4A61A

Parm from plasmid r1 in complex with amppnp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
321
structure length
309
Chain Sequence
HHLVFIDDGSTNIKLQWQESDGTIKQHISPNSFKREWAVSFGDKKVFNYTLNGEQYSFDPISPDAVVTTNIAWQYSDVNVVAVHHALLTSGLPVSEVDIVCTLPLTEYYDRNNQPNTENIERKKANFRKKITLNGGDTFTIKDVKVMPESIPAGYEVLQELDERDSLLIIDLGGTTLDISQVMGKLSGISKIYGDSSLGVSLVTSAVKDALSSYLADDIIIHRKDNNYLKQRINSIVTEAMNEALRKLEQRVLNTLNEFSGYTHVMVIGGGAELICDAVKKHTQIRDERFFKTNNSQYDLVNGMYLIGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASMID SEGREGATION PROTEIN PARM
publication title A Bipolar Spindle of Antiparallel Parm Filaments Drives Bacterial Plasmid Segregation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 92
structure length 309
sequence length 321
ec nomenclature
pdb deposition date 2011-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4a61A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4a61A01
1C0FA 1MWKA 3CETA 5EY4A 1RFQA 4H0OA 3LM2A 4L3QA 3ENOA 3LDLA 1S22A 4QS7A 1NLVA 1MA9B 2HF3A 2YHYA 3WXLA 2BUPA 4XEIA 4JHDA 4H0XB 4DCHA 2AA4A 5FPNA 5AQUA 1QZ6A 3MK6A 3QBXA 4B1WB 4BRPA 3ZX0A 4AM6A 1BWFO 3DAWA 4EAHD 4ISFA 3QBWA 4IWVA 4H5NA 3VEZA 3SMPA 1TYQB 3LDOA 3WEEA 4EHUA 1NGFA 1QHAA 1JCGA 2Q0RA 4BREA 2F9WA 4BC4A 2GUPA 1Z05A 2A40A 4B1ZA 3A5MC 3H1VX 5AQWA 3VF2A 4K25A 1HKGA 1QQNA 3HTVA 3EN9A 1GLCG 3GBTA 1NGDA 3AARA 5BR9A 5LJWA 1QZ5A 3VERA 2ZGZA 3GE1A 2GWJA 1BG3A 3H1QA 4BC3A 3U4LA 1HJOA 5E84A 4CZLA 4BR0A 4BRCA 3OHRA 4CBXA 3W0LA 1ATRA 5KQ8A 5BRHA 4H03B 3VGKA 5BRDA 3I33A 3WEEB 4BRQA 4CZMA 3I8BA 3DWLA 2A3ZA 1QQOA 5AQMA 4C23A 3CQXA 4M7YA 5JLHA 3P4IA 4QS8A 1ATSA 1Q18A 4IJAA 3FZLA 3HZ6A 3VOVA 2E20A 5EXWA 2CGLA 3HBTA 4RTFD 3O4WA 2J4RA 2QWMA 3QMLA 3H3NO 4H0VB 1Y64A 3A5OC 4NB4A 5AQZA 3VEYA 1ZC6A 2YJFA 5AQNA 2FSJA 3M3ZA 4CJ7A 2E2PA 3ZEUB 1IJJA 3FZKA 2QM1A 1BDGA 1NBWA 1NGJA 2YHWA 1GLJO 3VEWA 1HPMA 3O1WA 5AQKA 4B1VA 2QWRA 3A5LC 3O1BA 1BU6O 3MCPA 4BQZA 4FWKA 3ULEB 3FZFA 4CZEA 3O08A 3L4IA 3H6EA 4BRKA 3EZWA 3O6WA 4EHTA 4A2AA 1GLEG 4BRHA 4H5WA 2HMPA 2PAVA 5LY3A 2P9NB 4BR5A 3C7NB 4Y0WA 4YDUA 3SJHA 2A42A 3BF3A 3VF6A 4JAXA 3MMVA 2FSNA 4YDUC 4FL9A 3J8AA 1HLUA 1DKGD 5AQOA 5AQSA 2QW9A 2KHOA 5AQFA 3MN9A 2P9SB 4FOIA 4QS9A 3R9PA 4B1UB 2HF4A 1XUPO 5AR0A 2ASOA 4KBOA 1EQYA 4K41A 4XH5A 2Q31A 5EX5A 4CZHA 1DEJA 4H5VA 4K42A 1E4FT 3L0QA 4ISGA 3FE1A 2VWBA 3MN7A 3RSEB 3SK3A 5AQQA 4JN4A 3WQUA 4MO4A 2QWLA 2P9KB 5BREA 5JMVA 3CJBA 3KVGA 3FFKB 3EL2A 1R59O 3S41A 1DGKN 1BA1A 3O8MA 1YAGA 2IVNA 4PKIA 2OANA 4PKGA 4M7XA 1GLDG 1T6DA 1K8KB 2H3GX 3UKUA 3SMSA 3JXUA 2VYPA 2QXLA 3A0IX 3LDNA 1D4XA 3GDQA 4Z94A 5AQIA 4BRDA 3UE5A 4HWIA 4ISEA 2D4WA 1GLAG 1ZXOA 4CZGA 4MLEA 4EFHA 4B9QA 1NGGA 3WQTA 4EIAA 2UYTA 5TKYA 3U9DA 3AAQA 1NGHA 3A8YA 1YXQA 5JICA 1GLFO 4BRIA 4PL8A 3VGLA 5AQPA 4WQ4A 2IVPA 3B8AX 4FPAA 5LJVA 3G25A 2ZGYA 1CZAN 4GY2B 1HKBA 1NMDA 1SQKA 4WQ4C 2FF6A 3ZX2A 1KAZA 4BVPA 2ASPA 3ZEUA 3UKUB 2QWOA 4GNIA 5BPNA 1KAXA 3QFUA 2NLXA 4FPBA 3MN6A 4MO5A 1GLLO 4BR7A 3IUCA 3ULEA 2F9TA 4BR2A 4JD2B 4CZIA 2BTFA 1IG8A 1KXPA 4BR9A 4BRMA 1JCFA 3MN5A 3D2EB 4WYBA 3SLCA 3ZX3A 5BN8A 4H0TB 3VPZA 3TPQA 3CJ9A 4CBUA 2CGJA 4XH1A 4CI6A 1HKCA 3LM9A 3AAPA 3M1FA 2P9PB 3FR0A 4DQ8A 2P9NA 2NZTA 3C7NA 5FPDA 3GOIA 2FLOA 1X3MA 3BP8A 3ID8A 5I9EB 2AP1A 1NWKA 2A5XA 3EKUA 2V51B 3FZHA 3HI0A 3VEVA 4B1XB 1OKJA 4BG9A 2P9SA 5CE3A 3KHYA 3WXKA 3D2FB 5AQJA 4CD3A 1ZBSA 2ZF5O 3CIPA 3D7EO 4FO0A 4IJNA 2IVOA 3ATUA 2Q0UA 5KPTA 1QQMA 4BC2A 4BVOA 2YJEA 3RSEA 1BUPA 1T6CA 1U6ZA 4FSVA 5F1XA 4FWPA 2GELA 4H5TA 2P9KA 1E4GT 3VF4A 4BG8A 2E88A 3IMXA 4O8KA 4CZFA 4IXCA 2W40A 2FF3B 3HM8A 1K8KA 4K43A 4CZKA 2V52B 1TUYA 2GTDA 5ELZA 3UKRB 4A61A 3CHWA 4BQLA 3WXJA 2P9UA 2P9IB 3LL3A 4FWLA 1H1VA 4BR4A 4FWRA 1NGEA 1HX1A 2QWPA 4IO8A 1NM1A 4B1YB 3IDHA 3DXMA 2A41A 2I7NA 1NGCA 5F2RA 2NRHA 4FOEA 3FZMA 2W41A 5KPZA 3WXIA 4F9OA 3C0BA 1LOTB 3R6MA 4BRAA 3QFPA 1U2VB 3H45C 3EKSA 2QWNA 3CI5A 4BRFA 5KQDA 3WT0A 5BN9A 4IZ9A 5AQYA 3U9ZA 1NGAA 4FWOA 2ITMA 1ATNA 2E2QA 1J6ZA 4NO7A 3QDKA 5F0XA 4FWNA 3ATVA 3R8EA 4I6MB 2D0PA 4M63C 4LC9B 2D1KA 5BPMA 2E1ZA 5AZIB 3ZETB 3CQYA 1YVNA 2P9UB 1SAZA 2E1YA 3DJCA 5AQXA 4JD2A 3QICA 4XH4A 4JNEA 5EVZA 1KAYA 2CH6A 3D2EA 4E1JA 1X3NA 2FXUA 2E2NA 3DXMB 4WQ5A 3CJ7A 5AZJA 2D0OA 2P9PA 4CD1A 1SZ2A 4WQ5C 5BRFA 2GWKA 3GG4A 5BPLA 5AQVA 3KZBA 3U8XA 4H0YB 3CERA 4AM7A 3VEOA 1ESVA 4BGAA 5E26A 2CGKA 3CJCA 4H5RA 5AQGA 1XC3A 1Z6RA 3D2FA 1YUWA 3HSCA 2GEMA 1NGBA 3AY9A 2EWSA 3GL1A 4BROA 1WOQA 5AQLA 2QWQA 3UB5A 2PBDA 3CJAA 3VESA 4JHDB 4FWQA 1MDUB 1BA0A 3M6GA 2VCPA 2Q1NA 2E8AA 3BUZB 5AFUA 1BOTO 4J8FA 4FWSA 4DHYA 3VETA 4DB3A 4FWMA 1S3XA 5AZJB 2FSKA 2IIRA 2CH5A 2Q2RA 2V7YA 2WUSA 4CZJA 5AQHA 5EOYA 3A5NC 3LDQA 5FPEA 3O5BA 2P9LA 4A2BA 4H0PA 4BC5A 2Q36A 3UKRA 5FPMA 1RGIA 4BGBA 2YCHA 3H3OB 3W3DA 1RDWX 3F9MA 1X9JA 2P9IA 4BRLA 5ADXA 5AQTA 4RWTA 2HOEA 3DXKA 3VENA 4MLHA 3FLCO 1JCEA 5AFUH 3LDPA 4PL7A 2V7ZA 2ASMA 1U2VA 1LCUA 1V4SA 3L6QA 5JLFA 4RCHA 4BRNA 5KPRA 4A62A 2ZWHA 3EO3A 3VGMA 2Q97A 1P8ZA 3TU5A 3MDQA 4BRGA 1G99A 1GLBG 3JS6A 1HUXA 3O80A 4O5FA 3VEXA 3BEXA 1NGIA 1XQSC 2P9LB 4PKHA 4I6MA 4CBWA 1WUAA 3WUHA 5ADXH 4HTLA 5AZIA 3ZETA 2YI1A 3H46O 3CJ1A 3QB0A 2E2OA 2I7PA 1C0GA 3IFRA 2A6AA 5AQRA 3DXKB 5B8HA 2YHXA 3ENHA 1T44A 1TUUA 2DPNA 1TYQA 1V4TA 3BF1A 3FGUA 1MWMA 1BO5O
chains in the Genus database with same CATH superfamily
1WAJA 1XHZA 3ZSQA 1MWKA 3CETA 3H08A 4CJEA 4JI3K 4H0OA 4L3QA 1S22A 2HF3A 4R5PA 2VQEK 4DF8A 1RTHA 4H0XB 4NLCA 2HHHK 4C8LA 1UOCA 4B1WB 3NDKA 3AA5X 1XMQK 3ZX0A 4KB1A 2B6AA 3KLEA 3K57A 4IWVA 4OGEA 4I2QA 2IS3A 3WEEA 5CYMA 4ID5A 1ASUA 4BREA 2F9WA 4DQSA 1Z05A 2G8IA 1J53A 3VF2A 1HKGA 1Q9YA 5C12A 2G8FA 3GBTA 5KI6A 3ZT3A 3L3VA 2XY5A 1JXBA 3CM6A 1JXEA 1YT3A 1HJOA 5E84A 3NF7A 3G71N 4BR0A 4DR3K 4CGGA 1OH5A 1RDBA 4RW4A 5KRTA 4E7KA 1W2BM 4Z4CA 4HCBA 3AVBA 3I33A 3PLAA 4JKDA 3OYAA 4BE0A 2HNZA 1VSDA 2BANA 3CQXA 1S1TA 1U04A 4I9LA 4BDPA 2ATQA 3HZ6A 3MCAB 3VOVA 1NK7A 2W42A 1XI1A 4DTXA 4RTFD 3THWB 4CFAA 1KCFA 3CXCM 1TKZA 2VWJA 1K9MO 4H0VB 4JRPA 1WSHA 1NNEA 1BHLA 1C0TA 2YHBA 4KRFA 4JI5K 3RWUA 4FW2A 4FJXA 3J7ZO 3F5TA 2E2PA 2A1SA 3ZEUB 5AJ3K 2X74A 1Q8IA 1NBWA 2QM1A 3VEWA 4FZYA 3V1QA 4B1VA 2QWRA 3NE6A 1BU6O 5D3GA 4H8KA 4FWKA 3DI6A 5A2QO 3VQQA 3O6WA 4EHTA 3LPTA 4A2AA 3SQ4A 1L5UA 1BISA 2PAVA 5LY3A 3PO4A 2P9NB 3C7NB 1Q7YO 1QSYA 4LF9K 3V81A 3BF3A 2F4VK 2F96A 1HLUA 5AQOA 4UY8O 3QETA 1J9AA 2BGGA 3F9KA 2B5JA 3OYIA 3OYBA 4CCHA 1L3UA 5GIPA 3THYB 4XH5A 1EQYA 2Q31A 5EX5A 4HTUA 1WN7A 2Z1IA 3C6HA 1DEJA 4CW7B 2OTJN 4GVEA 3MN7A 4JKEA 4WFAL 2IDOA 4KTZA 4NYNA 2P9KB 4TSXA 3VA0A 1XC9A 4C1NK 3AA2A 3O8MA 1YAGA 3KK3A 4M7XA 1RT1A 4N41A 1HYZA 4B3TK 1K8KB 3UKUA 5GINA 1BQMA 3AVGA 3K9KA 1VQ8N 1FW6A 5DMRA 4PWDA 4ZHRA 3GDQA 2PYLA 4FJ7A 1NJWA 4CZGA 4Y1CA 4MLEA 4M3XA 4B9QA 1NGGA 5TKYA 3L4QA 3OYJA 1WSEA 1J5OA 1YXQA 5JICA 4BRIA 4YOUA 4RW7A 3OYGA 1S72N 3V6DA 2FBVA 2ZQBA 4IDKA 1NMDA 3VTHA 2FF6A 3ZX2A 1WLJA 4GNIA 1KAXA 3QFUA 4CJVA 2NLXA 2YNFA 4FPBA 1T3VA 4BDZA 4A5AA 1EWRA 5HP1A 3ULEA 4JD2B 2XY6A 4BR9A 4BRMA 4HUEA 3MN5A 4WYBA 2KFNA 3RMCA 3NHGA 4CI6A 1HKCA 4O55A 3M1FA 3FR0A 4EP5A 4FYDA 1VSMA 4EP4A 3F2KA 5FPDA 2YX6A 2KFZA 3KLIA 2OYQA 3EKUA 4CECA 4FJNA 3ZSYA 1SKWA 1EO1A 3HI0A 4NXMK 1OKJA 2P9SA 3WXKA 1O1WA 1ZBSA 3AO2A 4CJFA 3TAFA 4DQQA 3LP3A 5GAGP 3O9SA 3HP6A 1QQMA 1RBTA 1BUPA 3PSFA 1JL1A 2GUIA 2EHGA 3VF4A 4DR5K 2E88A 1IKVA 3Q7BA 4O8KA 2QI2A 2FF3B 4EZ6A 3HM8A 3OJSA 4DSFA 4KHQA 2V52B 1TUYA 1RBRA 3SUNA 3SPZA 3HO1A 3ISNC 5GAHP 3ZSRA 2W6KA 4FWLA 5SZTA 4JI4K 1HX1A 2QWPA 4KH5A 4B9SA 1CZ9A 3DXMA 3KKSA 1LOTB 4M41A 1RT5A 1U2VB 3ZT2A 3SPYA 1LAVA 2KZMA 1JKHA 3CI5A 1M1KO 2HHQA 5LMNK 4JKAA 3E66A 3AVHA 5KQDA 3SZ2A 4AHRA 2RN2A 3MEGA 4IZ9A 1SKSA 2ITMA 1NJZA 4CJRA 1VQMN 4OPHA 5F0XA 4FLYA 3TANA 1C1AA 1NKEA 4FLVA 2D1KA 5BPMA 2E1ZA 1FXXA 3CQYA 4ELVA 2P9UB 2E1YA 3HM9A 3QICA 1RDDA 2VWKA 4JNEA 1T7PA 4OO1J 1OH6A 2CH6A 