4A61A

Parm from plasmid r1 in complex with amppnp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
321
structure length
309
Chain Sequence
b'HHLVFIDDGSTNIKLQWQESDGTIKQHISPNSFKREWAVSFGDKKVFNYTLNGEQYSFDPISPDAVVTTNIAWQYSDVNVVAVHHALLTSGLPVSEVDIVCTLPLTEYYDRNNQPNTENIERKKANFRKKITLNGGDTFTIKDVKVMPESIPAGYEVLQELDERDSLLIIDLGGTTLDISQVMGKLSGISKIYGDSSLGVSLVTSAVKDALSSYLADDIIIHRKDNNYLKQRINSIVTEAMNEALRKLEQRVLNTLNEFSGYTHVMVIGGGAELICDAVKKHTQIRDERFFKTNNSQYDLVNGMYLIGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Bipolar Spindle of Antiparallel Parm Filaments Drives Bacterial Plasmid Segregation.
pubmed doi rcsb
molecule keywords PLASMID SEGREGATION PROTEIN PARM
source organism Escherichia coli
molecule tags Transport protein
total genus 92
structure length 309
sequence length 321
ec nomenclature
pdb deposition date 2011-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4a61A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4a61A01
3SK3A 5AFUA 4K25A 4CZEA 5FPEA 2GTDA 1BUPA 2HOEA 3CJBA 5AQFA 2NZTA 1NGEA 3ULEA 1KAYA 5JLFA 3UB5A 4CZGA 2D4WA 4JHDA 4RWTA 4MO5A 3VGMA 3BF1A 2E1YA 2Q31A 1KXPA 2PAVA 2ZGZA 4JD2A 3ZETB 3HSCA 5E26A 2Q2RA 2E1ZA 2YI1A 4DCHA 4QS9A 1NMDA 3SMPA 5AQQA 2P9NB 1RDWX 5AQWA 3D2FB 1T44A 3IUCA 5AQIA 5F1XA 3ZEUB 3L4IA 3SLCA 4H0PA 3DXMB 4BG9A 1MWMA 2J4RA 2HMPA 1HKCA 2FSKA 4CZFA 5BREA 1GLFO 3IDHA 3F9MA 4LC9B 4BRGA 1ZBSA 3L6QA 3WQTA 1NGHA 3VGLA 4BRFA 3C7NB 4FWPA 3B8AX 3AY9A 2QWMA 4B1WB 3A5NC 2P9KA 3JXUA 2YJEA 3IMXA 1MDUB 3AAPA 2ASPA 5EXWA 4FWMA 3KZBA 5KPZA 1K8KA 3GL1A 2GWKA 5BR9A 2Q0UA 3A5LC 5ADXH 1R59O 3UKRA 4HTLA 3VETA 2YCHA 3O4WA 2W41A 4B1XB 3VEXA 3HM8A 3GBTA 3O80A 1NGAA 5BPLA 2A41A 3FGUA 5AQXA 1NBWA 5EY4A 4NO7A 4GNIA 2CH6A 3MN6A 1GLLO 1GLEG 2QWOA 2P9PB 4I6MB 5AQGA 3M1FA 2P9LA 4FO0A 5AQKA 3LDPA 4FWOA 4B1ZA 3ZETA 1ZC6A 3EN9A 1OKJA 1G99A 3VGKA 2QWLA 1ESVA 2P9NA 2V52B 5JMVA 4H0OA 4CZKA 3D2FA 2A40A 4CBXA 3ZEUA 1EQYA 3J8AA 1GLCG 4CI6A 2EWSA 2CGKA 5BN8A 4A2BA 3WEEB 3GE1A 4IXCA 2P9UB 1Z05A 3M6GA 1TUUA 1Y64A 3R9PA 4H0VB 4CZMA 4PL8A 4BVPA 3U9DA 1BOTO 1SAZA 4IZ9A 2IVNA 2ZF5O 5LY3A 4JNEA 3FZHA 1X3MA 1YAGA 1HLUA 4ISGA 5E84A 2DPNA 2ASOA 1U2VA 3H45C 3GG4A 4BRIA 3D2EB 2VWBA 1E4FT 4ISEA 2A6AA 1JCGA 3O8MA 4A61A 4MLEA 3VEVA 1P8ZA 3UKUB 1RGIA 2ZGYA 3BF3A 4J8FA 5AQMA 4MO4A 4XH1A 4CD3A 4BR7A 4F9OA 1DGKN 3CIPA 3CQYA 3WXKA 1BO5O 5LJWA 4L3QA 4BRKA 1QQMA 4I6MA 3UE5A 4H5TA 5FPDA 4Y0WA 4BRHA 2FSNA 5TKYA 3BEXA 4K43A 3MCPA 3HBTA 4BREA 3FZKA 4IJAA 4BGBA 2P9IB 3BUZB 1MWKA 3ZX2A 5FPMA 5KQDA 4H0YB 3A0IX 5AQPA 2E2PA 4QS7A 1S3XA 5AQYA 3EKUA 4DQ8A 4BG8A 4M7YA 3VEWA 3HTVA 3QDKA 3WEEA 5F0XA 3O5BA 1ZXOA 4GY2B 4BR5A 5B8HA 3VENA 2D1KA 3EL2A 1DKGD 3SMSA 1ATRA 2V7ZA 3FZMA 3G25A 4BRNA 1BA0A 2AA4A 4AM6A 1IJJA 1Z6RA 5ADXA 4O8KA 1NGDA 4B1YB 3BP8A 4IJNA 1BU6O 5BRFA 3H3OB 1X3NA 1H1VA 2FLOA 4PKIA 3AARA 5BPMA 3D2EA 5AR0A 4CBWA 3WXIA 3MN7A 1T6DA 1SZ2A 3CJ1A 2F9WA 3C0BA 4BGAA 4K42A 4A62A 3UKUA 3S41A 3AAQA 1JCEA 4FWNA 3TU5A 3VESA 5KPTA 2CGJA 2D0OA 4IO8A 3CHWA 3ENOA 5AQNA 3FR0A 1QHAA 4CBUA 4H5VA 4ISFA 4AM7A 3L0QA 3U4LA 3VEZA 2ITMA 2ASMA 2H3GX 3LM9A 1S22A 1NM1A 4BRCA 4H0TB 4PKHA 4FWSA 4M63C 2QWRA 2OANA 5JLHA 4EFHA 2UYTA 2P9IA 2WUSA 2GWJA 3A5MC 3VOVA 2I7NA 2FF3B 3LDLA 4XH4A 4XH5A 3H1QA 4BR9A 3VEOA 4BRDA 3KHYA 1DEJA 5ELZA 4CZLA 2A3ZA 1NGCA 3CJ9A 1NWKA 3GOIA 5AZJB 4CD1A 3O1WA 4BC3A 5AQJA 1XQSC 2QW9A 1QZ5A 1TUYA 4BRMA 4C23A 1LOTB 3CJCA 3DXMA 4BRLA 3R8EA 3H1VX 5AQOA 1YVNA 3FE1A 4IWVA 3C7NA 5EOYA 4BR2A 4BC5A 3U8XA 3MN9A 5AQVA 5EVZA 1KAXA 3D7EO 3WUHA 5AQLA 3SJHA 3ZX0A 3WQUA 3ATUA 1BDGA 3A8YA 3HZ6A 4O5FA 3MK6A 5F2RA 2AP1A 3JS6A 3W3DA 4DB3A 4EIAA 3H6EA 3QFPA 4FWRA 1HKBA 3CERA 3FZLA 4FPBA 4NB4A 5KQ8A 1YUWA 3CJAA 3FFKB 4BC2A 2V7YA 3WT0A 3LM2A 3R6MA 2QWNA 1ATNA 2E88A 2QM1A 3CQXA 3M3ZA 4K41A 2D0PA 3VF2A 2P9SB 2P9PA 3CETA 2FXUA 2GELA 4MLHA 4B1VA 1Q18A 3O6WA 2QXLA 4BROA 3I33A 4CZHA 4H5RA 3A5OC 3QMLA 1GLBG 3QBWA 1K8KB 3P4IA 5AZJA 2V51B 3UKRB 4BRQA 3QFUA 5AQHA 1V4TA 2E2OA 4CZJA 3DWLA 2YHXA 1QQNA 2CH5A 5I9EB 2Q36A 2P9UA 3EZWA 3MMVA 5AQZA 3I8BA 1QQOA 3LDNA 3MDQA 1NGGA 4BRAA 1TYQB 4RTFD 1YXQA 4EHTA 3QICA 2ZWHA 2P9LB 2VYPA 1WOQA 5AFUH 4BQLA 3VEYA 2E8AA 4PL7A 3HI0A 3WXJA 1GLJO 1HPMA 3KVGA 1BA1A 5BN9A 3QBXA 1LCUA 3FZFA 5AQUA 4DHYA 4M7XA 4WQ5A 2A5XA 3QB0A 1QZ6A 5CE3A 5BRHA 1GLDG 3H46O 4HWIA 3DXKB 5AQRA 4BVOA 4BR0A 5LJVA 2QWQA 1J6ZA 3LDOA 2BTFA 2GUPA 1HX1A 4E1JA 2IIRA 1XUPO 2P9SA 5AQTA 2E2QA 2YHYA 1NLVA 2FSJA 2YHWA 1U6ZA 4H03B 4B1UB 5JICA 3CI5A 4FWKA 4WQ4A 1U2VB 3ID8A 2GEMA 4YDUA 3IFRA 2NRHA 3EKSA 3GDQA 4PKGA 3W0LA 4BQZA 4JN4A 1T6CA 1WUAA 2E20A 3OHRA 1HKGA 2Q1NA 3MN5A 1XC3A 3RSEB 4FPAA 4A2AA 5AZIB 3H3NO 5AQSA 4Z94A 2FF6A 1C0FA 4FOIA 4BC4A 4CJ7A 1TYQA 4FWQA 2A42A 1NGFA 1BWFO 2E2NA 4FL9A 4WQ5C 1JCFA 2IVPA 3ULEB 1NGBA 4EHUA 1X9JA 1GLAG 3O08A 2BUPA 4JHDB 4BR4A 5BPNA 4FWLA 1V4SA 3FLCO 4JD2B 5FPNA 3VF4A 5EX5A 3VF6A 3DJCA 3ZX3A 2HF3A 2YJFA 3DXKA 4H5WA 4EAHD 2NLXA 1SQKA 4QS8A 1D4XA 4FOEA 1RFQA 4H5NA 4WQ4C 2CGLA 4CZIA 3O1BA 2W40A 1KAZA 2QWPA 4YDUC 4B9QA 3VERA 3ENHA 1HUXA 4RCHA 1HJOA 2KHOA 1MA9B 2Q0RA 2P9KB 2HF4A 2F9TA 4WYBA 1CZAN 1NGIA 3LL3A 2VCPA 3DAWA 3LDQA 4FSVA 3VPZA 4XEIA 3TPQA 2Q97A 4BRPA 2I7PA 1BG3A 4H0XB 1E4GT 1NGJA 1ATSA 3WXLA 5BRDA 3EO3A 3RSEA 5KPRA 2PBDA 4KBOA 5AZIA 3U9ZA 3CJ7A 4JAXA 3ATVA 2IVOA 1C0GA 1IG8A
chains in the Genus database with same CATH superfamily
4CZEA 5FPEA 4ELTA 2Z1GA 4CEEA 3CJBA 2NZTA 3CG7A 4M3YA 1TV6A 2D4WA 3EY1A 3VGMA 2E1YA 1GOCA 2O8FA 2ZGZA 3VQ9A 1SKSA 5M1PA 4DCHA 2ZJRL 5KRTA 3K59A 4I7FA 2VGNA 5AQQA 4EP5A 1EETA 3CCUN 3D2FB 1ZBFA 3VA3A 3ZT4A 5JS1A 3ZEUB 3CXCM 4DR7K 4KI4A 2J4RA 2HMPA 4W5QA 2KLAA 3L3UA 4DV5K 3IDHA 3L6QA 1HMVA 3VGLA 4JKGA 3C7NB 4FWPA 4JS4A 4CJTA 4B1WB 3MXIA 4F3TA 3SUOA 3IMXA 4RW8A 1MDUB 2ASPA 4J2AA 3CM5A 2F8TA 3KZBA 3SYZA 3TAMA 2O8EA 3LP1A 3SJJA 3GL1A 3K5NA 4DSLA 3HPGA 4DLGA 5CR4A 2RHKA 3JAMO 3QNOA 1OVQA 3VEXA 1BGXT 1KRPA 3AGRA 1NGAA 5BPLA 2A41A 1NBWA 5EY4A 3PO5A 3V9WA 3MN6A 1GLLO 2HHTA 4F8RA 1DTQA 2Z1HA 4CJPA 4FK4A 3J7AP 1VQ6N 4PWDA 4JI7K 1FJGK 5AQKA 3S9HA 2PYLA 4JI1K 3SAGA 3ZETA 4DUYK 5D3GA 3EN9A 1G99A 4CF8A 1HRHA 4DV4K 5C2DA 3OYLA 2G8HA 3V9UA 1EQYA 3J8AA 1SS6A 3BGRA 4DTMA 1Y64A 4CHNA 1J9AA 3SBTA 4Z4IA 4DLEA 4BY9C 4DV2K 5SZTA 3OYBA 4IZ9A 4DSJA 2NRXA 4JNEA 1TL1A 1DLOA 4IEIA 4DR5K 3DYAA 4N41A 2VG7A 4DR1K 3O3GA 1C1CA 4CEZA 4CJKA 4J2BA 5KTQA 4CEQA 3GG4A 2NUBA 4ISEA 4IEEA 4U67L 1D5AA 4O8UA 1D9DA 2ZGYA 4M3XA 3O9QA 3OBWA 4J8FA 4ZHRA 4WFBL 4CD3A 4BR7A 5SWMA 1BHLA 5M1QA 1LWEA 3CIPA 1BO5O 3L2WA 4L3QA 3UE5A 1NK9A 2QTDA 4H5TA 2G8IA 4KHPK 3SAFA 1WSGA 3HVTA 4CIEA 4I9LA 2FSNA 5TKYA 1TKZA 4K43A 4BREA 3DLLL 3FZKA 1RTHA 3BUZB 1NK4A 3ZX2A 5KQDA 1L3VA 3A0IX 4FJIA 4DQPA 5GAEP 4DQ8A 3EKUA 4BG8A 4M7YA 3HTVA 1N33K 4F4KA 2D1KA 2UUBK 3O4QA 1VQ4N 4NXNK 3NE6A 3CCSN 3TANA 2V7ZA 4DR6K 1BA0A 4AM6A 1YJWN 1EP4A 2XY6A 3VQ7A 4OKKA 4CHZA 3ENBA 3PV8A 1BU6O 3H3OB 5BPMA 2FLOA 4JI0K 3KJVA 3L3VA 1IKXA 1Y97A 5AR0A 3WXIA 3NH1A 4LFAK 3CC2N 1SZ2A 4GVEA 4A62A 5C0YA 3AAQA 3O9UA 3TU5A 3IS9A 4RW7A 3U3GA 3ENOA 5AQNA 3AO2A 3FR0A 4H5VA 3DOKA 4RW9A 4DQQA 3U4LA 4QCLA 2ASMA 1DT9A 5HBMA 3QEIA 4FWSA 1RTJA 2HHSA 1Q81O 5JLHA 4CHOA 1ILYA 4CJQA 2D0AA 4CCHA 3FFIA 4CJEA 3G71N 2OYQA 3VOVA 1BIUA 3LDLA 1SL1A 3TAGA 4BRDA 4CZLA 5C42A 1NGCA 5AZJB 2NNWA 4FJ8A 4BC3A 4C23A 1U49A 3WNEA 5JVHL 3TAEA 5E41A 4LD0A 2D5RA 5DMRA 5M1KA 3ZSYA 3G0ZA 3FE1A 3CM6A 3DLHA 1RBUA 3V1QA 4DQRA 1S9GA 2GV9A 4E7KA 5J2MA 3U8XA 2ETJA 3THVA 2GUIA 4DV3K 5EVZA 3WNGA 3NF8A 4NLBA 3S3OA 1EWRA 3VMFB 2HNDA 1RT5A 3WNHA 4GV9A 2OCEA 3A8YA 1HNWK 3MXJA 4FZZA 4BACA 4EIAA 3H6EA 3QEXA 2X78A 3SPYA 4CESA 1HKBA 3CERA 1YUWA 2X74A 1RTIA 2V7YA 4DU4A 1ATNA 2E88A 4C8MA 5FRMA 5KRSA 2QM1A 1QVGM 3AVFA 4K41A 4CJ4A 3BZKA 3CETA 1IO2A 2FXUA 3E9LA 2GELA 5HP1A 4B1VA 3CFPA 3O6WA 1T7PA 2QXLA 2YNIA 3M5RA 4CZHA 4FJHA 3A5OC 3QMLA 5H1SQ 1S1WA 1QVFM 