1QVFM 4BR7A 5KQDA 4C23A 1NWKA 3F5TA 4JKAA 2ASPA 1NBWA 1Q18A 5JLFA 5AR0A 2FSKA 3B8AX 1YITN 1MDUB 1RFQA 1KD1O 2FSJA 3C65A 3FLCO 1M90O 2GEMA 4B1XB 4MLHA 3TTCA 2HBLA 3FZKA 4DQ8A 4WCEL 1VQPN 3KK7A 2P9LA 3UB5A 1GLFO 4JKGB 3WQTA 2D1KA 1WUAA 2HBKA 1E4GT 3F9MA 4BRFA 3IDHA 2D0OA 4H5VA 2HF3A 3D2FA 5AQIA 4ISGA 5M1PA 1ZC6A 2NRZA 3WT0A 4A61A 3I56N 1GLAG 3CQXA 3HSCA 4JAXA 3WXLA 2DPNA 3ID6A 3MCAB 4JNEA 3T7ZA 3CMAN 4GV3A 3EKUA 4H5WA 2E2PA 3HOSA 4M7YA 4PL7A 5C2DA 2P9PB 2IVPA 1ESVA 1E4FT 1XQSC 3MWPA 4ISFA 5ELZA 3ZEUB 5BN8A 3QICA 3A5NC 3U9DA 3VETA 1QVGM 3ATVA 3MX2A 3R6MA 4IWVA 1HKGA 5HOOA 2NRWA 4JKGA 2CH5A 3CCMN 2QWNA 3VERA 1OVYA 3D2EA 3NVMA 3VMFB 2E8AA 2NLXA 5JICA 5AQHA 4GV9A 3VGMA 1BA1A 1WOQA 1Z05A 4BRMA 1Q81O 4JK9A 4B1UB 4FOIA 4FWQA 4WQ4C 5AQYA 4C1NK 4YOYA 3L6QA 4A62A 4JKDA 3O4WA 3ZEUA 5E26A 3U9ZA 4CBXA 3DLLL 1V4SA 3FZMA 2RE2A 5JLHA 1DGKN 2YI1A 2YJFA 3FZLA 5M1NA 2WFBA 1KXPA 4IFEA 3H3OB 4JK8A 5AQQA 3RVCA 3HRGA 4K41A 5FPEA 1GLCG 5AZIB 5BRDA 3MN7A 4BR5A 3SBTA 3VEYA 2P9NA 1YJWN 4WYBA 4BRIA 2ITMA 4FWSA 2GELA 2Q1NA 3ENBA 4AF1A 2E2NA 1QQOA 5TKYA 2V52B 3FR0A 4BRAA 3CPWM 2ASMA 4FWNA 4DB3A 1TUYA 4H0OA 2GUPA 3H45C 3T69A 3EZWA 1K9MO 3O1BA 3D7EO 2NRHA 2HBJA 5MLCQ 3CF5L 3C7NB 4WQ5A 1KQSM 4GV6A 5AQKA 2V7ZA 2Q31A 5C2FA 3O5BA 5GIOA 3AGKA 3EE9A 4JK7A 4JN4A 3IMXA 1N8RO 4G9ZA 1KAXA 1NLVA 5F1XA 5H1SQ 1X9JA 1P90A 2UYTA 1HPMA 3N4PA 2Q2RA 3VPZA 1K73O 3OBYA 4AM7A 3QFUA 3CCEN 3BF3A 2PBDA 3RSEB 3CJCA 2QWQA 4H0TB 4IZ9A 2H3GX 4M63C 4YOUA 3UKUB 4A5AA 2P9IB 3LL3A 4FSVA 2CGLA 2QWOA 1RGIA 3ZYYX 3EKSA 4Y0WA 3NVKA 1CZAN 3C7NA 5ADXH 4A2AA 4EAHD 2AP1A 1HLUA 2E88A 4O5FA 2GWJA 5DM6L 3WXMB 1BDGA 4CZEA 3IKMA 1U2VB 2ZGZA 2NZTA 2ZWHA 4CI6A 3SK3A 5BPNA 5FPDA 3I8BA 3O08A 3RSEA 4IO8A 3DXMB 1VQON 4JKFA 1J6ZA 2E1ZA 4A59A 4DKWA 3DXKB 3FFKB 3WEEB 2D0PA 1NGBA 5GADP 1O13A 2QWRA 4JHDB 3U4LA 1S22A 3W3DA 4HWIA 4B1WB 3I55N 2IVNA 1KAZA 3M1FA 4BRQA 5AQFA 2A40A 1V4TA 2WUSA 3CPEA 4K43A 3WQUA 4IDHA 4E1JA 5AQOA 4MLEA 2YX6A 4FO0A 1VQKN 2A41A 3JS6A 4QS9A 2OANA 4FWOA 4DHYA 5AQVA 1BWFO 2KKZA 3MN6A 4IJAA 2ZF5O 4JKBA 3GOIA 1U2VA 4QS8A 5FPMA 2PFUA 3CCLN 4BROA 4IOCL 3DXMA 3TSPA 4GVEA 4KH5A 3Q7CA 5ADXA 1QZ5A 3O9SA 5AQGA 5LJWA 3SBGA 4JHDA 3UKRA 2QI2A 3CJ9A 3HZ6A 3QMLA 1HKBA 3NMUA 4JEPA 3OA9A 3VEOA 4BRHA 4CZHA 2A3ZA 4BVPA 1T6DA 3O80A 5LJVA 4BC4A 1RDUA 4WQ4A 4DCHA 4BG9A 5BPMA 5I9EB 3E9OA 3ATUA 3G25A 4XH5A 1NGAA 3ZETB 1NGIA 4NLBA 4CBUA 3D6RA 5KQ8A 2OTLN 3O9UA 4CD1A 3ULEB 1JCEA 3VTHA 4BR0A 4EHTA 3L0QA 3MX5A 4HTLA 5EXWA 3CD6N 3SLCA 4QS7A 1GLJO 2PAVA 4CZFA 3SAFA 4BRLA 3FGUA 3O8MA 4FWPA 5AQUA 2NRTA 4R79A 2VGMA 3HTVA 3HOTA 1YHQN 3DWLA 3VENA 2P9KB 5BREA 3HI0A 2IIRA 4O8KA 2P9PA 2FF6A 2JWKA 3E9PA 5C15A 3VEWA 3CC2N 1X3NA 3SAGA 3MN5A 1K8AO 2QEXN 1QQMA 5M1KA 4J8FA 4M7XA 3CCUN 3R3LA 3WXKA 1R59O 3LDLA 3MK6A 3CC4N 4H5TA 3U8XA 2HMPA 3OBWA 4FPBA 3ID8A 1VAZA 4CZLA 3J7ZO 1C0FA 1P8ZA 1MA9B 4B1YB 3PLAA 2NRVA 1BUPA 2JWLA 2ZGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EY4 A;  2KHO A;  1NM1 A;  1S3X A;  3IUC A;  3P4I A;  3VOV A;  4B9Q A;  1BU6 O;  3LM2 A;  1EQY A;  2FF3 B;  3HBT A;  4BC2 A;  3MCP A;  3CI5 A;  1TYQ B;  5BRF A;  2GWK A;  5LY3 A;  4FPA A;  5AQP A;  4BGA A;  5AZI A;  3I33 A;  2I7N A;  2ASO A;  5AZJ B;  4BGB A;  4BR4 A;  2YCH A;  4FOE A;  3ZX2 A;  4L3Q A;  3SMS A;  3VF2 A;  2BTF A;  1NGC A;  3VGL A;  1D4X A;  3ZX0 A;  2QW9 A;  3EO3 A;  4XH4 A;  2YHY A;  4H5R A;  2GTD A;  2P9S B;  5EVZ A;  2YHX A;  2EWS A;  3W0L A;  1ATS A;  3A5M C;  1TYQ A;  4BRD A;  4FWK A;  4BC3 A;  2QM1 A;  3R8E A;  1JCG A;  3KHY A;  1MWK A;  3H46 O;  2A42 A;  4H03 B;  3AAR A;  3J8A A;  1XUP O;  3GDQ A;  4CZM A;  2E2Q A;  1K8K B;  2Q36 A;  2E1Y A;  2HF4 A;  4PKG A;  3UKU A;  4CD3 A;  2P9I A;  4I6M B;  4NO7 A;  1QZ6 A;  1ZXO A;  2YHW A;  5AQL A;  4H0V B;  4H5N A;  2V51 B;  2CGK A;  2D4W A;  4BR2 A;  4EIA A;  1HJO A;  4FL9 A;  1TUU A;  1LOT B;  1X3M A;  4H0X B;  3AY9 A;  2FLO A;  2F9T A;  4BQZ A;  3OHR A;  5EOY A;  3SMP A;  2Q97 A;  3LDN A;  3LDQ A;  3O1W A;  4BG8 A;  3BP8 A;  1KAY A;  3CJB A;  3A5O C;  5AQW A;  4B1Z A;  5F0X A;  1NGG A;  2J4R A;  3VF6 A;  4RTF D;  3R9P A;  3DXK A;  3WEE A;  4I6M A;  2QXL A;  3A8Y A;  4H0P A;  4ISE A;  3ENH A;  2P9U B;  4IJN A;  5BPL A;  2QWM A;  3GBT A;  5E84 A;  2VYP A;  1BOT O;  2HOE A;  3VEX A;  1NGD A;  3CJ1 A;  3L4I A;  3LM9 A;  3QBX A;  3CQY A;  3GE1 A;  2I7P A;  1Z6R A;  1QHA A;  4JD2 B;  3D2E B;  1SQK A;  3ZX3 A;  3AAP A;  4F9O A;  4FWM A;  4BVO A;  3AAQ A;  3LDP A;  3CIP A;  4H0Y B;  1GLE G;  4BC5 A;  4GNI A;  2A6A A;  1BG3 A;  4BR9 A;  1DKG D;  1YVN A;  4B1V A;  5KPZ A;  4PKH A;  5AQJ A;  2A5X A;  4K25 A;  2P9U A;  5AQR A;  1JCF A;  5AQS A;  2YJE A;  1GLB G;  1NGH A;  4XEI A;  2W40 A;  4MO5 A;  4A2B A;  3DAW A;  3GG4 A;  3CJA A;  1H1V A;  4BRE A;  5AFU H;  1XC3 A;  2P9N B;  4JD2 A;  3ZET A;  3WXJ A;  4CZI A;  3QDK A;  4KBO A;  1GLD G;  3ULE A;  4XH1 A;  1U6Z A;  1SAZ A;  2QWP A;  3VGK A;  2W41 A;  3GL1 A;  2FXU A;  1HUX