1X3NA 1RBUA 2FXUA 3O9RA 3NH0A 3TTFA 3VQ6A 1TKTA 3P38A 2D0OA 3LWMA 5BRFA 4CGDA 3GG4A 3V9WA 5AQVA 3S3OA 3S3MA 2G8WA 2HHXA 4H0YB 1VSKA 4YORA 1NJIO 4RW6A 4YFUA 2CGKA 4DTOA 4A57A 3CG7A 1NOZA 4YOWA 3OYCA 2KZZA 3AY9A 2EWSA 4BROA 4CHQA 1WOQA 4E1NA 2QWQA 3CCLN 3TABA 4FXDA 4FWQA 1MDUB 4DFKA 3M6GA 2VCPA 2ZE2A 5HRPA 5AFUA 3HSTB 1Y97A 3HT3A 4DS5A 4DB3A 4FWMA 1S3XA 4KI4A 5HROA 2HVHA 2V7YA 1I3AA 2CH5A 2Q2RA 3AGKA 2PFUA 2KW4A 3G6EN 5AQHA 2VGNA 3LDQA 5FPEA 2P5OA 3U6FA 3DLGA 4H0PA 4BC5A 1VSJA 1WSJA 3U3YA 2YCHA 3H3OB 1QSSA 1HPZA 1CZBA 3D0PA 1X9JA 4BRLA 5ADXA 3RMDA 4RWTA 1Q86O 3DXKA 3OS1A 4MDBA 1NK9A 5M1PA 1B92A 1JCEA 3T69A 4CF2A 1RT7A 2UU9K 4CEAA 3O9QA 3M5RA 3SQ0A 2ASMA 4IOCL 5JLFA 1F21A 3AVAA 1W0HA 3AVJA 3AV9A 3RTVA 4QAGA 2VQFK 4DTRA 3AO4A 4OKKA 2Q97A 4DKWA 1P8ZA 4Z4EA 3TU5A 1S6PA 4CGHA 4BRGA 2O8FB 3O80A 4FM0A 4JV5K 1D5AA 3B6PA 4IG0A 1P90A 1XQSC 4ELUA 1FK9A 3QEWA 3KLGA 4CBWA 5HOOA 1WUAA 3ZETA 3CMEN 2YI1A 3CJ1A 1KSPA 2E2OA 2Z1HA 4O4GA 1IBLK 2A6AA 2RKIA 5AQRA 4FJIA 2QK9A 3RMBA 2X6SA 3OVNA 3NVMA 3DRRA 3AA4A 4CFBA 1KQSM 3E9PA 4OLBA 3BDPA 1HNXK 3WNFA 3LM2A 3ENOA 3LDLA 2QKKA 2E6LA 1NLVA 2YHYA 2BUPA 4LFCK 3T19A 1NK8A 4DCHA 2AA4A 1BQNA 5FPNA 1OH7A 4DSLA 4KHSA 4PHTX 3OJUA 3AVLA 3DAWA 1RDUA 5FDLA 1IBKK 4J2DA 3QBWA 3THXB 4KPYA 1TYQB 1MU2A 3VA3A 3O4QA 4HCCA 1NK6A 4U7BA 2R7YA 2HBKA 4K25A 3NGIA 2IAJA 1QQNA 1RCHA 1B9FA 1SS6A 1XWLA 3EYZA 3MXIA 4B9UA 3EN9A 1CLQA 4PUOA 4RG8A 5BR9A 3PIOL 3RRHA 1QZ5A 3QEVA 1BCOA 2ZGZA 1VSEA 2GWJA 4BC3A 3J80O 1U45A 1K6YA 3KK2A 1N6QA 4B8CA 4GV3A 4IFYA 2PZSA 4PQUA 1KFDA 4YOXA 3O9TA 3W0LA 1ATRA 3EY1A 3WNGA 1N34K 1BIZA 3THVA 3VGKA 4CF8A 4BRQA 4CZMA 4AHCA 4IG3A 5HRRA 3T1HK 5HBMA 4ZTJA 4RW8A 5FROA 4M7YA 5JLHA 3P4IA 3SAFA 1ATSA 4FW1A 1TKXA 2CGLA 3IKMA 3O4WA 2Z1GA 3R1XA 2J4RA 1DTQA 3TAGA 3O4NA 4CGJA 5TKWA 3CFPA 4CHPA 4DTSA 4NB4A 3NF6A 3VEYA 3V9UA 3K58A 2G8HA 2FSJA 3K0SA 4DV7K 3CPEA 3CCEN 3V4IA 1IJJA 3VQ4A 3HPOA 1GLJO 1LWEA 1HPMA 4WFNL 3CC2N 5AQKA 3NGZA 3A5LC 3AVFA 3HOTA 3ZT4A 3H6EA 3DLEA 3EZWA 4OLAA 3I0RA 4H5WA 2NRTA 2HMPA 1VSIA 4DQIA 2HHWA 4BR5A 2IGIA 4YDUA 5IT9O 3EE9A 3VQPA 1NU0A 3MMVA 4BACA 4Z0UA 4YDUC 1DKGD 2QW9A 1TAQA 1YJ9N 2WFBA 4QS9A 4B1UB 3DLRA 4OKEA 2D5RA 2HBJA 3L2RA 1IO2A 3Q7CA 5SWMA 2YV0X 1Q82O 4H5VA 1E4FT 4CJTA 3DYAA 1UA1A 1W9HA 2VWBA 3RSEB 2OA8A 3R3LA 3WQUA 5BREA 3SQ1A 4FLZA 3T1YK 3EL2A 4LFBK 4GV9A 2IVNA 4PKGA 1T6DA 1GLDG 4CJQA 4WE1A 3A0IX 3DOLA 1G15A 1D4XA 5BR8K 4Z94A 5CZ1A 4BRDA 2E4LA 1RTJA 3HVTA 5HLFA 4FK4A 2D4WA 2NRVA 2RE2A 1ZBFA 4CFDA 5IWAK 5C24A 4EIAA 2UYTA 3SUOA 3BY5A 2XHBA 2O8DB 3KIOA 1VAZA 3SAHA 4DU1A 1WAFA 5LJVA 3G25A 1HKBA 5CHIA 4CGFA 3C6AA 4BWJA 4BVPA 4GVMA 1HYVA 3PY8A 2NRWA 4B3SK 1WSIA 1IV0A 4HVJA 1HYSA 3QNNA 4MO5A 3TSPA 1GLLO 3KJVA 1SL0A 2VG5A 1QSLA 1OVYA 4CZIA 4DR7K 1L3TA 4GV6A 1KVAA 3VQDA 3D2EB 4BDYA 3SLCA 4H0TB 3VN5A 2BH1A 3S9HA 3HVRA 3AAPA 2P9PB 4YOYA 4DQ8A 2YKMA 2NZTA 2HSTA 4ILHA 3GOIA 2FLOA 5I9EB 2AP1A 5K14A 1NWKA 2A5XA 5HL7L 5KGXA 2V51B 3C95A 2NRXA 2O8CA 4ZTFA 4BG9A 1RDAA 5CE3A 3OW2M 3QINA 4B3MK 1VQ7N 2HW3A 1T8EA 2UXDK 4FO0A 2AJQA 4DQRA 2Q0UA 5KPTA 1M90O 4DFPA 5C0YA 2YJEA 2OTLN 1VK0A 2W6LA 3L2WA 1T6CA 4JKCA 5F1XA 4DR1K 4DS4A 4FWPA 2GELA 1SUQA 4H5TA 2E6MA 4CF0A 4IXCA 2W40A 5CY4A 1XMOK 2WONA 3KKRA 4K43A 4DU4A 5ELZA 3HJFA 4PY5A 3CHWA 4BQLA 3WXJA 2P9UA 2P9IB 2NUBA 1H1VA 1S9GA 1YF5L 1NGEA 1W97L 4IO8A 3MEEA 3IRXA 1NM1A 4B1YB 3O3GA 2I7NA 5KPZA 3OYFA 3WXIA 5M1QA 3QEXA 3C0BA 3PSIA 4CE9A 3QFPA 2IOCA 3H45C 2WC9A 2QWNA 4NYFA 3NH2A 1BI4B 1RILA 3WT0A 4K8XA 4CF9A 3SQ2A 3V9ZA 1YJWN 1ATNA 1X9MA 1J6ZA 4KI6A 4DV4K 2VG6A 3KLFA 1C1BA 3ATVA 3R8EA 4M63C 4JS5A 5AQXA 1KC8O 4JYAK 4XH4A 5EVZA 1KLMA 4E1JA 4JI2K 2DY4A 4JKGA 1I94K 4CD1A 1SZ2A 3OY9A 1LW2A 3KZBA 2BE2A 3OTOK 2WTUA 4DF4A 3CERA 3ZSWA 4CEDA 4FLWA 4FJ8A 1NK4A 1IBMK 4B9LA 1RTIA 4H5RA 1Z6RA 3D2FA 4DTUA 3KD5E 5AQLA 1SKRA 4C8OA 3NF8A 3AVMA 3OYDA 4CJ4A 3CFOA 2YKNA 1BA0A 4YNQA 3OA9A 4FJHA 1IKYA 1WB9A 2E8AA 3BUZB 1BOTO 1D9DA 2O8BB 3KLHA 1EXQA 3PX6A 4AHSA 5AZJB 3SBGA 2FSKA 4RW9A 2IIRA 1U4BA 2WUSA 5JS1A 3CF5L 3T7ZA 1KD1O 3ZSOA 3ZSVA 4E3SA 4IEEA 3UKRA 2UUBK 4FJ5A 4A59A 5I3UA 4NLBA 4B3OA 4CJWA 4Z4HA 4FLTA 1NKBA 4CHOA 1TV6A 4MLHA 3FLCO 3LDPA 1UWBA 3IAYA 1JLGA 1FJGK 1V4SA 3L6QA 2B4JA 3I8DA 4IFEA 2O8EA 5KPRA 4A62A 2ZWHA 3VGMA 3B6OA 4DLGA 1RBVA 4OPAA 1GLBG 3JS6A 4ILJA 1HUXA 4C8NA 3TTDA 3C6UA 4F2RA 4JI8K 2P9LB 5J2MA 1JLEA 4PKHA 3NAEA 3SJJA 2VGMA 4I6MA 4CEZA 1VSHA 2Y1JA 2NRZA 5AZIA 3H46O 3RMAA 3LAKA 4E7JA 1TKDA 2I7PA 1Q81O 3O9UA 3CC4N 4DTMA 5B8HA 2O4GA 4J2AA 3CCMN 3ENHA 3PIPL 4CEQA 5HRNA 1S5JA 1TYQA 1V4TA 4FVMA 4IKFA 1KTQA 2NNWA 3MDQA 3E9LA 4YHHK 5JVHL 3DLKA 1C0FA 3KWIA 5CR4A 5EY4A 1RFQA 3MEDA 1RDCA 1S1VA 1VRUA 3PUFA 4Z4FA 2JWKA 4MFBA 4KKOA 3OYMA 4QS7A 1MA9B 3TTCA 3WXLA 4X65K 2P1JA 3ENBA 4JHDA 4IEIA 4W5TA 4FCYA 4DG1A 5AQUA 1QZ6A 3QBXA 1JJ2M 4Y1DA 1S1XA 1X1PA 3SUQA 4AM6A 2FBTA 1BWFO 4EAHD 2E5LK 4ISFA 4NCGA 4CEOA 4H5NA 3VEZA 1N5YA 3LDOA 3OYNA 1RT3A 4UQGA 2D0AA 3C6TA 4KO0A 4B1ZA 5AQWA 2F7TA 3HTVA 1EKEA 2KQ2A 4CHZA 4N76A 1GLCG 4CVNE 4HHTA 4GMJB 5LJWA 5JS2A 4CGIA 3GE1A 3H1QA 2HHUA 3I56N 3U4LA 3MECA 3WNHA 3QO9A 3TAEA 4CZLA 4LY7A 1L3SA 4BRCA 4KTWA 3OS2A 1YJNN 2HNDA 4CBXA 5MLCQ 3P39A 5LL6Z 5J1EA 5BRHA 2A1RA 3V9SA 2ETJA 3JYTA 2A3ZA 3N4QA 3DRPA 5AQMA 3RRGA 1YIJN 4NCAA 4AHUA 4Z4GA 3VQEA 2OPRA 4HUGA 4AHVA 1Q18A 4IJAA 5GADP 4B9NA 4W5NA 4CERA 5EXWA 1EETA 3DM2A 3OYHA 3ZT1A 5C2FA 2QWMA 3QMLA 3MX2A 4FM1A 5J2NA 3CCJN 3A5OC 1U48A 5GIOA 2YJFA 4W5OA 4F4KA 5AQNA 4JI0K 5FLXO 4CJ7A 3E01A 1OVQA 3L8BA 1QS4A 2YHWA 4N47A 4I9QA 4KH6A 3NF9A 3HYFA 1C0UA 3O1WA 4E7HA 1XHXA 3ULDA 4C8KA 3O1BA 4KHNA 4CK3A 3MCPA 4BQZA 3ULEB 3NBPA 2PYJA 4Z4IA 3DRSA 3O08A 4N5SA 1ITGA 3L4IA 4DLEA 3OYLA 1NMNA 3WNEA 1GLEG 1VQ9N 4J2EA 4KFBA 2OPSA 3HPGA 4Y0WA 3SJHA 4C8MA 3LZIA 4JAXA 4LF5K 2G8VA 1VSLA 4FL9A 1W7AA 3J8AA 4KHWA 3ZSXA 1KRPA 1T05A 3MN9A 2P9SB 3C65A 4FOIA 3R9PA 3VQ8A 4BWMA 4PA1A 4NCBA 5AR0A 1XUPO 1VQPN 1LW0A 2GBZA 5E41A 3VTIA 1YTUA 4CZHA 4K42A 2DFHA 1VHXA 3ZSZA 1ZBHA 2O8DA 4JI7K 4FZZA 4MO4A 2UUAK 3A2FA 3CJBA 3L2UA 3KVGA 1R59O 3S41A 4JKFA 4DSKA 1DGKN 4W5RA 4PKIA 4FLUA 2OANA 1ZBIA 1VQ6N 2QXLA 3PX0A 4CF1A 2GV9A 3D45A 4OGCA 1SL1A 5AQIA 1QVGM 3UE5A 4LH5A 4LF8K 3QERA 4B08A 2YNIA 3SV3A 1QTMA 1GLAG 3SI6A 1ZXOA 3ZYYX 4EFHA 3THWA 4JRQA 2QXFA 3TSUA 3I55N 3WQTA 1TGOA 1XNRK 1TAUA 1ILYA 3AAQA 1TL1A 1NGHA 3P1GA 3A8YA 3IG1A 4DSEA 3VGLA 5AQPA 5H1SQ 1ZYQA 2KTQA 4DV2K 2ZGYA 3ID6A 1VQNN 3J7YP 5CZ2A 4O8UA 2ASPA 3ZEUA 4CK2A 1VRTA 2QWOA 3MN6A 1K8AO 4OPJA 4BR7A 3IUCA 4IO9L 2F9TA 4BR2A 4DV6K 1IG8A 1KXPA 3L3UA 4DWIA 3VMFB 3L2QA 5BN8A 4CBUA 2RPIA 3CJ9A 3TPQA 4XH1A 3OYKA 3CCSN 4FJMA 4KHYA 2I5JA 4GKJK 4CHNA 3ITHA 1EWQA 2FBYA 2P9NA 3C7NA 3ZT0A 1X3MA 4CJSA 2NRRA 3FZHA 4E89A 3VEVA 4B1XB 3KHYA 1RT6A 3THYA 2ZF5O 3CIPA 3D7EO 2ZJRL 2F8TA 2ZJQL 3M8SA 1SV5A 1YVUA 4BC2A 3CPWM 2Y1IA 4AILC 3K5NA 4CJUA 1HNZK 1U6ZA 4JK7A 4FSVA 3SBTA 2FC0A 4W5QA 2P9KA 3K5MA 3IMXA 1BI4A 1NJXA 4IBNA 3P83D 4CZFA 3QLHA 3NCIA 3RR7A 3DMJA 4CESA 4M3TA 1HRHA 1K8KA 3HRGA 4KHUA 3TARA 4FJGA 4FJKA 5DK5A 4L8RB 4A61A 1KLNA 1RT4A 4BR4A 1Z26A 4FWRA 4O44A 5HRSA 3HXMA 3IDHA 4CIFA 2A41A 4JK8A 1NOYA 4X64K 3N4PA 2W41A 3NMUA 4F9OA 3R6MA 2ZD1A 1HNWK 3EKSA 5C15A 3K59A 2QEXN 4KHPK 4BRFA 1ZBLA 1T03A 4MQ3A 5BN9A 4LF4K 2XY8A 3VQCA 3U9ZA 4FWOA 3KD1E 3T1AA 1RTDA 3K9JA 4NO7A 4ILGB 3CM5A 4FWNA 4KREA 2D0PA 4LC9B 3ZETB 1JLQA 1YVNA 1SAZA 3DJCA 4JD2A 2OPQA 4J2BA 4JKBA 3DLLL 3L2VA 1K73O 3LDSA 1KVCA 5JVGL 2O8BA 4WQ5A 5AZJA 2UXCK 4WQ5C 4WCEL 4CJLA 4FM2A 4DU3A 5KTQA 3U8XA 3V9XA 4AM7A 3VEOA 4DFJA 3CJCA 4I2PA 1XC3A 1RNHA 1YUWA 3HSCA 3PX4A 2GEMA 1NGBA 2OPPA 4ICLA 2UUCK 4M3WA 2EX3A 4Q0BA 3QEPA 2D0BA 2PBDA 4OVLA 1JLAA 2GX9A 4CJKA 2X78A 3HK2A 2Q1NA 4N56A 2HHSA 1GOAA 4J8FA 4DHYA 1Z25A 5C25A 2JWLA 3F73A 1C1CA 3M8QA 1DTTA 1VQKN 3ASMA 1HQEA 3O5BA 3DLBA 4DV0K 2P9LA 4A2BA 5FPMA 1SL2A 3IS9A 4H4OA 4BGBA 