2HHVA 4QOZB 2YV0X 4GW6A 4B9MA 2YHXA 1KVBA 1QQNA 3TTFA 2Q36A 3AO1A 3P39A 3QIOA 4G9ZA 4G1QA 1JXBA 3T7ZA 2GX9A 3OBYA 1K8AO 3KK7A 3K0SA 3U6FA 4IKFA 4AILC 4BRAA 3KIOA 1REVA 1YXQA 3QICA 2XRIA 1WOQA 5AFUH 3VEYA 2E8AA 4PL7A 3HI0A 4JKFA 2HHUA 2WFBA 1LAVA 3KVGA 4YOVA 5BN9A 4DHYA 3KK2A 4WE1A 4A57A 3QB0A 3B6OA 1GLDG 3THYA 1KQSM 3LZJA 3QLHA 4HTUA 2O8CB 3SQ0A 1A5XA 2E6LA 1HX1A 5I42A 4YOWA 2QKBA 1T8EA 4M3WA 1C0TA 2DFHA 4CK2A 4JI6K 4KREA 2YNFA 4H03B 4Q0BA 3ISNC 1L5UA 4WFAL 4E7HA 4OKJA 5JICA 3CI5A 4O0IA 3AVBA 3ID8A 2UUCK 4FJ9A 4BQZA 3EKSA 3ALYA 3GDQA 3B6PA 3W0LA 4YOYA 1T6CA 2E20A 4CHQA 5IT9O 3AVGA 3N4PA 3HK2A 5AQSA 2FF6A 3K57A 4WCEL 1C0FA 4FOIA 3T1YK 2HBMA 4DTNA 2UUAK 2IDOA 1O13A 1BWFO 3QEVA 4FZYA 1YJNN 4Q5VA 2IVPA 4M3TA 3RMBA 1Q7YO 5JS2A 2YNHA 4DTRA 2FBXA 4Z4CA 3TSUA 3O08A 4JI3K 4HCCA 1OH6A 3FLCO 4YY3K 2WC9A 4F2SA 1S1VA 2NRRA 3DJCA 3OTOK 1VQNN 3DXKA 4H5WA 3Q7CA 3SUQA 1ASVA 1HYZA 1E3MA 3V1RA 3THXB 3PX0A 1RFQA 3O1BA 1XHXA 1KAZA 1ZBHA 4ZTFA 1JKHA 4KFBA 4FJMA 1HJOA 3PUFA 3D6RA 2KZMA 3PO4A 3DAWA 3VPZA 3HSTB 4KPYA 3E9PA 4H0XB 1SL2A 1NGJA 1F21A 2G8WA 4H4OA 5BRDA 4FLZA 3DRSA 1TK0A 3CJ7A 1WSHA 4B3SK 1KFDA 1IBKK 4JKCA 1R0AA 2IVOA 5AFUA 1N8RO 3K58A 4BE1A 3I8DA 2GTDA 4A5BA 1BUPA 4DFMA 1QHTA 5JLFA 4CEFA 3J7YP 2PZSA 3UB5A 4GV3A 1SUQA 4J2DA 4FK2A 2EX3A 4JHDA 3ZSQA 4RWTA 4MO5A 4AHUA 4CGGA 4ELVA 4K8XA 5T7BA 2Q31A 1KXPA 2PAVA 4JD2A 1VSLA 4Z4EA 3HSCA 5C10A 5E26A 3HVRA 1BISA 3C6AA 3K9JA 4CJ3A 1XMOK 1NMDA 3SMPA 4YOXA 2P9NB 4JKDA 4I2PA 4M3UA 4LF9K 3IUCA 1RBTA 5FROA 3NMUA 4I2QA 4JKAA 3NGZA 3G6EN 1WSFA 3T69A 2O8BA 4OPAA 2FSKA 1RILA 3NHGA 3QO9A 5BREA 4LC9B 4X62K 3M8RA 4DTJA 3B8AX 3AY9A 4KV8A 4CJFA 2P9KA 1ZYQA 4IDKA 3TTDA 5KPZA 1TKTA 1T03A 5AJ3K 3QESA 3SCXA 2Q0UA 1R59O 3UKRA 1U48A 1XNQK 1VSJA 3MWTA 3VETA 3K5MA 2KFNA 2VG5A 2W41A 1FKPA 3DRRA 2XO7A 3HM8A 3GBTA 4BWJA 1RT7A 3FGUA 4CEOA 4KTQA 4E3SA 4GNIA 3IAYA 1YT3A 4RW6A 3PY8A 1GLEG 1QTMA 3KKSA 4I6MB 1RT2A 4MQ3A 5AQGA 2HVIA 5M1OA 3M1FA 4CGHA 3LDPA 5HRPA 3ZSZA 4C8KA 1WAJA 1OKJA 5CHIA 1HPZA 4FJKA 4H0OA 4CZKA 2GBZA 3C6UA 4H8KA 1GLCG 3JSMA 4CI6A 4FJNA 1BCMA 4A2BA 1YJ9N 3GE1A 4IXCA 3MX2A 4CJLA 1GOAA 4H0VB 3UIQA 1RBRA 2X6NA 3NFAA 4CECA 3THWB 3HOTA 1SAZA 3CF5L 2IVNA 2ZF5O 5LY3A 1ASUA 2UXBK 3DOLA 4DR2K 1YAGA 1NNEA 2OZSA 3TTCA 1HLUA 4ISGA 4JI8K 4CF1A 1K73O 2ASOA 4C8NA 3H45C 1SL0A 1TKXA 3D2EB 3S3MA 2VWBA 4IOXA 4OLAA 1B92A 1VQLN 3CCJN 1RDBA 3NBPA 4Y1CA 1JCGA 4MLEA 1MU2A 2WONA 1NJIO 4FVUA 1DTTA 3BF3A 4ICLA 5AQMA 1S1UA 3K5LA 1DGKN 3LALA 3WXKA 3LZIA 3VTIA 5LJWA 4CHYA 2JGUA 1K6YA 5C25A 3M8QA 4JRPA 3HOSA 4E7IA 4BRHA 4DR4K 3C95A 3QERA 4DSKA 4U7BA 4IJAA 3VQPA 1MWKA 1C1BA 4FLTA 4KKOA 4FYDA 4RW4A 4PHTX 3C94A 4FJ5A 1G15A 3O9SA 3VQEA 3VEWA 1NG9A 3QDKA 3KWGA 3WEEA 3C65A 1ZXOA 1M1KO 5B8HA 4WFNL 3VENA 1J5OA 4BDZA 3EL2A 4LF4K 4AHRA 3L2VA 2ITGA 3AVCA 4CGIA 3FZMA 3G25A 3AVAA 3RRHA 3SNNA 4CJSA 4B1YB 4IJNA 3AGKA 5BRFA 2ZJQL 1X3NA 2R7YA 1A5VA 4PKIA 3AARA 4LF6K 3E1YA 3G4SN 1T6DA 1VQKN 2F9WA 2D0BA 4K42A 3UKUA 3S41A 1VSEA 4DV0K 3VQBA 2CGJA 2HB5A 4IO8A 3ZSVA 2Q3SA 1I39A 4Z4HA 1QHAA 3TSQA 4B8CA 4ISFA 3VA0A 4A59A 3VEZA 5DM7L 1BI4A 4OLBA 3LPTA 1T3VA 4PA1A 1X9MA 4BE0A 1GOBA 4BRCA 3Q7BA 4BWMA 2OANA 3PX4A 2UYTA 4DSEA 5CY4A 4BE2A 2P9IA 3A5MC 2I7NA 3VQ8A 3NGIA 4K0KK 1JLBA 1KVCA 4CJUA 4C8OA 2AJQA 4BR9A 3VEOA 4FM1A 3KHYA 2A3ZA 4CD1A 1HYVA 1NWKA 4N76A 2I5JA 1VRTA 3ID6A 5AQJA 1XQSC 4OO1J 4BRMA 1U4BA 4FVMA 3DXMA 3AVHA 4BRLA 4YNQA 3TWHA 1IH7A 5AQOA 5EOYA 1WSEA 4B3RK 4BC5A 3SZ2A 3RMAA 3MN9A 5AQVA 3WUHA 4KI6A 2VQFK 2BE2A 1BDGA 1EO1A 2IOCA 5FDLA 3WXMB 2AP1A 3JS6A 5TKWA 2UU9K 4OPJA 4OPKA 1VHXA 4FWRA 4LSNA 5KQ8A 1UAXA 1D9FA 4DS5A 1I3AA 3R6MA 1RTDA 4O55A 1CLQA 3CQXA 4W5NA 3PX6A 2HBJA 3C6HA 2P9PA 4IO9L 5JVGL 2KKZA 3I0RA 1Q18A 4FW2A 4BROA 3KLEA 3DLRA 3G10A 1GLBG 3QBWA 3V9ZA 3P4IA 2V51B 3UKRB 4F2RA 5AQHA 2WBNA 5J2NA 3DWLA 4DF4A 1U45A 1HNIA 3LP2A 1VQMN 1FKOA 1ASWA 2P9UA 3MMVA 2LSNA 1RDUA 2QK9A 4CERA 2OTJN 3DLGA 3I8BA 1Q8IA 2NRTA 4RTFD 3IRXA 4EHTA 2G8FA 3NDKA 4DR3K 3SPZA 2VYPA 3CCLN 1WSJA 4BQLA 3ZLJA 1EKEA 5BR8K 3WXJA 1BA1A 4M7XA 3K5OA 4JI4K 1QZ6A 5LMNK 2PYJA 5CE3A 4DF8A 3CD6N 3KLHA 3H46O 5AQRA 1RBSA 2QWQA 1J6ZA 4YOTA 2OA8A 3SV3A 1NMNA 1X9SA 1JLCA 3KLIA 4KTZA 2FBVA 4HUEA 1XUPO 3TAPA 2P9SA 2W6KA 2YHYA 1NLVA 4K8ZA 2FBTA 5FLXO 3PSIA 3NH0A 4NCBA 2VWKA 1B9DA 4YDUA 3NVMA 4CFCA 4PKGA 4JV5K 3IKMA 3SV4A 1WUAA 1NJXA 4LH5A 1JL1A 2Z1JA 1UOCA 3E9OA 4DU3A 3MXMA 4FPAA 5J2PA 3V9SA 1RCHA 3H3NO 4Z94A 4IDHA 2HHWA 2O8DA 1TYQA 5CYQA 4FWQA 2IGIA 3BZCA 1WAFA 4DV6K 3I56N 1GLAG 1KLMA 2B6AA 5C2FA 2BUPA 4C1NK 5C15A 5BPNA 1C6VA 4EZ6A 4OGCA 2O8FB 3VF4A 5KI6A 3HP9A 4A5AA 1JLQA 3O9TA 1VQPN 3VF6A 1NOZA 3O9RA 4IBNA 1SQKA 2HNZA 3CFOA 2E6MA 3OYJA 3U3YA 1NK8A 1UA1A 1FW6A 1RDAA 2CGLA 4CZIA 3QINA 2W40A 4YDUC 3KTQA 4JKGB 4JEPA 4CFBA 1EXQA 3EYZA 4WYBA 1YF5L 2RE2A 4FSVA 4RG8A 1RDCA 2O8EB 1X1PA 5HLFA 3V4IA 1E4GT 1ATSA 2YKMA 4O44A 3LWMA 3RSEA 4GKJK 1UWBA 4KBOA 5AZIA 3U9ZA 5C24A 1RT3A 3SK3A 1RBVA 3OYGA 1I94K 1BI4B 2HOEA 3HO1A 5AQFA 2QI2A 3ULEA 3L8BA 1KAYA 3F9KA 4N47A 5GADP 4HUGA 3F2KA 1S72N 4NCAA 4KB1A 4FLUA 4CZGA 1S1TA 4CGFA 3ZYYX 4FXDA 1HQUA 3KK3A 4CIFA 3ZETB 3T1HK 1RT1A 2Q2RA 3ITHA 2E1ZA 2YI1A 1KFSA 4QS9A 4I9QA 4TSXA 5AQWA 4KAZA 5AQIA 3H08A 2BH1A 5F1XA 3L4IA 3SLCA 4ID1A 3CMEN 3DXMB 4BG9A 1MWMA 3QIPA 2B4JA 4CZFA 2JLEA 2VGMA 4Z0UA 3AVKA 4BRFA 1TK5A 4CF0A 4PQUA 4DWIA 2QWMA 3A5NC 3JXUA 2YJEA 1L3TA 2KQ2A 3CFRA 4EP4A 4PUOA 5EXWA 4FWMA 3OYHA 1K8KA 5BR9A 2HSTA 3CCQN 1Z25A 5MLCQ 4HTLA 3PIPL 3RWUA 3P31A 1HQEA 4YHHK 3SBGA 4FJXA 2YCHA 3O4WA 4L8RB 4B1XB 1YVUA 3NF9A 3SQ2A 4CFDA 1RDDA 3O80A 2QKKA 1IG9A 2CH6A 3E01A 4M42A 1YTAA 2QWOA 3ZSWA 3ZSXA 1IBMK 2P9PB 3OW2M 1T05A 4KHWA 3N4QA 2P9LA 4FO0A 4FWOA 1QQCA 4B1ZA 3OYAA 3HM9A 1ZC6A 3VGKA 1J53A 1ESVA 2V52B 4B9TA 2XY5A 3J7ZO 3D2FA 2A40A 3KKRA 2RN2A 2YHBA 4WF9L 4NXMK 3ZEUA 4HHTA 2OPSA 2EWSA 1N34K 2W6LA 4OGEA 1NKCA 2P9UB 1Z05A 1HNZK 3M6GA 3DM2A 4CZMA 2ZJPL 1X3MA 4CFAA 3VQDA 3HPOA 2UXDK 2YNGA 2IAJA 4Y1DA 2O4GA 4FCYA 4BRIA 3RR7A 4DKWA 1E4FT 2A6AA 2HHQA 3TR8A 4A61A 3KWIA 4FM2A 4UQGA 2F8SA 3ZSOA 4E7LA 1L3UA 4F9OA 2OPRA 3M8PA 2W42A 3OVNA 3CCVN 4FM0A 3KD5E 4DTUA 1QQMA 1C0UA 5J1EA 4FLVA 3CPEA 2BANA 3MAQA 1SKWA 2P5OA 1XMQK 1EWQA 1VSHA 3MCPA 3HBTA 1VQ9N 4BGBA 4CF2A 3VN5A 5FPMA 4H0YB 5AQPA 2E2PA 4QS7A 2RPIA 1S3XA 5HRNA 5AQYA 2PFUA 3MX5A 4KTWA 1TKDA 2Y1JA 4GMJB 3O5BA 4GY2B 1LW2A 4KHNA 2QA4N 3PIOL 5KGXA 3ZT3A 3RMCA 4DTSA 1ATRA 1KTQA 3F5TA 3CCEN 4AQYK 4BRNA 2KFZA 3LWLA 2F4VK 4DG1A 1Z6RA 4NLCA 1NGDA 3HRGA 3OYNA 2F7TA 3AO5A 1H1VA 2YKNA 3ZT2A 3CJ1A 3C0BA 3K9KA 3AVLA 4BGAA 1OH7A 2XY8A 4MDAA 5KPTA 2IS3A 2D0OA 3CHWA 4MFBA 4E89A 1N6QA 1WBDA 1WN7A 2NRZA 1RNHA 3L0QA 4KHQA 3LDSA 1C1AA 2VG6A 1S22A 1NM1A 1VQ5N 4QAGA 4H0TB 1K9MO 4EFHA 3SQ4A 1J54A 2ATQA 3J80O 1KLNA 5EU7A 3AVMA 2WUSA 1HYSA 3T3FA 3HYFA 4ILJA 4XH5A 3H1QA 1DEJA 5ELZA 3CJ9A 3GOIA 4X64K 4E1NA 1S1XA 3CJCA 4JYAK 3R8EA 3H1VX 1W97L 1YITN 4FK0A 1ZBIA 3PLAA 4R79A 2F96A 2G8UA 1QS4A 2OPQA 3KLGA 2NRVA 3D7EO 5GAGP 3PSFA 4DU1A 5FRNA 4YORA 3CQ8A 4KH4A 3SJHA 3WQUA 4DTXA 3ATUA 4O5FA 3MK6A 4MDBA 2ZE2A 5F2RA 4JKBA 4IOCL 4DB3A 3QFPA 2ZD1A 3THYB 3FZLA 4FPBA 4NB4A 1OH8A 3CJAA 3FFKB 4BC2A 4Z4FA 1TVRA 4NYNA 4FJGA 4HCBA 1Q9XA 4MLHA 1NOYA 4B9UA 1JJ2M 4H5RA 1VSIA 1K8KB 3HT3A 1VAZA 2Z1IA 5AZJA 3K2PA 1VSFA 3QFUA 4CK3A 4E19A 1LV5A 2E2OA 5I9EB 2D0CA 2CH5A 2XY7A 4ZTJA 1VSKA 3NCIA 3BY5A 3EZWA 2EHGA 3VQQA 1HJRA 5I3UA 1RT4A 3L4QA 1S6QA 1W7AA 1QQOA 3LDNA 4F3OA 3VQ4A 2P9LB 3OS2A 1M90O 4E1MA 1GLJO 1HPMA 4X65K 3FZFA 1TAUA 2E5LK 4WQ5A 1D8YA 1WB9A 4IG0A 4ILGB 4LY7A 1S9EA 4HWIA 3DXKB 4BVOA 4X66K 3P83D 1NK0A 1B9FA 3LDOA 2BTFA 4JKEA 2GUPA 1BQMA 1KVAA 5AQTA 4JK8A 3ZT1A 1NKBA 2QXFA 2YHWA 1JLAA 3ZSRA 2RKIA 4B1UB 3AVNA 4M45A 1VSMA 1SKRA 4IFVA 2O4IA 2P1JA 3IFRA 2NRHA 4JN4A 4DMNA 1HKGA 2Q1NA 1XC9A 1JLEA 1ZBUA 3DLKA 4AHVA 3SAHA 4BC4A 4CJ7A 1YIJN 4O5BA 3DMJA 