4A66A

Mutations in the neighbourhood of cota-laccase trinuclear site: d116a mutant
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
510
structure length
501
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHHEEPEVKTVVHLHGGVTPDDSAGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SPORE COAT PROTEIN A
publication title The Role of Asp116 in the Reductive Cleavage of Dioxygen to Water in Cota Laccase: Assistance During the Proton Transfer Mechanism
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 145
structure length 501
sequence length 510
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a66A03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a66A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a66A02
2A3TA 2PP8A 3FSWA 2HRHA 3FSVA 4BWWA 2TSBA 4PAZA 1ETJA 1GY2A 3PLYA 3NJHA 1XB3A 2XV2A 2VW7A 1E30A 3NYKA 2FJSA 3NT0A 1AS8A 1ET8A 4GYBA 1RZPA 4YSAA 1PZBA 2CCWA 2OCCB 4YVNA 4YSSA 2XX1A 1KDIA 1AZUA 2YXWA 3BVDB 1FA4A 4P5RA 5I6PA 2XUWA 1SHWA 1NWPA 1TKWA 4E9QA 3CVDA 4E9RA 1NIFA 2Y1AA 3WKQA 3FQ2A 3UGEA 3H56A 4JHUA 4A2FA 1CC3A 3SQRA 2YAFA 2PCYA 3HB3B 1PNDA 5B7EA 3H4FA 4YSDA 3S3CB 1MDAA 4BDVA 4FA7B 1PZAA 4W1TA 2H47C 3NJNA 1SFDA 4G70B 1E5YA 1R1CA 3T6XA 3DTUB 3NSFA 1L9SA 4NB7A 3T6WA 3U25A 1OCRB 3BQVA 4BWUA 3SBRA 3T9WA 4X4KA 3X1FA 1ASOA 1E65A 1AACA 2AZAA 2AVFA 2UXGA 5B7MA 4P5SA 2CALA 3OMNB 1HAUA 6PAZA 1JVLA 2BW5A 3AG2B 3N55A 3NJGA 1PLAA 3GXUB 4M4RB 5B1BB 1J5DA 5D4JA 2UXFA 5AKRA 1XMEB 2FT7A 2VM3A 2XV3A 1X9UA 1BXVA 2IDSA 3TU6A 3ZIYA 3CDZA 3FPXA 1SJMA 1JZEA 4HZ1A 1GYCA 2E86A 1AS6A 3IN2A 2AZUA 1AZNA 1T5KA 3AG3B 2ZONA 4K9JA 2EILB 4CSZA 2Y69B 4YSOA 2HX8A 4BXVA 2PP7A 3AZUA 1ZIBA 1ILUA 4A68A 1JVOA 2I7SA 1W6WA 1PLCA 2B08A 3C75A 2HX7A 2UX7A 3T6ZA 1EZLA 3QQXA 1XB6A 2W8CA 7PCYA 3PAVA 4BWTA 4CSPA 2YQBA 1SNRA 1RKRA 1BAWA 3GYRA 2W88A 3OQRA 1AR1B 3TA4D 3AG4B 1MG3C 2N0MA 3ZBMA 4F7KA 3QJRB 4NERA 1J9SA 5B7FA 3PPSA 2XVBA 3IEAA 4ENZA 1OCCB 4DP2X 1ILSA 2I7OA 2BZ7A 4Q8BA 2WO2B 2PLTA 1VLXA 4KOCA 4A2HA 4A2EA 1NICA 4DP4X 