1WBBA 3W3DA 4FK0A 1N32K 1RDWX 3TAMA 1ZBUA 1TK0A 4M3YA 3WXMB 1HR0K 3K5OA 1DT9A 5FRNA 1X9SA 3KWGA 4JKHA 3VENA 3SNNA 3CQ8A 5AFUH 4GKKK 4DR4K 2V7ZA 1U2VA 3ZCMA 3M8PA 4BRNA 2RF2A 4FZXC 4YOVA 3CC7N 4JEPA 2HHVA 3MX5A 1G99A 2KLAA 2VG7A 4O5FA 4DR2K 3BEXA 1NGIA 4K8ZA 1TL3A 4DV3K 2LSNA 4KB0A 5ADXH 3KK7A 1JLBA 4B9VA 1FKOA 4E7IA 3EEQA 3T3FA 1TUUA 4JI6K 2DPNA 2D0CA 3BF1A 1N8RO 1LV5A 4CEEA 3K2PA 5C10A 1HMVA 3SV4A 3VQ5A 2HHTA 4IFVA 3MWTA 3TI0A 4DUZK 4FVUA 4DQPA 1TK8A 2G8UA 4XEIA 3LALA 4DUYK 2P5GA 1LWFA 3J7AP 3AVNA 3MK6A 3QESA 4CK1A 3E1YA 4HUFA 4BRPA 2RHKA 3MWPA 4CIGA 4OPKA 4CEFA 3MAQA 3SMPA 3VQ9A 4EHUA 1NGFA 1QHAA 1JCGA 3O3FA 2Q0RA 4M3UA 4BC4A 4DFMA 2GUPA 2A40A 3BZKA 3A5MC 1IH7A 3H1VX 4M3RA 3HOSA 4F8RA 4KH4A 4JS4A 1NGDA 3AARA 4X66K 4F2SA 4FJ9A 3VERA 1TVRA 3V1RA 1TK5A 1XNQK 1A5XA 1BG3A 1RBSA 1QQCA 3TWHA 4QCLA 1QHTA 5KRSA 3OHRA 3LPUA 1GOBA 4ELTA 5KQ8A 2WBNA 1U49A 4H03B 5BRDA 3WEEB 2O8FA 1HQUA 3I8BA 3DWLA 5M1FA 1QQOA 4C23A 1NJYA 1WBDA 4QS8A 3FZLA 2E20A 2WOMA 3HBTA 1A5WA 1REVA 4AHTA 3QIPA 4AF1A 2G8KA 3QEIA 3H3NO 4IOAL 3BZCA 1Y64A 1C0MA 4Q5VA 1RT2A 1C6VA 5AQZA 3S3NA 1ZC6A 4WF9L 3M3ZA 4IDHA 2QA4N 4FK2A 3FZKA 1BDGA 1A5VA 1NGJA 3JAMO 3LANA 2QTDA 1UAXA 4LSNA 3FZFA 3NGYA 4LF6K 4M3ZA 4CZEA 4DV5K 2JLEA 4BRKA 1UA0A 4LSLA 1HJRA 2P51A 4BRHA 3CYMA 3G10A 4WFBL 3THXA 1HNIA 4B3RK 1BGXT 3AVKA 2A42A 3VF6A 3QIOA 2FSNA 3OS0A 4I7FA 5AQSA 1VQON 5AQFA 2KHOA 2O8CB 2DFFA 3HP9A 3LAMA 1WNSA 2HF4A 2ASOA 4KBOA 4BE1A 4K41A 4F3TA 3L0QA 4CJ5A 2XRIA 4ISGA 3FE1A 3RVCA 3VQAA 4E7LA 3SK3A 4CIEA 5AQQA 4GW6A 4JN4A 3AO5A 3NH1A 2QWLA 1CXUA 5JMVA 4OKJA 3ALYA 1IKWA 3FFKB 1EX4A 4M42A 3EE8A 1BA1A 1GOCA 4JK9A 4A5BA 1S1UA 2H3GX 1VQLN 3SMSA 3JXUA 1D8YA 2VYPA 4DTPA 3AGRA 3LDNA 4U67L 1YTAA 2HMIA 4YOTA 3HPHA 1NK0A 1U47A 4HWIA 4ISEA 4LF7K 4G1QA 1IG9A 4O0JA 1DLOA 3LP0A 4JI1K 3U9DA 2HBMA 3UIQA 1JL2A 5M1OA 3VQ7A 2IC3A 1S6QA 1JLCA 3LZJA 1GLFO 4PL8A 4WQ4A 2IVPA 3B8AX 1JLFA 4FPAA 1X9WA 1CZAN 3G0ZA 4GY2B 1SQKA 4DMNA 2HVIA 1YITN 4WQ4C 2QKBA 1S1WA 4CJ3A 2HB5A 1KAZA 3CD6N 3UKUB 2ITGA 5BPNA 3CMAN 3U3GA 4C1NI 3M8RA 3TSQA 1R0AA 2FBXA 2BTFA 1EP4A 3SYZA 1JCFA 1O13A 5EU7A 5FRMA 5M1NA 3ZX3A 3LP1A 3VPZA 2CGJA 4O5BA 4JKGB 3LM9A 3D6RA 3BP8A 4ID1A 3ID8A 1BL3A 1KFSA 1IKXA 3O3HA 4CFCA 4E19A 3AO3A 4KTQA 3SAGA 3D2FB 5AQJA 4CD3A 4H4MA 2DTUA 4B8AB 3CCRN 4LH4A 3NVKA 4IJNA 2IVOA 3ATUA 4EZ9A 1B9DA 4BVOA 2YHAA 5M1KA 3QNOA 2JGUA 3RSEA 1VSFA 1LWCA 4DR6K 3G4SN 3LWLA 1E4GT 4BG8A 3CCQN 5I42A 3AVCA 1Q9XA 1J5EK 4KAZA 3RR8A 3AO1A 4OX9K 1L3VA 4AQYK 4CZKA 2GTDA 5C2DA 3UKRB 5GAEP 1YI2N 2YNHA 2UXBK 4K0KK 4E0DA 3LL3A 5DM7L 2F8SA 3OYEA 3V1OA 1D9FA 3DOKA 1NGCA 5F2RA 1WSGA 2NRHA 4FOEA 3FZMA 3TAPA 5C42A 4BRAA 1J54A 3LP2A 2PY5A 4JLHA 2O8EB 3BGRA 3CFRA 5DM6L 4R79A 4B9TA 5J2QA 5AQYA 1NKCA 1NGAA 3AVIA 4BY9C 2E2QA 3MXJA 3QDKA 1E3MA 1QE1A 1LAWA 4XIUA 4CJPA 4I6MB 3OBWA 1YHQN 2OZSA 4DTJA 5AZIB 1OH8A 1KVBA 1ASVA 3SUPA 4MDAA 4V19S 4AH9A 3K5LA 3CCUN 2X6NA 2O4IA 1KAYA 3D2EA 4F3OA 4M45A 2E2NA 4X62K 2ZJPL 3DXMB 3MXMA 3CJ7A 1BCMA 2P9PA 3PO5A 3C94A 4FLXA 3J81O 2GWKA 5BPLA 5T7BA 4KV8A 4BGAA 1ESVA 1NK5A 5E26A 2YNGA 4O0IA 3KK1A 5AQGA 3NFAA 3GL1A 5J2PA 3UB5A 3I0SA 4FJLA 3CJAA 3VESA 4JHDB 1CXQA 1QVFM 3DLHA 2KKZA 4QOZB 1HNVA 4LFAK 3EZ5A 4FWSA 3VETA 2XO7A 1VQ4N 4BE2A 3E9OA 4CZJA 5CYQA 3A5NC 5EOYA 2Q3SA 3JSMA 2BDPA 4OJRA 2Q36A 1RGIA 4G9ZA 1S9EA 4YY3K 3F9MA 4IOXA 3VQBA 3P5JA 1VQ5N 2P9IA 3ZLJA 5AQTA 2HOEA 2XY7A 4DSIA 3FFIA 5KGWA 2OCEA 1FKPA 4CEBA 4DV1K 1BIUA 4NXNK 2OZMA 4PL7A 1I39A 1LCUA 4RCHA 2DFEA 4DSJA 4LD0A 1NG9A 3PV8A 3EO3A 4B9MA 4FJJA 2Z1JA 4E1MA 3SCXA 3VEXA 2ZM6K 3P31A 1WSFA 1N36K 4CHYA 3WUHA 2HBLA 1N33K 4HTLA 3AA3A 3QB0A 1C0GA 3IFRA 3KTQA 5LMUK 3DXKB 3TAQA 4DTNA 2YHXA 1T44A 3OBYA 2HNYA 1ASWA 3FGUA 1MWMA 3HL8A 3TR8A 3CCVN 1BO5O
chains in the Genus database with same CATH topology
5JVHL 1C0FA 1MWKA 3CETA 3KWIA 5CR4A 5EY4A 1RFQA 3E9PA 1KQSM 5C10A 4H0OA 2JWKA 3LM2A 4L3QA 3ENOA 3MWTA 3LDLA 1S22A 4QS7A 4FVUA 1NLVA 1MA9B 2HF3A 2YHYA 3TTCA 3WXLA 2BUPA 4XEIA 3ENBA 4JHDA 4H0XB 4NLCA 4IEIA 4DCHA 2AA4A 5FPNA 5AQUA 1QZ6A 3MK6A 3QBXA 1JJ2M 4B1WB 3E1YA 4BRPA 2RHKA 3MWPA 4PHTX 3ZX0A 4AM6A 1BWFO 3DAWA 4EAHD 1RDUA 4ISFA 3QBWA 4IWVA 4H5NA 3VEZA 3SMPA 1TYQB 3LDOA 3WEEA 4EHUA 1NGFA 1QHAA 1JCGA 2Q0RA 4BREA 2F9WA 4BC4A 2GUPA 1Z05A 2A40A 4B1ZA 3A5MC 4U7BA 3H1VX 5AQWA 2HBKA 3VF2A 3HOSA 4K25A 1HKGA 1QQNA 2F7TA 1SS6A 3HTVA 4KH4A 3EN9A 5C12A 1GLCG 3GBTA 1NGDA 3AARA 5BR9A 3PIOL 5LJWA 1QZ5A 3VERA 2ZGZA 3GE1A 2GWJA 1BG3A 3H1QA 4BC3A 3I56N 3U4LA 1HJOA 5E84A 4GV3A 4CZLA 3G71N 4BR0A 4BRCA 1YJNN 3OHRA 3O9TA 4YOXA 4CBXA 3W0LA 5MLCQ 1W2BM 3P39A 1ATRA 5KQ8A 2WBNA 5BRHA 4H03B 3VGKA 5BRDA 3I33A 3WEEB 4BRQA 4CZMA 3PLAA 4JKDA 3I8BA 3DWLA 5M1FA 2A3ZA 3N4QA 1QQOA 5AQMA 4C23A 1YIJN 3CQXA 4M7YA 5JLHA 3P4IA 3SAFA 4QS8A 1ATSA 1Q18A 4IJAA 3FZLA 5GADP 3HZ6A 3MCAB 3VOVA 2E20A 5EXWA 3IKMA 2CGLA 3HBTA 4RTFD 3O4WA 3R1XA 2J4RA 5C2FA 3CXCM 4AF1A 5TKWA 1K9MO 2QWMA 3QMLA 3MX2A 3H3NO 4H0VB 4IOAL 1Y64A 3CCJN 3A5OC 5GIOA 4NB4A 5AQZA 3VEYA 1ZC6A 2YJFA 5AQNA 1BO5O 3J7ZO 4WF9L 2FSJA 3M3ZA 4IDHA 4CJ7A 3F5TA 2QA4N 3CPEA 2E2PA 3ZEUB 3CCEN 1IJJA 3FZKA 2QM1A 1BDGA 1NBWA 1NGJA 2YHWA 1GLJO 4KH6A 3VEWA 1HPMA 4WFNL 3CC2N 3O1WA 5AQKA 2QTDA 4B1VA 2QWRA 3A5LC 3O1BA 1BU6O 3MCPA 4BQZA 4FWKA 3ULEB 3FZFA 3HOTA 4CZEA 3O08A 3L4IA 3H6EA 4BRKA 3EZWA 3O6WA 4EHTA 4A2AA 1GLEG 4BRHA 4H5WA 1VQ9N 2NRTA 2HMPA 2PAVA 4WFBL 5LY3A 2P9NB 4BR5A 3C7NB 4Y0WA 4YDUA 3SJHA 1Q7YO 2A42A 3EE9A 3BF3A 3VF6A 4JAXA 3MMVA 2FSNA 4YDUC 4FL9A 3J8AA 1HLUA 1DKGD 5AQOA 5AQSA 2QW9A 2KHOA 5AQFA 1YJ9N 2WFBA 1VQON 4UY8O 3MN9A 2P9SB 3C65A 4FOIA 4QS9A 3R9PA 4B1UB 5GIPA 2HF4A 1XUPO 5AR0A 1VQPN 2ASOA 4KBOA 1EQYA 4K41A 2HBJA 4XH5A 2Q31A 3VTIA 5EX5A 3Q7CA 3C6HA 4CZHA 1DEJA 4H5VA 1Q82O 4K42A 1E4FT 3L0QA 2OTJN 4GVEA 4ISGA 3FE1A 2VWBA 3MN7A 4JKEA 3RVCA 4WFAL 3RSEB 3SK3A 5AQQA 3R3LA 4JN4A 3WQUA 4MO4A 2QWLA 2P9KB 5BREA 5JMVA 3CJBA 3KVGA 3FFKB 3EL2A 1R59O 3S41A 4JKFA 4C1NK 1DGKN 3EE8A 1BA1A 3O8MA 4GV9A 1YAGA 2IVNA 4JK9A 4PKIA 2OANA 4PKGA 4A5BA 4M7XA 1GLDG 1T6DA 1K8KB 2H3GX 3UKUA 5GINA 3SMSA 3K9KA 1VQLN 1VQ8N 3JXUA 1VQ6N 2VYPA 2QXLA 3A0IX 3AGRA 3LDNA 4U67L 1D4XA 3GDQA 4Z94A 5AQIA 1QVGM 4BRDA 3UE5A 4YOTA 4HWIA 4ISEA 2D4WA 1GLAG 2NRVA 2RE2A 1ZXOA 3ZYYX 4CZGA 4MLEA 4EFHA 4B9QA 1NGGA 3TSUA 3I55N 3WQTA 4EIAA 2UYTA 4BY9C 5TKYA 2HBMA 3L4QA 3U9DA 1ILYA 3AAQA 1NGHA 5M1OA 3A8YA 1YXQA 5JICA 1GLFO 4BRIA 4PL8A 1VAZA 5AQPA 4WQ4A 3VGLA 2IVPA 3B8AX 4YOUA 3SAHA 5H1SQ 1S72N 4FPAA 5LJVA 3G25A 2ZGYA 1CZAN 4GY2B 1HKBA 1NMDA 1SQKA 3ID6A 3VTHA 3C6AA 4WQ4C 2FF6A 3ZX2A 5CHIA 1YITN 1VQNN 1KAZA 4BVPA 3CD6N 4O8UA 2ASPA 3ZEUA 3UKUB 2NRWA 2QWOA 4GNIA 5BPNA 1KAXA 3QFUA 3CMAN 2NLXA 4FPBA 3MN6A 4C1NI 1T3VA 3TSQA 1K8AO 4MO5A 3TSPA 1GLLO 4A5AA 4BR7A 3IUCA 4IO9L 3ULEA 2F9TA 4BR2A 1OVYA 4JD2B 4CZIA 2BTFA 1IG8A 1KXPA 4BR9A 4BRMA 4GV6A 1JCFA 3MN5A 1O13A 3VMFB 3D2EB 4WYBA 5M1NA 3SLCA 3ZX3A 5BN8A 4H0TB 3VPZA 3TPQA 2BH1A 3CJ9A 2CGJA 4XH1A 4CBUA 3CCSN 4JKGB 4CI6A 1HKCA 3D6RA 3AAPA 3LM9A 3M1FA 2P9PB 4YOYA 3FR0A 4DQ8A 2P9NA 2NZTA 3C7NA 3F2KA 2HSTA 4ILHA 3GOIA 5FPDA 2YX6A 2FLOA 1X3MA 3BP8A 3ID8A 5I9EB 2AP1A 1NWKA 2A5XA 5HL7L 3EKUA 2V51B 2NRRA 3FZHA 1EO1A 2NRXA 3HI0A 3VEVA 4B1XB 1OKJA 4BG9A 2P9SA 5CE3A 3KHYA 3WXKA 3SAGA 3D2FB 5AQJA 4CD3A 3OW2M 1VQ7N 1ZBSA 2ZF5O 3CIPA 3D7EO 3CCRN 2ZJRL 3NVKA 4FO0A 4IJNA 2IVOA 2ZJQL 5GAGP 3ATUA 2Q0UA 5KPTA 3O9SA 1M90O 1QQMA 4BC2A 4BVOA 5M1KA 5C0YA 2YJEA 3CPWM 2OTLN 3RSEA 1BUPA 1T6CA 1U6ZA 4JKCA 4FSVA 4JK7A 5F1XA 3SBTA 3G4SN 4FWPA 2GELA 4H5TA 2P9KA 1E4GT 3VF4A 4BG8A 2E88A 3CCQN 3IMXA 3Q7BA 4O8KA 4CZFA 4IXCA 2QI2A 2W40A 2FF3B 3HM8A 1K8KA 3HRGA 4K43A 4CZKA 2V52B 1TUYA 2GTDA 5ELZA 3UKRB 5GAEP 5C2DA 1YI2N 4A61A 3CHWA 4BQLA 3WXJA 5GAHP 2P9UA 2P9IB 3LL3A 4FWLA 1H1VA 4BR4A 1YF5L 4FWRA 1NGEA 1W97L 5DM7L 1HX1A 2QWPA 4IO8A 4KH5A 1NM1A 4B1YB 3IDHA 3DXMA 2A41A 