2A42A 4ELUA 2E2NA 4FL9A 4WQ5C 2OTLN 1JCFA 1NGBA 4W5OA 1CXUA 1X9JA 3O3HA 2HNYA 3AA4A 3NVKA 4JHDB 4BR4A 4GKKK 1V4SA 4JD2B 3R3LA 3CC4N 5EX5A 5LL6Z 2Y1IA 3ZX3A 3CMAN 2HF3A 2YJFA 3QNNA 4B3TK 3OYEA 1IKWA 2O8CA 2DFEA 4FOEA 3AO4A 2O8BB 4LF7K 4CJVA 3DI6A 1YTUA 3HJFA 4JI5K 3VERA 1HUXA 5GIPA 2X6SA 1MA9B 4CGDA 3SUNA 3LP3A 4B3MK 3V6DA 2P9KB 2F9TA 2KW4A 3LL3A 2VCPA 3LDQA 4YOUA 4OPHA 3CC7N 3TPQA 3O4NA 2Q97A 4BRPA 1BG3A 4B3OA 3WXLA 1NK5A 1N36K 3EO3A 5KPRA 4FJLA 3TAFA 4M41A 1C0GA 3EZ5A 4K25A 3MWPA 1TAQA 2PY5A 1YHQN 1NGEA 2RF2A 3I55N 1TK8A 1KD1O 3OYKA 3R1XA 1QSSA 3BF1A 1NK6A 2OZMA 2ZM6K 4DV7K 4IG3A 3EE9A 1Q82O 1RDWX 1NJZA 1T44A 2WOMA 4NYFA 3THXA 4DTOA 4H0PA 1VK0A 5IWAK 1HKCA 4FW1A 1GLFO 4CEAA 3F9MA 4BRGA 1ZBSA 1CZBA 1HNXK 3WQTA 1NGHA 1NK7A 3NH2A 4O0JA 3OS0A 3T1AA 1LAWA 3AAPA 3TARA 2YX6A 3MEEA 1JLGA 3JYTA 4AHTA 3HP6A 2GWKA 3A5LC 1HR0K 5ADXH 4JRQA 3C6TA 1NU0A 4CW7B 1Q9YA 3LANA 2OPPA 3CCMN 1EX4A 2DTUA 3J81O 5AQXA 4NO7A 2FC0A 3A2FA 4LH4A 4EZ9A 3LP0A 2NRWA 3CYMA 1VQ7N 1LWFA 4CK1A 2E4LA 4DQSA 2A1SA 3AA3A 3IG1A 1KSPA 3KLFA 3AA2A 1LW0A 4H4MA 3VQCA 3VQ5A 2QWLA 1IKVA 3OYDA 2P9NA 5JMVA 1JLFA 4CBXA 4B9VA 2B5JA 5BN8A 2CGKA 3TSPA 3WEEB 3QEPA 4R5PA 4E0DA 1TUUA 1ZBLA 3R9PA 3V9XA 2HBLA 3EEQA 2VQEK 4DV1K 5KGWA 4PL8A 4BVPA 3U9DA 1BOTO 4KB0A 4V19S 3OYCA 3FZHA 2P5GA 2HHXA 4LF5K 2P51A 1W9HA 3V81A 3RTVA 5E84A 2G8KA 2DPNA 1BQNA 4HUFA 1U2VA 3VTHA 3OYIA 1HNVA 1IKYA 5DK5A 5GINA 2G8VA 4B9SA 1OVYA 2HW3A 3SI6A 3O8MA 3VEVA 1P8ZA 3O3FA 3UKUB 4HVJA 1RGIA 4MO4A 4AF1A 4XH1A 1U47A 4KHYA 4UY8O 3CQYA 5HRRA 4BRKA 4DUZK 4I6MA 4DFKA 1OH5A 3HL8A 5FPDA 3LAMA 4Y0WA 4BDPA 5HROA 3ULDA 3EE8A 3DRPA 3BEXA 4CVNE 5CZ1A 2P9IB 1JXEA 4JK9A 3SUPA 4KH6A 4DS4A 1BCOA 1XI1A 1C0MA 5F0XA 5HL7L 4BR5A 3S3NA 4PY5A 3D0PA 1UA0A 2DY4A 1DKGD 5K14A 3THWA 3RR8A 4CIGA 1QE1A 3SMSA 2BDPA 4B8AB 2AA4A 1BIZA 4JS5A 1IJJA 5ADXA 4O8KA 4LSLA 4FZXC 3AA5X 3BP8A 4AHCA 3D2EA 4ID5A 4CBWA 4CHPA 5GIOA 3MN7A 4C1NI 1XNRK 3BDPA 1VRUA 3P1GA 4DSFA 1JCEA 4FWNA 3VESA 4CF9A 1L3SA 4CBUA 4AM7A 2ITMA 2H3GX 3LM9A 1CXQA 4PKHA 4M63C 3NGYA 2QWRA 1RT6A 1JL2A 4M3RA 1BL3A 4AH9A 4JK7A 2GWJA 5CZ2A 4XIUA 2FF3B 4XH4A 3HPHA 5CYMA 2BGGA 1Q86O 4BDYA 4CJ5A 3O1WA 2IC3A 5J2QA 3VQAA 2QW9A 1QZ5A 1TGOA 1TUYA 1KC8O 4CE9A 4JI2K 1LOTB 5C12A 1NJWA 1VSDA 1QSLA 1YVNA 3DLEA 4IWVA 2KZZA 3MCAB 1TL3A 3E66A 3TABA 3C7NA 5M1NA 3ZCMA 4BR2A 2ZQBA 1FK9A 3HXMA 1KAXA 3QETA 1WLJA 1WNSA 5AQLA 3P38A 3ZX0A 1W0HA 3T19A 3KK1A 2KTQA 4OKEA 3HZ6A 3W3DA 4N5SA 3OS1A 4Z4GA 5HRSA 4FLXA 4W5RA 4B9NA 4FJJA 3WT0A 3LM2A 4GV6A 2QWNA 4OJRA 3M3ZA 3VF2A 2D0PA 2P9SB 3L2UA 3I33A 2HBKA 3OA9A 4KO0A 5LMUK 5A2QO 5HOOA 4CGJA 1QSYA 2HVHA 4BRQA 1S6PA 3CPWM 3SQ1A 4FLWA 1V4TA 3OY9A 4CZJA 3RRGA 2A1RA 3AVIA 3VQ6A 2O8DB 5AQZA 1ITGA 4M3ZA 3MDQA 1NGGA 4NCGA 1TYQB 3NAEA 3M8SA 1LWCA 2ZWHA 1FXXA 1XWLA 4C8LA 1U04A 3QBXA 3TAQA 1LCUA 5AQUA 3P5JA 1W2BM 1YI2N 4E7JA 2A5XA 2DFFA 1S5JA 5BRHA 1SV5A 4YFUA 1P90A 4B9LA 4BR0A 5LJVA 4CEDA 1VQ8N 4E1JA 1NKEA 2IIRA 3OYMA 3L2QA 2E2QA 2FSJA 4DFPA 1U6ZA 3MECA 1NJYA 1CZ9A 1IBLK 2QEXN 3AO3A 4FWKA 1N32K 4WQ4A 4DFJA 1U2VB 2GEMA 4CJRA 3WNFA 2UXCK 2YHAA 1WSIA 4FJ7A 3OYFA 4O4GA 3TI0A 3OHRA 3MN5A 4OVLA 1X9WA 1XC3A 2XHBA 3RSEB 3MEGA 3LPUA 4A2AA 5AZIB 5DM6L 1O1WA 4GVMA 1N5YA 1J5EK 4KHUA 1NGFA 4JLHA 4KRFA 4DSIA 3D45A 3ULEB 4CJWA 4EHUA 4CEBA 3AVJA 3OJUA 3ZT0A 4LFCK 4FWLA 4KH5A 4FLYA 4JKHA 5FPNA 4IFEA 4DQIA 3V1OA 4N56A 4LF8K 2VWJA 4ILHA 4EAHD 2NLXA 2JWLA 4QS8A 4AHSA 2WTUA 1D4XA 4IOAL 3I0SA 4H5NA 4WQ4C 3KD1E 5M1FA 2HMIA 2QWPA 4B9QA 1XHZA 2FBYA 3RVCA 3ENHA 3F73A 4RCHA 3ASMA 3L2RA 5GAHP 2KHOA 4B08A 1KCFA 4IFYA 4W5TA 2Q0RA 2HF4A 3MEDA 1CZAN 4KHSA 1NGIA 1Z26A 4LFBK 4XEIA 2HHHK 3NF6A 3OJSA 4DTPA 3DLBA 2I7PA 2JWKA 3AV9A 3NF7A 4J2EA 3LAKA 2PBDA 4OX9K 3RMDA 1IV0A 1A5WA 1VQON 4JAXA 3QEWA 3ATVA 1WBBA 3CCRN 1IG8A
chains in the Genus database with same CATH topology
3SK3A 5AFUA 4K25A 4CZEA 5FPEA 1N8RO 2GTDA 4A5BA 1BUPA 3MWPA 2HOEA 3CJBA 5AQFA 2NZTA 2QI2A 1NGEA 1YHQN 3ULEA 1KAYA 5GADP 3F2KA 5JLFA 3I55N 1S72N 3UB5A 4CZGA 4GV3A 2D4WA 4JHDA 4RWTA 1KD1O 4MO5A 3ZYYX 3R1XA 3VGMA 3BF1A 2E1YA 2Q31A 1KXPA 2PAVA 2ZGZA 4JD2A 3ZETB 3HSCA 5C10A 5E26A 2Q2RA 5M1PA 3C6AA 2E1ZA 2YI1A 3K9JA 4DCHA 2ZJRL 4QS9A 1NMDA 3SMPA 3EE9A 2VGNA 5AQQA 4YOXA 1Q82O 2P9NB 1RDWX 4JKDA 5AQWA 3CCUN 3D2FB 1T44A 3IUCA 5AQIA 2BH1A 4DQ8A 3ZEUB 5F1XA 3CXCM 3NMUA 3L4IA 4JKAA 3SLCA 3G6EN 3CMEN 4H0PA 3DXMB 4BG9A 3T69A 1MWMA 2J4RA 4OPAA 2HMPA 1HKCA 2FSKA 2KLAA 4CZFA 1GLFO 5BREA 3IDHA 3F9MA 4LC9B 4BRGA 1ZBSA 3L6QA 2VGMA 1NGHA 3VGLA 3WQTA 4JKGA 4BRFA 3C7NB 4FWPA 3B8AX 3AY9A 2QWMA 4B1WB 3A5NC 2P9KA 3JXUA 2YJEA 3IMXA 1MDUB 3AAPA 2ASPA 3TTDA 5EXWA 4FWMA 3KZBA 2YX6A 5KPZA 1K8KA 3GL1A 2GWKA 5BR9A 2HSTA 3CCQN 2Q0UA 3A5LC 5MLCQ 5ADXH 1R59O 3UKRA 4HTLA 3PIPL 3P31A 5CR4A 2RHKA 3MWTA 3SBGA 3VETA 2YCHA 3O4WA 2W41A 4B1XB 3VEXA 3AGRA 3HM8A 3GBTA 3O80A 3CCMN 1NGAA 5BPLA 2A41A 3FGUA 5AQXA 1NBWA 5EY4A 4NO7A 4GNIA 2CH6A 3MN6A 1GLLO 1GLEG 2QWOA 2P9PB 4I6MB 2NRWA 5AQGA 3OW2M 1VQ7N 1VQ6N 5M1OA 3M1FA 3N4QA 2P9LA 4FO0A 5AQKA 3LDPA 4FWOA 4B1ZA 3SAGA 3ZETA 1ZC6A 3EN9A 1OKJA 1G99A 3VGKA 5CHIA 2QWLA 1ESVA 2P9NA 2V52B 5JMVA 5C2DA 4H0OA 4CZKA 3J7ZO 3D2FA 2A40A 4CBXA 4WF9L 3ZEUA 1EQYA 3J8AA 1GLCG 4CI6A 2EWSA 2CGKA 5BN8A 4A2BA 1SS6A 3TSPA 3WEEB 1YJ9N 3GE1A 4IXCA 2P9UB 1Z05A 3MX2A 3M6GA 1TUUA 1Y64A 3R9PA 2HBLA 3SBTA 4H0VB 4CZMA 4PL8A 4BY9C 4BVPA 3U9DA 1BOTO 3HOTA 1SAZA 4IZ9A 2IVNA 3CF5L 2ZF5O 5LY3A 2NRXA 2ZJPL 4JNEA 3FZHA 1X3MA 4IEIA 1YAGA 3TTCA 1HLUA 4ISGA 5E84A 2DPNA 1K73O 2ASOA 1U2VA 3H45C 3VTHA 3GG4A 4BRIA 5GINA 3D2EB 4DKWA 2VWBA 4IOXA 1E4FT 4ISEA 1OVYA 2A6AA 4IEEA 4U67L 3CCJN 1VQLN 1JCGA 3KWIA 3O8MA 4A61A 4MLEA 3VEVA 1P8ZA 4O8UA 3UKUB 1NJIO 4FVUA 1RGIA 2ZGYA 3O9QA 3OBWA 3BF3A 4J8FA 5AQMA 4MO4A 4AF1A 4WFBL 4XH1A 4CD3A 4BR7A 4F9OA 1DGKN 4UY8O 3CCVN 5M1QA 3CIPA 3CQYA 3WXKA 1BO5O 3VTIA 5LJWA 4L3QA 4BRKA 1QQMA 4I6MA 3UE5A 2QTDA 3HOSA 4H5TA 3CPEA 5FPDA 3SAFA 4Y0WA 4BRHA 2FSNA 5TKYA 3EE8A 3BEXA 4K43A 3MCPA 3HBTA 4BREA 4U7BA 3DLLL 3FZKA 4IJAA 1VQ9N 4BGBA 2P9IB 3BUZB 1MWKA 3ZX2A 5FPMA 5KQDA 4JK9A 4H0YB 3A0IX 5AQPA 2E2PA 4PHTX 4QS7A 1S3XA 5GAEP 5AQYA 2PFUA 3EKUA 3MX5A 3O9SA 4M7YA 3VEWA 3HTVA 4KH6A 4BG8A 3QDKA 3KWGA 3WEEA 3C65A 5F0XA 3O5BA 1ZXOA 4GY2B 5HL7L 4BR5A 5B8HA 4WFNL 1M1KO 2QA4N 3VENA 2D1KA 3PIOL 3EL2A 1VQ4N 1DKGD 3SMSA 3CCSN 1ATRA 2V7ZA 3F5TA 3FZMA 3CCEN 3G25A 4BRNA 1BA0A 2AA4A 4AM6A 1YJWN 1IJJA 1Z6RA 4NLCA 5ADXA 4O8KA 1NGDA 4B1YB 3HRGA 3ENBA 3BP8A 4IJNA 3AGKA 1BU6O 2F7TA 5BRFA 3H3OB 1X3NA 1H1VA 2FLOA 4PKIA 3AARA 5BPMA 2ZJQL 3D2EA 5AR0A 4CBWA 3E1YA 3WXIA 3MN7A 5GIOA 4C1NI 3G4SN 3CC2N 1T6DA 1SZ2A 4GVEA 3CJ1A 2F9WA 3C0BA 3K9KA 1VQKN 4BGAA 4K42A 4A62A 3UKUA 3S41A 4MDAA 3AAQA 5C0YA 1JCEA 3O9UA 4FWNA 3TU5A 3VESA 5KPTA 2CGJA 2D0OA 4IO8A 3CHWA 3ENOA 5AQNA 3FR0A 1QHAA 4CBUA 4H5VA 3TSQA 2NRZA 4ISFA 4AM7A 3L0QA 3U4LA 4A59A 3VEZA 2ITMA 5DM7L 2ASMA 2H3GX 3LM9A 1S22A 1NM1A 1DT9A 1T3VA 1VQ5N 4BRCA 4H0TB 3Q7BA 4FWSA 4M63C 4PKHA 2QWRA 1Q81O 2OANA 5JLHA 1K9MO 4EFHA 2UYTA 1ILYA 2P9IA 3G71N 4JK7A 2WUSA 2GWJA 3A5MC 3VOVA 2I7NA 2FF3B 4ILJA 3LDLA 4XH4A 4XH5A 3H1QA 4BR9A 3VEOA 4BRDA 3KHYA 1DEJA 5ELZA 4CZLA 1Q86O 2A3ZA 1NGCA 3CJ9A 1NWKA 3GOIA 2NNWA 5AZJB 4CD1A 3O1WA 3ID6A 4BC3A 5AQJA 1XQSC 2QW9A 1QZ5A 4OO1J 1TUYA 4BRMA 4C23A 1KC8O 5JVHL 1LOTB 3CJCA 3DXMA 4BRLA 5C12A 3R8EA 5M1KA 3H1VX 1W97L 5AQOA 1YITN 1YVNA 3FE1A 4IWVA 3PLAA 3MCAB 4R79A 3E66A 3C7NA 5M1NA 5EOYA 4BR2A 4BC5A 3U8XA 3MN9A 2NRVA 5AQVA 5EVZA 1KAXA 3D7EO 3WUHA 5GAGP 4NLBA 4YORA 5AQLA 3P38A 4KH4A 3SJHA 3ZX0A 3VMFB 3WQUA 3ATUA 1BDGA 4GV9A 1EO1A 3A8YA 3HZ6A 4O5FA 3MK6A 4MDBA 5F2RA 3WXMB 2AP1A 3JS6A 4JKBA 5TKWA 3W3DA 4IOCL 4DB3A 4EIAA 3H6EA 3QFPA 4FWRA 1HKBA 3CERA 3FZLA 4FPBA 4NB4A 5KQ8A 1YUWA 3CJAA 3FFKB 4BC2A 2V7YA 3WT0A 3LM2A 4GV6A 3R6MA 2QWNA 1ATNA 2E88A 2QM1A 1QVGM 3CQXA 3M3ZA 4K41A 2D0PA 3VF2A 2HBJA 2P9SB 