1OCZB 1A8ZA 4EF3A 3H4HA 3NJIA 5LDUA 4DP0X 1WS7A 2BWDA 1NDTA 3AG1B 1N68A 4WKXA 4AKQA 3FQYA 2HRGA 5ANHA 2QDWA 5IY5B 2IH8A 4HCIA 4A2DA 4G7RB 4JKNA 5TK4A 4HIPA 2MRYA 1AOZA 2UXTA 4GP4B 4YL4A 4DP1X 2HXAA 3S3DB 2VM4A 5I5JA 1V55B 5I6LA 3S8GB 2TSAA 1N70A 3MX0B 4YVUA 2FQGA 3FS9A 1CURA 1OCOB 5B1JC 5EHFA 2J55A 4GXFA 2FTAA 4PCYA 2ZWNA 3OMIB 4RH4A 1JZFA 1OF0A 1KCBA 1SF3A 1ET7A 3WNJA 3ABMB 3OD3A 3QJVB 2BHFA 1IBZA 5B1KA 5I6KA 3CG8A 2IWEA 2XWZA 1WS8A 1L9PA 1PAZA 4G72B 1ZV2A 4A2GA 2IDUA 4JHVA 2PCFA 3IN0A 5I5MA 4E9YA 2VMJA 1ID2A 3X1BA 3SBPA 2XU9A 2J57A 2BZCA 4DP6X 3ABLB 1BQKA 1JZHA 1NZRA 3EHBB 1V10A 2OJ1A 2QT6A 2VSKB 1TEFA 1BEXA 3RYMA 3CZUB 1YLBB 1PY0A 2PPDA 2CJ3A 4ZK8A 3AY2A 4Q89A 1AS7A 1AG0A 1AIZA 4HHGA 3PCYA 3QJTB 2YXVA 3G5WA 1JERA 3AW5A 3JTBA 3FYEB 2MTAA 3NJKA 2J5WA 4YSRA 2PPAA 4L0PB 3GDCA 5B3SB 4BK5C 2R7EB 2IH9A 3FU9A 1CYXA 4HHWA 5I6OA 3FSAA 3IE9A 1X9RA 4HAKA 3S3BB 1JXFA 3QJSB 3ASNB 1WA1X 3FQ1A 2DWTA 3ERXA 2AANA 4KO5A 3X1NA 1PZCA 4E9WA 2BP8B 4GP5B 4AKOA 3ABKB 2FT8A 4G71B 4G7QB 2WSDA 2GC7C 3PAZA 2EIKB 1ZIAA 2BP0B 5I26A 2QPEB 2RACA 4AKPA 2VSMB 4YSPA 1TU2A 2XX0A 3UADA 2YAPA 1RZQA 3ZX1A 1PNCA 4GP8B 1WA2X 1NIEA 2IAAC 4DPCX 1KBVA 1GW0A 2ZXWB 1UATA 3T6VA 3QJQB 3FYIB 1AZBA 2VW6A 1JZJA 3WI9A 1JXDA 3EH5B 2LLNA 3FU8A 3D12B 4W9ZA 4YSEA 1QLEB 2EINB 2H3XC 2GC4C 3HEIB 4G7SB 2YAEA 1SHXA 1BYOA 5E9NA 2UX6A 5I5IA 4E9VA 5D4IA 1OE2A 1IBYA 1AAJA 2H5UA 1RCYA 1GR7A 1BXAA 3L45A 2FT6A 1AG6A 1KYAA 2ZOOA 2X87A 2FQDA 2BW4A 4KO7A 4NAJA 1DZ0A 1M57B 2J56A 2P80A 2IDQA 2X88A 1OOWA 2I85A 3DKHA 1AANA 3TBCA 3WIAA 2Q5BA 3WKPA 1IKOP 1KBWA 1AZCA 2NRDA 3MBWB 4KNUA 3EH3B 1NWOA 1A65A 1OE3A 2DV6A 4DP7X 1DYZA 7PAZA 4KO6A 3SBQA 3KW8A 3KW7A 2PPEA 3V9CA 3NJMA 1E5ZA 2FQEA 1ET5A 3UAEA 4F2EA 2HLEB 2R7EA 2JXMA 1CYWA 1W8EA 2FQFA 5FC9A 1AQ8A 2YAHA 1OV8A 3UACA 4AI7A 1M56B 3ASOB 3EF4A 3FU7B 4UAHA 1SDDB 2HZHA 3ABGA 1L9QA 2BP8A 1GS8A 2QPDB 4FAAB 1M9WA 2XLLA 1BQRA 3FSZA 1V54B 2IDFA 3NSYA 4KNSA 1BXUA 2EIMB 4QLWA 1FWXA 1NINA 2BP0A 4YSTA 5I6MA 3NSCA 4DP9X 1JOIA 4N4YB 1AZRA 