2I7NA 1NGCA 4JK8A 5F2RA 2NRHA 3N4PA 3FZMA 2W41A 4FOEA 5KPZA 3WXIA 3NMUA 5M1QA 4F9OA 3C0BA 1LOTB 3R6MA 4BRAA 3QFPA 1U2VB 3H45C 3EKSA 5C15A 2WC9A 2QEXN 2QWNA 3CI5A 1M1KO 4BRFA 4JKAA 3E66A 5KQDA 3WT0A 5DM6L 5BN9A 4R79A 4IZ9A 5AQYA 3U9ZA 1NGAA 4FWOA 2ITMA 1YJWN 1ATNA 3K9JA 2E2QA 1J6ZA 4NO7A 4ILGB 3QDKA 4OPHA 5F0XA 1VQMN 4FWNA 3ATVA 3R8EA 4I6MB 2D0PA 3OBWA 4M63C 4LC9B 1YHQN 2D1KA 5BPMA 2E1ZA 5AZIB 3ZETB 3CQYA 1YVNA 2P9UB 1SAZA 2E1YA 3DJCA 5AQXA 1KC8O 4JD2A 4MDAA 3QICA 4JKBA 4XH4A 3DLLL 4JNEA 5EVZA 3CCUN 1K73O 1KAYA 4OO1J 2CH6A 3D2EA 4E1JA 5JVGL 1X3NA 2FXUA 3O9RA 2ZJPL 2E2NA 3DXMB 4WQ5A 3TTFA 3CJ7A 4JKGA 5AZJA 3P38A 2D0OA 2P9PA 4CD1A 1SZ2A 4WQ5C 4WCEL 5BRFA 2GWKA 3GG4A 5BPLA 5AQVA 3KZBA 3U8XA 4H0YB 3CERA 4AM7A 3VEOA 1ESVA 4BGAA 4YORA 1NJIO 5E26A 2CGKA 3CJCA 4A57A 4H5RA 5AQGA 4YOWA 1XC3A 1Z6RA 3D2FA 1YUWA 3HSCA 2GEMA 1NGBA 3AY9A 2EWSA 3GL1A 4BROA 1WOQA 5AQLA 2QWQA 3UB5A 2PBDA 3CJAA 3VESA 4JHDB 3CCLN 1QVFM 4FWQA 1MDUB 2GX9A 1BA0A 3M6GA 2KKZA 2VCPA 3OA9A 2Q1NA 2E8AA 3BUZB 5AFUA 1BOTO 4J8FA 4FWSA 4DHYA 3VETA 1VQ4N 2JWLA 4DB3A 4FWMA 1S3XA 5AZJB 2FSKA 2IIRA 2CH5A 2Q2RA 2V7YA 3AGKA 3SBGA 2PFUA 2WUSA 1VQKN 3E9OA 3G6EN 4CZJA 5AQHA 5EOYA 3A5NC 2VGNA 3CF5L 3LDQA 3T7ZA 1KD1O 5FPEA 3O5BA 2P9LA 4A2BA 4IEEA 4H0PA 4BC5A 2Q36A 3UKRA 5FPMA 1RGIA 4BGBA 2YCHA 3H3OB 3W3DA 4A59A 1RDWX 4G9ZA 3F9MA 4IOXA 4NLBA 1X9JA 2P9IA 3WXMB 4BRLA 1VQ5N 5ADXA 5AQTA 4RWTA 1DT9A 2HOEA 1Q86O 3DXKA 3KWGA 4JKHA 4MDBA 3VENA 4MLHA 5M1PA 3FLCO 1JCEA 5AFUH 3T69A 3LDPA 4PL7A 2V7ZA 3O9QA 3M5RA 2ASMA 4IOCL 1U2VA 1LCUA 1V4SA 3L6QA 5JLFA 4RCHA 4IFEA 4BRNA 5KPRA 4A62A 2ZWHA 3EO3A 3VGMA 2Q97A 4JEPA 1P8ZA 4DKWA 3TU5A 4YOVA 3CC7N 3MDQA 4BRGA 3MX5A 4OPAA 1G99A 1GLBG 2KLAA 3JS6A 4ILJA 1HUXA 3TTDA 3O80A 4O5FA 3VEXA 3BEXA 1NGIA 1P90A 1XQSC 3P31A 2P9LB 4PKHA 2VGMA 4I6MA 4CBWA 5HOOA 1WUAA 3WUHA 2HBLA 5ADXH 2NRZA 3KK7A 4HTLA 5AZIA 3ZETA 3CMEN 2YI1A 3H46O 3CJ1A 3QB0A 2E2OA 2I7PA 1C0GA 3IFRA 1Q81O 3O9UA 2A6AA 3CC4N 5AQRA 3DXKB 5B8HA 3CCMN 2YHXA 1T44A 3ENHA 1TUUA 3OBYA 3PIPL 2DPNA 1TYQA 1V4TA 3NVMA 3BF1A 3FGUA 1MWMA 1N8RO 3CCVN 2NNWA 3E9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C0F A;  1MWK A;  3CET A;  5EY4 A;  1RFQ A;  4H0O A;  3LM2 A;  4L3Q A;  3ENO A;  3LDL A;  1S22 A;  4QS7 A;  1NLV A;  1MA9 B;  2HF3 A;  2YHY A;  3WXL A;  2BUP A;  4XEI A;  4JHD A;  4H0X B;  4DCH A;  2AA4 A;  5FPN A;  5AQU A;  1QZ6 A;  3MK6 A;  3QBX A;  4B1W B;  4BRP A;  3ZX0 A;  4AM6 A;  1BWF O;  3DAW A;  4EAH D;  4ISF A;  3QBW A;  4IWV A;  4H5N A;  3VEZ A;  3SMP A;  1TYQ B;  3LDO A;  3WEE A;  4EHU A;  1NGF A;  1QHA A;  1JCG A;  2Q0R A;  4BRE A;  2F9W A;  4BC4 A;  2GUP A;  1Z05 A;  2A40 A;  4B1Z A;  3A5M C;  3H1V X;  5AQW A;  3VF2 A;  4K25 A;  1HKG A;  1QQN A;  3HTV A;  3EN9 A;  1GLC G;  3GBT A;  1NGD A;  3AAR A;  5BR9 A;  5LJW A;  1QZ5 A;  3VER A;  2ZGZ A;  3GE1 A;  2GWJ A;  1BG3 A;  3H1Q A;  4BC3 A;  3U4L A;  1HJO A;  5E84 A;  4CZL A;  4BR0 A;  4BRC A;  3OHR A;  4CBX A;  3W0L A;  1ATR A;  5KQ8 A;  5BRH A;  4H03 B;  3VGK A;  5BRD A;  3I33 A;  3WEE B;  4BRQ A;  4CZM A;  3I8B A;  3DWL A;  2A3Z A;  1QQO A;  5AQM A;  4C23 A;  3CQX A;  4M7Y A;  5JLH A;  3P4I A;  4QS8 A;  1ATS A;  1Q18 A;  4IJA A;  3FZL A;  3HZ6 A;  3VOV A;  2E20 A;  5EXW A;  2CGL A;  3HBT A;  4RTF D;  3O4W A;  2J4R A;  2QWM A;  3QML A;  3H3N O;  4H0V B;  1Y64 A;  3A5O C;  4NB4 A;  5AQZ A;  3VEY A;  1ZC6 A;  2YJF A;  5AQN A;  2FSJ A;  3M3Z A;  4CJ7 A;  2E2P A;  3ZEU B;  1IJJ A;  3FZK A;  2QM1 A;  1BDG A;  1NBW A;  1NGJ A;  2YHW A;  1GLJ O;  3VEW A;  1HPM A;  3O1W A;  5AQK A;  4B1V A;  2QWR A;  3A5L C;  3O1B A;  1BU6 O;  3MCP A;  4BQZ A;  4FWK A;  3ULE B;  3FZF A;  4CZE A;  3O08 A;  3L4I A;  3H6E A;  4BRK A;  3EZW A;  3O6W A;  4EHT A;  4A2A A;  1GLE G;  4BRH A;  4H5W A;  2HMP A;  2PAV A;  5LY3 A;  2P9N B;  4BR5 A;  3C7N B;  4Y0W A;  4YDU A;  3SJH A;  2A42 A;  3BF3 A;  3VF6 A;  4JAX A;  3MMV A;  2FSN A;  4YDU C;  4FL9 A;  3J8A A;  1HLU A;  1DKG D;  5AQO A;  5AQS A;  2QW9 A;  2KHO A;  5AQF A;  3MN9 A;  2P9S B;  4FOI A;  4QS9 A;  3R9P A;  4B1U B;  2HF4 A;  1XUP O;  5AR0 A;  2ASO A;  4KBO A;  1EQY A;  4K41 A;  4XH5 A;  2Q31 A;  5EX5 A;  4CZH A;  1DEJ A;  4H5V A;  4K42 A;  1E4F T;  3L0Q A;  4ISG A;  3FE1 A;  2VWB A;  3MN7 A;  3RSE B;  3SK3 A;  5AQQ A;  4JN4 A;  3WQU A;  4MO4 A;  2QWL A;  2P9K B;  5BRE A;  5JMV A;  3CJB A;  3KVG A;  3FFK B;  3EL2 A;  1R59 O;  3S41 A;  1DGK N;  1BA1 A;  3O8M A;  1YAG A;  2IVN A;  4PKI A;  2OAN A;  4PKG A;  4M7X A;  1GLD G;  1T6D A;  1K8K B;  2H3G X;  3UKU A;  3SMS A;  3JXU A;  2VYP A;  2QXL A;  3A0I X;  3LDN A;  1D4X A;  3GDQ A;  4Z94 A;  5AQI A;  4BRD A;  3UE5 A;  4HWI A;  4ISE A;  2D4W A;  1GLA G;  1ZXO A;  4CZG A;  4MLE A;  4EFH A;  4B9Q A;  1NGG A;  3WQT A;  4EIA A;  2UYT A;  5TKY A;  3U9D A;  3AAQ A;  1NGH A;  3A8Y A;  1YXQ A;  5JIC A;  1GLF O;  4BRI A;  4PL8 A;  3VGL A;  5AQP A;  4WQ4 A;  2IVP A;  3B8A X;  4FPA A;  5LJV A;  3G25 A;  2ZGY A;  1CZA N;  4GY2 B;  1HKB A;  1NMD A;  1SQK A;  4WQ4 C;  2FF6 A;  3ZX2 A;  1KAZ A;  4BVP A;  2ASP A;  3ZEU A;  3UKU B;  2QWO A;  4GNI A;  5BPN A;  1KAX A;  3QFU A;  2NLX A;  4FPB A;  3MN6 A;  4MO5 A;  1GLL O;  4BR7 A;  3IUC A;  3ULE A;  2F9T A;  4BR2 A;  4JD2 B;  4CZI A;  2BTF A;  1IG8 A;  1KXP A;  4BR9 A;  4BRM A;  1JCF A;  3MN5 A;  3D2E B;  4WYB A;  3SLC A;  3ZX3 A;  5BN8 A;  4H0T B;  3VPZ A;  3TPQ A;  3CJ9 A;  4CBU A;  2CGJ A;  4XH1 A;  4CI6 A;  1HKC A;  3LM9 A;  3AAP A;  3M1F A;  2P9P B;  3FR0 A;  4DQ8 A;  2P9N A;  2NZT A;  3C7N A;  5FPD A;  3GOI A;  2FLO A;  1X3M A;  3BP8 A;  3ID8 A;  5I9E B;  2AP1 A;  1NWK A;  2A5X A;  3EKU A;  2V51 B;  3FZH A;  3HI0 A;  3VEV A;  4B1X B;  1OKJ A;  4BG9 A;  2P9S A;  5CE3 A;  3KHY A;  3WXK A;  3D2F B;  5AQJ A;  4CD3 A;  1ZBS A;  2ZF5 O;  3CIP A;  3D7E O;  4FO0 A;  4IJN A;  2IVO A;  3ATU A;  2Q0U A;  5KPT A;  1QQM A;  4BC2 A;  4BVO A;  2YJE A;  3RSE A;  1BUP A;  1T6C A;  1U6Z A;  4FSV A;  5F1X A;  4FWP A;  2GEL A;  4H5T A;  2P9K A;  1E4G T;  3VF4 A;  4BG8 A;  2E88 A;  3IMX A;  4O8K A;  4CZF A;  4IXC A;  2W40 A;  2FF3 B;  3HM8 A;  1K8K A;  4K43 A;  4CZK A;  2V52 B;  1TUY A;  2GTD A;  5ELZ A;  3UKR B;  4A61 A;  3CHW A;  4BQL A;  3WXJ A;  2P9U A;  2P9I B;  3LL3 A;  4FWL A;  1H1V A;  4BR4 A;  4FWR A;  1NGE A;  1HX1 A;  2QWP A;  4IO8 A;  1NM1 A;  4B1Y B;  3IDH A;  3DXM A;  2A41 A;  2I7N A;  1NGC A;  5F2R A;  2NRH A;  4FOE A;  3FZM A;  2W41 A;  5KPZ A;  3WXI A;  4F9O A;  3C0B A;  1LOT B;  3R6M A;  4BRA A;  3QFP A;  1U2V B;  3H45 C;  3EKS A;  2QWN A;  3CI5 A;  4BRF A;  5KQD A;  3WT0 A;  5BN9 A;  4IZ9 A;  5AQY A;  3U9Z A;  1NGA A;  4FWO A;  2ITM A;  1ATN A;  2E2Q A;  1J6Z A;  4NO7 A;  3QDK A;  5F0X A;  4FWN A;  3ATV A;  3R8E A;  4I6M B;  2D0P A;  4M63 C;  4LC9 B;  2D1K A;  5BPM A;  2E1Z A;  5AZI B;  3ZET B;  3CQY A;  1YVN A;  2P9U B;  1SAZ A;  2E1Y A;  3DJC A;  5AQX A;  4JD2 A;  3QIC A;  4XH4 A;  4JNE A;  5EVZ A;  1KAY A;  2CH6 A;  3D2E A;  4E1J A;  1X3N A;  2FXU A;  2E2N A;  3DXM B;  4WQ5 A;  3CJ7 A;  5AZJ A;  2D0O A;  2P9P A;  4CD1 A;  1SZ2 A;  4WQ5 C;  5BRF A;  2GWK A;  3GG4 A;  5BPL A;  5AQV A;  3KZB A;  3U8X A;  4H0Y B;  3CER A;  4AM7 A;  3VEO A;  1ESV A;  4BGA A;  5E26 A;  2CGK A;  3CJC A;  4H5R A;  5AQG A;  1XC3 A;  1Z6R A;  3D2F A;  1YUW A;  3HSC A;  2GEM A;  1NGB A;  3AY9 A;  2EWS A;  3GL1 A;  4BRO A;  1WOQ A;  5AQL A;  2QWQ A;  3UB5 A;  2PBD A;  3CJA A;  3VES A;  4JHD B;  4FWQ A;  1MDU B;  1BA0 A;  3M6G A;  2VCP A;  2Q1N A;  2E8A A;  3BUZ B;  5AFU A;  1BOT O;  4J8F A;  4FWS A;  4DHY A;  3VET A;  4DB3 A;  4FWM A;  1S3X A;  5AZJ B;  2FSK A;  2IIR A;  2CH5 A;  2Q2R A;  2V7Y A;  2WUS A;  4CZJ A;  5AQH A;  5EOY A;  3A5N C;  3LDQ A;  5FPE A;  3O5B A;  2P9L A;  4A2B A;  4H0P A;  4BC5 A;  2Q36 A;  3UKR A;  5FPM A;  1RGI A;  4BGB A;  2YCH A;  3H3O B;  3W3D A;  1RDW X;  3F9M A;  1X9J A;  2P9I A;  4BRL A;  5ADX A;  5AQT A;  4RWT A;  2HOE A;  3DXK A;  3VEN A;  4MLH A;  3FLC O;  1JCE A;  5AFU H;  3LDP A;  4PL7 A;  2V7Z A;  2ASM A;  1U2V A;  1LCU A;  1V4S A;  3L6Q A;  5JLF A;  4RCH A;  4BRN A;  5KPR A;  4A62 A;  2ZWH A;  3EO3 A;  3VGM A;  2Q97 A;  1P8Z A;  3TU5 A;  3MDQ A;  4BRG A;  1G99 A;  1GLB G;  3JS6 A;  1HUX A;  3O80 A;  4O5F A;  3VEX A;  3BEX A;  1NGI A;  1XQS C;  2P9L B;  4PKH A;  4I6M A;  4CBW A;  1WUA A;  3WUH A;  5ADX H;  4HTL A;  5AZI A;  3ZET A;  2YI1 A;  3H46 O;  3CJ1 A;  3QB0 A;  2E2O A;  2I7P A;  1C0G A;  3IFR A;  2A6A A;  5AQR A;  3DXK B;  5B8H A;  2YHX A;  3ENH A;  1T44 A;  1TUU A;  2DPN A;  1TYQ A;  1V4T A;  3BF1 A;  3FGU A;  1MWM A;  1BO5 O; 