3C6HA 2P9PA 3CETA 4IO9L 2FXUA 3E9LA 5JVGL 2GELA 2KKZA 4MLHA 4B1VA 1Q18A 3O6WA 2QXLA 4BROA 3I33A 2HBKA 3M5RA 4CZHA 1JJ2M 4H5RA 4EAHD 3A5OC 3QMLA 5H1SQ 1GLBG 3OA9A 3QBWA 1K8KB 1VAZA 5HOOA 3P4IA 5AZJA 2V51B 3UKRB 1QVFM 4BRQA 3QFUA 5AQHA 2WBNA 3CPWM 1V4TA 2E2OA 4CZJA 3DWLA 2YHXA 1QQNA 2CH5A 3TTFA 5I9EB 2Q36A 3P39A 4G9ZA 1VQMN 3T7ZA 2P9UA 3EZWA 2GX9A 3MMVA 1RDUA 3OBYA 1K8AO 3KK7A 3L4QA 5AQZA 2OTJN 3I8BA 1QQOA 3LDNA 3MDQA 1NGGA 4BRAA 1TYQB 2NRTA 4RTFD 1YXQA 4EHTA 3QICA 2ZWHA 2P9LB 2VYPA 1M90O 3CCLN 1WOQA 5AFUH 4BQLA 3VEYA 2E8AA 4PL7A 3HI0A 4JKFA 3WXJA 1GLJO 1HPMA 2WFBA 1BA1A 3KVGA 4YOVA 5BN9A 3QBXA 1LCUA 3FZFA 5AQUA 4DHYA 1W2BM 4M7XA 4A57A 4WQ5A 1YI2N 2A5XA 3QB0A 1QZ6A 5CE3A 5BRHA 3CD6N 1GLDG 4ILGB 3H46O 4HWIA 1KQSM 3DXKB 5AQRA 1P90A 4BVOA 4BR0A 5LJVA 2QWQA 1J6ZA 4YOTA 4JKEA 3LDOA 2BTFA 1VQ8N 2GUPA 1HX1A 4E1JA 4YOWA 2IIRA 1XUPO 2P9SA 5AQTA 4JK8A 2E2QA 2YHYA 1NLVA 2FSJA 2YHWA 1U6ZA 4H03B 4WFAL 4B1UB 2QEXN 5JICA 3CI5A 4FWKA 4WQ4A 1U2VB 3ID8A 2GEMA 4YDUA 3NVMA 3IFRA 2NRHA 3EKSA 3GDQA 4PKGA 3IKMA 3W0LA 4BQZA 4JN4A 4YOYA 1T6CA 1WUAA 2E20A 3OHRA 1HKGA 2Q1NA 3MN5A 3E9OA 1XC3A 3N4PA 3RSEB 4FPAA 4A2AA 5AZIB 5DM6L 3H3NO 5AQSA 4Z94A 2FF6A 4IDHA 4WCEL 1C0FA 4FOIA 3SAHA 4BC4A 2HBMA 1TYQA 4CJ7A 1YIJN 4FWQA 2A42A 1NGFA 1O13A 1BWFO 2E2NA 1YJNN 4FL9A 4WQ5C 2OTLN 1JCFA 2IVPA 3ULEB 1NGBA 4EHUA 3I56N 1Q7YO 1X9JA 1GLAG 3TSUA 5C2FA 3O08A 2BUPA 4JHDB 4BR4A 4C1NK 5C15A 3NVKA 5BPNA 4FWLA 4KH5A 1V4SA 3FLCO 4JD2B 4JKHA 5FPNA 3VF4A 2WC9A 3R3LA 4IFEA 3CC4N 5EX5A 4A5AA 3O9TA 1VQPN 2NRRA 3DJCA 3VF6A 3O9RA 3ZX3A 3CMAN 1VQNN 2HF3A 2YJFA 3DXKA 4H5WA 4ILHA 3Q7CA 2NLXA 2JWLA 1SQKA 4QS8A 1D4XA 4IOAL 4FOEA 1RFQA 4H5NA 4WQ4C 2CGLA 4CZIA 5M1FA 3O1BA 2W40A 1KAZA 2QWPA 4YDUC 4B9QA 3RVCA 3VERA 3ENHA 1HUXA 4JKGB 4RCHA 5GIPA 1HJOA 2KHOA 1MA9B 4JEPA 5GAHP 3D6RA 2Q0RA 2P9KB 2HF4A 2F9TA 4WYBA 1CZAN 1NGIA 1YF5L 2RE2A 3LL3A 2VCPA 3DAWA 3LDQA 4FSVA 4YOUA 3VPZA 4OPHA 4XEIA 3CC7N 3TPQA 2Q97A 4BRPA 3E9PA 2I7PA 1BG3A 2JWKA 1E4GT 4H0XB 1NGJA 1ATSA 3WXLA 5BRDA 3EO3A 3RSEA 5KPRA 2PBDA 4KBOA 5AZIA 3U9ZA 3CJ7A 3CCRN 1VQON 4JAXA 4JKCA 3ATVA 2IVOA 1C0GA 1IG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SK3 A;  5AFU A;  4K25 A;  4CZE A;  5FPE A;  2GTD A;  1BUP A;  2HOE A;  3CJB A;  5AQF A;  2NZT A;  1NGE A;  3ULE A;  1KAY A;  5JLF A;  3UB5 A;  4CZG A;  2D4W A;  4JHD A;  4RWT A;  4MO5 A;  3VGM A;  3BF1 A;  2E1Y A;  2Q31 A;  1KXP A;  2PAV A;  2ZGZ A;  4JD2 A;  3ZET B;  3HSC A;  5E26 A;  2Q2R A;  2E1Z A;  2YI1 A;  4DCH A;  4QS9 A;  1NMD A;  3SMP A;  5AQQ A;  2P9N B;  1RDW X;  5AQW A;  3D2F B;  1T44 A;  3IUC A;  5AQI A;  5F1X A;  3ZEU B;  3L4I A;  3SLC A;  4H0P A;  3DXM B;  4BG9 A;  1MWM A;  2J4R A;  2HMP A;  1HKC A;  2FSK A;  4CZF A;  5BRE A;  1GLF O;  3IDH A;  3F9M A;  4LC9 B;  4BRG A;  1ZBS A;  3L6Q A;  3WQT A;  1NGH A;  3VGL A;  4BRF A;  3C7N B;  4FWP A;  3B8A X;  3AY9 A;  2QWM A;  4B1W B;  3A5N C;  2P9K A;  3JXU A;  2YJE A;  3IMX A;  1MDU B;  3AAP A;  2ASP A;  5EXW A;  4FWM A;  3KZB A;  5KPZ A;  1K8K A;  3GL1 A;  2GWK A;  5BR9 A;  2Q0U A;  3A5L C;  5ADX H;  1R59 O;  3UKR A;  4HTL A;  3VET A;  2YCH A;  3O4W A;  2W41 A;  4B1X B;  3VEX A;  3HM8 A;  3GBT A;  3O80 A;  1NGA A;  5BPL A;  2A41 A;  3FGU A;  5AQX A;  1NBW A;  5EY4 A;  4NO7 A;  4GNI A;  2CH6 A;  3MN6 A;  1GLL O;  1GLE G;  2QWO A;  2P9P B;  4I6M B;  5AQG A;  3M1F A;  2P9L A;  4FO0 A;  5AQK A;  3LDP A;  4FWO A;  4B1Z A;  3ZET A;  1ZC6 A;  3EN9 A;  1OKJ A;  1G99 A;  3VGK A;  2QWL A;  1ESV A;  2P9N A;  2V52 B;  5JMV A;  4H0O A;  4CZK A;  3D2F A;  2A40 A;  4CBX A;  3ZEU A;  1EQY A;  3J8A A;  1GLC G;  4CI6 A;  2EWS A;  2CGK A;  5BN8 A;  4A2B A;  3WEE B;  3GE1 A;  4IXC A;  2P9U B;  1Z05 A;  3M6G A;  1TUU A;  1Y64 A;  3R9P A;  4H0V B;  4CZM A;  4PL8 A;  4BVP A;  3U9D A;  1BOT O;  1SAZ A;  4IZ9 A;  2IVN A;  2ZF5 O;  5LY3 A;  4JNE A;  3FZH A;  1X3M A;  1YAG A;  1HLU A;  4ISG A;  5E84 A;  2DPN A;  2ASO A;  1U2V A;  3H45 C;  3GG4 A;  4BRI A;  3D2E B;  2VWB A;  1E4F T;  4ISE A;  2A6A A;  1JCG A;  3O8M A;  4A61 A;  4MLE A;  3VEV A;  1P8Z A;  3UKU B;  1RGI A;  2ZGY A;  3BF3 A;  4J8F A;  5AQM A;  4MO4 A;  4XH1 A;  4CD3 A;  4BR7 A;  4F9O A;  1DGK N;  3CIP A;  3CQY A;  3WXK A;  1BO5 O;  5LJW A;  4L3Q A;  4BRK A;  1QQM A;  4I6M A;  3UE5 A;  4H5T A;  5FPD A;  4Y0W A;  4BRH A;  2FSN A;  5TKY A;  3BEX A;  4K43 A;  3MCP A;  3HBT A;  4BRE A;  3FZK A;  4IJA A;  4BGB A;  2P9I B;  3BUZ B;  1MWK A;  3ZX2 A;  5FPM A;  5KQD A;  4H0Y B;  3A0I X;  5AQP A;  2E2P A;  4QS7 A;  1S3X A;  5AQY A;  3EKU A;  4DQ8 A;  4BG8 A;  4M7Y A;  3VEW A;  3HTV A;  3QDK A;  3WEE A;  5F0X A;  3O5B A;  1ZXO A;  4GY2 B;  4BR5 A;  5B8H A;  3VEN A;  2D1K A;  3EL2 A;  1DKG D;  3SMS A;  1ATR A;  2V7Z A;  3FZM A;  3G25 A;  4BRN A;  1BA0 A;  2AA4 A;  4AM6 A;  1IJJ A;  1Z6R A;  5ADX A;  4O8K A;  1NGD A;  4B1Y B;  3BP8 A;  4IJN A;  1BU6 O;  5BRF A;  3H3O B;  1X3N A;  1H1V A;  2FLO A;  4PKI A;  3AAR A;  5BPM A;  3D2E A;  5AR0 A;  4CBW A;  3WXI A;  3MN7 A;  1T6D A;  1SZ2 A;  3CJ1 A;  2F9W A;  3C0B A;  4BGA A;  4K42 A;  4A62 A;  3UKU A;  3S41 A;  3AAQ A;  1JCE A;  4FWN A;  3TU5 A;  3VES A;  5KPT A;  2CGJ A;  2D0O A;  4IO8 A;  3CHW A;  3ENO A;  5AQN A;  3FR0 A;  1QHA A;  4CBU A;  4H5V A;  4ISF A;  4AM7 A;  3L0Q A;  3U4L A;  3VEZ A;  2ITM A;  2ASM A;  2H3G X;  3LM9 A;  1S22 A;  1NM1 A;  4BRC A;  4H0T B;  4PKH A;  4FWS A;  4M63 C;  2QWR A;  2OAN A;  5JLH A;  4EFH A;  2UYT A;  2P9I A;  2WUS A;  2GWJ A;  3A5M C;  3VOV A;  2I7N A;  2FF3 B;  3LDL A;  4XH4 A;  4XH5 A;  3H1Q A;  4BR9 A;  3VEO A;  4BRD A;  3KHY A;  1DEJ A;  5ELZ A;  4CZL A;  2A3Z A;  1NGC A;  3CJ9 A;  1NWK A;  3GOI A;  5AZJ B;  4CD1 A;  3O1W A;  4BC3 A;  5AQJ A;  1XQS C;  2QW9 A;  1QZ5 A;  1TUY A;  4BRM A;  4C23 A;  1LOT B;  3CJC A;  3DXM A;  4BRL A;  3R8E A;  3H1V X;  5AQO A;  1YVN A;  3FE1 A;  4IWV A;  3C7N A;  5EOY A;  4BR2 A;  4BC5 A;  3U8X A;  3MN9 A;  5AQV A;  5EVZ A;  1KAX A;  3D7E O;  3WUH A;  5AQL A;  3SJH A;  3ZX0 A;  3WQU A;  3ATU A;  1BDG A;  3A8Y A;  3HZ6 A;  4O5F A;  3MK6 A;  5F2R A;  2AP1 A;  3JS6 A;  3W3D A;  4DB3 A;  4EIA A;  3H6E A;  3QFP A;  4FWR A;  1HKB A;  3CER A;  3FZL A;  4FPB A;  4NB4 A;  5KQ8 A;  1YUW A;  3CJA A;  3FFK B;  4BC2 A;  2V7Y A;  3WT0 A;  3LM2 A;  3R6M A;  2QWN A;  1ATN A;  2E88 A;  2QM1 A;  3CQX A;  3M3Z A;  4K41 A;  2D0P A;  3VF2 A;  2P9S B;  2P9P A;  3CET A;  2FXU A;  2GEL A;  4MLH A;  4B1V A;  1Q18 A;  3O6W A;  2QXL A;  4BRO A;  3I33 A;  4CZH A;  4H5R A;  3A5O C;  3QML A;  1GLB G;  3QBW A;  1K8K B;  3P4I A;  5AZJ A;  2V51 B;  3UKR B;  4BRQ A;  3QFU A;  5AQH A;  1V4T A;  2E2O A;  4CZJ A;  3DWL A;  2YHX A;  1QQN A;  2CH5 A;  5I9E B;  2Q36 A;  2P9U A;  3EZW A;  3MMV A;  5AQZ A;  3I8B A;  1QQO A;  3LDN A;  3MDQ A;  1NGG A;  4BRA A;  1TYQ B;  4RTF D;  1YXQ A;  4EHT A;  3QIC A;  2ZWH A;  2P9L B;  2VYP A;  1WOQ A;  5AFU H;  4BQL A;  3VEY A;  2E8A A;  4PL7 A;  3HI0 A;  3WXJ A;  1GLJ O;  1HPM A;  3KVG A;  1BA1 A;  5BN9 A;  3QBX A;  1LCU A;  3FZF A;  5AQU A;  4DHY A;  4M7X A;  4WQ5 A;  2A5X A;  3QB0 A;  1QZ6 A;  5CE3 A;  5BRH A;  1GLD G;  3H46 O;  4HWI A;  3DXK B;  5AQR A;  4BVO A;  4BR0 A;  5LJV A;  2QWQ A;  1J6Z A;  3LDO A;  2BTF A;  2GUP A;  1HX1 A;  4E1J A;  2IIR A;  1XUP O;  2P9S A;  5AQT A;  2E2Q A;  2YHY A;  1NLV A;  2FSJ A;  2YHW A;  1U6Z A;  4H03 B;  4B1U B;  5JIC A;  3CI5 A;  4FWK A;  4WQ4 A;  1U2V B;  3ID8 A;  2GEM A;  4YDU A;  3IFR A;  2NRH A;  3EKS A;  3GDQ A;  4PKG A;  3W0L A;  4BQZ A;  4JN4 A;  1T6C A;  1WUA A;  2E20 A;  3OHR A;  1HKG A;  2Q1N A;  3MN5 A;  1XC3 A;  3RSE B;  4FPA A;  4A2A A;  5AZI B;  3H3N O;  5AQS A;  4Z94 A;  2FF6 A;  1C0F A;  4FOI A;  4BC4 A;  4CJ7 A;  1TYQ A;  4FWQ A;  2A42 A;  1NGF A;  1BWF O;  2E2N A;  4FL9 A;  4WQ5 C;  1JCF A;  2IVP A;  3ULE B;  1NGB A;  4EHU A;  1X9J A;  1GLA G;  3O08 A;  2BUP A;  4JHD B;  4BR4 A;  5BPN A;  4FWL A;  1V4S A;  3FLC O;  4JD2 B;  5FPN A;  3VF4 A;  5EX5 A;  3VF6 A;  3DJC A;  3ZX3 A;  2HF3 A;  2YJF A;  3DXK A;  4H5W A;  4EAH D;  2NLX A;  1SQK A;  4QS8 A;  1D4X A;  4FOE A;  1RFQ A;  4H5N A;  4WQ4 C;  2CGL A;  4CZI A;  3O1B A;  2W40 A;  1KAZ A;  2QWP A;  4YDU C;  4B9Q A;  3VER A;  3ENH A;  1HUX A;  4RCH A;  1HJO A;  2KHO A;  1MA9 B;  2Q0R A;  2P9K B;  2HF4 A;  2F9T A;  4WYB A;  1CZA N;  1NGI A;  3LL3 A;  2VCP A;  3DAW A;  3LDQ A;  4FSV A;  3VPZ A;  4XEI A;  3TPQ A;  2Q97 A;  4BRP A;  2I7P A;  1BG3 A;  4H0X B;  1E4G T;  1NGJ A;  1ATS A;  3WXL A;  5BRD A;  3EO3 A;  3RSE A;  5KPR A;  2PBD A;  4KBO A;  5AZI A;  3U9Z A;  3CJ7 A;  4JAX A;  3ATV A;  2IVO A;  1C0G A;  1IG8 A; 