2UXVA 1JZGA 4HALA 3NP4A 3OMAB 4UF7C 4BXSV 1PMYA 1ASQA 5PCYA 2DYSB 1MG2C 5AFAA 1KDJA 4M3HA 1L9TA 1L9OA 4KO9A 1URIA 2GSMB 4KNTA 3T71A 1J9TA 5B1JA 2BO0A 2PP9A 2PPCA 4GY4A 2YARA 5F7AA 1NPJA 3UAAA 1TEGA 2XXFA 3NJFA 4KOBA 2PPFA 1QHQA 3X1EA 1HFUA 2DYRB 1PF3A 1W6LA 1ASPA 3S8FB 3OM3B 2FNWA 3FT0A 1J9RA 2GIMA 5D4HA 1EHKB 2VW4A 2P80D 4AX3A 3PXLA 2EIJB 1PLBA 2FWLB 3UABA 4HCGA 1JXGA 4WTQA 4DPAX 4DP8X 4F2FA 1I53A 1MZYA 3ZDWA 4YSQA 3DIVA 1QNIA 2BWIA 1B3IA 1IC0A 1L9RA 1A4AA 3QJUB 3NP3A 1NPNA 3NJJA 3X2QB 3TASA 2AFNA 1KGYE 1F56A 2JFCA 1XB8A 1GS6X 2CUAA 2DWSA 3N2JA 3EH4B 1NIDA 1HAWA 1NIAA 1SF5A 1BQ5A 4E9SA 3WG7B 4TXVB 2XYBA 2YAOA 5F7BA 5AZUA 5PAZA 1E67A 3FU7A 3V9EA 1A3ZA 2GHZA 1SDDA 5I28A 9PCYA 1NIBA 5I6NA 3CVCA 1GY1A 1CUOA 2XV0A 3FPYA 4YSUA 4QKTA 1JZIA 2OV0A 3X1GA 1GS7A 4AZUA 4E9XA 1WAEA 4UANA 3NJLA 4BDVB 2GI0A 2VN3A 6PCYA 2B3IA 4N8UA 2IWFA 4A66A 1BYPA 1A4CA 2CBPA 2QDVA 1KV7A 1PCSA 5B1AB 1MZZA 2WO3B 4DP5X 2YAQA 2JKWA 4DPBX 3JT2A 1SFHA 3IBOA 1KCWA 2DY2A 1NTDA 8PAZA 4E9TA 3QPKA 5TK2A 2IDTA 1ZDSA 1ZPUA 1OE1A 2GB2A 4HCFA 3CVBA 2IWKA 1FFTB 4A67A 1J9QA 2GBAA 1A4BA 2HX9A 3PAUA 5A7EA 1WA0X 1J5CA 1ZDQA 4YSCA 4MFHA 2CAKA 1IUZA 1GSKA 3CDZB 2XXGA 2Q9OA 2YAMA 3WNIA 3TBBA 3NSDA 1ADWA
chains in the Genus database with same CATH superfamily
5D5MA 2A3TA 4LCWD 5IHZA 2GSGB 4LOUC 3FOMA 5EOCJ 4L3FA 4JO4H 1IRAY 2XTJB 4XAKD 1XB3A 5F3HA 1BJ1H 1KB5A 1X3DA 4X5WB 5F0PB 1MCOH 4AQEB 1O75A 1JMXA 2E9WA 5HJ3B 3US1A 3Q6FA 3F6IA 2VDNL 4GYBA 4J3TA 3GMNB 3CFEB 2OCCB 4MBOA 2OYPA 4Z3FA 5G4MA 3VSVA 4FLQA 4P8QA 1H15B 2EE0A 1AZUA 5ABZA 3RG1C 4X9YA 3WLWC 4ELMB 2H6PB 2W81C 3A24A 2ZUQC 4PGCA 2NNXA 2Z4QA 5I0WA 1DQLL 1IFRA 1I1AA 3MMEB 3LPGA 3H8NA 5JW4R 1A3RH 2VXQH 5I8EB 3RIKA 1DQJA 2ARJA 3H4FA 4AQ1A 4XBMA 4U6VL 2XN9B 4L5FH 3W9DA 4R7VA 2ZXQA 3IFNL 3QI9B 2CO2A 4HOWA 3EYVA 2ITFA 1OM3L 1XX9C 2ERJB 2XWXA 3M17B 2VC2B 1MW1A 5BMFL 4M5TA 4XPFH 3QP3A 4Y4KC 4EBQH 3PXHA 1HT6A 3WSQL 4AH2B 5JW3H 1QLRA 3T9WA 2BH0A 2AVFA 1I3VA 2MNWA 2EXTA 2OX5A 4IK6A 4UILH 2VCOA 4HZLA 3LN5B 3QDGD 4PJDB 