A;  4K42 A;  1QQN A;  2BUP A;  5FPN A;  2F9W A;  3EN9 A;  5JMV A;  4BRG A;  3ENO A;  4PKI A;  2Q0R A;  3BEX A;  4Z94 A;  1T44 A;  2P9K A;  4EFH A;  3BF1 A;  1DEJ A;  1IG8 A;  1NGJ A;  2CGJ A;  3H3N O;  1C0G A;  4FWR A;  4CJ7 A;  1ATR A;  1BO5 O;  3MDQ A;  4BRK A;  3M3Z A;  2V7Y A;  4YDU A;  3S41 A;  1NMD A;  3QB0 A;  3CET A;  2VCP A;  2AA4 A;  3WUH A;  1RDW X;  5BN9 A;  2FSN A;  3FZH A;  3UE5 A;  3VEZ A;  3VF4 A;  1HX1 A;  1T6C A;  3QFP A;  1BA0 A;  2E2O A;  4BRP A;  5B8H A;  5AFU A;  5AQX A;  1OKJ A;  4YDU C;  3TPQ A;  4RWT A;  4PL8 A;  3C0B A;  4EHU A;  1YAG A;  1Y64 A;  3DJC A;  3QBW A;  4MO4 A;  4BRC A;  4AM6 A;  5AQT A;  5AQZ A;  3SJH A;  3MN9 A;  3VEV A;  5AZJ A;  1ATN A;  3O6W A;  1NGE A;  5BR9 A;  5CE3 A;  3CER A;  5AQM A;  3TU5 A;  4IXC A;  3A0I X;  4WQ5 C;  3H6E A;  2VWB A;  3FZF A;  1MWM A;  1LCU A;  3WXI A;  2E20 A;  1YUW A;  3KVG A;  2CH6 A;  4LC9 B;  3CJ7 A;  2P9S A;  1YXQ A;  1ZBS A;  1GLL O;  3IFR A;  1G99 A;  5F2R A;  3H1V X;  5EX5 A;  2QWL A;  3KZB A;  4CZG A;  4FWL A;  2IVO A;  1NGF A;  2Q0U A;  4NB4 A;  5KPT A;  1IJJ A;  2P9L B;  4CBW A;  3FE1 A;  3EL2 A;  3H1Q A;  4CZK A;  4CZJ A;  3LDO A;  5AQN A;  5BRH A;  3CHW A;  4RCH A;  3MMV A;  1HKC A;  3A5L C;  3D2F B;  3HM8 A;  4GY2 B;  3JXU A;  1K8K A;  5KPR A;  3M6G A;  3UKR B;  4BQL A;  3BUZ B;  4BRN A;  3VES A;  4BR7 A;  5KQD A;  4C23 A;  1NWK A;  2ASP A;  1NBW A;  1Q18 A;  5JLF A;  5AR0 A;  2FSK A;  3B8A X;  1MDU B;  1RFQ A;  2FSJ A;  3FLC O;  2GEM A;  4B1X B;  4MLH A;  3FZK A;  4DQ8 A;  2P9L A;  3UB5 A;  1GLF O;  3WQT A;  2D1K A;  1WUA A;  1E4G T;  3F9M A;  4BRF A;  3IDH A;  2D0O A;  4H5V A;  2HF3 A;  3D2F A;  5AQI A;  4ISG A;  1ZC6 A;  3WT0 A;  4A61 A;  1GLA G;  3CQX A;  3HSC A;  4JAX A;  3WXL A;  2DPN A;  4JNE A;  3EKU A;  4H5W A;  2E2P A;  4M7Y A;  4PL7 A;  2P9P B;  2IVP A;  1ESV A;  1E4F T;  1XQS C;  5ELZ A;  4ISF A;  3ZEU B;  5BN8 A;  3QIC A;  3A5N C;  3U9D A;  3VET A;  3ATV A;  3R6M A;  4IWV A;  1HKG A;  2CH5 A;  2QWN A;  3VER A;  3D2E A;  2E8A A;  2NLX A;  5JIC A;  5AQH A;  3VGM A;  1BA1 A;  1WOQ A;  1Z05 A;  4BRM A;  4B1U B;  4FOI A;  4FWQ A;  4WQ4 C;  5AQY A;  3L6Q A;  4A62 A;  3O4W A;  3ZEU A;  5E26 A;  3U9Z A;  4CBX A;  1V4S A;  3FZM A;  5JLH A;  1DGK N;  2YI1 A;  2YJF A;  3FZL A;  1KXP A;  3H3O B;  5AQQ A;  4K41 A;  5FPE A;  1GLC G;  5AZI B;  5BRD A;  3MN7 A;  4BR5 A;  3VEY A;  2P9N A;  4WYB A;  4BRI A;  2ITM A;  4FWS A;  2GEL A;  2Q1N A;  2E2N A;  1QQO A;  5TKY A;  2V52 B;  3FR0 A;  4BRA A;  2ASM A;  4FWN A;  4DB3 A;  1TUY A;  4H0O A;  2GUP A;  3H45 C;  3EZW A;  3O1B A;  3D7E O;  2NRH A;  3C7N B;  4WQ5 A;  5AQK A;  2V7Z A;  2Q31 A;  3O5B A;  4JN4 A;  3IMX A;  1KAX A;  1NLV A;  5F1X A;  1X9J A;  2UYT A;  1HPM A;  2Q2R A;  3VPZ A;  4AM7 A;  3QFU A;  3BF3 A;  2PBD A;  3RSE B;  3CJC A;  2QWQ A;  4H0T B;  4IZ9 A;  2H3G X;  4M63 C;  3UKU B;  2P9I B;  3LL3 A;  4FSV A;  2CGL A;  2QWO A;  1RGI A;  3EKS A;  4Y0W A;  1CZA N;  3C7N A;  5ADX H;  4A2A A;  4EAH D;  2AP1 A;  1HLU A;  2E88 A;  4O5F A;  2GWJ A;  1BDG A;  4CZE A;  1U2V B;  2ZGZ A;  2NZT A;  2ZWH A;  4CI6 A;  3SK3 A;  5BPN A;  5FPD A;  3I8B A;  3O08 A;  3RSE A;  4IO8 A;  3DXM B;  1J6Z A;  2E1Z A;  3DXK B;  3FFK B;  3WEE B;  2D0P A;  1NGB A;  2QWR A;  4JHD B;  3U4L A;  4B1W B;  1S22 A;  3W3D A;  4HWI A;  2IVN A;  1KAZ A;  3M1F A;  4BRQ A;  5AQF A;  2A40 A;  1V4T A;  2WUS A;  4K43 A;  3WQU A;  4E1J A;  5AQO A;  4MLE A;  4FO0 A;  2A41 A;  3JS6 A;  4QS9 A;  2OAN A;  4FWO A;  4DHY A;  5AQV A;  1BWF O;  3MN6 A;  4IJA A;  2ZF5 O;  3GOI A;  1U2V A;  4QS8 A;  5FPM A;  4BRO A;  3DXM A;  5ADX A;  1QZ5 A;  5AQG A;  5LJW A;  4JHD A;  3UKR A;  3CJ9 A;  3HZ6 A;  3QML A;  1HKB A;  3VEO A;  4BRH A;  4CZH A;  2A3Z A;  4BVP A;  1T6D A;  3O80 A;  5LJV A;  4BC4 A;  4WQ4 A;  4DCH A;  4BG9 A;  5BPM A;  5I9E B;  3G25 A;  3ATU A;  4XH5 A;  1NGA A;  3ZET B;  1NGI A;  4CBU A;  5KQ8 A;  4CD1 A;  3ULE B;  1JCE A;  4BR0 A;  4EHT A;  3L0Q A;  4HTL A;  5EXW A;  3SLC A;  4QS7 A;  1GLJ O;  2PAV A;  4CZF A;  4BRL A;  3FGU A;  3O8M A;  4FWP A;  5AQU A;  3HTV A;  3DWL A;  3VEN A;  2P9K B;  5BRE A;  3HI0 A;  2IIR A;  4O8K A;  2P9P A;  2FF6 A;  3VEW A;  1X3N A;  3MN5 A;  1QQM A;  4J8F A;  4M7X A;  3WXK A;  1R59 O;  3LDL A;  3MK6 A;  4H5T A;  3U8X A;  2HMP A;  4FPB A;  3ID8 A;  4CZL A;  1C0F A;  1P8Z A;  1MA9 B;  4B1Y B;  1BUP A;  1SZ2 A;  2ZGY A; 
#chains in the Genus database with same CATH topology