#chains in the Genus database with same CATH topology
 1WAJ A;  1XHZ A;  3ZSQ A;  1MWK A;  3CET A;  3H08 A;  4CJE A;  4JI3 K;  4H0O A;  4L3Q A;  1S22 A;  2HF3 A;  4R5P A;  2VQE K;  4DF8 A;  1RTH A;  4H0X B;  4NLC A;  2HHH K;  4C8L A;  1UOC A;  4B1W B;  3NDK A;  3AA5 X;  1XMQ K;  3ZX0 A;  4KB1 A;  2B6A A;  3KLE A;  3K57 A;  4IWV A;  4OGE A;  4I2Q A;  2IS3 A;  3WEE A;  5CYM A;  4ID5 A;  1ASU A;  4BRE A;  2F9W A;  4DQS A;  1Z05 A;  2G8I A;  1J53 A;  3VF2 A;  1HKG A;  1Q9Y A;  5C12 A;  2G8F A;  3GBT A;  5KI6 A;  3ZT3 A;  3L3V A;  2XY5 A;  1JXB A;  3CM6 A;  1JXE A;  1YT3 A;  1HJO A;  5E84 A;  3NF7 A;  3G71 N;  4BR0 A;  4DR3 K;  4CGG A;  1OH5 A;  1RDB A;  4RW4 A;  5KRT A;  4E7K A;  1W2B M;  4Z4C A;  4HCB A;  3AVB A;  3I33 A;  3PLA A;  4JKD A;  3OYA A;  4BE0 A;  2HNZ A;  1VSD A;  2BAN A;  3CQX A;  1S1T A;  1U04 A;  4I9L A;  4BDP A;  2ATQ A;  3HZ6 A;  3MCA B;  3VOV A;  1NK7 A;  2W42 A;  1XI1 A;  4DTX A;  4RTF D;  3THW B;  4CFA A;  1KCF A;  3CXC M;  1TKZ A;  2VWJ A;  1K9M O;  4H0V B;  4JRP A;  1WSH A;  1NNE A;  1BHL A;  1C0T A;  2YHB A;  4KRF A;  4JI5 K;  3RWU A;  4FW2 A;  4FJX A;  3J7Z O;  3F5T A;  2E2P A;  2A1S A;  3ZEU B;  5AJ3 K;  2X74 A;  1Q8I A;  1NBW A;  2QM1 A;  3VEW A;  4FZY A;  3V1Q A;  4B1V A;  2QWR A;  3NE6 A;  1BU6 O;  5D3G A;  4H8K A;  4FWK A;  3DI6 A;  5A2Q O;  3VQQ A;  3O6W A;  4EHT A;  3LPT A;  4A2A A;  3SQ4 A;  1L5U A;  1BIS A;  2PAV A;  5LY3 A;  3PO4 A;  2P9N B;  3C7N B;  1Q7Y O;  1QSY A;  4LF9 K;  3V81 A;  3BF3 A;  2F4V K;  2F96 A;  1HLU A;  5AQO A;  4UY8 O;  3QET A;  1J9A A;  2BGG A;  3F9K A;  2B5J A;  3OYI A;  3OYB A;  4CCH A;  1L3U A;  5GIP A;  3THY B;  4XH5 A;  1EQY A;  2Q31 A;  5EX5 A;  4HTU A;  1WN7 A;  2Z1I A;  3C6H A;  1DEJ A;  4CW7 B;  2OTJ N;  4GVE A;  3MN7 A;  4JKE A;  4WFA L;  2IDO A;  4KTZ A;  4NYN A;  2P9K B;  4TSX A;  3VA0 A;  1XC9 A;  4C1N K;  3AA2 A;  3O8M A;  1YAG A;  3KK3 A;  4M7X A;  1RT1 A;  4N41 A;  1HYZ A;  4B3T K;  1K8K B;  3UKU A;  5GIN A;  1BQM A;  3AVG A;  3K9K A;  1VQ8 N;  1FW6 A;  5DMR A;  4PWD A;  4ZHR A;  3GDQ A;  2PYL A;  4FJ7 A;  1NJW A;  4CZG A;  4Y1C A;  4MLE A;  4M3X A;  4B9Q A;  1NGG A;  5TKY A;  3L4Q A;  3OYJ A;  1WSE A;  1J5O A;  1YXQ A;  5JIC A;  4BRI A;  4YOU A;  4RW7 A;  3OYG A;  1S72 N;  3V6D A;  2FBV A;  2ZQB A;  4IDK A;  1NMD A;  3VTH A;  2FF6 A;  3ZX2 A;  1WLJ A;  4GNI A;  1KAX A;  3QFU A;  4CJV A;  2NLX A;  2YNF A;  4FPB A;  1T3V A;  4BDZ A;  4A5A A;  1EWR A;  5HP1 A;  3ULE A;  4JD2 B;  2XY6 A;  4BR9 A;  4BRM A;  4HUE A;  3MN5 A;  4WYB A;  2KFN A;  3RMC A;  3NHG A;  4CI6 A;  1HKC A;  4O55 A;  3M1F A;  3FR0 A;  4EP5 A;  4FYD A;  1VSM A;  4EP4 A;  3F2K A;  5FPD A;  2YX6 A;  2KFZ A;  3KLI A;  2OYQ A;  3EKU A;  4CEC A;  4FJN A;  3ZSY A;  1SKW A;  1EO1 A;  3HI0 A;  4NXM K;  1OKJ A;  2P9S A;  3WXK A;  1O1W A;  1ZBS A;  3AO2 A;  4CJF A;  3TAF A;  4DQQ A;  3LP3 A;  5GAG P;  3O9S A;  3HP6 A;  1QQM A;  1RBT A;  1BUP A;  3PSF A;  1JL1 A;  2GUI A;  2EHG A;  3VF4 A;  4DR5 K;  2E88 A;  1IKV A;  3Q7B A;  4O8K A;  2QI2 A;  2FF3 B;  4EZ6 A;  3HM8 A;  3OJS A;  4DSF A;  4KHQ A;  2V52 B;  1TUY A;  1RBR A;  3SUN A;  3SPZ A;  3HO1 A;  3ISN C;  5GAH P;  3ZSR A;  2W6K A;  4FWL A;  5SZT A;  4JI4 K;  1HX1 A;  2QWP A;  4KH5 A;  4B9S A;  1CZ9 A;  3DXM A;  3KKS A;  1LOT B;  4M41 A;  1RT5 A;  1U2V B;  3ZT2 A;  3SPY A;  1LAV A;  2KZM A;  1JKH A;  3CI5 A;  1M1K O;  2HHQ A;  5LMN K;  4JKA A;  3E66 A;  3AVH A;  5KQD A;  3SZ2 A;  4AHR A;  2RN2 A;  3MEG A;  4IZ9 A;  1SKS A;  2ITM A;  1NJZ A;  4CJR A;  1VQM N;  4OPH A;  5F0X A;  4FLY A;  3TAN A;  1C1A A;  1NKE A;  4FLV A;  2D1K A;  5BPM A;  2E1Z A;  1FXX A;  3CQY A;  4ELV A;  2P9U B;  2E1Y A;  3HM9 A;  3QIC A;  1RDD A;  2VWK A;  4JNE A;  1T7P A;  4OO1 J;  1OH6 A;  2CH6 A;  1X3N A;  1RBU A;  2FXU A;  3O9R A;  3NH0 A;  3TTF A;  3VQ6 A;  1TKT A;  3P38 A;  2D0O A;  3LWM A;  5BRF A;  4CGD A;  3GG4 A;  3V9W A;  5AQV A;  3S3O A;  3S3M A;  2G8W A;  2HHX A;  4H0Y B;  1VSK A;  4YOR A;  1NJI O;  4RW6 A;  4YFU A;  2CGK A;  4DTO A;  4A57 A;  3CG7 A;  1NOZ A;  4YOW A;  3OYC A;  2KZZ A;  3AY9 A;  2EWS A;  4BRO A;  4CHQ A;  1WOQ A;  4E1N A;  2QWQ A;  3CCL N;  3TAB A;  4FXD A;  4FWQ A;  1MDU B;  4DFK A;  3M6G A;  2VCP A;  2ZE2 A;  5HRP A;  5AFU A;  3HST B;  1Y97 A;  3HT3 A;  4DS5 A;  4DB3 A;  4FWM A;  1S3X A;  4KI4 A;  5HRO A;  2HVH A;  2V7Y A;  1I3A A;  2CH5 A;  2Q2R A;  3AGK A;  2PFU A;  2KW4 A;  3G6E N;  5AQH A;  2VGN A;  3LDQ A;  5FPE A;  2P5O A;  3U6F A;  3DLG A;  4H0P A;  4BC5 A;  1VSJ A;  1WSJ A;  3U3Y A;  2YCH A;  3H3O B;  1QSS A;  1HPZ A;  1CZB A;  3D0P A;  1X9J A;  4BRL A;  5ADX A;  3RMD A;  4RWT A;  1Q86 O;  3DXK A;  3OS1 A;  4MDB A;  1NK9 A;  5M1P A;  1B92 A;  1JCE A;  3T69 A;  4CF2 A;  1RT7 A;  2UU9 K;  4CEA A;  3O9Q A;  3M5R A;  3SQ0 A;  2ASM A;  4IOC L;  5JLF A;  1F21 A;  3AVA A;  1W0H A;  3AVJ A;  3AV9 A;  3RTV A;  4QAG A;  2VQF K;  4DTR A;  3AO4 A;  4OKK A;  2Q97 A;  4DKW A;  1P8Z A;  4Z4E A;  3TU5 A;  1S6P A;  4CGH A;  4BRG A;  2O8F B;  3O80 A;  4FM0 A;  4JV5 K;  1D5A A;  3B6P A;  4IG0 A;  1P90 A;  1XQS C;  4ELU A;  1FK9 A;  3QEW A;  3KLG A;  4CBW A;  5HOO A;  1WUA A;  3ZET A;  3CME N;  2YI1 A;  3CJ1 A;  1KSP A;  2E2O A;  2Z1H A;  4O4G A;  1IBL K;  2A6A A;  2RKI A;  5AQR A;  4FJI A;  2QK9 A;  3RMB A;  2X6S A;  3OVN A;  3NVM A;  3DRR A;  3AA4 A;  4CFB A;  1KQS M;  3E9P A;  4OLB A;  3BDP A;  1HNX K;  3WNF A;  3LM2 A;  3ENO A;  3LDL A;  2QKK A;  2E6L A;  1NLV A;  2YHY A;  2BUP A;  4LFC K;  3T19 A;  1NK8 A;  4DCH A;  2AA4 A;  1BQN A;  5FPN A;  1OH7 A;  4DSL A;  4KHS A;  4PHT X;  3OJU A;  3AVL A;  3DAW A;  1RDU A;  5FDL A;  1IBK K;  4J2D A;  3QBW A;  3THX B;  4KPY A;  1TYQ B;  1MU2 A;  3VA3 A;  3O4Q A;  4HCC A;  1NK6 A;  4U7B A;  2R7Y A;  2HBK A;  4K25 A;  3NGI A;  2IAJ A;  1QQN A;  1RCH A;  1B9F A;  1SS6 A;  1XWL A;  3EYZ A;  3MXI A;  4B9U A;  3EN9 A;  1CLQ A;  4PUO A;  4RG8 A;  5BR9 A;  3PIO L;  3RRH A;  1QZ5 A;  3QEV A;  1BCO A;  2ZGZ A;  1VSE A;  2GWJ A;  4BC3 A;  3J80 O;  1U45 A;  1K6Y A;  3KK2 A;  1N6Q A;  4B8C A;  4GV3 A;  4IFY A;  2PZS A;  4PQU A;  1KFD A;  4YOX A;  3O9T A;  3W0L A;  1ATR A;  3EY1 A;  3WNG A;  1N34 K;  1BIZ A;  3THV A;  3VGK A;  4CF8 A;  4BRQ A;  4CZM A;  4AHC A;  4IG3 A;  5HRR A;  3T1H K;  5HBM A;  4ZTJ A;  4RW8 A;  5FRO A;  4M7Y A;  5JLH A;  3P4I A;  3SAF A;  1ATS A;  4FW1 A;  1TKX A;  2CGL A;  3IKM A;  3O4W A;  2Z1G A;  3R1X A;  2J4R A;  1DTQ A;  3TAG A;  3O4N A;  4CGJ A;  5TKW A;  3CFP A;  4CHP A;  4DTS A;  4NB4 A;  3NF6 A;  3VEY A;  3V9U A;  3K58 A;  2G8H A;  2FSJ A;  3K0S A;  4DV7 K;  3CPE A;  3CCE N;  3V4I A;  1IJJ A;  3VQ4 A;  3HPO A;  1GLJ O;  1LWE A;  1HPM A;  4WFN L;  3CC2 N;  5AQK A;  3NGZ A;  3A5L C;  3AVF A;  3HOT A;  3ZT4 A;  3H6E A;  3DLE A;  3EZW A;  4OLA A;  3I0R A;  4H5W A;  2NRT A;  2HMP A;  1VSI A;  4DQI A;  2HHW A;  4BR5 A;  2IGI A;  4YDU A;  5IT9 O;  3EE9 A;  3VQP A;  1NU0 A;  3MMV A;  4BAC A;  4Z0U A;  