#chains in the Genus database with same CATH topology
 4CZE A;  5FPE A;  4ELT A;  2Z1G A;  4CEE A;  3CJB A;  2NZT A;  3CG7 A;  4M3Y A;  1TV6 A;  2D4W A;  3EY1 A;  3VGM A;  2E1Y A;  1GOC A;  2O8F A;  2ZGZ A;  3VQ9 A;  1SKS A;  5M1P A;  4DCH A;  2ZJR L;  5KRT A;  3K59 A;  4I7F A;  2VGN A;  5AQQ A;  4EP5 A;  1EET A;  3CCU N;  3D2F B;  1ZBF A;  3VA3 A;  3ZT4 A;  5JS1 A;  3ZEU B;  3CXC M;  4DR7 K;  4KI4 A;  2J4R A;  2HMP A;  4W5Q A;  2KLA A;  3L3U A;  4DV5 K;  3IDH A;  3L6Q A;  1HMV A;  3VGL A;  4JKG A;  3C7N B;  4FWP A;  4JS4 A;  4CJT A;  4B1W B;  3MXI A;  4F3T A;  3SUO A;  3IMX A;  4RW8 A;  1MDU B;  2ASP A;  4J2A A;  3CM5 A;  2F8T A;  3KZB A;  3SYZ A;  3TAM A;  2O8E A;  3LP1 A;  3SJJ A;  3GL1 A;  3K5N A;  4DSL A;  3HPG A;  4DLG A;  5CR4 A;  2RHK A;  3JAM O;  3QNO A;  1OVQ A;  3VEX A;  1BGX T;  1KRP A;  3AGR A;  1NGA A;  5BPL A;  2A41 A;  1NBW A;  5EY4 A;  3PO5 A;  3V9W A;  3MN6 A;  1GLL O;  2HHT A;  4F8R A;  1DTQ A;  2Z1H A;  4CJP A;  4FK4 A;  3J7A P;  1VQ6 N;  4PWD A;  4JI7 K;  1FJG K;  5AQK A;  3S9H A;  2PYL A;  4JI1 K;  3SAG A;  3ZET A;  4DUY K;  5D3G A;  3EN9 A;  1G99 A;  4CF8 A;  1HRH A;  4DV4 K;  5C2D A;  3OYL A;  2G8H A;  3V9U A;  1EQY A;  3J8A A;  1SS6 A;  3BGR A;  4DTM A;  1Y64 A;  4CHN A;  1J9A A;  3SBT A;  4Z4I A;  4DLE A;  4BY9 C;  4DV2 K;  5SZT A;  3OYB A;  4IZ9 A;  4DSJ A;  2NRX A;  4JNE A;  1TL1 A;  1DLO A;  4IEI A;  4DR5 K;  3DYA A;  4N41 A;  2VG7 A;  4DR1 K;  3O3G A;  1C1C A;  4CEZ A;  4CJK A;  4J2B A;  5KTQ A;  4CEQ A;  3GG4 A;  2NUB A;  4ISE A;  4IEE A;  4U67 L;  1D5A A;  4O8U A;  1D9D A;  2ZGY A;  4M3X A;  3O9Q A;  3OBW A;  4J8F A;  4ZHR A;  4WFB L;  4CD3 A;  4BR7 A;  5SWM A;  1BHL A;  5M1Q A;  1LWE A;  3CIP A;  1BO5 O;  3L2W A;  4L3Q A;  3UE5 A;  1NK9 A;  2QTD A;  4H5T A;  2G8I A;  4KHP K;  3SAF A;  1WSG A;  3HVT A;  4CIE A;  4I9L A;  2FSN A;  5TKY A;  1TKZ A;  4K43 A;  4BRE A;  3DLL L;  3FZK A;  1RTH A;  3BUZ B;  1NK4 A;  3ZX2 A;  5KQD A;  1L3V A;  3A0I X;  4FJI A;  4DQP A;  5GAE P;  4DQ8 A;  3EKU A;  4BG8 A;  4M7Y A;  3HTV A;  1N33 K;  4F4K A;  2D1K A;  2UUB K;  3O4Q A;  1VQ4 N;  4NXN K;  3NE6 A;  3CCS N;  3TAN A;  2V7Z A;  4DR6 K;  1BA0 A;  4AM6 A;  1YJW N;  1EP4 A;  2XY6 A;  3VQ7 A;  4OKK A;  4CHZ A;  3ENB A;  3PV8 A;  1BU6 O;  3H3O B;  5BPM A;  2FLO A;  4JI0 K;  3KJV A;  3L3V A;  1IKX A;  1Y97 A;  5AR0 A;  3WXI A;  3NH1 A;  4LFA K;  3CC2 N;  1SZ2 A;  4GVE A;  4A62 A;  5C0Y A;  3AAQ A;  3O9U A;  3TU5 A;  3IS9 A;  4RW7 A;  3U3G A;  3ENO A;  5AQN A;  3AO2 A;  3FR0 A;  4H5V A;  3DOK A;  4RW9 A;  4DQQ A;  3U4L A;  4QCL A;  2ASM A;  1DT9 A;  5HBM A;  3QEI A;  4FWS A;  1RTJ A;  2HHS A;  1Q81 O;  5JLH A;  4CHO A;  1ILY A;  4CJQ A;  2D0A A;  4CCH A;  3FFI A;  4CJE A;  3G71 N;  2OYQ A;  3VOV A;  1BIU A;  3LDL A;  1SL1 A;  3TAG A;  4BRD A;  4CZL A;  5C42 A;  1NGC A;  5AZJ B;  2NNW A;  4FJ8 A;  4BC3 A;  4C23 A;  1U49 A;  3WNE A;  5JVH L;  3TAE A;  5E41 A;  4LD0 A;  2D5R A;  5DMR A;  5M1K A;  3ZSY A;  3G0Z A;  3FE1 A;  3CM6 A;  3DLH A;  1RBU A;  3V1Q A;  4DQR A;  1S9G A;  2GV9 A;  4E7K A;  5J2M A;  3U8X A;  2ETJ A;  3THV A;  2GUI A;  4DV3 K;  5EVZ A;  3WNG A;  3NF8 A;  4NLB A;  3S3O A;  1EWR A;  3VMF B;  2HND A;  1RT5 A;  3WNH A;  4GV9 A;  2OCE A;  3A8Y A;  1HNW K;  3MXJ A;  4FZZ A;  4BAC A;  4EIA A;  3H6E A;  3QEX A;  2X78 A;  3SPY A;  4CES A;  1HKB A;  3CER A;  1YUW A;  2X74 A;  1RTI A;  2V7Y A;  4DU4 A;  1ATN A;  2E88 A;  4C8M A;  5FRM A;  5KRS A;  2QM1 A;  1QVG M;  3AVF A;  4K41 A;  4CJ4 A;  3BZK A;  3CET A;  1IO2 A;  2FXU A;  3E9L A;  2GEL A;  5HP1 A;  4B1V A;  3CFP A;  3O6W A;  1T7P A;  2QXL A;  2YNI A;  3M5R A;  4CZH A;  4FJH A;  3A5O C;  3QML A;  5H1S Q;  1S1W A;  1QVF M;  2HHV A;  4QOZ B;  2YV0 X;  4GW6 A;  4B9M A;  2YHX A;  1KVB A;  1QQN A;  3TTF A;  2Q36 A;  3AO1 A;  3P39 A;  3QIO A;  4G9Z A;  4G1Q A;  1JXB A;  3T7Z A;  2GX9 A;  3OBY A;  1K8A O;  3KK7 A;  3K0S A;  3U6F A;  4IKF A;  4AIL C;  4BRA A;  3KIO A;  1REV A;  1YXQ A;  3QIC A;  2XRI A;  1WOQ A;  5AFU H;  3VEY A;  2E8A A;  4PL7 A;  3HI0 A;  4JKF A;  2HHU A;  2WFB A;  1LAV A;  3KVG A;  4YOV A;  5BN9 A;  4DHY A;  3KK2 A;  4WE1 A;  4A57 A;  3QB0 A;  3B6O A;  1GLD G;  3THY A;  1KQS M;  3LZJ A;  3QLH A;  4HTU A;  2O8C B;  3SQ0 A;  1A5X A;  2E6L A;  1HX1 A;  5I42 A;  4YOW A;  2QKB A;  1T8E A;  4M3W A;  1C0T A;  2DFH A;  4CK2 A;  4JI6 K;  4KRE A;  2YNF A;  4H03 B;  4Q0B A;  3ISN C;  1L5U A;  4WFA L;  4E7H A;  4OKJ A;  5JIC A;  3CI5 A;  4O0I A;  3AVB A;  3ID8 A;  2UUC K;  4FJ9 A;  4BQZ A;  3EKS A;  3ALY A;  3GDQ A;  3B6P A;  3W0L A;  4YOY A;  1T6C A;  2E20 A;  4CHQ A;  5IT9 O;  3AVG A;  3N4P A;  3HK2 A;  5AQS A;  2FF6 A;  3K57 A;  4WCE L;  1C0F A;  4FOI A;  3T1Y K;  2HBM A;  4DTN A;  2UUA K;  2IDO A;  1O13 A;  1BWF O;  3QEV A;  4FZY A;  1YJN N;  4Q5V A;  2IVP A;  4M3T A;  3RMB A;  1Q7Y O;  5JS2 A;  2YNH A;  4DTR A;  2FBX A;  4Z4C A;  3TSU A;  3O08 A;  4JI3 K;  4HCC A;  1OH6 A;  3FLC O;  4YY3 K;  2WC9 A;  4F2S A;  1S1V A;  2NRR A;  3DJC A;  3OTO K;  1VQN N;  3DXK A;  4H5W A;  3Q7C A;  3SUQ A;  1ASV A;  1HYZ A;  1E3M A;  3V1R A;  3THX B;  3PX0 A;  1RFQ A;  3O1B A;  1XHX A;  1KAZ A;  1ZBH A;  4ZTF A;  1JKH A;  4KFB A;  4FJM A;  1HJO A;  3PUF A;  3D6R A;  2KZM A;  3PO4 A;  3DAW A;  3VPZ A;  3HST B;  4KPY A;  3E9P A;  4H0X B;  1SL2 A;  1NGJ A;  1F21 A;  2G8W A;  4H4O A;  5BRD A;  4FLZ A;  3DRS A;  1TK0 A;  3CJ7 A;  1WSH A;  4B3S K;  1KFD A;  1IBK K;  4JKC A;  1R0A A;  2IVO A;  5AFU A;  1N8R O;  3K58 A;  4BE1 A;  3I8D A;  2GTD A;  4A5B A;  1BUP A;  4DFM A;  1QHT A;  5JLF A;  4CEF A;  3J7Y P;  2PZS A;  3UB5 A;  4GV3 A;  1SUQ A;  4J2D A;  4FK2 A;  2EX3 A;  4JHD A;  3ZSQ A;  4RWT A;  4MO5 A;  4AHU A;  4CGG A;  4ELV A;  4K8X A;  5T7B A;  2Q31 A;  1KXP A;  2PAV A;  4JD2 A;  1VSL A;  4Z4E A;  3HSC A;  5C10 A;  5E26 A;  3HVR A;  1BIS A;  3C6A A;  3K9J A;  4CJ3 A;  1XMO K;  1NMD A;  3SMP A;  4YOX A;  2P9N B;  4JKD A;  4I2P A;  4M3U A;  4LF9 K;  3IUC A;  1RBT A;  5FRO A;  3NMU A;  4I2Q A;  4JKA A;  3NGZ A;  3G6E N;  1WSF A;  3T69 A;  2O8B A;  4OPA A;  2FSK A;  1RIL A;  3NHG A;  3QO9 A;  5BRE A;  4LC9 B;  4X62 K;  3M8R A;  4DTJ A;  3B8A X;  3AY9 A;  4KV8 A;  4CJF A;  2P9K A;  1ZYQ A;  4IDK A;  3TTD A;  5KPZ A;  1TKT A;  1T03 A;  5AJ3 K;  3QES A;  3SCX A;  2Q0U A;  1R59 O;  3UKR A;  1U48 A;  1XNQ K;  1VSJ A;  3MWT A;  3VET A;  3K5M A;  2KFN A;  2VG5 A;  2W41 A;  1FKP A;  3DRR A;  2XO7 A;  3HM8 A;  3GBT A;  4BWJ A;  1RT7 A;  3FGU A;  4CEO A;  4KTQ A;  4E3S A;  4GNI A;  3IAY A;  1YT3 A;  4RW6 A;  3PY8 A;  1GLE G;  1QTM A;  3KKS A;  4I6M B;  1RT2 A;  4MQ3 A;  5AQG A;  2HVI A;  5M1O A;  3M1F A;  4CGH A;  3LDP A;  5HRP A;  3ZSZ A;  4C8K A;  1WAJ A;  1OKJ A;  5CHI A;  1HPZ A;  4FJK A;  4H0O A;  4CZK A;  2GBZ A;  3C6U A;  4H8K A;  1GLC G;  3JSM A;  4CI6 A;  4FJN A;  1BCM A;  4A2B A;  1YJ9 N;  3GE1 A;  4IXC A;  3MX2 A;  4CJL A;  1GOA A;  4H0V B;  3UIQ A;  