 5EY4 A;  2KHO A;  3QNO A;  3ZT2 A;  1RBS A;  5I42 A;  3THY A;  4YNQ A;  4FJI A;  4DV4 K;  5HL7 L;  3CI5 A;  4LSN A;  3KIO A;  2GWK A;  3CXC M;  3K2P A;  4JYA K;  4NCB A;  4DTM A;  2Q3S A;  3KLG A;  4BGA A;  4WF9 L;  2HBM A;  4BR4 A;  1O1W A;  1B9F A;  4CFB A;  4DR7 K;  1D4X A;  1W2B M;  2QW9 A;  1U04 A;  3VQ6 A;  4H5R A;  4NXN K;  3CCR N;  2P9S B;  1G15 A;  3SI6 A;  1VQN N;  4FJH A;  1ATS A;  3TAB A;  3A5M C;  3QEP A;  1VSD A;  1FKO A;  4BRD A;  2BH1 A;  3VTI A;  1QSY A;  3N4Q A;  3R8E A;  3C6U A;  3TSU A;  3LPT A;  3AAR A;  1XUP O;  3P31 A;  2RHK A;  4KAZ A;  5C12 A;  4KH6 A;  4O55 A;  1ZXO A;  3K5O A;  4GVM A;  1SL0 A;  5AQL A;  3RWU A;  3AY9 A;  1VQM N;  4BQZ A;  1JLQ A;  3OHR A;  2UUB K;  4CF8 A;  4KHQ A;  1S9G A;  4CGD A;  2VGN A;  3LDN A;  4FK2 A;  4OPJ A;  1EO1 A;  3CJB A;  2XO7 A;  3V9X A;  3K0S A;  3THV A;  3E66 A;  1EXQ A;  1VQ4 N;  2QKK A;  3DXK A;  4I6M A;  4X64 K;  4EP5 A;  4CEA A;  3ENH A;  5FLX O;  2QTD A;  1SKS A;  1WSE A;  3GBT A;  2VYP A;  4KPY A;  2HOE A;  4BWM A;  1NGD A;  4M3W A;  1BGX T;  2NRR A;  3L4I A;  4LF9 K;  3QBX A;  2X6S A;  3L2W A;  5CYQ A;  3ZX3 A;  1SQK A;  1NK9 A;  3HYF A;  3AAP A;  4ICL A;  2KZM A;  1D5A A;  1DKG D;  4YOR A;  4K25 A;  1TL1 A;  2P9U A;  5AQR A;  2YJE A;  3LP1 A;  1XMQ K;  1N33 K;  4BDP A;  2Z1H A;  2A1R A;  4CW7 B;  4JI3 K;  3QIN A;  4FJJ A;  3DAW A;  1H1V A;  4BRE A;  4FM1 A;  3LP2 A;  1T8E A;  3T1Y K;  4CZI A;  4NCG A;  4CER A;  2QWP A;  4EP4 A;  4J2B A;  2AJQ A;  1B9D A;  1HUX A;  1YIJ N;  2X6N A;  4DF4 A;  4B9L A;  2BUP A;  4QCL A;  3AVJ A;  4KV8 A;  2Q0R A;  2GBZ A;  4DU4 A;  5JVG L;  3AVF A;  1OH5 A;  4FVM A;  4C8K A;  2ZJR L;  3CCQ N;  3H3N O;  4FWR A;  4MQ3 A;  3DRR A;  1U47 A;  4B9N A;  1S1W A;  3MDQ A;  4BRK A;  1KTQ A;  4CED A;  4DV2 K;  5CYM A;  4B9S A;  2VCP A;  4F4K A;  2AA4 A;  5BN9 A;  1S72 N;  1NOY A;  3OS2 A;  3VEZ A;  3FZH A;  3VF4 A;  1T6C A;  2ITG A;  1NK4 A;  5B8H A;  1NJI O;  1OKJ A;  4YDU C;  3TPQ A;  1YVU A;  2ZD1 A;  4PL8 A;  4CEO A;  4RWT A;  1SV5 A;  5J2M A;  4EHU A;  1S5J A;  3RTV A;  2DFH A;  3QBW A;  3T1H K;  4MO4 A;  1VK0 A;  5AQZ A;  3SJH A;  1ASU A;  3VEV A;  5AZJ A;  4E7K A;  4CIG A;  3CER A;  1T05 A;  2G8W A;  3FZF A;  4CHO A;  3OYJ A;  3OYF A;  3WXI A;  1OH6 A;  4KTZ A;  3THW A;  1M1K O;  1OVQ A;  3G71 N;  2G8K A;  4BAC A;  3ITH A;  4CIE A;  1JL1 A;  2NNW A;  1GLL O;  3S9H A;  1WNS A;  3KZB A;  4FJ9 A;  2IVO A;  1NGF A;  4CGJ A;  5KPT A;  3MXI A;  1JL2 A;  2P9L B;  2FBY A;  2WON A;  4CJ5 A;  3LDO A;  3VQ7 A;  5AQN A;  3CHW A;  4RCH A;  2HW3 A;  3J81 O;  4IOX A;  1QSL A;  4LFB K;  3BUZ B;  3THX B;  5J1E A;  1NBW A;  5JLF A;  2O8C B;  1YIT N;  4DTJ A;  2FSJ A;  1W7A A;  3IAY A;  4BE0 A;  2PZS A;  2HBL A;  3M8P A;  4HCC A;  4JKG B;  2UU9 K;  4BRF A;  5AQI A;  5M1P A;  1ZC6 A;  4B9M A;  1HNW K;  2DPN A;  3MCA B;  3NGY A;  3OYI A;  3EKU A;  1NNE A;  4H5W A;  4Z0U A;  2E2P A;  4M3U A;  4CE9 A;  4L8R B;  3WNF A;  5C2D A;  2IVP A;  1ESV A;  3KKS A;  3MWP A;  4HUF A;  3PSI A;  3A5N C;  4E7I A;  1HQE A;  2WOM A;  3U9D A;  3R6M A;  3LZJ A;  4CEZ A;  5HOO A;  3K5N A;  4AIL C;  1QQC A;  2QWN A;  3NF7 A;  3D2E A;  1U48 A;  1E3M A;  2E8A A;  5JIC A;  4GV9 A;  3VGM A;  1VRT A;  1WOQ A;  1Z05 A;  3K5M A;  4JK9 A;  4FOI A;  2YKM A;  3K57 A;  4A62 A;  1UA0 A;  4CGG A;  3ZEU A;  5CY4 A;  3HST B;  3CYM A;  2P5G A;  3FZM A;  1NOZ A;  2RE2 A;  3I8D A;  4DTS A;  4ELU A;  4IFE A;  3ZSX A;  4CF1 A;  5HLF A;  4N41 A;  4BR5 A;  2O8E A;  3MXJ A;  3AA5 X;  1N6Q A;  4FWS A;  2Q1N A;  4AF1 A;  2A1S A;  2E2N A;  2V52 B;  2NUB A;  2ASM A;  4CJP A;  4DB3 A;  4JRP A;  2GUP A;  3OS0 A;  4PY5 A;  1BQN A;  1Q9Y A;  1HJR A;  3VQP A;  1OH7 A;  2HBJ A;  3LP0 A;  4DQS A;  5AQK A;  2V7Z A;  4OX9 K;  4JK7 A;  3D45 A;  1KAX A;  1RDB A;  4FJN A;  1X9J A;  2IAJ A;  1P90 A;  4LF8 K;  1NK5 A;  2Q2R A;  1WLJ A;  4AM7 A;  3BF3 A;  1L5U A;  4YY3 K;  2QWO A;  3G0Z A;  1RGI A;  1CZA N;  4FYD A;  3C7N A;  1HYZ A;  4OJR A;  4EAH D;  2AP1 A;  2E88 A;  3V1O A;  3HO1 A;  2GWJ A;  3DLH A;  2HHQ A;  4LF7 K;  4CZE A;  3NGI A;  2NZT A;  3K59 A;  4CI6 A;  3I8B A;  4IO8 A;  2F8T A;  2E1Z A;  2OPP A;  4I2Q A;  4A59 A;  3DXK B;  1ZBH A;  3NF8 A;  1O13 A;  5C42 A;  3NH0 A;  4CFC A;  3M1F A;  2P1J A;  3ZT4 A;  4CJS A;  1BIS A;  3WQU A;  1BHL A;  5AQO A;  3JS6 A;  3AA3 A;  2RKI A;  1S9E A;  2DFF A;  2QK9 A;  1U2V A;  5IT9 O;  3B6O A;  3VN5 A;  4GVE A;  4JI8 K;  3NGZ A;  5D3G A;  3SBG A;  4JHD A;  3ZT3 A;  1KLN A;  4CGF A;  2BE2 A;  3DLK A;  3CM6 A;  1LAW A;  2A3Z A;  4RW8 A;  3LAL A;  2Z1J A;  3O80 A;  4BC4 A;  4WQ4 A;  1GOA A;  5BPM A;  4IFY A;  4WE1 A;  3DMJ A;  1NGA A;  1NGI A;  4NLB A;  3TAQ A;  3O9U A;  4EHT A;  3PX6 A;  1D8Y A;  5EXW A;  1GLJ O;  4CZF A;  3SAF A;  4BRL A;  4FWP A;  3VQC A;  1T03 A;  3DWL A;  4FLX A;  3HI0 A;  2P9P A;  5E41 A;  1D9F A;  3SAG A;  1K8A O;  3S3O A;  2OPQ A;  1QQM A;  4DS4 A;  3AVH A;  4M7X A;  1R59 O;  3BY5 A;  3MK6 A;  4DU1 A;  3QEI A;  2HMP A;  3OBW A;  4FPB A;  4EZ6 A;  1C0F A;  5T7B A;  4B1Y B;  3PLA A;  1SZ2 A;  3H08 A;  4JI1 K;  1NKC A;  4B8A B;  1WBB A;  4WFN L;  5C10 A;  3P4I A;  3KLE A;  3ZSR A;  4DV1 K;  4FM2 A;  1BU6 O;  3LWM A;  3HBT A;  3OYC A;  5LY3 A;  4Z4F A;  3O9T A;  5GAG P;  3TAG A;  1ASV A;  3O3G A;  3HK2 A;  4DSF A;  1W0H A;  3I33 A;  1YJ9 N;  5AZJ B;  2YCH A;  1RDA A;  4FOE A;  3ZX2 A;  4UY8 O;  1ITG A;  4CFD A;  