4YDU C;  1DKG D;  2QW9 A;  1TAQ A;  1YJ9 N;  2WFB A;  4QS9 A;  4B1U B;  3DLR A;  4OKE A;  2D5R A;  2HBJ A;  3L2R A;  1IO2 A;  3Q7C A;  5SWM A;  2YV0 X;  1Q82 O;  4H5V A;  1E4F T;  4CJT A;  3DYA A;  1UA1 A;  1W9H A;  2VWB A;  3RSE B;  2OA8 A;  3R3L A;  3WQU A;  5BRE A;  3SQ1 A;  4FLZ A;  3T1Y K;  3EL2 A;  4LFB K;  4GV9 A;  2IVN A;  4PKG A;  1T6D A;  1GLD G;  4CJQ A;  4WE1 A;  3A0I X;  3DOL A;  1G15 A;  1D4X A;  5BR8 K;  4Z94 A;  5CZ1 A;  4BRD A;  2E4L A;  1RTJ A;  3HVT A;  5HLF A;  4FK4 A;  2D4W A;  2NRV A;  2RE2 A;  1ZBF A;  4CFD A;  5IWA K;  5C24 A;  4EIA A;  2UYT A;  3SUO A;  3BY5 A;  2XHB A;  2O8D B;  3KIO A;  1VAZ A;  3SAH A;  4DU1 A;  1WAF A;  5LJV A;  3G25 A;  1HKB A;  5CHI A;  4CGF A;  3C6A A;  4BWJ A;  4BVP A;  4GVM A;  1HYV A;  3PY8 A;  2NRW A;  4B3S K;  1WSI A;  1IV0 A;  4HVJ A;  1HYS A;  3QNN A;  4MO5 A;  3TSP A;  1GLL O;  3KJV A;  1SL0 A;  2VG5 A;  1QSL A;  1OVY A;  4CZI A;  4DR7 K;  1L3T A;  4GV6 A;  1KVA A;  3VQD A;  3D2E B;  4BDY A;  3SLC A;  4H0T B;  3VN5 A;  2BH1 A;  3S9H A;  3HVR A;  3AAP A;  2P9P B;  4YOY A;  4DQ8 A;  2YKM A;  2NZT A;  2HST A;  4ILH A;  3GOI A;  2FLO A;  5I9E B;  2AP1 A;  5K14 A;  1NWK A;  2A5X A;  5HL7 L;  5KGX A;  2V51 B;  3C95 A;  2NRX A;  2O8C A;  4ZTF A;  4BG9 A;  1RDA A;  5CE3 A;  3OW2 M;  3QIN A;  4B3M K;  1VQ7 N;  2HW3 A;  1T8E A;  2UXD K;  4FO0 A;  2AJQ A;  4DQR A;  2Q0U A;  5KPT A;  1M90 O;  4DFP A;  5C0Y A;  2YJE A;  2OTL N;  1VK0 A;  2W6L A;  3L2W A;  1T6C A;  4JKC A;  5F1X A;  4DR1 K;  4DS4 A;  4FWP A;  2GEL A;  1SUQ A;  4H5T A;  2E6M A;  4CF0 A;  4IXC A;  2W40 A;  5CY4 A;  1XMO K;  2WON A;  3KKR A;  4K43 A;  4DU4 A;  5ELZ A;  3HJF A;  4PY5 A;  3CHW A;  4BQL A;  3WXJ A;  2P9U A;  2P9I B;  2NUB A;  1H1V A;  1S9G A;  1YF5 L;  1NGE A;  1W97 L;  4IO8 A;  3MEE A;  3IRX A;  1NM1 A;  4B1Y B;  3O3G A;  2I7N A;  5KPZ A;  3OYF A;  3WXI A;  5M1Q A;  3QEX A;  3C0B A;  3PSI A;  4CE9 A;  3QFP A;  2IOC A;  3H45 C;  2WC9 A;  2QWN A;  4NYF A;  3NH2 A;  1BI4 B;  1RIL A;  3WT0 A;  4K8X A;  4CF9 A;  3SQ2 A;  3V9Z A;  1YJW N;  1ATN A;  1X9M A;  1J6Z A;  4KI6 A;  4DV4 K;  2VG6 A;  3KLF A;  1C1B A;  3ATV A;  3R8E A;  4M63 C;  4JS5 A;  5AQX A;  1KC8 O;  4JYA K;  4XH4 A;  5EVZ A;  1KLM A;  4E1J A;  4JI2 K;  2DY4 A;  4JKG A;  1I94 K;  4CD1 A;  1SZ2 A;  3OY9 A;  1LW2 A;  3KZB A;  2BE2 A;  3OTO K;  2WTU A;  4DF4 A;  3CER A;  3ZSW A;  4CED A;  4FLW A;  4FJ8 A;  1NK4 A;  1IBM K;  4B9L A;  1RTI A;  4H5R A;  1Z6R A;  3D2F A;  4DTU A;  3KD5 E;  5AQL A;  1SKR A;  4C8O A;  3NF8 A;  3AVM A;  3OYD A;  4CJ4 A;  3CFO A;  2YKN A;  1BA0 A;  4YNQ A;  3OA9 A;  4FJH A;  1IKY A;  1WB9 A;  2E8A A;  3BUZ B;  1BOT O;  1D9D A;  2O8B B;  3KLH A;  1EXQ A;  3PX6 A;  4AHS A;  5AZJ B;  3SBG A;  2FSK A;  4RW9 A;  2IIR A;  1U4B A;  2WUS A;  5JS1 A;  3CF5 L;  3T7Z A;  1KD1 O;  3ZSO A;  3ZSV A;  4E3S A;  4IEE A;  3UKR A;  2UUB K;  4FJ5 A;  4A59 A;  5I3U A;  4NLB A;  4B3O A;  4CJW A;  4Z4H A;  4FLT A;  1NKB A;  4CHO A;  1TV6 A;  4MLH A;  3FLC O;  3LDP A;  1UWB A;  3IAY A;  1JLG A;  1FJG K;  1V4S A;  3L6Q A;  2B4J A;  3I8D A;  4IFE A;  2O8E A;  5KPR A;  4A62 A;  2ZWH A;  3VGM A;  3B6O A;  4DLG A;  1RBV A;  4OPA A;  1GLB G;  3JS6 A;  4ILJ A;  1HUX A;  4C8N A;  3TTD A;  3C6U A;  4F2R A;  4JI8 K;  2P9L B;  5J2M A;  1JLE A;  4PKH A;  3NAE A;  3SJJ A;  2VGM A;  4I6M A;  4CEZ A;  1VSH A;  2Y1J A;  2NRZ A;  5AZI A;  3H46 O;  3RMA A;  3LAK A;  4E7J A;  1TKD A;  2I7P A;  1Q81 O;  3O9U A;  3CC4 N;  4DTM A;  5B8H A;  2O4G A;  4J2A A;  3CCM N;  3ENH A;  3PIP L;  4CEQ A;  5HRN A;  1S5J A;  1TYQ A;  1V4T A;  4FVM A;  4IKF A;  1KTQ A;  2NNW A;  3MDQ A;  3E9L A;  4YHH K;  5JVH L;  3DLK A;  1C0F A;  3KWI A;  5CR4 A;  5EY4 A;  1RFQ A;  3MED A;  1RDC A;  1S1V A;  1VRU A;  3PUF A;  4Z4F A;  2JWK A;  4MFB A;  4KKO A;  3OYM A;  4QS7 A;  1MA9 B;  3TTC A;  3WXL A;  4X65 K;  2P1J A;  3ENB A;  4JHD A;  4IEI A;  4W5T A;  4FCY A;  4DG1 A;  5AQU A;  1QZ6 A;  3QBX A;  1JJ2 M;  4Y1D A;  1S1X A;  1X1P A;  3SUQ A;  4AM6 A;  2FBT A;  1BWF O;  4EAH D;  2E5L K;  4ISF A;  4NCG A;  4CEO A;  4H5N A;  3VEZ A;  1N5Y A;  3LDO A;  3OYN A;  1RT3 A;  4UQG A;  2D0A A;  3C6T A;  4KO0 A;  4B1Z A;  5AQW A;  2F7T A;  3HTV A;  1EKE A;  2KQ2 A;  4CHZ A;  4N76 A;  1GLC G;  4CVN E;  4HHT A;  4GMJ B;  5LJW A;  5JS2 A;  4CGI A;  3GE1 A;  3H1Q A;  2HHU A;  3I56 N;  3U4L A;  3MEC A;  3WNH A;  3QO9 A;  3TAE A;  4CZL A;  4LY7 A;  1L3S A;  4BRC A;  4KTW A;  3OS2 A;  1YJN N;  2HND A;  4CBX A;  5MLC Q;  3P39 A;  5LL6 Z;  5J1E A;  5BRH A;  2A1R A;  3V9S A;  2ETJ A;  3JYT A;  2A3Z A;  3N4Q A;  3DRP A;  5AQM A;  3RRG A;  1YIJ N;  4NCA A;  4AHU A;  4Z4G A;  3VQE A;  2OPR A;  4HUG A;  4AHV A;  1Q18 A;  4IJA A;  5GAD P;  4B9N A;  4W5N A;  4CER A;  5EXW A;  1EET A;  3DM2 A;  3OYH A;  3ZT1 A;  5C2F A;  2QWM A;  3QML A;  3MX2 A;  4FM1 A;  5J2N A;  3CCJ N;  3A5O C;  1U48 A;  5GIO A;  2YJF A;  4W5O A;  4F4K A;  5AQN A;  4JI0 K;  5FLX O;  4CJ7 A;  3E01 A;  1OVQ A;  3L8B A;  1QS4 A;  2YHW A;  4N47 A;  4I9Q A;  4KH6 A;  3NF9 A;  3HYF A;  1C0U A;  3O1W A;  4E7H A;  1XHX A;  3ULD A;  4C8K A;  3O1B A;  4KHN A;  4CK3 A;  3MCP A;  4BQZ A;  3ULE B;  3NBP A;  2PYJ A;  4Z4I A;  3DRS A;  3O08 A;  4N5S A;  1ITG A;  3L4I A;  4DLE A;  3OYL A;  1NMN A;  3WNE A;  1GLE G;  1VQ9 N;  4J2E A;  4KFB A;  2OPS A;  3HPG A;  4Y0W A;  3SJH A;  4C8M A;  3LZI A;  4JAX A;  4LF5 K;  2G8V A;  1VSL A;  4FL9 A;  1W7A A;  3J8A A;  4KHW A;  3ZSX A;  1KRP A;  1T05 A;  3MN9 A;  2P9S B;  3C65 A;  4FOI A;  3R9P A;  3VQ8 A;  4BWM A;  4PA1 A;  4NCB A;  5AR0 A;  1XUP O;  1VQP N;  1LW0 A;  2GBZ A;  5E41 A;  3VTI A;  1YTU A;  4CZH A;  4K42 A;  2DFH A;  1VHX A;  3ZSZ A;  1ZBH A;  2O8D A;  4JI7 K;  4FZZ A;  4MO4 A;  2UUA K;  3A2F A;  3CJB A;  3L2U A;  3KVG A;  1R59 O;  3S41 A;  4JKF A;  4DSK A;  1DGK N;  4W5R A;  4PKI A;  4FLU A;  2OAN A;  1ZBI A;  1VQ6 N;  2QXL A;  3PX0 A;  4CF1 A;  2GV9 A;  3D45 A;  4OGC A;  1SL1 A;  5AQI A;  1QVG M;  3UE5 A;  4LH5 A;  4LF8 K;  3QER A;  4B08 A;  2YNI A;  3SV3 A;  1QTM A;  1GLA G;  3SI6 A;  1ZXO A;  3ZYY X;  4EFH A;  3THW A;  4JRQ A;  2QXF A;  3TSU A;  3I55 N;  3WQT A;  1TGO A;  1XNR K;  1TAU A;  1ILY A;  3AAQ A;  1TL1 A;  1NGH A;  3P1G A;  3A8Y A;  3IG1 A;  4DSE A;  3VGL A;  5AQP A;  5H1S Q;  1ZYQ A;  2KTQ A;  4DV2 K;  2ZGY A;  3ID6 A;  1VQN N;  3J7Y P;  5CZ2 A;  4O8U A;  2ASP A;  3ZEU A;  4CK2 A;  1VRT A;  2QWO A;  3MN6 A;  1K8A O;  4OPJ A;  4BR7 A;  3IUC A;  4IO9 L;  2F9T A;  4BR2 A;  4DV6 K;  1IG8 A;  1KXP A;  3L3U A;  4DWI A;  3VMF B;  3L2Q A;  5BN8 A;  4CBU A;  2RPI A;  3CJ9 A;  3TPQ A;  4XH1 A;  3OYK A;  3CCS N;  4FJM A;  4KHY A;  2I5J A;  4GKJ K;  4CHN A;  3ITH A;  1EWQ A;  2FBY A;  2P9N A;  3C7N A;  3ZT0 A;  1X3M A;  4CJS A;  2NRR A;  3FZH A;  4E89 A;  3VEV A;  4B1X B;  3KHY A;  1RT6 A;  3THY A;  2ZF5 O;  3CIP A;  3D7E O;  2ZJR L;  2F8T A;  2ZJQ L;  3M8S A;  1SV5 A;  1YVU A;  4BC2 A;  3CPW M;  2Y1I A;  4AIL C;  3K5N A;  4CJU A;  1HNZ K;  1U6Z A;  4JK7 A;  4FSV A;  3SBT A;  2FC0 A;  4W5Q A;  2P9K A;  3K5M A;  3IMX A;  1BI4 A;  1NJX A;  4IBN A;  3P83 D;  4CZF A;  3QLH A;  3NCI A;  3RR7 A;  3DMJ A;  4CES A;  4M3T A;  1HRH A;  1K8K A;  3HRG A;  4KHU A;  3TAR A;  4FJG A;  4FJK A;  5DK5 A;  4L8R B;  4A61 A;  1KLN A;  1RT4 A;  4BR4 A;  1Z26 A;  4FWR A;  4O44 A;  5HRS A;  3HXM A;  3IDH A;  4CIF A;  2A41 A;  4JK8 A;  1NOY A;  4X64 K;  3N4P A;  2W41 A;  3NMU A;  4F9O A;  3R6M A;  2ZD1 A;  1HNW K;  3EKS A;  5C15 A;  3K59 A;  2QEX N;  4KHP K;  4BRF A;  1ZBL A;  1T03 A;  4MQ3 A;  5BN9 A;  4LF4 K;  2XY8 A;  3VQC A;  3U9Z A;  4FWO A;  3KD1 E;  3T1A A;  1RTD A;  3K9J A;  4NO7 A;  4ILG B;  3CM5 A;  4FWN A;  4KRE A;  2D0P A;  4LC9 B;  3ZET B;  1JLQ A;  1YVN A;  1SAZ A;  3DJC