1RBR A;  2X6N A;  3NFA A;  4CEC A;  3THW B;  3HOT A;  1SAZ A;  3CF5 L;  2IVN A;  2ZF5 O;  5LY3 A;  1ASU A;  2UXB K;  3DOL A;  4DR2 K;  1YAG A;  1NNE A;  2OZS A;  3TTC A;  1HLU A;  4ISG A;  4JI8 K;  4CF1 A;  1K73 O;  2ASO A;  4C8N A;  3H45 C;  1SL0 A;  1TKX A;  3D2E B;  3S3M A;  2VWB A;  4IOX A;  4OLA A;  1B92 A;  1VQL N;  3CCJ N;  1RDB A;  3NBP A;  4Y1C A;  1JCG A;  4MLE A;  1MU2 A;  2WON A;  1NJI O;  4FVU A;  1DTT A;  3BF3 A;  4ICL A;  5AQM A;  1S1U A;  3K5L A;  1DGK N;  3LAL A;  3WXK A;  3LZI A;  3VTI A;  5LJW A;  4CHY A;  2JGU A;  1K6Y A;  5C25 A;  3M8Q A;  4JRP A;  3HOS A;  4E7I A;  4BRH A;  4DR4 K;  3C95 A;  3QER A;  4DSK A;  4U7B A;  4IJA A;  3VQP A;  1MWK A;  1C1B A;  4FLT A;  4KKO A;  4FYD A;  4RW4 A;  4PHT X;  3C94 A;  4FJ5 A;  1G15 A;  3O9S A;  3VQE A;  3VEW A;  1NG9 A;  3QDK A;  3KWG A;  3WEE A;  3C65 A;  1ZXO A;  1M1K O;  5B8H A;  4WFN L;  3VEN A;  1J5O A;  4BDZ A;  3EL2 A;  4LF4 K;  4AHR A;  3L2V A;  2ITG A;  3AVC A;  4CGI A;  3FZM A;  3G25 A;  3AVA A;  3RRH A;  3SNN A;  4CJS A;  4B1Y B;  4IJN A;  3AGK A;  5BRF A;  2ZJQ L;  1X3N A;  2R7Y A;  1A5V A;  4PKI A;  3AAR A;  4LF6 K;  3E1Y A;  3G4S N;  1T6D A;  1VQK N;  2F9W A;  2D0B A;  4K42 A;  3UKU A;  3S41 A;  1VSE A;  4DV0 K;  3VQB A;  2CGJ A;  2HB5 A;  4IO8 A;  3ZSV A;  2Q3S A;  1I39 A;  4Z4H A;  1QHA A;  3TSQ A;  4B8C A;  4ISF A;  3VA0 A;  4A59 A;  3VEZ A;  5DM7 L;  1BI4 A;  4OLB A;  3LPT A;  1T3V A;  4PA1 A;  1X9M A;  4BE0 A;  1GOB A;  4BRC A;  3Q7B A;  4BWM A;  2OAN A;  3PX4 A;  2UYT A;  4DSE A;  5CY4 A;  4BE2 A;  2P9I A;  3A5M C;  2I7N A;  3VQ8 A;  3NGI A;  4K0K K;  1JLB A;  1KVC A;  4CJU A;  4C8O A;  2AJQ A;  4BR9 A;  3VEO A;  4FM1 A;  3KHY A;  2A3Z A;  4CD1 A;  1HYV A;  1NWK A;  4N76 A;  2I5J A;  1VRT A;  3ID6 A;  5AQJ A;  1XQS C;  4OO1 J;  4BRM A;  1U4B A;  4FVM A;  3DXM A;  3AVH A;  4BRL A;  4YNQ A;  3TWH A;  1IH7 A;  5AQO A;  5EOY A;  1WSE A;  4B3R K;  4BC5 A;  3SZ2 A;  3RMA A;  3MN9 A;  5AQV A;  3WUH A;  4KI6 A;  2VQF K;  2BE2 A;  1BDG A;  1EO1 A;  2IOC A;  5FDL A;  3WXM B;  2AP1 A;  3JS6 A;  5TKW A;  2UU9 K;  4OPJ A;  4OPK A;  1VHX A;  4FWR A;  4LSN A;  5KQ8 A;  1UAX A;  1D9F A;  4DS5 A;  1I3A A;  3R6M A;  1RTD A;  4O55 A;  1CLQ A;  3CQX A;  4W5N A;  3PX6 A;  2HBJ A;  3C6H A;  2P9P A;  4IO9 L;  5JVG L;  2KKZ A;  3I0R A;  1Q18 A;  4FW2 A;  4BRO A;  3KLE A;  3DLR A;  3G10 A;  1GLB G;  3QBW A;  3V9Z A;  3P4I A;  2V51 B;  3UKR B;  4F2R A;  5AQH A;  2WBN A;  5J2N A;  3DWL A;  4DF4 A;  1U45 A;  1HNI A;  3LP2 A;  1VQM N;  1FKO A;  1ASW A;  2P9U A;  3MMV A;  2LSN A;  1RDU A;  2QK9 A;  4CER A;  2OTJ N;  3DLG A;  3I8B A;  1Q8I A;  2NRT A;  4RTF D;  3IRX A;  4EHT A;  2G8F A;  3NDK A;  4DR3 K;  3SPZ A;  2VYP A;  3CCL N;  1WSJ A;  4BQL A;  3ZLJ A;  1EKE A;  5BR8 K;  3WXJ A;  1BA1 A;  4M7X A;  3K5O A;  4JI4 K;  1QZ6 A;  5LMN K;  2PYJ A;  5CE3 A;  4DF8 A;  3CD6 N;  3KLH A;  3H46 O;  5AQR A;  1RBS A;  2QWQ A;  1J6Z A;  4YOT A;  2OA8 A;  3SV3 A;  1NMN A;  1X9S A;  1JLC A;  3KLI A;  4KTZ A;  2FBV A;  4HUE A;  1XUP O;  3TAP A;  2P9S A;  2W6K A;  2YHY A;  1NLV A;  4K8Z A;  2FBT A;  5FLX O;  3PSI A;  3NH0 A;  4NCB A;  2VWK A;  1B9D A;  4YDU A;  3NVM A;  4CFC A;  4PKG A;  4JV5 K;  3IKM A;  3SV4 A;  1WUA A;  1NJX A;  4LH5 A;  1JL1 A;  2Z1J A;  1UOC A;  3E9O A;  4DU3 A;  3MXM A;  4FPA A;  5J2P A;  3V9S A;  1RCH A;  3H3N O;  4Z94 A;  4IDH A;  2HHW A;  2O8D A;  1TYQ A;  5CYQ A;  4FWQ A;  2IGI A;  3BZC A;  1WAF A;  4DV6 K;  3I56 N;  1GLA G;  1KLM A;  2B6A A;  5C2F A;  2BUP A;  4C1N K;  5C15 A;  5BPN A;  1C6V A;  4EZ6 A;  4OGC A;  2O8F B;  3VF4 A;  5KI6 A;  3HP9 A;  4A5A A;  1JLQ A;  3O9T A;  1VQP N;  3VF6 A;  1NOZ A;  3O9R A;  4IBN A;  1SQK A;  2HNZ A;  3CFO A;  2E6M A;  3OYJ A;  3U3Y A;  1NK8 A;  1UA1 A;  1FW6 A;  1RDA A;  2CGL A;  4CZI A;  3QIN A;  2W40 A;  4YDU C;  3KTQ A;  4JKG B;  4JEP A;  4CFB A;  1EXQ A;  3EYZ A;  4WYB A;  1YF5 L;  2RE2 A;  4FSV A;  4RG8 A;  1RDC A;  2O8E B;  1X1P A;  5HLF A;  3V4I A;  1E4G T;  1ATS A;  2YKM A;  4O44 A;  3LWM A;  3RSE A;  4GKJ K;  1UWB A;  4KBO A;  5AZI A;  3U9Z A;  5C24 A;  1RT3 A;  3SK3 A;  1RBV A;  3OYG A;  1I94 K;  1BI4 B;  2HOE A;  3HO1 A;  5AQF A;  2QI2 A;  3ULE A;  3L8B A;  1KAY A;  3F9K A;  4N47 A;  5GAD P;  4HUG A;  3F2K A;  1S72 N;  4NCA A;  4KB1 A;  4FLU A;  4CZG A;  1S1T A;  4CGF A;  3ZYY X;  4FXD A;  1HQU A;  3KK3 A;  4CIF A;  3ZET B;  3T1H K;  1RT1 A;  2Q2R A;  3ITH A;  2E1Z A;  2YI1 A;  1KFS A;  4QS9 A;  4I9Q A;  4TSX A;  5AQW A;  4KAZ A;  5AQI A;  3H08 A;  2BH1 A;  5F1X A;  3L4I A;  3SLC A;  4ID1 A;  3CME N;  3DXM B;  4BG9 A;  1MWM A;  3QIP A;  2B4J A;  4CZF A;  2JLE A;  2VGM A;  4Z0U A;  3AVK A;  4BRF A;  1TK5 A;  4CF0 A;  4PQU A;  4DWI A;  2QWM A;  3A5N C;  3JXU A;  2YJE A;  1L3T A;  2KQ2 A;  3CFR A;  4EP4 A;  4PUO A;  5EXW A;  4FWM A;  3OYH A;  1K8K A;  5BR9 A;  2HST A;  3CCQ N;  1Z25 A;  5MLC Q;  4HTL A;  3PIP L;  3RWU A;  3P31 A;  1HQE A;  4YHH K;  3SBG A;  4FJX A;  2YCH A;  3O4W A;  4L8R B;  4B1X B;  1YVU A;  3NF9 A;  3SQ2 A;  4CFD A;  1RDD A;  3O80 A;  2QKK A;  1IG9 A;  2CH6 A;  3E01 A;  4M42 A;  1YTA A;  2QWO A;  3ZSW A;  3ZSX A;  1IBM K;  2P9P B;  3OW2 M;  1T05 A;  4KHW A;  3N4Q A;  2P9L A;  4FO0 A;  4FWO A;  1QQC A;  4B1Z A;  3OYA A;  3HM9 A;  1ZC6 A;  3VGK A;  1J53 A;  1ESV A;  2V52 B;  4B9T A;  2XY5 A;  3J7Z O;  3D2F A;  2A40 A;  3KKR A;  2RN2 A;  2YHB A;  4WF9 L;  4NXM K;  3ZEU A;  4HHT A;  2OPS A;  2EWS A;  1N34 K;  2W6L A;  4OGE A;  1NKC A;  2P9U B;  1Z05 A;  1HNZ K;  3M6G A;  3DM2 A;  4CZM A;  2ZJP L;  1X3M A;  4CFA A;  3VQD A;  3HPO A;  2UXD K;  2YNG A;  2IAJ A;  4Y1D A;  2O4G A;  4FCY A;  4BRI A;  3RR7 A;  4DKW A;  1E4F T;  2A6A A;  2HHQ A;  3TR8 A;  4A61 A;  3KWI A;  4FM2 A;  4UQG A;  2F8S A;  3ZSO A;  4E7L A;  1L3U A;  4F9O A;  2OPR A;  3M8P A;  2W42 A;  3OVN A;  3CCV N;  4FM0 A;  3KD5 E;  4DTU A;  1QQM A;  1C0U A;  5J1E A;  4FLV A;  3CPE A;  2BAN A;  3MAQ A;  1SKW A;  2P5O A;  1XMQ K;  1EWQ A;  1VSH A;  3MCP A;  3HBT A;  1VQ9 N;  4BGB A;  4CF2 A;  3VN5 A;  5FPM A;  4H0Y B;  5AQP A;  2E2P A;  4QS7 A;  2RPI A;  1S3X A;  5HRN A;  5AQY A;  2PFU A;  3MX5 A;  4KTW A;  1TKD A;  2Y1J A;  4GMJ B;  3O5B A;  4GY2 B;  1LW2 A;  4KHN A;  2QA4 N;  3PIO L;  5KGX A;  3ZT3 A;  3RMC A;  4DTS A;  1ATR A;  1KTQ A;  3F5T A;  3CCE N;  4AQY K;  4BRN A;  2KFZ A;  3LWL A;  2F4V K;  4DG1 A;  1Z6R A;  4NLC A;  1NGD A;  3HRG A;  3OYN A;  2F7T A;  3AO5 A;  1H1V A;  2YKN A;  3ZT2 A;  3CJ1 A;  3C0B A;  3K9K A;  3AVL A;  4BGA A;  1OH7 A;  2XY8 A;  4MDA A;  5KPT A;  2IS3 A;  2D0O A;  3CHW A;  4MFB A;  4E89 A;  1N6Q A;  1WBD A;  1WN7 A;  2NRZ A;  1RNH A;  3L0Q A;  4KHQ A;  3LDS A;  1C1A A;  2VG6 A;  1S22 A;  1NM1 A;  1VQ5 N;  4QAG A;  4H0T B;  1K9M O;  4EFH A;  3SQ4 A;  1J54 A;  2ATQ A;  3J80 O;  1KLN A;  5EU7 A;  3AVM A;  2WUS A;  1HYS A;  3T3F A;  3HYF A;  4ILJ A;  4XH5 A;  3H1Q A;  1DEJ A;  5ELZ A;  3CJ9 A;  3GOI A;  4X64 K;  4E1N A;  1S1X A;  3CJC A;  4JYA K;  3R8E A;  3H1V X;  1W97 L;  1YIT N;  4FK0 A;  1ZBI A;  3PLA A;  4R79 A;  2F96 A;  2G8U A;  1QS4 A;  2OPQ A;  3KLG A;  2NRV A;  3D7E O;  5GAG P;  3PSF A;  4DU1 A;  5FRN A;  4YOR A;  3CQ8 A;  4KH4 A;  3SJH A;  3WQU A;  4DTX A;  3ATU A;  4O5F A;  3MK6 A;  4MDB A;  2ZE2 A;  5F2R A;  4JKB A;  4IOC L;  4DB3 A;  3QFP A;  2ZD1 A;  3THY B;  3FZL A;  4FPB A;  4NB4 A;  1OH8 A;  3CJA A;  3FFK B;  4BC2 A;  4Z4F A;  1TVR A;  4NYN A;  4FJG A;  4HCB A;  1Q9X A;  4MLH A;  1NOY A;  4B9U A;  1JJ2 M;  4H5R A;  1VSI A;  1K8K B;  3HT3 A;  1VAZ A;  2Z1I A;  5AZJ A;  3K2P A;  1VSF A;  3QFU A;  4CK3 A;  4E19 A;  1LV5 A;  2E2O A;  5I9E B;  2D0C A;  2CH5 A;  2XY7 A;  4ZTJ A;  1VSK A;  3NCI A;  3BY5 A;  3EZW A;  2EHG A;  3VQQ A;  1HJR A;  5I3U A;  1RT4 A;  3L4Q