4JKC A;  3THW B;  5HRO A;  2GTD A;  5EVZ A;  2OPS A;  2YHX A;  3W0L A;  1KVB A;  3TSQ A;  4YOX A;  1CXQ A;  1TYQ A;  1WB9 A;  5C24 A;  4YOT A;  4FWK A;  4BC3 A;  3V9W A;  5KRS A;  4IFV A;  4F2R A;  3H46 O;  1CZB A;  2A42 A;  3DM2 A;  4FLY A;  4FJM A;  4H03 B;  4JV5 K;  4I2P A;  4ILH A;  1IO2 A;  3GDQ A;  2E2Q A;  1YI2 N;  1TKZ A;  4PKG A;  4CD3 A;  1TL3 A;  4NO7 A;  3CCV N;  1HYS A;  1Y97 A;  2YHW A;  1RDC A;  2D4W A;  2V51 B;  1HJO A;  4U67 L;  3DYA A;  4Z4C A;  4H0X B;  3E9L A;  2FLO A;  1JLC A;  2F9T A;  4I7F A;  3AGR A;  3SMP A;  4AHC A;  1L3V A;  5FRN A;  3JSM A;  1YJN N;  3DI6 A;  3BP8 A;  2BDP A;  3LDS A;  4B1Z A;  1RT2 A;  1NK0 A;  3VF6 A;  3PUF A;  3R9P A;  3IG1 A;  3WEE A;  1REV A;  2QXL A;  1NK8 A;  4H0P A;  3PX0 A;  1KCF A;  2W42 A;  2VWJ A;  5BPL A;  3EEQ A;  4A57 A;  4O8U A;  3VEX A;  3VQD A;  4K8Z A;  1NMN A;  4DS5 A;  4KO0 A;  1B92 A;  3CQY A;  4RW7 A;  2I7P A;  1QHA A;  4JD2 B;  3D2E B;  3K58 A;  1IBL K;  3QIP A;  1TGO A;  4BVO A;  1GOB A;  4CK2 A;  2XRI A;  4N47 A;  1GLE G;  4BC5 A;  3SZ2 A;  4E0D A;  1DTT A;  3KLH A;  3MEC A;  2A6A A;  3VQ4 A;  3KK1 A;  2PYL A;  4DSL A;  4DR3 K;  3BDP A;  2YHB A;  1JCF A;  1ZBI A;  3L2R A;  4E7J A;  1FXX A;  3CME N;  4CJ3 A;  4OKK A;  4NCA A;  1SKW A;  3PIP L;  2W40 A;  4A2B A;  4JRQ A;  2O8E B;  3CJA A;  1VRU A;  4ID1 A;  1DT9 A;  1KLM A;  4XH1 A;  4FJK A;  1SAZ A;  5J2N A;  3VGK A;  4Z4E A;  2W41 A;  3V9S A;  2O8F A;  1QQN A;  3CCS N;  1RBT A;  4LF6 K;  5FPN A;  2F9W A;  4F3T A;  1WSJ A;  1U49 A;  4CJT A;  4E1M A;  4PKI A;  3BEX A;  3UIQ A;  4XIU A;  4FZY A;  4N76 A;  2IGI A;  2CGJ A;  4CJ7 A;  4X66 K;  4GKK K;  3ZSZ A;  4ILJ A;  2V7Y A;  4YDU A;  1NMD A;  1S1T A;  3LPU A;  2D0B A;  1T3V A;  3CET A;  3P1G A;  1RDW X;  2FBT A;  3AVL A;  2E2O A;  2OYQ A;  2FC0 A;  5AQX A;  3M8R A;  1KRP A;  4DSI A;  1YAG A;  1Y64 A;  4FM0 A;  4WFB L;  4Z4G A;  2YNF A;  3WNE A;  3P38 A;  4AM6 A;  3AVG A;  4NLC A;  2B4J A;  1ATN A;  3O6W A;  4N56 A;  1NGE A;  5AQM A;  1CZ9 A;  3O9Q A;  4WQ5 C;  3H6E A;  3KWI A;  2VWK A;  4ELT A;  5FRM A;  3E1Y A;  1LCU A;  3CG7 A;  1HR0 K;  2E20 A;  3G10 A;  4H4O A;  3KVG A;  3O4Q A;  3CJ7 A;  1S1X A;  4HHT A;  3LAM A;  1YXQ A;  4PUO A;  1JXB A;  4M45 A;  1G99 A;  2X74 A;  3FFI A;  3H1V X;  3ZSV A;  5CHI A;  3NFA A;  4NB4 A;  3ASM A;  2GV9 A;  3FE1 A;  4CZK A;  3H1Q A;  5AJ3 K;  5LMN K;  2KTQ A;  1C1C A;  3D2F B;  3AVA A;  3EE8 A;  3JXU A;  4FZX C;  3M6G A;  1RNH A;  1QVF M;  4BR7 A;  4C23 A;  3DLB A;  4CK1 A;  1JLB A;  2FSK A;  1KD1 O;  2HHV A;  1TKT A;  3FLC O;  2GEM A;  4B1X B;  4MLH A;  4DQ8 A;  3L3V A;  3UB5 A;  1GLF O;  1RT6 A;  2D1K A;  4PQU A;  1L3T A;  4H5V A;  3AVI A;  4ISG A;  3WT0 A;  4A61 A;  1GLA G;  4JAX A;  3WXL A;  3NBP A;  2G8V A;  2HHS A;  3CMA N;  3HOS A;  4M7Y A;  3JAM O;  4PL7 A;  4B3R K;  1HQU A;  2HHT A;  2P9P B;  5BN8 A;  4ISF A;  1XHZ A;  3MX2 A;  1IKV A;  2Y1I A;  1X9M A;  3V1R A;  4UQG A;  1KVC A;  4B3O A;  3ZCM A;  2NRW A;  1TKD A;  3CCM N;  5KGX A;  3NVM A;  4Z4H A;  3NHG A;  5AQH A;  4W5R A;  4KB1 A;  4BRM A;  4C1N K;  3L6Q A;  2DY4 A;  1JXE A;  4M3Y A;  4JKD A;  3U9Z A;  4KRE A;  4CBX A;  1V4S A;  5JLH A;  1SL1 A;  2YI1 A;  2YJF A;  4DR2 K;  4DUZ K;  3QEW A;  1KXP A;  3HJF A;  4FLV A;  4JK8 A;  5FPE A;  3PO5 A;  1LV5 A;  5BRD A;  3SBT A;  1IBM K;  1BI4 A;  3VEY A;  1YJW N;  1EWR A;  2G8U A;  2VG5 A;  1VSK A;  4FWN A;  1TUY A;  3V9Z A;  3SCX A;  3H45 C;  1VSL A;  3EZW A;  4DTU A;  4CJU A;  1J54 A;  5MLC Q;  1RT1 A;  5DMR A;  3O5B A;  3AGK A;  1FJG K;  4FLU A;  2IOC A;  4LSL A;  2OZM A;  4DUY K;  1NLV A;  2UYT A;  2UXB K;  3VQQ A;  4E89 A;  2BAN A;  4AHT A;  3OBY A;  2W6L A;  3RSE B;  2PBD A;  2E4L A;  2QWQ A;  3LAK A;  1S6P A;  2O8D A;  4M63 C;  4A5A A;  3SPY A;  4CF9 A;  5KTQ A;  5ADX H;  4M3R A;  3F73 A;  3ALY A;  4CIF A;  3NDK A;  4KI6 A;  4Y1C A;  1RT4 A;  4M3T A;  1MU2 A;  4O5F A;  2O8B A;  3QES A;  4J2D A;  5FRO A;  3TAE A;  2ZGZ A;  3MED A;  3LAN A;  3SK3 A;  3O08 A;  4JKF A;  3QIO A;  4DV7 K;  3WEE B;  2ZE2 A;  1NGB A;  2QWR A;  4B1W B;  1WAF A;  3W3D A;  4HWI A;  4BRQ A;  5AQF A;  2A40 A;  1V4T A;  2WUS A;  4YOW A;  4CHP A;  4E1J A;  2YX6 A;  4CJL A;  4W5T A;  4DV0 K;  1WBD A;  4RW4 A;  4B08 A;  2G8H A;  4ID5 A;  5AQV A;  1BWF O;  3PX4 A;  3ZT0 A;  3AA2 A;  2ZF5 O;  5FPM A;  2KFZ A;  2PFU A;  4DFJ A;  4BRO A;  2O4I A;  3DXM A;  4KH5 A;  2KQ2 A;  5ADX A;  2OCE A;  4W5Q A;  5LJW A;  3UKR A;  4HUE A;  2QI2 A;  1HYV A;  3HZ6 A;  2UXD K;  3QML A;  3RMB A;  4CJV A;  4JEP A;  3OA9 A;  3NMU A;  4CZH A;  4BVP A;  1T6D A;  5LJV A;  3KJV A;  1NU0 A;  1RDU A;  4AHS A;  2E6L A;  5KQ8 A;  4JI2 K;  4DTR A;  4Q0B A;  1JCE A;  3VTH A;  2XY6 A;  1C1A A;  1IG9 A;  1VSH A;  2XY8 A;  3CD6 N;  2HHU A;  2PAV A;  2O8F B;  2F4V K;  3TR8 A;  4R79 A;  1HRH A;  3L2V A;  3U6F A;  4FJ7 A;  3HOT A;  1YHQ N;  3THY B;  3VQ5 A;  2JWK A;  3O3F A;  4OLA A;  1TAU A;  3TAN