A;  4JD2 A;  2OPQ A;  4J2B A;  4JKB A;  3DLL L;  3L2V A;  1K73 O;  3LDS A;  1KVC A;  5JVG L;  2O8B A;  4WQ5 A;  5AZJ A;  2UXC K;  4WQ5 C;  4WCE L;  4CJL A;  4FM2 A;  4DU3 A;  5KTQ A;  3U8X A;  3V9X A;  4AM7 A;  3VEO A;  4DFJ A;  3CJC A;  4I2P A;  1XC3 A;  1RNH A;  1YUW A;  3HSC A;  3PX4 A;  2GEM A;  1NGB A;  2OPP A;  4ICL A;  2UUC K;  4M3W A;  2EX3 A;  4Q0B A;  3QEP A;  2D0B A;  2PBD A;  4OVL A;  1JLA A;  2GX9 A;  4CJK A;  2X78 A;  3HK2 A;  2Q1N A;  4N56 A;  2HHS A;  1GOA A;  4J8F A;  4DHY A;  1Z25 A;  5C25 A;  2JWL A;  3F73 A;  1C1C A;  3M8Q A;  1DTT A;  1VQK N;  3ASM A;  1HQE A;  3O5B A;  3DLB A;  4DV0 K;  2P9L A;  4A2B A;  5FPM A;  1SL2 A;  3IS9 A;  4H4O A;  4BGB A;  1WBB A;  3W3D A;  4FK0 A;  1N32 K;  1RDW X;  3TAM A;  1ZBU A;  1TK0 A;  4M3Y A;  3WXM B;  1HR0 K;  3K5O A;  1DT9 A;  5FRN A;  1X9S A;  3KWG A;  4JKH A;  3VEN A;  3SNN A;  3CQ8 A;  5AFU H;  4GKK K;  4DR4 K;  2V7Z A;  1U2V A;  3ZCM A;  3M8P A;  4BRN A;  2RF2 A;  4FZX C;  4YOV A;  3CC7 N;  4JEP A;  2HHV A;  3MX5 A;  1G99 A;  2KLA A;  2VG7 A;  4O5F A;  4DR2 K;  3BEX A;  1NGI A;  4K8Z A;  1TL3 A;  4DV3 K;  2LSN A;  4KB0 A;  5ADX H;  3KK7 A;  1JLB A;  4B9V A;  1FKO A;  4E7I A;  3EEQ A;  3T3F A;  1TUU A;  4JI6 K;  2DPN A;  2D0C A;  3BF1 A;  1N8R O;  1LV5 A;  4CEE A;  3K2P A;  5C10 A;  1HMV A;  3SV4 A;  3VQ5 A;  2HHT A;  4IFV A;  3MWT A;  3TI0 A;  4DUZ K;  4FVU A;  4DQP A;  1TK8 A;  2G8U A;  4XEI A;  3LAL A;  4DUY K;  2P5G A;  1LWF A;  3J7A P;  3AVN A;  3MK6 A;  3QES A;  4CK1 A;  3E1Y A;  4HUF A;  4BRP A;  2RHK A;  3MWP A;  4CIG A;  4OPK A;  4CEF A;  3MAQ A;  3SMP A;  3VQ9 A;  4EHU A;  1NGF A;  1QHA A;  1JCG A;  3O3F A;  2Q0R A;  4M3U A;  4BC4 A;  4DFM A;  2GUP A;  2A40 A;  3BZK A;  3A5M C;  1IH7 A;  3H1V X;  4M3R A;  3HOS A;  4F8R A;  4KH4 A;  4JS4 A;  1NGD A;  3AAR A;  4X66 K;  4F2S A;  4FJ9 A;  3VER A;  1TVR A;  3V1R A;  1TK5 A;  1XNQ K;  1A5X A;  1BG3 A;  1RBS A;  1QQC A;  3TWH A;  4QCL A;  1QHT A;  5KRS A;  3OHR A;  3LPU A;  1GOB A;  4ELT A;  5KQ8 A;  2WBN A;  1U49 A;  4H03 B;  5BRD A;  3WEE B;  2O8F A;  1HQU A;  3I8B A;  3DWL A;  5M1F A;  1QQO A;  4C23 A;  1NJY A;  1WBD A;  4QS8 A;  3FZL A;  2E20 A;  2WOM A;  3HBT A;  1A5W A;  1REV A;  4AHT A;  3QIP A;  4AF1 A;  2G8K A;  3QEI A;  3H3N O;  4IOA L;  3BZC A;  1Y64 A;  1C0M A;  4Q5V A;  1RT2 A;  1C6V A;  5AQZ A;  3S3N A;  1ZC6 A;  4WF9 L;  3M3Z A;  4IDH A;  2QA4 N;  4FK2 A;  3FZK A;  1BDG A;  1A5V A;  1NGJ A;  3JAM O;  3LAN A;  2QTD A;  1UAX A;  4LSN A;  3FZF A;  3NGY A;  4LF6 K;  4M3Z A;  4CZE A;  4DV5 K;  2JLE A;  4BRK A;  1UA0 A;  4LSL A;  1HJR A;  2P51 A;  4BRH A;  3CYM A;  3G10 A;  4WFB L;  3THX A;  1HNI A;  4B3R K;  1BGX T;  3AVK A;  2A42 A;  3VF6 A;  3QIO A;  2FSN A;  3OS0 A;  4I7F A;  5AQS A;  1VQO N;  5AQF A;  2KHO A;  2O8C B;  2DFF A;  3HP9 A;  3LAM A;  1WNS A;  2HF4 A;  2ASO A;  4KBO A;  4BE1 A;  4K41 A;  4F3T A;  3L0Q A;  4CJ5 A;  2XRI A;  4ISG A;  3FE1 A;  3RVC A;  3VQA A;  4E7L A;  3SK3 A;  4CIE A;  5AQQ A;  4GW6 A;  4JN4 A;  3AO5 A;  3NH1 A;  2QWL A;  1CXU A;  5JMV A;  4OKJ A;  3ALY A;  1IKW A;  3FFK B;  1EX4 A;  4M42 A;  3EE8 A;  1BA1 A;  1GOC A;  4JK9 A;  4A5B A;  1S1U A;  2H3G X;  1VQL N;  3SMS A;  3JXU A;  1D8Y A;  2VYP A;  4DTP A;  3AGR A;  3LDN A;  4U67 L;  1YTA A;  2HMI A;  4YOT A;  3HPH A;  1NK0 A;  1U47 A;  4HWI A;  4ISE A;  4LF7 K;  4G1Q A;  1IG9 A;  4O0J A;  1DLO A;  3LP0 A;  4JI1 K;  3U9D A;  2HBM A;  3UIQ A;  1JL2 A;  5M1O A;  3VQ7 A;  2IC3 A;  1S6Q A;  1JLC A;  3LZJ A;  1GLF O;  4PL8 A;  4WQ4 A;  2IVP A;  3B8A X;  1JLF A;  4FPA A;  1X9W A;  1CZA N;  3G0Z A;  4GY2 B;  1SQK A;  4DMN A;  2HVI A;  1YIT N;  4WQ4 C;  2QKB A;  1S1W A;  4CJ3 A;  2HB5 A;  1KAZ A;  3CD6 N;  3UKU B;  2ITG A;  5BPN A;  3CMA N;  3U3G A;  4C1N I;  3M8R A;  3TSQ A;  1R0A A;  2FBX A;  2BTF A;  1EP4 A;  3SYZ A;  1JCF A;  1O13 A;  5EU7 A;  5FRM A;  5M1N A;  3ZX3 A;  3LP1 A;  3VPZ A;  2CGJ A;  4O5B A;  4JKG B;  3LM9 A;  3D6R A;  3BP8 A;  4ID1 A;  3ID8 A;  1BL3 A;  1KFS A;  1IKX A;  3O3H A;  4CFC A;  4E19 A;  3AO3 A;  4KTQ A;  3SAG A;  3D2F B;  5AQJ A;  4CD3 A;  4H4M A;  2DTU A;  4B8A B;  3CCR N;  4LH4 A;  3NVK A;  4IJN A;  2IVO A;  3ATU A;  4EZ9 A;  1B9D A;  4BVO A;  2YHA A;  5M1K A;  3QNO A;  2JGU A;  3RSE A;  1VSF A;  1LWC A;  4DR6 K;  3G4S N;  3LWL A;  1E4G T;  4BG8 A;  3CCQ N;  5I42 A;  3AVC A;  1Q9X A;  1J5E K;  4KAZ A;  3RR8 A;  3AO1 A;  4OX9 K;  1L3V A;  4AQY K;  4CZK A;  2GTD A;  5C2D A;  3UKR B;  5GAE P;  1YI2 N;  2YNH A;  2UXB K;  4K0K K;  4E0D A;  3LL3 A;  5DM7 L;  2F8S A;  3OYE A;  3V1O A;  1D9F A;  3DOK A;  1NGC A;  5F2R A;  1WSG A;  2NRH A;  4FOE A;  3FZM A;  3TAP A;  5C42 A;  4BRA A;  1J54 A;  3LP2 A;  2PY5 A;  4JLH A;  2O8E B;  3BGR A;  3CFR A;  5DM6 L;  4R79 A;  4B9T A;  5J2Q A;  5AQY A;  1NKC A;  1NGA A;  3AVI A;  4BY9 C;  2E2Q A;  3MXJ A;  3QDK A;  1E3M A;  1QE1 A;  1LAW A;  4XIU A;  4CJP A;  4I6M B;  3OBW A;  1YHQ N;  2OZS A;  4DTJ A;  5AZI B;  1OH8 A;  1KVB A;  1ASV A;  3SUP A;  4MDA A;  4V19 S;  4AH9 A;  3K5L A;  3CCU N;  2X6N A;  2O4I A;  1KAY A;  3D2E A;  4F3O A;  4M45 A;  2E2N A;  4X62 K;  2ZJP L;  3DXM B;  3MXM A;  3CJ7 A;  1BCM A;  2P9P A;  3PO5 A;  3C94 A;  4FLX A;  3J81 O;  2GWK A;  5BPL A;  5T7B A;  4KV8 A;  4BGA A;  1ESV A;  1NK5 A;  5E26 A;  2YNG A;  4O0I A;  3KK1 A;  5AQG A;  3NFA A;  3GL1 A;  5J2P A;  3UB5 A;  3I0S A;  4FJL A;  3CJA A;  3VES A;  4JHD B;  1CXQ A;  1QVF M;  3DLH A;  2KKZ A;  4QOZ B;  1HNV A;  4LFA K;  3EZ5 A;  4FWS A;  3VET A;  2XO7 A;  1VQ4 N;  4BE2 A;  3E9O A;  4CZJ A;  5CYQ A;  3A5N C;  5EOY A;  2Q3S A;  3JSM A;  2BDP A;  4OJR A;  2Q36 A;  1RGI A;  4G9Z A;  1S9E A;  4YY3 K;  3F9M A;  4IOX A;  3VQB A;  3P5J A;  1VQ5 N;  2P9I A;  3ZLJ A;  5AQT A;  2HOE A;  2XY7 A;  4DSI A;  3FFI A;  5KGW A;  2OCE A;  1FKP A;  4CEB A;  4DV1 K;  1BIU A;  4NXN K;  2OZM A;  4PL7 A;  1I39 A;  1LCU A;  4RCH A;  2DFE A;  4DSJ A;  4LD0 A;  1NG9 A;  3PV8 A;  3EO3 A;  4B9M A;  4FJJ A;  2Z1J A;  4E1M A;  3SCX A;  3VEX A;  2ZM6 K;  3P31 A;  1WSF A;  1N36 K;  4CHY A;  3WUH A;  2HBL A;  1N33 K;  4HTL A;  3AA3 A;  3QB0 A;  1C0G A;  3IFR A;  3KTQ A;  5LMU K;  3DXK B;  3TAQ A;  4DTN A;  2YHX A;  1T44 A;  3OBY A;  2HNY A;  1ASW A;  3FGU A;  1MWM A;  3HL8 A;  3TR8 A;  3CCV N;  1BO5 O; 
#chains in the Genus database with same CATH homology
 5JVH L;  1C0F A;  1MWK A;  3CET A;  3KWI A;  5CR4 A;  5EY4 A;  1RFQ A;  3E9P A;  1KQS M;  5C10 A;  4H0O A;  2JWK A;  3LM2 A;  4L3Q A;  3ENO A;  3MWT A;  3LDL A;  1S22 A;  4QS7 A;  4FVU A;  1NLV A;  1MA9 B;  2HF3 A;  2YHY A;  3TTC A;  3WXL A;  2BUP A;  4XEI A;  3ENB A;  4JHD A;  4H0X B;  4NLC A;  4IEI A;  4DCH A;  2AA4 A;  5FPN A;  5AQU A;  1QZ6 A;  3MK6 A;  3QBX A;  1JJ2 M;  4B1W B;  3E1Y A;  4BRP A;  2RHK A;  3MWP A;  4PHT X;  3ZX0 A;  4AM6 A;  1BWF O;  3DAW A;  4EAH D;  1RDU A;  4ISF A;  3QBW A;  4IWV A;  4H5N A;  3VEZ A;  3SMP A;  1TYQ B;  3LDO A;  3WEE A;  4EHU A;  1NGF A;  1QHA A;  1JCG A;  2Q0R A;  4BRE A;  2F9W A;  4BC4 A;  2GUP A;  1Z05 A;  2A40 A;  4B1Z A;  3A5M C;  4U7B A;  3H1V X;  5AQW A;  2HBK A;  3VF2 A;  3HOS A;  4K25 A;  1HKG A;  1QQN A;  2F7T A;  1SS6 A;  3HTV A;  4KH4 A;  3EN9 A;  5C12 A;  1GLC G;  3GBT A;  1NGD A;  3AAR A;  5BR9 A;  3PIO L;  5LJW A;  1QZ5 A;  3VER A;  2ZGZ A;  3GE1 A;  2GWJ A;  1BG3 A;  3H1Q A;  4BC3 A;  3I56 N;  3U4L A;  1HJO A;  5E84 A;  4GV3 A;  4CZL A;  3G71 N;  4BR0 A;  4BRC A;  1YJN N;  3OHR A;  3O9T A;  4YOX A;  4CBX A;  3W0L A;  5MLC Q;  1W2B M;  3P39 A;  1ATR A;  5KQ8 A;  2WBN A;  5BRH A;  4H03 B;  3VGK A;  5BRD A;  3I33 A;  3WEE B;  4BRQ A;  4CZM A;  3PLA A;  4JKD A;  3I8B A;  3DWL A;  5M1F A;  2A3Z A;  3N4Q A;  1QQO A;  5AQM A;  4C23 A;  1YIJ N;  3CQX A;  4M7Y A;  5JLH A;  