A;  1S6Q A;  1W7A A;  1QQO A;  3LDN A;  4F3O A;  3VQ4 A;  2P9L B;  3OS2 A;  1M90 O;  4E1M A;  1GLJ O;  1HPM A;  4X65 K;  3FZF A;  1TAU A;  2E5L K;  4WQ5 A;  1D8Y A;  1WB9 A;  4IG0 A;  4ILG B;  4LY7 A;  1S9E A;  4HWI A;  3DXK B;  4BVO A;  4X66 K;  3P83 D;  1NK0 A;  1B9F A;  3LDO A;  2BTF A;  4JKE A;  2GUP A;  1BQM A;  1KVA A;  5AQT A;  4JK8 A;  3ZT1 A;  1NKB A;  2QXF A;  2YHW A;  1JLA A;  3ZSR A;  2RKI A;  4B1U B;  3AVN A;  4M45 A;  1VSM A;  1SKR A;  4IFV A;  2O4I A;  2P1J A;  3IFR A;  2NRH A;  4JN4 A;  4DMN A;  1HKG A;  2Q1N A;  1XC9 A;  1JLE A;  1ZBU A;  3DLK A;  4AHV A;  3SAH A;  4BC4 A;  4CJ7 A;  1YIJ N;  4O5B A;  3DMJ A;  2A42 A;  4ELU A;  2E2N A;  4FL9 A;  4WQ5 C;  2OTL N;  1JCF A;  1NGB A;  4W5O A;  1CXU A;  1X9J A;  3O3H A;  2HNY A;  3AA4 A;  3NVK A;  4JHD B;  4BR4 A;  4GKK K;  1V4S A;  4JD2 B;  3R3L A;  3CC4 N;  5EX5 A;  5LL6 Z;  2Y1I A;  3ZX3 A;  3CMA N;  2HF3 A;  2YJF A;  3QNN A;  4B3T K;  3OYE A;  1IKW A;  2O8C A;  2DFE A;  4FOE A;  3AO4 A;  2O8B B;  4LF7 K;  4CJV A;  3DI6 A;  1YTU A;  3HJF A;  4JI5 K;  3VER A;  1HUX A;  5GIP A;  2X6S A;  1MA9 B;  4CGD A;  3SUN A;  3LP3 A;  4B3M K;  3V6D A;  2P9K B;  2F9T A;  2KW4 A;  3LL3 A;  2VCP A;  3LDQ A;  4YOU A;  4OPH A;  3CC7 N;  3TPQ A;  3O4N A;  2Q97 A;  4BRP A;  1BG3 A;  4B3O A;  3WXL A;  1NK5 A;  1N36 K;  3EO3 A;  5KPR A;  4FJL A;  3TAF A;  4M41 A;  1C0G A;  3EZ5 A;  4K25 A;  3MWP A;  1TAQ A;  2PY5 A;  1YHQ N;  1NGE A;  2RF2 A;  3I55 N;  1TK8 A;  1KD1 O;  3OYK A;  3R1X A;  1QSS A;  3BF1 A;  1NK6 A;  2OZM A;  2ZM6 K;  4DV7 K;  4IG3 A;  3EE9 A;  1Q82 O;  1RDW X;  1NJZ A;  1T44 A;  2WOM A;  4NYF A;  3THX A;  4DTO A;  4H0P A;  1VK0 A;  5IWA K;  1HKC A;  4FW1 A;  1GLF O;  4CEA A;  3F9M A;  4BRG A;  1ZBS A;  1CZB A;  1HNX K;  3WQT A;  1NGH A;  1NK7 A;  3NH2 A;  4O0J A;  3OS0 A;  3T1A A;  1LAW A;  3AAP A;  3TAR A;  2YX6 A;  3MEE A;  1JLG A;  3JYT A;  4AHT A;  3HP6 A;  2GWK A;  3A5L C;  1HR0 K;  5ADX H;  4JRQ A;  3C6T A;  1NU0 A;  4CW7 B;  1Q9Y A;  3LAN A;  2OPP A;  3CCM N;  1EX4 A;  2DTU A;  3J81 O;  5AQX A;  4NO7 A;  2FC0 A;  3A2F A;  4LH4 A;  4EZ9 A;  3LP0 A;  2NRW A;  3CYM A;  1VQ7 N;  1LWF A;  4CK1 A;  2E4L A;  4DQS A;  2A1S A;  3AA3 A;  3IG1 A;  1KSP A;  3KLF A;  3AA2 A;  1LW0 A;  4H4M A;  3VQC A;  3VQ5 A;  2QWL A;  1IKV A;  3OYD A;  2P9N A;  5JMV A;  1JLF A;  4CBX A;  4B9V A;  2B5J A;  5BN8 A;  2CGK A;  3TSP A;  3WEE B;  3QEP A;  4R5P A;  4E0D A;  1TUU A;  1ZBL A;  3R9P A;  3V9X A;  2HBL A;  3EEQ A;  2VQE K;  4DV1 K;  5KGW A;  4PL8 A;  4BVP A;  3U9D A;  1BOT O;  4KB0 A;  4V19 S;  3OYC A;  3FZH A;  2P5G A;  2HHX A;  4LF5 K;  2P51 A;  1W9H A;  3V81 A;  3RTV A;  5E84 A;  2G8K A;  2DPN A;  1BQN A;  4HUF A;  1U2V A;  3VTH A;  3OYI A;  1HNV A;  1IKY A;  5DK5 A;  5GIN A;  2G8V A;  4B9S A;  1OVY A;  2HW3 A;  3SI6 A;  3O8M A;  3VEV A;  1P8Z A;  3O3F A;  3UKU B;  4HVJ A;  1RGI A;  4MO4 A;  4AF1 A;  4XH1 A;  1U47 A;  4KHY A;  4UY8 O;  3CQY A;  5HRR A;  4BRK A;  4DUZ K;  4I6M A;  4DFK A;  1OH5 A;  3HL8 A;  5FPD A;  3LAM A;  4Y0W A;  4BDP A;  5HRO A;  3ULD A;  3EE8 A;  3DRP A;  3BEX A;  4CVN E;  5CZ1 A;  2P9I B;  1JXE A;  4JK9 A;  3SUP A;  4KH6 A;  4DS4 A;  1BCO A;  1XI1 A;  1C0M A;  5F0X A;  5HL7 L;  4BR5 A;  3S3N A;  4PY5 A;  3D0P A;  1UA0 A;  2DY4 A;  1DKG D;  5K14 A;  3THW A;  3RR8 A;  4CIG A;  1QE1 A;  3SMS A;  2BDP A;  4B8A B;  2AA4 A;  1BIZ A;  4JS5 A;  1IJJ A;  5ADX A;  4O8K A;  4LSL A;  4FZX C;  3AA5 X;  3BP8 A;  4AHC A;  3D2E A;  4ID5 A;  4CBW A;  4CHP A;  5GIO A;  3MN7 A;  4C1N I;  1XNR K;  3BDP A;  1VRU A;  3P1G A;  4DSF A;  1JCE A;  4FWN A;  3VES A;  4CF9 A;  1L3S A;  4CBU A;  4AM7 A;  2ITM A;  2H3G X;  3LM9 A;  1CXQ A;  4PKH A;  4M63 C;  3NGY A;  2QWR A;  1RT6 A;  1JL2 A;  4M3R A;  1BL3 A;  4AH9 A;  4JK7 A;  2GWJ A;  5CZ2 A;  4XIU A;  2FF3 B;  4XH4 A;  3HPH A;  5CYM A;  2BGG A;  1Q86 O;  4BDY A;  4CJ5 A;  3O1W A;  2IC3 A;  5J2Q A;  3VQA A;  2QW9 A;  1QZ5 A;  1TGO A;  1TUY A;  1KC8 O;  4CE9 A;  4JI2 K;  1LOT B;  5C12 A;  1NJW A;  1VSD A;  1QSL A;  1YVN A;  3DLE A;  4IWV A;  2KZZ A;  3MCA B;  1TL3 A;  3E66 A;  3TAB A;  3C7N A;  5M1N A;  3ZCM A;  4BR2 A;  2ZQB A;  1FK9 A;  3HXM A;  1KAX A;  3QET A;  1WLJ A;  1WNS A;  5AQL A;  3P38 A;  3ZX0 A;  1W0H A;  3T19 A;  3KK1 A;  2KTQ A;  4OKE A;  3HZ6 A;  3W3D A;  4N5S A;  3OS1 A;  4Z4G A;  5HRS A;  4FLX A;  4W5R A;  4B9N A;  4FJJ A;  3WT0 A;  3LM2 A;  4GV6 A;  2QWN A;  4OJR A;  3M3Z A;  3VF2 A;  2D0P A;  2P9S B;  3L2U A;  3I33 A;  2HBK A;  3OA9 A;  4KO0 A;  5LMU K;  5A2Q O;  5HOO A;  4CGJ A;  1QSY A;  2HVH A;  4BRQ A;  1S6P A;  3CPW M;  3SQ1 A;  4FLW A;  1V4T A;  3OY9 A;  4CZJ A;  3RRG A;  2A1R A;  3AVI A;  3VQ6 A;  2O8D B;  5AQZ A;  1ITG A;  4M3Z A;  3MDQ A;  1NGG A;  4NCG A;  1TYQ B;  3NAE A;  3M8S A;  1LWC A;  2ZWH A;  1FXX A;  1XWL A;  4C8L A;  1U04 A;  3QBX A;  3TAQ A;  1LCU A;  5AQU A;  3P5J A;  1W2B M;  1YI2 N;  4E7J A;  2A5X A;  2DFF A;  1S5J A;  5BRH A;  1SV5 A;  4YFU A;  1P90 A;  4B9L A;  4BR0 A;  5LJV A;  4CED A;  1VQ8 N;  4E1J A;  1NKE A;  2IIR A;  3OYM A;  3L2Q A;  2E2Q A;  2FSJ A;  4DFP A;  1U6Z A;  3MEC A;  1NJY A;  1CZ9 A;  1IBL K;  2QEX N;  3AO3 A;  4FWK A;  1N32 K;  4WQ4 A;  4DFJ A;  1U2V B;  2GEM A;  4CJR A;  3WNF A;  2UXC K;  2YHA A;  1WSI A;  4FJ7 A;  3OYF A;  4O4G A;  3TI0 A;  3OHR A;  3MN5 A;  4OVL A;  1X9W A;  1XC3 A;  2XHB A;  3RSE B;  3MEG A;  3LPU A;  4A2A A;  5AZI B;  5DM6 L;  1O1W A;  4GVM A;  1N5Y A;  1J5E K;  4KHU A;  1NGF A;  4JLH A;  4KRF A;  4DSI A;  3D45 A;  3ULE B;  4CJW A;  4EHU A;  4CEB A;  3AVJ A;  3OJU A;  3ZT0 A;  4LFC K;  4FWL A;  4KH5 A;  4FLY A;  4JKH A;  5FPN A;  4IFE A;  4DQI A;  3V1O A;  4N56 A;  4LF8 K;  2VWJ A;  4ILH A;  4EAH D;  2NLX A;  2JWL A;  4QS8 A;  4AHS A;  2WTU A;  1D4X A;  4IOA L;  3I0S A;  4H5N A;  4WQ4 C;  3KD1 E;  5M1F A;  2HMI A;  2QWP A;  4B9Q A;  1XHZ A;  2FBY A;  3RVC A;  3ENH A;  3F73 A;  4RCH A;  3ASM A;  3L2R A;  5GAH P;  2KHO A;  4B08 A;  1KCF A;  4IFY A;  4W5T A;  2Q0R A;  2HF4 A;  3MED A;  1CZA N;  4KHS A;  1NGI A;  1Z26 A;  4LFB K;  4XEI A;  2HHH K;  3NF6 A;  3OJS A;  4DTP A;  3DLB A;  2I7P A;  2JWK A;  3AV9 A;  3NF7 A;  4J2E A;  3LAK A;  2PBD A;  4OX9 K;  3RMD A;  1IV0 A;  1A5W A;  1VQO N;  4JAX A;  3QEW A;  3ATV A;  1WBB A;  3CCR N;  1IG8 A; 
#chains in the Genus database with same CATH homology
 3SK3 A;  5AFU A;  4K25 A;  4CZE A;  5FPE A;  1N8R O;  2GTD A;  4A5B A;  1BUP A;  3MWP A;  2HOE A;  3CJB A;  5AQF A;  2NZT A;  2QI2 A;  1NGE A;  1YHQ N;  3ULE A;  1KAY A;  5GAD P;  3F2K A;  5JLF A;  3I55 N;  1S72 N;  3UB5 A;  4CZG A;  4GV3 A;  2D4W A;  4JHD A;  4RWT A;  1KD1 O;  4MO5 A;  3ZYY X;  3R1X A;  3VGM A;  3BF1 A;  2E1Y A;  2Q31 A;  1KXP A;  2PAV A;  2ZGZ A;  4JD2 A;  3ZET B;  3HSC A;  5C10 A;  5E26 A;  2Q2R A;  5M1P A;  3C6A A;  2E1Z A;  2YI1 A;  3K9J A;  4DCH A;  2ZJR L;  4QS9 A;  1NMD A;  3SMP A;  3EE9 A;  2VGN A;  5AQQ A;  4YOX A;  1Q82 O;  2P9N B;  1RDW X;  4JKD A;  5AQW A;  3CCU N;  3D2F B;  1T44 A;  3IUC A;  5AQI A;  2BH1 A;  4DQ8 A;  3ZEU B;  5F1X A;  3CXC M;  3NMU A;  3L4I A;  4JKA A;  3SLC A;  3G6E N;  3CME N;  4H0P A;  3DXM B;  4BG9 A;  3T69 A;  1MWM A;  2J4R A;  4OPA A;  2HMP A;  1HKC A;  2FSK A;  2KLA A;  4CZF A;  1GLF O;  5BRE A;  3IDH A;  3F9M A;  4LC9 B;  4BRG A;  1ZBS A;  3L6Q A;  2VGM A;  1NGH A;  3VGL A;  3WQT A;  4JKG A;  4BRF A;  3C7N B;  4FWP A;  3B8A X;  3AY9 A;  2QWM A;  4B1W B;  3A5N C;  2P9K A;  3JXU A;  2YJE A;  3IMX A;  1MDU B;  3AAP A;  2ASP A;  3TTD A;  5EXW A;  4FWM A;  3KZB A;  2YX6 A;  5KPZ A;  1K8K A;  3GL1 A;  2GWK A;  5BR9 A;  2HST A;  3CCQ N;  2Q0U A;  3A5L C;  5MLC Q;  5ADX H;  1R59 O;  3UKR A;  4HTL A;  3PIP L;  3P31 A;  5CR4 A;  2RHK A;  3MWT A;  3SBG A;  3VET A;  2YCH