A;  3CCU N;  3R3L A;  5IWA K;  1TAQ A;  3CC4 N;  4CJF A;  1XHX A;  1YTU A;  1VAZ A;  4DTX A;  1P8Z A;  1MA9 B;  1RBV A;  3HPO A;  1BUP A;  3M8Q A;  2ZGY A;  3RMA A;  4CEQ A;  1NM1 A;  1S3X A;  3IUC A;  3VOV A;  2ETJ A;  4DV5 K;  1TKX A;  4PWD A;  3SUP A;  3ZLJ A;  3P83 D;  3E01 A;  5GAH P;  3OYL A;  2ATQ A;  3P5J A;  2ZJQ L;  4GMJ B;  3SPZ A;  3SQ2 A;  4OO1 J;  5AQP A;  5AZI A;  3BZK A;  4C1N I;  2ASO A;  5C0Y A;  5HBM A;  4BGB A;  1RIL A;  3SMS A;  3TTF A;  3VF2 A;  2BTF A;  3KWG A;  4CF0 A;  1LW0 A;  3VGL A;  3ZX0 A;  3EO3 A;  4LY7 A;  4CEB A;  3HVT A;  1ILY A;  4PHT X;  4KHP K;  2XHB A;  3VA0 A;  2EWS A;  3S3M A;  4KHS A;  1J5O A;  4B8C A;  4X65 K;  3OYH A;  1D9D A;  2HMI A;  3AVB A;  1JCG A;  3TTD A;  4I9L A;  1MWK A;  2X78 A;  2OPR A;  4JLH A;  3V6D A;  3L4Q A;  2F8S A;  2E1Y A;  2HF4 A;  3UKU A;  4I6M B;  1UWB A;  4YOV A;  2CGK A;  4J2A A;  3C6H A;  2XY5 A;  4FL9 A;  1LOT B;  4R5P A;  3EY1 A;  4I9Q A;  1Q82 O;  4QOZ B;  1BIU A;  5EOY A;  4CES A;  3CFR A;  3K9K A;  3O1W A;  4OPA A;  1KAY A;  4WFA L;  3A5O C;  5JS2 A;  4DTP A;  2F7T A;  2J4R A;  4IEI A;  1BCM A;  1C0T A;  3PV8 A;  3A8Y A;  4IEE A;  3ZSO A;  4ISE A;  2P9U B;  2VG6 A;  4IJN A;  3ULD A;  4FCY A;  2QWM A;  2LSN A;  3Q7B A;  4H8K A;  5HP1 A;  1EKE A;  3KLF A;  4HTU A;  2G8I A;  1Z6R A;  3OJU A;  1IH7 A;  4CK3 A;  4B9U A;  4F9O A;  3LWL A;  1J9A A;  4J2E A;  4FWM A;  1VQ7 N;  3VQ8 A;  4DMN A;  1X1P A;  5J2Q A;  3CIP A;  4H0Y B;  4GNI A;  2UUC K;  4RG8 A;  4BR9 A;  4IG0 A;  4K0K K;  4F2S A;  1ZBF A;  5KPZ A;  4B1V A;  2A5X A;  5DK5 A;  5CZ2 A;  1SKR A;  4JKH A;  2OZS A;  1GLB G;  3WNG A;  1NGH A;  4MO5 A;  3GG4 A;  1XC3 A;  3OYM A;  3S3N A;  4KH4 A;  4C8M A;  3SQ0 A;  3WXJ A;  5BR8 K;  3KK2 A;  3QDK A;  4KBO A;  1GLD G;  2VG7 A;  3ULE A;  1JLF A;  1U6Z A;  3K9J A;  4DTN A;  1WSG A;  4CCH A;  4K42 A;  1J53 A;  1EET A;  2O4G A;  5JMV A;  4BRG A;  3ENO A;  1T44 A;  2P9K A;  5GIN A;  5KI6 A;  4KI4 A;  1IG8 A;  1I3A A;  1C0G A;  1ATR A;  5HRR A;  1BO5 O;  4N5S A;  3SUN A;  4DQR A;  4DSJ A;  1WSF A;  3AO4 A;  1DTQ A;  4FVU A;  2UXC K;  3QB0 A;  1Q9X A;  2O8D B;  4LD0 A;  2OTJ N;  4ZTF A;  4FW2 A;  5DM7 L;  3PIO L;  1BA0 A;  1SS6 A;  3G6E N;  1RT7 A;  4C8N A;  5JS1 A;  4OKJ A;  2FBX A;  4OPH A;  3SV3 A;  2R7Y A;  5I3U A;  4Z4I A;  5AQT A;  3QLH A;  3TU5 A;  4IXC A;  3A0I X;  3KK3 A;  4CHY A;  5M1F A;  2VWB A;  4ILG B;  3CC7 N;  4B3T K;  1WSH A;  1LWF A;  1XMO K;  4JI4 K;  1YUW A;  2CH6 A;  4LC9 B;  2ZQB A;  4E3S A;  2P51 A;  3OTO K;  3CFP A;  5GAE P;  4CGI A;  2HVH A;  3IFR A;  2QWL A;  4CZG A;  4IO9 L;  4H4M A;  4DLE A;  1IJJ A;  3EL2 A;  2VQF K;  1XI1 A;  4CZJ A;  1YF5 L;  5M1O A;  5BRH A;  4FJL A;  3HM8 A;  3DOL A;  3G4S N;  4MDA A;  1K8K A;  2WBN A;  5KPR A;  3L2Q A;  3UKR B;  2DTU A;  4U7B A;  1Q7Y O;  4CEC A;  4AHV A;  4KHW A;  2HNY A;  3RR7 A;  4BWJ A;  1NWK A;  2IC3 A;  5SWM A;  4DV3 K;  1MDU B;  1RFQ A;  1RBR A;  3C65 A;  4NYF A;  3TTC A;  1EX4 A;  3A2F A;  3MEE A;  3JYT A;  3TAF A;  1IKY A;  4WCE L;  2P9L A;  4DR5 K;  4O44 A;  1RTJ A;  2RPI A;  3I56 N;  2NRZ A;  4C8O A;  3CQX A;  3HSC A;  4GV3 A;  3HP6 A;  2IDO A;  4O4G A;  3THX A;  4K8X A;  2YNG A;  3ZEU B;  1T7P A;  1E4F T;  1TV6 A;  4CVN E;  3QIC A;  3MEG A;  3AVN A;  4MFB A;  4KTQ A;  4KTW A;  1QVG M;  3AVK A;  1HKG A;  4CJK A;  4JKG A;  2CH5 A;  4LH5 A;  1OVY A;  4JS5 A;  3TAR A;  4FLZ A;  1A5V A;  3V9U A;  1TK8 A;  1BIZ A;  1Q81 O;  4GW6 A;  4B1U B;  4WQ4 C;  4FWQ A;  5AQY A;  2QXF A;  1ASW A;  1IKW A;  5E26 A;  2YNI A;  3OYA A;  3FZL A;  5M1N A;  2WFB A;  3F9K A;  4HCB A;  3AO2 A;  4JI0 K;  3RVC A;  3HRG A;  5AZI B;  3MN7 A;  4CFA A;  4B9T A;  4NYN A;  2P9N A;  4WYB A;  4BRI A;  2ITM A;  1JKH A;  1QHT A;  3ENB A;  2YHA A;  1QQO A;  3FR0 A;  4BRA A;  3CPW M;  2PYJ A;  1LWE A;  4H0O A;  4JI7 K;  3NF9 A;  3V4I A;  3T69 A;  3D7E O;  2NRH A;  2HNZ A;  3C7N B;  1KQS M;  1CLQ A;  5C2F A;  4CEF A;  2P5O A;  4JN4 A;  5KGW A;  2EHG A;  3OJS A;  3IMX A;  5LMU K;  5H1S Q;  4KHN A;  1L3S A;  3VPZ A;  1K73 O;  3QFU A;  3CCE N;  4FXD A;  3DRP A;  4F3O A;  1RTI A;  4E7H A;  2H3G X;  4YOU A;  3UKU B;  3IRX A;  4DR4 K;  1EP4 A;  4BE2 A;  3AVM A;  4FZZ A;  2PY5 A;  3EKS A;  4CF2 A;  1HLU A;  1RT5 A;  4DQQ A;  4RW6 A;  3KLI A;  3WXM B;  1BDG A;  4AQY K;  1U2V B;  2ZWH A;  4DWI A;  3OYN A;  5BPN A;  5FPD A;  3AO3 A;  4JS4 A;  4KFB A;  1VQO N;  4ZHR A;  1SL2 A;  1J6Z A;  3FFK B;  3CQ8 A;  2D0P A;  4JHD B;  3OY9 A;  3I55 N;  1S22 A;  2Y1J A;  4DR1 K;  1KAZ A;  3CPE A;  3RMC A;  4MLE A;  4FO0 A;  1VQK N;  3RMD A;  1QS4 A;  4DHY A;  3RR8 A;  3MN6 A;  4IJA A;  1J5E K;  3GOI A;  3PSF A;  4QS8 A;  5CZ1 A;  3OYD A;  4DU3 A;  1S1U A;  3OS1 A;  4IOC L;  1KFS A;  4F8R A;  3TSP A;  1QZ5 A;  5K14 A;  2FBV A;  3RRH A;  2QKB A;  3ZSQ A;  2D0A A;  1HKB A;  3VEO A;  4BRH A;  2B6A A;  1KVA A;  4W5O A;  1C1B A;  3LZI A;  3E9O A;  3G25 A;  3SUQ A;  3KD1 