3P4I A;  3SAF A;  4QS8 A;  1ATS A;  1Q18 A;  4IJA A;  3FZL A;  5GAD P;  3HZ6 A;  3MCA B;  3VOV A;  2E20 A;  5EXW A;  3IKM A;  2CGL A;  3HBT A;  4RTF D;  3O4W A;  3R1X A;  2J4R A;  5C2F A;  3CXC M;  4AF1 A;  5TKW A;  1K9M O;  2QWM A;  3QML A;  3MX2 A;  3H3N O;  4H0V B;  4IOA L;  1Y64 A;  3CCJ N;  3A5O C;  5GIO A;  4NB4 A;  5AQZ A;  3VEY A;  1ZC6 A;  2YJF A;  5AQN A;  1BO5 O;  3J7Z O;  4WF9 L;  2FSJ A;  3M3Z A;  4IDH A;  4CJ7 A;  3F5T A;  2QA4 N;  3CPE A;  2E2P A;  3ZEU B;  3CCE N;  1IJJ A;  3FZK A;  2QM1 A;  1BDG A;  1NBW A;  1NGJ A;  2YHW A;  1GLJ O;  4KH6 A;  3VEW A;  1HPM A;  4WFN L;  3CC2 N;  3O1W A;  5AQK A;  2QTD A;  4B1V A;  2QWR A;  3A5L C;  3O1B A;  1BU6 O;  3MCP A;  4BQZ A;  4FWK A;  3ULE B;  3FZF A;  3HOT A;  4CZE A;  3O08 A;  3L4I A;  3H6E A;  4BRK A;  3EZW A;  3O6W A;  4EHT A;  4A2A A;  1GLE G;  4BRH A;  4H5W A;  1VQ9 N;  2NRT A;  2HMP A;  2PAV A;  4WFB L;  5LY3 A;  2P9N B;  4BR5 A;  3C7N B;  4Y0W A;  4YDU A;  3SJH A;  1Q7Y O;  2A42 A;  3EE9 A;  3BF3 A;  3VF6 A;  4JAX A;  3MMV A;  2FSN A;  4YDU C;  4FL9 A;  3J8A A;  1HLU A;  1DKG D;  5AQO A;  5AQS A;  2QW9 A;  2KHO A;  5AQF A;  1YJ9 N;  2WFB A;  1VQO N;  4UY8 O;  3MN9 A;  2P9S B;  3C65 A;  4FOI A;  4QS9 A;  3R9P A;  4B1U B;  5GIP A;  2HF4 A;  1XUP O;  5AR0 A;  1VQP N;  2ASO A;  4KBO A;  1EQY A;  4K41 A;  2HBJ A;  4XH5 A;  2Q31 A;  3VTI A;  5EX5 A;  3Q7C A;  3C6H A;  4CZH A;  1DEJ A;  4H5V A;  1Q82 O;  4K42 A;  1E4F T;  3L0Q A;  2OTJ N;  4GVE A;  4ISG A;  3FE1 A;  2VWB A;  3MN7 A;  4JKE A;  3RVC A;  4WFA L;  3RSE B;  3SK3 A;  5AQQ A;  3R3L A;  4JN4 A;  3WQU A;  4MO4 A;  2QWL A;  2P9K B;  5BRE A;  5JMV A;  3CJB A;  3KVG A;  3FFK B;  3EL2 A;  1R59 O;  3S41 A;  4JKF A;  4C1N K;  1DGK N;  3EE8 A;  1BA1 A;  3O8M A;  4GV9 A;  1YAG A;  2IVN A;  4JK9 A;  4PKI A;  2OAN A;  4PKG A;  4A5B A;  4M7X A;  1GLD G;  1T6D A;  1K8K B;  2H3G X;  3UKU A;  5GIN A;  3SMS A;  3K9K A;  1VQL N;  1VQ8 N;  3JXU A;  1VQ6 N;  2VYP A;  2QXL A;  3A0I X;  3AGR A;  3LDN A;  4U67 L;  1D4X A;  3GDQ A;  4Z94 A;  5AQI A;  1QVG M;  4BRD A;  3UE5 A;  4YOT A;  4HWI A;  4ISE A;  2D4W A;  1GLA G;  2NRV A;  2RE2 A;  1ZXO A;  3ZYY X;  4CZG A;  4MLE A;  4EFH A;  4B9Q A;  1NGG A;  3TSU A;  3I55 N;  3WQT A;  4EIA A;  2UYT A;  4BY9 C;  5TKY A;  2HBM A;  3L4Q A;  3U9D A;  1ILY A;  3AAQ A;  1NGH A;  5M1O A;  3A8Y A;  1YXQ A;  5JIC A;  1GLF O;  4BRI A;  4PL8 A;  1VAZ A;  5AQP A;  4WQ4 A;  3VGL A;  2IVP A;  3B8A X;  4YOU A;  3SAH A;  5H1S Q;  1S72 N;  4FPA A;  5LJV A;  3G25 A;  2ZGY A;  1CZA N;  4GY2 B;  1HKB A;  1NMD A;  1SQK A;  3ID6 A;  3VTH A;  3C6A A;  4WQ4 C;  2FF6 A;  3ZX2 A;  5CHI A;  1YIT N;  1VQN N;  1KAZ A;  4BVP A;  3CD6 N;  4O8U A;  2ASP A;  3ZEU A;  3UKU B;  2NRW A;  2QWO A;  4GNI A;  5BPN A;  1KAX A;  3QFU A;  3CMA N;  2NLX A;  4FPB A;  3MN6 A;  4C1N I;  1T3V A;  3TSQ A;  1K8A O;  4MO5 A;  3TSP A;  1GLL O;  4A5A A;  4BR7 A;  3IUC A;  4IO9 L;  3ULE A;  2F9T A;  4BR2 A;  1OVY A;  4JD2 B;  4CZI A;  2BTF A;  1IG8 A;  1KXP A;  4BR9 A;  4BRM A;  4GV6 A;  1JCF A;  3MN5 A;  1O13 A;  3VMF B;  3D2E B;  4WYB A;  5M1N A;  3SLC A;  3ZX3 A;  5BN8 A;  4H0T B;  3VPZ A;  3TPQ A;  2BH1 A;  3CJ9 A;  2CGJ A;  4XH1 A;  4CBU A;  3CCS N;  4JKG B;  4CI6 A;  1HKC A;  3D6R A;  3AAP A;  3LM9 A;  3M1F A;  2P9P B;  4YOY A;  3FR0 A;  4DQ8 A;  2P9N A;  2NZT A;  3C7N A;  3F2K A;  2HST A;  4ILH A;  3GOI A;  5FPD A;  2YX6 A;  2FLO A;  1X3M A;  3BP8 A;  3ID8 A;  5I9E B;  2AP1 A;  1NWK A;  2A5X A;  5HL7 L;  3EKU A;  2V51 B;  2NRR A;  3FZH A;  1EO1 A;  2NRX A;  3HI0 A;  3VEV A;  4B1X B;  1OKJ A;  4BG9 A;  2P9S A;  5CE3 A;  3KHY A;  3WXK A;  3SAG A;  3D2F B;  5AQJ A;  4CD3 A;  3OW2 M;  1VQ7 N;  1ZBS A;  2ZF5 O;  3CIP A;  3D7E O;  3CCR N;  2ZJR L;  3NVK A;  4FO0 A;  4IJN A;  2IVO A;  2ZJQ L;  5GAG P;  3ATU A;  2Q0U A;  5KPT A;  3O9S A;  1M90 O;  1QQM A;  4BC2 A;  4BVO A;  5M1K A;  5C0Y A;  2YJE A;  3CPW M;  2OTL N;  3RSE A;  1BUP A;  1T6C A;  1U6Z A;  4JKC A;  4FSV A;  4JK7 A;  5F1X A;  3SBT A;  3G4S N;  4FWP A;  2GEL A;  4H5T A;  2P9K A;  1E4G T;  3VF4 A;  4BG8 A;  2E88 A;  3CCQ N;  3IMX A;  3Q7B A;  4O8K A;  4CZF A;  4IXC A;  2QI2 A;  2W40 A;  2FF3 B;  3HM8 A;  1K8K A;  3HRG A;  4K43 A;  4CZK A;  2V52 B;  1TUY A;  2GTD A;  5ELZ A;  3UKR B;  5GAE P;  5C2D A;  1YI2 N;  4A61 A;  3CHW A;  4BQL A;  3WXJ A;  5GAH P;  2P9U A;  2P9I B;  3LL3 A;  4FWL A;  1H1V A;  4BR4 A;  1YF5 L;  4FWR A;  1NGE A;  1W97 L;  5DM7 L;  1HX1 A;  2QWP A;  4IO8 A;  4KH5 A;  1NM1 A;  4B1Y B;  3IDH A;  3DXM A;  2A41 A;  2I7N A;  1NGC A;  4JK8 A;  5F2R A;  2NRH A;  3N4P A;  3FZM A;  2W41 A;  4FOE A;  5KPZ A;  3WXI A;  3NMU A;  5M1Q A;  4F9O A;  3C0B A;  1LOT B;  3R6M A;  4BRA A;  3QFP A;  1U2V B;  3H45 C;  3EKS A;  5C15 A;  2WC9 A;  2QEX N;  2QWN A;  3CI5 A;  1M1K O;  4BRF A;  4JKA A;  3E66 A;  5KQD A;  3WT0 A;  5DM6 L;  5BN9 A;  4R79 A;  4IZ9 A;  5AQY A;  3U9Z A;  1NGA A;  4FWO A;  2ITM A;  1YJW N;  1ATN A;  3K9J A;  2E2Q A;  1J6Z A;  4NO7 A;  4ILG B;  3QDK A;  4OPH A;  5F0X A;  1VQM N;  4FWN A;  3ATV A;  3R8E A;  4I6M B;  2D0P A;  3OBW A;  4M63 C;  4LC9 B;  1YHQ N;  2D1K A;  5BPM A;  2E1Z A;  5AZI B;  3ZET B;  3CQY A;  1YVN A;  2P9U B;  1SAZ A;  2E1Y A;  3DJC A;  5AQX A;  1KC8 O;  4JD2 A;  4MDA A;  3QIC A;  4JKB A;  4XH4 A;  3DLL L;  4JNE A;  5EVZ A;  3CCU N;  1K73 O;  1KAY A;  4OO1 J;  2CH6 A;  3D2E A;  4E1J A;  5JVG L;  1X3N A;  2FXU A;  3O9R A;  2ZJP L;  2E2N A;  3DXM B;  4WQ5 A;  3TTF A;  3CJ7 A;  4JKG A;  5AZJ A;  3P38 A;  2D0O A;  2P9P A;  4CD1 A;  1SZ2 A;  4WQ5 C;  4WCE L;  5BRF A;  2GWK A;  3GG4 A;  5BPL A;  5AQV A;  3KZB A;  3U8X A;  4H0Y B;  3CER A;  4AM7 A;  3VEO A;  1ESV A;  4BGA A;  4YOR A;  1NJI O;  5E26 A;  2CGK A;  3CJC A;  4A57 A;  4H5R A;  5AQG A;  4YOW A;  1XC3 A;  1Z6R A;  3D2F A;  1YUW A;  3HSC A;  2GEM A;  1NGB A;  3AY9 A;  2EWS A;  3GL1 A;  4BRO A;  1WOQ A;  5AQL A;  2QWQ A;  3UB5 A;  2PBD A;  3CJA A;  3VES A;  4JHD B;  3CCL N;  1QVF M;  4FWQ A;  1MDU B;  2GX9 A;  1BA0 A;  3M6G A;  2KKZ A;  2VCP A;  3OA9 A;  2Q1N A;  2E8A A;  3BUZ B;  5AFU A;  1BOT O;  4J8F A;  4FWS A;  4DHY A;  3VET A;  1VQ4 N;  2JWL A;  4DB3 A;  4FWM A;  1S3X A;  5AZJ B;  2FSK A;  2IIR A;  2CH5 A;  2Q2R A;  2V7Y A;  3AGK A;  3SBG A;  2PFU A;  2WUS A;  1VQK N;  3E9O A;  3G6E N;  4CZJ A;  5AQH A;  5EOY A;  3A5N C;  2VGN A;  3CF5 L;  3LDQ A;  3T7Z A;  1KD1 O;  5FPE A;  3O5B A;  2P9L A;  4A2B A;  4IEE A;  4H0P A;  4BC5 A;  2Q36 A;  3UKR A;  5FPM A;  1RGI A;  4BGB A;  2YCH A;  3H3O B;  3W3D A;  4A59 A;  1RDW X;  4G9Z A;  3F9M A;  4IOX A;  4NLB A;  1X9J A;  2P9I A;  3WXM B;  4BRL A;  1VQ5 N;  5ADX A;  5AQT A;  4RWT A;  1DT9 A;  2HOE A;  1Q86 O;  3DXK A;  3KWG A;  4JKH A;  4MDB A;  3VEN A;  4MLH A;  5M1P A;  3FLC O;  1JCE A;  5AFU H;  3T69 A;  3LDP A;  4PL7 A;  2V7Z A;  3O9Q A;  3M5R A;  2ASM A;  4IOC L;  1U2V A;  1LCU A;  1V4S A;  3L6Q A;  5JLF A;  4RCH A;  4IFE A;  4BRN A;  5KPR A;  4A62 A;  2ZWH A;  3EO3 A;  3VGM A;  2Q97 A;  4JEP A;  1P8Z A;  4DKW A;  3TU5 A;  4YOV A;  3CC7 N;  3MDQ A;  4BRG A;  3MX5 A;  4OPA A;  1G99 A;  1GLB G;  2KLA A;  3JS6 A;  4ILJ A;  1HUX A;  3TTD A;  3O80 A;  4O5F A;  3VEX A;  3BEX A;  1NGI A;  1P90 A;  1XQS C;  3P31 A;  2P9L B;  4PKH A;  2VGM A;  4I6M A;  4CBW A;  5HOO A;  1WUA A;  3WUH A;  2HBL A;  5ADX H;  2NRZ A;  3KK7 A;  4HTL A;  5AZI A;  3ZET A;  3CME N;  2YI1 A;  3H46 O;  3CJ1 A;  3QB0 A;  2E2O A;  2I7P A;  1C0G A;  3IFR A;  1Q81 O;  3O9U A;  2A6A A;  3CC4 N;  5AQR A;  3DXK B;  5B8H A;  3CCM N;  2YHX A;  1T44 A;  3ENH A;  1TUU A;  3OBY A;  3PIP L;  2DPN A;  1TYQ A;  1V4T A;  3NVM A;  3BF1 A;  3FGU A;  1MWM A;  1N8R O;  3CCV N;  2NNW A;  3E9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...