A;  3O4W A;  2W41 A;  4B1X B;  3VEX A;  3AGR A;  3HM8 A;  3GBT A;  3O80 A;  3CCM N;  1NGA A;  5BPL A;  2A41 A;  3FGU A;  5AQX A;  1NBW A;  5EY4 A;  4NO7 A;  4GNI A;  2CH6 A;  3MN6 A;  1GLL O;  1GLE G;  2QWO A;  2P9P B;  4I6M B;  2NRW A;  5AQG A;  3OW2 M;  1VQ7 N;  1VQ6 N;  5M1O A;  3M1F A;  3N4Q A;  2P9L A;  4FO0 A;  5AQK A;  3LDP A;  4FWO A;  4B1Z A;  3SAG A;  3ZET A;  1ZC6 A;  3EN9 A;  1OKJ A;  1G99 A;  3VGK A;  5CHI A;  2QWL A;  1ESV A;  2P9N A;  2V52 B;  5JMV A;  5C2D A;  4H0O A;  4CZK A;  3J7Z O;  3D2F A;  2A40 A;  4CBX A;  4WF9 L;  3ZEU A;  1EQY A;  3J8A A;  1GLC G;  4CI6 A;  2EWS A;  2CGK A;  5BN8 A;  4A2B A;  1SS6 A;  3TSP A;  3WEE B;  1YJ9 N;  3GE1 A;  4IXC A;  2P9U B;  1Z05 A;  3MX2 A;  3M6G A;  1TUU A;  1Y64 A;  3R9P A;  2HBL A;  3SBT A;  4H0V B;  4CZM A;  4PL8 A;  4BY9 C;  4BVP A;  3U9D A;  1BOT O;  3HOT A;  1SAZ A;  4IZ9 A;  2IVN A;  3CF5 L;  2ZF5 O;  5LY3 A;  2NRX A;  2ZJP L;  4JNE A;  3FZH A;  1X3M A;  4IEI A;  1YAG A;  3TTC A;  1HLU A;  4ISG A;  5E84 A;  2DPN A;  1K73 O;  2ASO A;  1U2V A;  3H45 C;  3VTH A;  3GG4 A;  4BRI A;  5GIN A;  3D2E B;  4DKW A;  2VWB A;  4IOX A;  1E4F T;  4ISE A;  1OVY A;  2A6A A;  4IEE A;  4U67 L;  3CCJ N;  1VQL N;  1JCG A;  3KWI A;  3O8M A;  4A61 A;  4MLE A;  3VEV A;  1P8Z A;  4O8U A;  3UKU B;  1NJI O;  4FVU A;  1RGI A;  2ZGY A;  3O9Q A;  3OBW A;  3BF3 A;  4J8F A;  5AQM A;  4MO4 A;  4AF1 A;  4WFB L;  4XH1 A;  4CD3 A;  4BR7 A;  4F9O A;  1DGK N;  4UY8 O;  3CCV N;  5M1Q A;  3CIP A;  3CQY A;  3WXK A;  1BO5 O;  3VTI A;  5LJW A;  4L3Q A;  4BRK A;  1QQM A;  4I6M A;  3UE5 A;  2QTD A;  3HOS A;  4H5T A;  3CPE A;  5FPD A;  3SAF A;  4Y0W A;  4BRH A;  2FSN A;  5TKY A;  3EE8 A;  3BEX A;  4K43 A;  3MCP A;  3HBT A;  4BRE A;  4U7B A;  3DLL L;  3FZK A;  4IJA A;  1VQ9 N;  4BGB A;  2P9I B;  3BUZ B;  1MWK A;  3ZX2 A;  5FPM A;  5KQD A;  4JK9 A;  4H0Y B;  3A0I X;  5AQP A;  2E2P A;  4PHT X;  4QS7 A;  1S3X A;  5GAE P;  5AQY A;  2PFU A;  3EKU A;  3MX5 A;  3O9S A;  4M7Y A;  3VEW A;  3HTV A;  4KH6 A;  4BG8 A;  3QDK A;  3KWG A;  3WEE A;  3C65 A;  5F0X A;  3O5B A;  1ZXO A;  4GY2 B;  5HL7 L;  4BR5 A;  5B8H A;  4WFN L;  1M1K O;  2QA4 N;  3VEN A;  2D1K A;  3PIO L;  3EL2 A;  1VQ4 N;  1DKG D;  3SMS A;  3CCS N;  1ATR A;  2V7Z A;  3F5T A;  3FZM A;  3CCE N;  3G25 A;  4BRN A;  1BA0 A;  2AA4 A;  4AM6 A;  1YJW N;  1IJJ A;  1Z6R A;  4NLC A;  5ADX A;  4O8K A;  1NGD A;  4B1Y B;  3HRG A;  3ENB A;  3BP8 A;  4IJN A;  3AGK A;  1BU6 O;  2F7T A;  5BRF A;  3H3O B;  1X3N A;  1H1V A;  2FLO A;  4PKI A;  3AAR A;  5BPM A;  2ZJQ L;  3D2E A;  5AR0 A;  4CBW A;  3E1Y A;  3WXI A;  3MN7 A;  5GIO A;  4C1N I;  3G4S N;  3CC2 N;  1T6D A;  1SZ2 A;  4GVE A;  3CJ1 A;  2F9W A;  3C0B A;  3K9K A;  1VQK N;  4BGA A;  4K42 A;  4A62 A;  3UKU A;  3S41 A;  4MDA A;  3AAQ A;  5C0Y A;  1JCE A;  3O9U A;  4FWN A;  3TU5 A;  3VES A;  5KPT A;  2CGJ A;  2D0O A;  4IO8 A;  3CHW A;  3ENO A;  5AQN A;  3FR0 A;  1QHA A;  4CBU A;  4H5V A;  3TSQ A;  2NRZ A;  4ISF A;  4AM7 A;  3L0Q A;  3U4L A;  4A59 A;  3VEZ A;  2ITM A;  5DM7 L;  2ASM A;  2H3G X;  3LM9 A;  1S22 A;  1NM1 A;  1DT9 A;  1T3V A;  1VQ5 N;  4BRC A;  4H0T B;  3Q7B A;  4FWS A;  4M63 C;  4PKH A;  2QWR A;  1Q81 O;  2OAN A;  5JLH A;  1K9M O;  4EFH A;  2UYT A;  1ILY A;  2P9I A;  3G71 N;  4JK7 A;  2WUS A;  2GWJ A;  3A5M C;  3VOV A;  2I7N A;  2FF3 B;  4ILJ A;  3LDL A;  4XH4 A;  4XH5 A;  3H1Q A;  4BR9 A;  3VEO A;  4BRD A;  3KHY A;  1DEJ A;  5ELZ A;  4CZL A;  1Q86 O;  2A3Z A;  1NGC A;  3CJ9 A;  1NWK A;  3GOI A;  2NNW A;  5AZJ B;  4CD1 A;  3O1W A;  3ID6 A;  4BC3 A;  5AQJ A;  1XQS C;  2QW9 A;  1QZ5 A;  4OO1 J;  1TUY A;  4BRM A;  4C23 A;  1KC8 O;  5JVH L;  1LOT B;  3CJC A;  3DXM A;  4BRL A;  5C12 A;  3R8E A;  5M1K A;  3H1V X;  1W97 L;  5AQO A;  1YIT N;  1YVN A;  3FE1 A;  4IWV A;  3PLA A;  3MCA B;  4R79 A;  3E66 A;  3C7N A;  5M1N A;  5EOY A;  4BR2 A;  4BC5 A;  3U8X A;  3MN9 A;  2NRV A;  5AQV A;  5EVZ A;  1KAX A;  3D7E O;  3WUH A;  5GAG P;  4NLB A;  4YOR A;  5AQL A;  3P38 A;  4KH4 A;  3SJH A;  3ZX0 A;  3VMF B;  3WQU A;  3ATU A;  1BDG A;  4GV9 A;  1EO1 A;  3A8Y A;  3HZ6 A;  4O5F A;  3MK6 A;  4MDB A;  5F2R A;  3WXM B;  2AP1 A;  3JS6 A;  4JKB A;  5TKW A;  3W3D A;  4IOC L;  4DB3 A;  4EIA A;  3H6E A;  3QFP A;  4FWR A;  1HKB A;  3CER A;  3FZL A;  4FPB A;  4NB4 A;  5KQ8 A;  1YUW A;  3CJA A;  3FFK B;  4BC2 A;  2V7Y A;  3WT0 A;  3LM2 A;  4GV6 A;  3R6M A;  2QWN A;  1ATN A;  2E88 A;  2QM1 A;  1QVG M;  3CQX A;  3M3Z A;  4K41 A;  2D0P A;  3VF2 A;  2HBJ A;  2P9S B;  3C6H A;  2P9P A;  3CET A;  4IO9 L;  2FXU A;  3E9L A;  5JVG L;  2GEL A;  2KKZ A;  4MLH A;  4B1V A;  1Q18 A;  3O6W A;  2QXL A;  4BRO A;  3I33 A;  2HBK A;  3M5R A;  4CZH A;  1JJ2 M;  4H5R A;  4EAH D;  3A5O C;  3QML A;  5H1S Q;  1GLB G;  3OA9 A;  3QBW A;  1K8K B;  1VAZ A;  5HOO A;  3P4I A;  5AZJ A;  2V51 B;  3UKR B;  1QVF M;  4BRQ A;  3QFU A;  5AQH A;  2WBN A;  3CPW M;  1V4T A;  2E2O A;  4CZJ A;  3DWL A;  2YHX A;  1QQN A;  2CH5 A;  3TTF A;  5I9E B;  2Q36 A;  3P39 A;  4G9Z A;  1VQM N;  3T7Z A;  2P9U A;  3EZW A;  2GX9 A;  3MMV A;  1RDU A;  3OBY A;  1K8A O;  3KK7 A;  3L4Q A;  5AQZ A;  2OTJ N;  3I8B A;  1QQO A;  3LDN A;  3MDQ A;  1NGG A;  4BRA A;  1TYQ B;  2NRT A;  4RTF D;  1YXQ A;  4EHT A;  3QIC A;  2ZWH A;  2P9L B;  2VYP A;  1M90 O;  3CCL N;  1WOQ A;  5AFU H;  4BQL A;  3VEY A;  2E8A A;  4PL7 A;  3HI0 A;  4JKF A;  3WXJ A;  1GLJ O;  1HPM A;  2WFB A;  1BA1 A;  3KVG A;  4YOV A;  5BN9 A;  3QBX A;  1LCU A;  3FZF A;  5AQU A;  4DHY A;  1W2B M;  4M7X A;  4A57 A;  4WQ5 A;  1YI2 N;  2A5X A;  3QB0 A;  1QZ6 A;  5CE3 A;  5BRH A;  3CD6 N;  1GLD G;  4ILG B;  3H46 O;  4HWI A;  1KQS M;  3DXK B;  5AQR A;  1P90 A;  4BVO A;  4BR0 A;  5LJV A;  2QWQ A;  1J6Z A;  4YOT A;  4JKE A;  3LDO A;  2BTF A;  1VQ8 N;  2GUP A;  1HX1 A;  4E1J A;  4YOW A;  2IIR A;  1XUP O;  2P9S A;  5AQT A;  4JK8 A;  2E2Q A;  2YHY A;  1NLV A;  2FSJ A;  2YHW A;  1U6Z A;  4H03 B;  4WFA L;  4B1U B;  2QEX N;  5JIC A;  3CI5 A;  4FWK A;  4WQ4 A;  1U2V B;  3ID8 A;  2GEM A;  4YDU A;  3NVM A;  3IFR A;  2NRH A;  3EKS A;  3GDQ A;  4PKG A;  3IKM A;  3W0L A;  4BQZ A;  4JN4 A;  4YOY A;  1T6C A;  1WUA A;  2E20 A;  3OHR A;  1HKG A;  2Q1N A;  3MN5 A;  3E9O A;  1XC3 A;  3N4P A;  3RSE B;  4FPA A;  4A2A A;  5AZI B;  5DM6 L;  3H3N O;  5AQS A;  4Z94 A;  2FF6 A;  4IDH A;  4WCE L;  1C0F A;  4FOI A;  3SAH A;  4BC4 A;  2HBM A;  1TYQ A;  4CJ7 A;  1YIJ N;  4FWQ A;  2A42 A;  1NGF A;  1O13 A;  1BWF O;  2E2N A;  1YJN N;  4FL9 A;  4WQ5 C;  2OTL N;  1JCF A;  2IVP A;  3ULE B;  1NGB A;  4EHU A;  3I56 N;  1Q7Y O;  1X9J A;  1GLA G;  3TSU A;  5C2F A;  3O08 A;  2BUP A;  4JHD B;  4BR4 A;  4C1N K;  5C15 A;  3NVK A;  5BPN A;  4FWL A;  4KH5 A;  1V4S A;  3FLC O;  4JD2 B;  4JKH A;  5FPN A;  3VF4 A;  2WC9 A;  3R3L A;  4IFE A;  3CC4 N;  5EX5 A;  4A5A A;  3O9T A;  1VQP N;  2NRR A;  3DJC A;  3VF6 A;  3O9R A;  3ZX3 A;  3CMA N;  1VQN N;  2HF3 A;  2YJF A;  3DXK A;  4H5W A;  4ILH A;  3Q7C A;  2NLX A;  2JWL A;  1SQK A;  4QS8 A;  1D4X A;  4IOA L;  4FOE A;  1RFQ A;  4H5N A;  4WQ4 C;  2CGL A;  4CZI A;  5M1F A;  3O1B A;  2W40 A;  1KAZ A;  2QWP A;  4YDU C;  4B9Q A;  3RVC A;  3VER A;  3ENH A;  1HUX A;  4JKG B;  4RCH A;  5GIP A;  1HJO A;  2KHO A;  1MA9 B;  4JEP A;  5GAH P;  3D6R A;  2Q0R A;  2P9K B;  2HF4 A;  2F9T A;  4WYB A;  1CZA N;  1NGI A;  1YF5 L;  2RE2 A;  3LL3 A;  2VCP A;  3DAW A;  3LDQ A;  4FSV A;  4YOU A;  3VPZ A;  4OPH A;  4XEI A;  3CC7 N;  3TPQ A;  2Q97 A;  4BRP A;  3E9P A;  2I7P A;  1BG3 A;  2JWK A;  1E4G T;  4H0X B;  1NGJ A;  1ATS A;  3WXL A;  5BRD A;  3EO3 A;  3RSE A;  5KPR A;  2PBD A;  4KBO A;  5AZI A;  3U9Z A;  3CJ7 A;  3CCR N;  1VQO N;  4JAX A;  4JKC A;  3ATV A;  2IVO A;  1C0G A;  1IG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...