E;  3D6R A;  1VSM A;  1NJZ A;  1NK6 A;  4CD1 A;  3ULE B;  3AO1 A;  4BR0 A;  3I0S A;  3MX5 A;  4HTL A;  4IKF A;  3SLC A;  4QS7 A;  4FJ8 A;  3SQ4 A;  3FGU A;  2NRT A;  4E7L A;  2YKN A;  4AH9 A;  3HTV A;  1HMV A;  4CGH A;  4M3Z A;  4LH4 A;  4CJE A;  3VEN A;  2P9K B;  5BRE A;  4O8K A;  5C15 A;  1X3N A;  1QTM A;  3MN5 A;  4M3X A;  2QEX N;  5M1K A;  1HNZ K;  4J8F A;  1JLG A;  2HVI A;  2ZM6 K;  3LDL A;  1ZBU A;  5KRT A;  4H5T A;  3U8X A;  3QEX A;  4FW1 A;  3ID8 A;  4CZL A;  3VA3 A;  3J7Z O;  4EZ9 A;  4GKJ K;  1RDD A;  1RTD A;  2NRV A;  3VET A;  1ZYQ A;  1QSS A;  2YNH A;  3HPG A;  3R1X A;  2WC9 A;  1XNQ K;  1X9W A;  2HHH K;  1LW2 A;  4LF5 K;  4B9Q A;  3MXM A;  3MWT A;  3LM2 A;  3O4N A;  1SUQ A;  1EQY A;  2FF3 B;  4B3M K;  1HNI A;  4BC2 A;  1EWQ A;  3MCP A;  1TYQ B;  5BRF A;  4OGE A;  4B3S K;  2IS3 A;  3VQE A;  4FPA A;  4RW9 A;  3CM5 A;  1BL3 A;  2I7N A;  1VHX A;  2UUA K;  4L3Q A;  4CJR A;  3DOK A;  4LF4 K;  1NGC A;  4MDB A;  4FLW A;  4XH4 A;  3HVR A;  4M42 A;  1IKX A;  2YHY A;  4HUG A;  3O9R A;  1VQ6 N;  3J7A P;  4IDK A;  1A5W A;  3NCI A;  4O0I A;  1GOC A;  3VQA A;  2OA8 A;  2QM1 A;  1FKP A;  3KHY A;  1JLE A;  4CHQ A;  4KRF A;  1W97 L;  3QET A;  2RN2 A;  1VQ8 N;  3J8A A;  3DLG A;  4DFP A;  4W5N A;  4CZM A;  5CR4 A;  4LFC K;  1K8K B;  2Q36 A;  2NRX A;  4CHZ A;  2P9I A;  1UAX A;  4DF8 A;  1QZ6 A;  3DRS A;  4CHN A;  4H0V B;  4H5N A;  4EIA A;  2HHX A;  4BR2 A;  1VSJ A;  5LL6 Z;  2RF2 A;  3OVN A;  1TUU A;  1X3M A;  2KLA A;  1KSP A;  1IBK K;  4DSE A;  1VQ9 N;  5HRS A;  2Q97 A;  3LDQ A;  5A2Q O;  3TWH A;  4BG8 A;  4B9V A;  4IBN A;  5SZT A;  1FK9 A;  5AQW A;  3AO5 A;  5F0X A;  1NGG A;  4RTF D;  1BCO A;  1Q86 O;  3J7Y P;  1K6Y A;  5FDL A;  1WSI A;  5E84 A;  1F21 A;  3U3Y A;  1W9H A;  1BOT O;  4LFA K;  2JLE A;  4BE1 A;  3CJ1 A;  1YTA A;  3LM9 A;  3GE1 A;  3BZC A;  3SAH A;  1QE1 A;  4DQI A;  2E6M A;  3ZSY A;  3AAQ A;  3LDP A;  2HB5 A;  4JKE A;  4YHH K;  1UA1 A;  1FW6 A;  4FJX A;  1N36 K;  1BG3 A;  4FJ5 A;  1YVN A;  4CJW A;  4PKH A;  5AQJ A;  3SV4 A;  3V1Q A;  3NH1 A;  5AQS A;  3NH2 A;  1VSI A;  4FK4 A;  4XEI A;  1JLA A;  1OH8 A;  3PY8 A;  5AFU H;  3T1A A;  2P9N B;  4JD2 A;  1U45 A;  3ZET A;  4ZTJ A;  1ZBL A;  1WAJ A;  5TKW A;  1HPZ A;  3SQ1 A;  3BGR A;  3HM9 A;  3GL1 A;  2KZZ A;  2FXU A;  4KHY A;  3EN9 A;  2ZJP L;  4DFM A;  3OW2 M;  4Z94 A;  3OYB A;  1XWL A;  2KFN A;  1JJ2 M;  4EFH A;  3BF1 A;  3MAQ A;  1DEJ A;  3O3H A;  3RRG A;  4CJQ A;  1XC9 A;  1NGJ A;  1N5Y A;  5M1Q A;  3M3Z A;  4OGC A;  3TI0 A;  3J80 O;  2GX9 A;  3S41 A;  1HNV A;  3F2K A;  4IOA L;  3CCJ N;  3WUH A;  3P39 A;  2FSN A;  3UE5 A;  4A5B A;  2QA4 N;  5GIP A;  1HX1 A;  3QFP A;  3TAM A;  3OYE A;  4KB0 A;  4BRP A;  3QNN A;  4DG1 A;  3M5R A;  5AFU A;  2HST A;  3C0B A;  1I94 K;  1KC8 O;  3AA4 A;  3DJC A;  3M8S A;  1NKE A;  3DLE A;  2D0C A;  4BRC A;  2E5L K;  1C0U A;  3MN9 A;  5BR9 A;  5CE3 A;  1TVR A;  1UOC A;  1MWM A;  3ZT1 A;  4OLB A;  1VQL N;  3C95 A;  1A5X A;  1Z25 A;  2P9S A;  3C6T A;  2HND A;  1ZBS A;  1Z26 A;  4DTO A;  3C6A A;  1VQ5 N;  5F2R A;  1NJW A;  5EX5 A;  4E1N A;  5EU7 A;  4FWL A;  2Q0U A;  4CBW A;  1N34 K;  3SYZ A;  4BY9 C;  4Y1D A;  3MMV A;  1HKC A;  3A5L C;  4GY2 B;  4QAG A;  4BQL A;  3HP9 A;  5JVH L;  4BRN A;  3VES A;  5KQD A;  3F5T A;  4JKA A;  2ASP A;  1VSE A;  1Q18 A;  2XY7 A;  5AR0 A;  3B8A X;  1S1V A;  1M90 O;  4FJG A;  4KHU A;  4DQP A;  1RCH A;  3V81 A;  3FZK A;  3LP3 A;  1VQP N;  3KK7 A;  3WQT A;  1RT3 A;  1WUA A;  2HBK A;  1E4G T;  1RBU A;  3F9M A;  4IG3 A;  1R0A A;  1C0M A;  2D0O A;  3IDH A;  5J2P A;  2HF3 A;  3D2F A;  3AV9 A;  3NAE A;  1KFD A;  1Q8I A;  2JGU A;  3ID6 A;  4JNE A;  4PA1 A;  3T7Z A;  5HRP A;  4DFK A;  4CEE A;  2W6K A;  1XQS C;  5ELZ A;  5HRN A;  4KKO A;  3T3F A;  3ATV A;  3VQB A;  4NXM K;  3U3G A;  1NJY A;  4IWV A;  4Q5V A;  4TSX A;  1NG9 A;  1BI4 B;  2Z1I A;  1C6V A;  3VER A;  3VMF B;  2NLX A;  2GUI A;  2G8F A;  1BA1 A;  3WNH A;  4YOY A;  4DSK A;  1NKB A;  3O4W A;  4E19 A;  4OPK A;  3EZ5 A;  3NE6 A;  3L8B A;  3DLL L;  1DGK N;  4BDZ A;  4FK0 A;  3IS9 A;  3H3O B;  5AQQ A;  4K41 A;  1GLC G;  3L2U A;  3PO4 A;  2GEL A;  4V19 S;  3L3U A;  5TKY A;  3OYG A;  4O5B A;  2I5J A;  1NK7 A;  1K9M O;  3O1B A;  3VQ9 A;  3TAP A;  3CF5 L;  4WQ5 A;  4GV6 A;  4DLG A;  2Q31 A;  1NJX A;  5GIO A;  3EE9 A;  1N8R O;  3KKR A;  5C25 A;  4G9Z A;  1I39 A;  4CJ4 A;  2O8B B;  5F1X A;  3SNN A;  1HPM A;  3N4P A;  1XNR K;  1DLO A;  1VSF A;  4JI5 K;  1BQM A;  3CJC A;  2EX3 A;  4H0T B;  4IZ9 A;  2P9I B;  3LL3 A;  4FSV A;  2CGL A;  3QO9 A;  4YFU A;  3ZYY X;  3D0P A;  4OKE A;  4Y0W A;  3NVK A;  4A2A A;  1TK0 A;  3QEV A;  4G1Q A;  3OYK A;  3NF6 A;  1L3U A;  5DM6 L;  3IKM A;  3T19 A;  4DV6 K;  3SUO A;  2HHW A;  4AHU A;  3KD5 E;  4BDY A;  1TK5 A;  3RSE A;  1LAV A;  3DXM B;  3ISN C;  4DKW A;  3QER A;  3HXM A;  5GAD P;  3U4L A;  3SJJ A;  4HVJ A;  2IVN A;  4K43 A;  4IDH A;  3KTQ A;  3HL8 A;  3HT3 A;  2A41 A;  3C94 A;  4QS9 A;  1U4B A;  2OAN A;  1CXU A;  3AVC A;  4FWO A;  1IV0 A;  2KKZ A;  4JKB A;  3DLR A;  2KW4 A;  3CCL N;  3EYZ A;  3B6P A;  3ZSW A;  4FLT A;  3Q7C A;  3O9S A;  5AQG A;  4AHR A;  2WTU A;  1HNX K;  3CJ9 A;  3K5L A;  4X62 K;  4ELV A;  2BGG A;  2O8C A;  2B5J A;  4DR6 K;  4JI6 K;  4DCH A;  4BG9 A;  5I9E B;  3HPH A;  3ATU A;  4XH5 A;  4M41 A;  3ZET B;  4CBU A;  2OTL N;  4C8L A;  3L0Q A;  1WN7 A;  2YV0 X;  1RTH A;  1S6Q A;  3O8M A;  5AQU A;  1X9S A;  1N32 K;  2VGM A;  1LWC A;  1YT3 A;  2IIR A;  3CC2 N;  2FF6 A;  3E9P A;  3VEW A;  4OVL A;  2F96 A;  2D5R A;  2VQE K;  4O0J A;  3I0R A;  3WXK A;  2DFE A;  3CFO A;  2Z1G A;  2JWL A; 
#chains in the Genus database with same CATH homology
 5EY4 A;  2KHO A;  4WFN L;  1NM1 A;  1S3X A;  2WC9 A;  3R1X A;  3IUC A;  5C10 A;  3P4I A;  3VOV A;  4B9Q A;  1BU6 O;  3MWT A;  3LM2 A;  1EQY A;  2FF3 B;  3HBT A;  4BC2 A;  3MCP A;  1SZ2 A;  3CI5 A;  5HL7 L;  1TYQ B;  5BRF A;  2GWK A;  5LY3 A;  5GAH P;  3O9T A;  5GAG P;  3CXC M;  2ZJQ L;  4OO1 J;  4FPA A;  5AQP A;  4BGA A;  4WF9 L;  2HBM A;  5AZI A;  3I33 A;  1YJ9 N;  2I7N A;  4C1N I;  2ASO A;  5AZJ B;  5C0Y A;  4BGB A;  4BR4 A;  2YCH A;  4FOE A;  3ZX2 A;  4UY8 O;  4L3Q A;  3SMS A;  3TTF A;  3VF2 A;  2BTF A;  1NGC A;  3KWG A;  4MDB A;  3VGL A;  1D4X A;  3ZX0 A;  2QW9 A;  3EO3 A;  4XH4 A;  1W2B M;  4JKC A;  1ILY A;  2YHY A;  4H5R A;  4PHT X;  2GTD A;  3CCR N;  2P9S B;  5EVZ A;  3O9R A;  1VQ6 N;  2YHX A;  2EWS A;  3W0L A;  1VQN N;  1ATS A;  3TSQ A;  4YOX A;  3A5M C;  1TYQ A;  4BRD A;  4YOT A;  4FWK A;  2BH1 A;  4BC3 A;  3VTI A;  2QM1 A;  3N4Q A;  3R8E A;  3TTD A;  1JCG A;  3KHY A;  1MWK A;  3H46 O;  1W97 L;  3TSU A;  2A42 A;  4H03 B;  3AAR A;  1VQ8 N;  3J8A A;  1XUP O;  3P31 A;  2RHK A;  4ILH A;  3GDQ A;  4CZM A;  5C12 A;  2E2Q A;  5CR4 A;  1YI2 N;  1K8K B;  3L4Q A;  2Q36 A;  2E1Y A;  4KH6 A;  2NRX A;  2HF4 A;  4PKG A;  3UKU A;  4CD3 A;  2P9I A;  4I6M B;  4NO7 A;  1QZ6 A;  1ZXO A;  3CCV N;  4YOV A;  2YHW A;  5AQL A;  4H0V B;  4H5N A;  2V51 B;  2CGK A;  2D4W A;  4BR2 A;  4EIA A;  1HJO A;  3C6H A;  4FL9 A;  1TUU A;  1LOT B;  1X3M A;  4U67 L;  2KLA A;  3E9L A;  3AY9 A;  4H0X B;  2FLO A;  1Q82 O;  1VQ9 N;  2F9T A;  1VQM N;  4BQZ A;  3OHR A;  3AGR A;  5EOY A;  3SMP A;  2Q97 A;  2VGN A;  3LDN A;  3LDQ A;  3K9K A;  3O1W A;  4BG8 A;  3BP8 A;  4OPA A;  1YJN N;  1KAY A;  4WFA L;  1EO1 A;  3CJB A;  3A5O C;  5AQW A;  4B1Z A;  2F7T A;  1NGG A;  2J4R A;  4IEI A;  3VF6 A;  4RTF D;  5F0X A;  3E66 A;  1VQ4 N;  3R9P A;  1Q86 O;  3DXK A;  3WEE A;  4I6M A;  2QXL A;  3A8Y A;  4IEE A;  4YOW A;  4H0P A;  4ISE A;  3ENH A;  2P9U B;  4IJN A;  2QTD A;  5BPL A;  2QWM A;  3GBT A;  5E84 A;  2VYP A;  4A57 A;  1BOT O;  4O8U A;  2HOE A;  3Q7B A;  3VEX A;  1NGD A;  3CJ1 A;  2NRR A;  3L4I A;  3LM9 A;  3QBX A;  3CQY A;  3GE1 A;  2I7P A;  1Z6R A;  1QHA A;  4JD2 B;  3D2E B;  1SQK A;  3ZX3 A;  3AAP A;  4F9O A;  3SAH A;  4FWM A;  4BVO A;  1VQ7 N;  3AAQ A;  3LDP A;  3CIP A;  4JKE A;  4H0Y B;  1GLE G;  4BC5 A;  4GNI A;  2A6A A;  1BG3 A;  4BR9 A;  1DKG D;  1YVN A;  4B1V A;  5KPZ A;  4PKH A;  5AQJ A;  2A5X A;  4YOR A;  4K25 A;  2P9U A;  5AQR A;  1JCF A;  5AQS A;  4JKH A;  3CME N;  2YJE A;  1GLB G;  1NGH A;  4XEI A;  3PIP L;  2W40 A;  4MO5 A;  4A2B A;  3DAW A;  3GG4 A;  3CJA A;  1H1V A;  4BRE A;  5AFU H;  1XC3 A;  2P9N B;  4JD2 A;  3ZET A;  4KH4 A;  3WXJ A;  1DT9 A;  4CZI A;  3QDK A;  4KBO A;  5TKW A;  1GLD G;  3ULE A;  4XH1 A;  1U6Z A;  1SAZ A;  2QWP A;  3K9J A;  3VGK A;  2W41 A;  3GL1 A;  2FXU A;  1HUX A;  1YIJ N;  4K42 A;  1QQN A;  2BUP A;  3CCS N;  5FPN A;  2F9W A;  3EN9 A;  5JMV A;  4BRG A;  2ZJP L;  3ENO A;  4PKI A;  2Q0R A;  3BEX A;  4Z94 A;  1T44 A;  3OW2 M;  2P9K A;  5JVG L;  1JJ2 M;  4EFH A;  3BF1 A;  5GIN A;  1DEJ A;  1IG8 A;  2ZJR L;  3CCQ N;  1NGJ A;  2CGJ A;  3H3N O;  1C0G A;  5M1Q A;  4FWR A;  4CJ7 A;  1ATR A;  1BO5 O;  3MDQ A;  4BRK A;  3M3Z A;  4ILJ A;  2GX9 A;  2V7Y A;  4YDU A;  1NMD A;  3S41 A;  4FVU A;  3QB0 A;  1T3V A;  3CET A;  2VCP A;  3F2K A;  4IOA L;  2AA4 A;  3CCJ N;  3WUH A;  1RDW X;  5BN9 A;  1S72 N;  2OTJ N;  3P39 A;  2FSN A;  3FZH A;  3UE5 A;  3VEZ A;  3VF4 A;  4A5B A;  5GIP A;  2QA4 N;  1HX1 A;  1T6C A;  3QFP A;  5DM7 L;  3PIO L;  1BA0 A;  2E2O A;  4BRP A;  5B8H A;  3M5R A;  5AFU A;  2HST A;  5AQX A;  1NJI O;  1OKJ A;  1SS6 A;  4YDU C;  3TPQ A;  4RWT A;  3G6E N;  4PL8 A;  4OPH A;  3C0B A;  4EHU A;  1YAG A;  1Y64 A;  1KC8 O;  4WFB L;  3DJC A;  3QBW A;  3P38 A;  4MO4 A;  4BRC A;  4AM6 A;  5AQT A;  5AQZ A;  3SJH A;  3MN9 A;  3VEV A;  4NLC A;  5AZJ A;  1ATN A;  3O6W A;  1NGE A;  5BR9 A;  5CE3 A;  3CER A;  5AQM A;  3TU5 A;  4IXC A;  3A0I X;  3O9Q A;  4WQ5 C;  3H6E A;  3KWI A;  2VWB A;  4ILG B;  5M1F A;  3FZF A;  1MWM A;  3CC7 N;  3E1Y A;  1LCU A;  3WXI A;  2E20 A;  1VQL N;  1YUW A;  3KVG A;  2CH6 A;  4LC9 B;  3CJ7 A;  1M1K O;  3G71 N;  2P9S A;  1YXQ A;  5GAE P;  1ZBS A;  2NNW A;  1VQ5 N;  1GLL O;  3C6A A;  1G99 A;  3IFR A;  5F2R A;  3H1V X;  5EX5 A;  2QWL A;  3KZB A;  5CHI A;  4CZG A;  4FWL A;  2IVO A;  1NGF A;  2Q0U A;  4NB4 A;  4IO9 L;  5KPT A;  1IJJ A;  2P9L B;  4CBW A;  3FE1 A;  3EL2 A;  3H1Q A;  4CZK A;  4CZJ A;  1YF5 L;  3LDO A;  5M1O A;  4BY9 C;  5AQN A;  5BRH A;  3CHW A;  4RCH A;  3MMV A;  1HKC A;  3A5L C;  3D2F B;  3HM8 A;  3EE8 A;  3G4S N;  4GY2 B;  4MDA A;  3JXU A;  1K8K A;  2WBN A;  4IOX A;  5KPR A;  3M6G A;  3UKR B;  4BQL A;  3BUZ B;  4U7B A;  4BRN A;  5JVH L;  1Q7Y O;  3VES A;  1QVF M;  4BR7 A;  5KQD A;  4C23 A;  1NWK A;  3F5T A;  4JKA A;  2ASP A;  1NBW A;  1Q18 A;  5JLF A;  5AR0 A;  2FSK A;  3B8A X;  1YIT N;  1MDU B;  1RFQ A;  1KD1 O;  2FSJ A;  3C65 A;  3FLC O;  1M90 O;  2GEM A;  4B1X B;  4MLH A;  3TTC A;  2HBL A;  3FZK A;  4DQ8 A;  4WCE L;  1VQP N;  3KK7 A;  2P9L A;  3UB5 A;  1GLF O;  4JKG B;  3WQT A;  2D1K A;  1WUA A;  2HBK A;  1E4G T;  3F9M A;  4BRF A;  3IDH A;  2D0O A;  4H5V A;  2HF3 A;  3D2F A;  5AQI A;  4ISG A;  5M1P A;  1ZC6 A;  2NRZ A;  3WT0 A;  4A61 A;  3I56 N;  1GLA G;  3CQX A;  3HSC A;  4JAX A;  3WXL A;  2DPN A;  3ID6 A;  3MCA B;  4JNE A;  3T7Z A;  3CMA N;  4GV3 A;  3EKU A;  4H5W A;  2E2P A;  3HOS A;  4M7Y A;  4PL7 A;  5C2D A;  2P9P B;  2IVP A;  1ESV A;  1E4F T;  1XQS C;  3MWP A;  4ISF A;  5ELZ A;  3ZEU B;  5BN8 A;  3QIC A;  3A5N C;  3U9D A;  3VET A;  1QVG M;  3ATV A;  3MX2 A;  3R6M A;  4IWV A;  1HKG A;  5HOO A;  2NRW A;  4JKG A;  2CH5 A;  3CCM N;  2QWN A;  3VER A;  1OVY A;  3D2E A;  3NVM A;  3VMF B;  2E8A A;  2NLX A;  5JIC A;  5AQH A;  4GV9 A;  3VGM A;  1BA1 A;  1WOQ A;  1Z05 A;  4BRM A;  1Q81 O;  4JK9 A;  4B1U B;  4FOI A;  4FWQ A;  4WQ4 C;  5AQY A;  4C1N K;  4YOY A;  3L6Q A;  4A62 A;  4JKD A;  3O4W A;  3ZEU A;  5E26 A;  3U9Z A;  4CBX A;  3DLL L;  1V4S A;  3FZM A;  2RE2 A;  5JLH A;  1DGK N;  2YI1 A;  2YJF A;  3FZL A;  5M1N A;  2WFB A;  1KXP A;  4IFE A;  3H3O B;  4JK8 A;  5AQQ A;  3RVC A;  3HRG A;  4K41 A;  5FPE A;  1GLC G;  5AZI B;  5BRD A;  3MN7 A;  4BR5 A;  3SBT A;  3VEY A;  2P9N A;  1YJW N;  4WYB A;  4BRI A;  2ITM A;  4FWS A;  2GEL A;  2Q1N A;  3ENB A;  4AF1 A;  2E2N A;  1QQO A;  5TKY A;  2V52 B;  3FR0 A;  4BRA A;  3CPW M;  2ASM A;  4FWN A;  4DB3 A;  1TUY A;  4H0O A;  2GUP A;  3H45 C;  3T69 A;  3EZW A;  1K9M O;  3O1B A;  3D7E O;  2NRH A;  2HBJ A;  5MLC Q;  3CF5 L;  3C7N B;  4WQ5 A;  1KQS M;  4GV6 A;  5AQK A;  2V7Z A;  2Q31 A;  5C2F A;  3O5B A;  5GIO A;  3AGK A;  3EE9 A;  4JK7 A;  4JN4 A;  3IMX A;  1N8R O;  4G9Z A;  1KAX A;  1NLV A;  5F1X A;  5H1S Q;  1X9J A;  1P90 A;  2UYT A;  1HPM A;  3N4P A;  2Q2R A;  3VPZ A;  1K73 O;  3OBY A;  4AM7 A;  3QFU A;  3CCE N;  3BF3 A;  2PBD A;  3RSE B;  3CJC A;  2QWQ A;  4H0T B;  4IZ9 A;  2H3G X;  4M63 C;  4YOU A;  3UKU B;  4A5A A;  2P9I B;  3LL3 A;  4FSV A;  2CGL A;  2QWO A;  1RGI A;  3ZYY X;  3EKS A;  4Y0W A;  3NVK A;  1CZA N;  3C7N A;  5ADX H;  4A2A A;  4EAH D;  2AP1 A;  1HLU A;  2E88 A;  4O5F A;  2GWJ A;  5DM6 L;  3WXM B;  1BDG A;  4CZE A;  3IKM A;  1U2V B;  2ZGZ A;  2NZT A;  2ZWH A;  4CI6 A;  3SK3 A;  5BPN A;  5FPD A;  3I8B A;  3O08 A;  3RSE A;  4IO8 A;  3DXM B;  1VQO N;  4JKF A;  1J6Z A;  2E1Z A;  4A59 A;  4DKW A;  3DXK B;  3FFK B;  3WEE B;  2D0P A;  1NGB A;  5GAD P;  1O13 A;  2QWR A;  4JHD B;  3U4L A;  1S22 A;  3W3D A;  4HWI A;  4B1W B;  3I55 N;  2IVN A;  1KAZ A;  3M1F A;  4BRQ A;  5AQF A;  2A40 A;  1V4T A;  2WUS A;  3CPE A;  4K43 A;  3WQU A;  4IDH A;  4E1J A;  5AQO A;  4MLE A;  2YX6 A;  4FO0 A;  1VQK N;  2A41 A;  3JS6 A;  4QS9 A;  2OAN A;  4FWO A;  4DHY A;  5AQV A;  1BWF O;  2KKZ A;  3MN6 A;  4IJA A;  2ZF5 O;  4JKB A;  3GOI A;  1U2V A;  4QS8 A;  5FPM A;  2PFU A;  3CCL N;  4BRO A;  4IOC L;  3DXM A;  3TSP A;  4GVE A;  4KH5 A;  3Q7C A;  5ADX A;  1QZ5 A;  3O9S A;  5AQG A;  5LJW A;  3SBG A;  4JHD A;  3UKR A;  2QI2 A;  3CJ9 A;  3HZ6 A;  3QML A;  1HKB A;  3NMU A;  4JEP A;  3OA9 A;  3VEO A;  4BRH A;  4CZH A;  2A3Z A;  4BVP A;  1T6D A;  3O80 A;  5LJV A;  4BC4 A;  1RDU A;  4WQ4 A;  4DCH A;  4BG9 A;  5BPM A;  5I9E B;  3E9O A;  3ATU A;  3G25 A;  4XH5 A;  1NGA A;  3ZET B;  1NGI A;  4NLB A;  4CBU A;  3D6R A;  5KQ8 A;  2OTL N;  3O9U A;  4CD1 A;  3ULE B;  1JCE A;  3VTH A;  4BR0 A;  4EHT A;  3L0Q A;  3MX5 A;  4HTL A;  5EXW A;  3CD6 N;  3SLC A;  4QS7 A;  1GLJ O;  2PAV A;  4CZF A;  3SAF A;  4BRL A;  3FGU A;  3O8M A;  4FWP A;  5AQU A;  2NRT A;  4R79 A;  2VGM A;  3HTV A;  3HOT A;  1YHQ N;  3DWL A;  3VEN A;  2P9K B;  5BRE A;  3HI0 A;  2IIR A;  4O8K A;  2P9P A;  2FF6 A;  2JWK A;  3E9P A;  5C15 A;  3VEW A;  3CC2 N;  1X3N A;  3SAG A;  3MN5 A;  1K8A O;  2QEX N;  1QQM A;  5M1K A;  4J8F A;  4M7X A;  3CCU N;  3R3L A;  3WXK A;  1R59 O;  3LDL A;  3MK6 A;  3CC4 N;  4H5T A;  3U8X A;  2HMP A;  3OBW A;  4FPB A;  3ID8 A;  1VAZ A;  4CZL A;  3J7Z O;  1C0F A;  1P8Z A;  1MA9 B;  4B1Y B;  3PLA A;  2NRV A;  1BUP A;  2JWL A;  2ZGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...