4NJ9L 3GXUB 3JWDH 3HBGA 2J1ZA 4H8PA 1KXTA 1A9BA 3O6FD 4BFIA 2OMXB 4V1DE 3O9WC 4ZMLA 2D4DA 3NCJH 3V4VH 1K6QL 3N42F 3PFQA 4AT6A 5AZ2H 1JNLH 2E86A 3WAJA 2BWQA 2AAAA 1T3FB 3MRLB 5L4JA 5LN8A 5EC2A 3I2CH 3DX8B 3CJJA 1X4YA 3F00A 4HMDA 4OM0L 3VVVA 5MENA 2YD8A 3ZHNA 4CN6A 1Z6JT 4NZJA 1MF2L 2QJDA 4PLNC 3IKCA 1D5BA 2BNQB 2F53E 3UG5A 4K8RC 3HG2A 4FNUA 2GITB 3H7BA 3VRIA 4EDXA 2Z6FA 4K5NA 5C0NC 2PXYA 2HFGH 1ED3B 2WLKA 3APNA 1S9VB 5GRZA 1JMZA 1H19A 2BCKA 3GLDA 4EJ1C 1F6LL 4MASA 4PRIB 3UTQA 4YC2B 3EF7A 3U0WH 3KPLB 5FO8A 1AHWA 1DFBH 2J1KA 2PMZA 3GSVB 4Y2OB 3WMQA 1T89A 2GW5A 5AUMB 2WN3A 4KGLA 4JG5A 3LNIA 1AMXA 1E7VA 1UB6A 3SQOH 3ZY7A 2A5UA 3AJ7A 4PTUB 4XPHH 3UAJA 3D8MA 5MEPB 2XXMB 4X9GA 4ABWA 5LWYL 3ARXA 4X99B 2WLIA 4NBZB 3A21A 1QQDB 3I9GL 3EYFB 1NAML 2H2PD 4HIEB 5J1AB 2NYYD 4I3RH 1EPFA 2P8MB 2PLTA 2YEQA 2DQDH 4LSRL 4R6UA 4RESB 4HIHB 3SGDH 1RZ8B 2WYTA 4JCMA 3V4PL 3M8OL 1P7QB 2A9BA 1XF1A 4LNVA 4TYUA 1T7YA 1YY8B 1JJUA 4A7TA 3FHEA 2EYTB 5EU6D 4PREA 4QHPA 4AKQA 2VDML 5KYYA 1TJGL 3E1ZA 5KSBE 3N42B 2VLRA 5DHMC 4MDIA 4WV1C 1JDDA 4MDJB 2XRAL 2K1MA 5TQ0L 5BW7C 4RDQG 4JFFB 2MPAH 1FNFA 1NCDL 1CTOA 1HIML 3FSOA 3QUYB 1HSAB 4NRXA 4QEGA 5E5RB 4M6NL 4UOW0 4UM9A 2Z8WC 1M9SA 1UZ8A 5ALBL 5BXFA 4ORZC 3ZO9A 5CAYB 4L37B 3BPOB 4FXKA 1UJ3C 5F1SA 2G2RB 2JB5H 1J1OH 1I85A 1LM8V 1NC2A 1OGAB 2ATPB 2MJWA 2YRPA 3FB6A 3I9AA 4N87A 5IROD 1A5FH 1FFOA 2FJFA 5L0QB 2GVYA 2VNCA 5C0BE 3QXWA 1E5BA 3A6BH 2D3LA 1KC5L 3ZZ1A 4CILA 5I6XB 1HZKA 2OXGA 4MA3B 1I9EA 4J12A 1IBZA 3JUZA 4LVNC 3HBQA 3NIFF 2LFGA 3G5YA 5EZLA 5C09A 1AKPA 5C07D 2OMUA 3QC5X 3ULUD 4EUPH 2PCFA 2IOMA 1OKEA 2A77H 3U4BL 5E8OB 5JOFA 5MEQA 1DLHA 3F3HA 4KJWD 1YMMA 4GLRI 1BQHA 3MV8E 1KT2B 3LIUA 2E8YA 4I0PB 5IW6B 4NNYA 3V0DA 1MLBB 4ZMVA 5FEBA 3EFOA 3BSGA 4L4VE 4LLMA 3TA3B 4BHUI 4KKLD 5IMKA 5HHXH 3ZN6A 5AD0A 1GOGA 2YD1A 3EJTA 4UT9L 5GS3A 2AGJL 5E9DA 4POUB 3TYGL 4YDKL 3ARGC 1AE6H 2JJVA 3PCYA 2AJZB 4L2YA 3F01A 5D7JA 3QPQC 1J1XL 2WINA 2AQ1A 2RQ8A 4U4BA 2ZOWA 2HA1A 2UWEF 3AW5A 3GM0A 3QCUL 4YDIH 3C6LB 4BKSC 5GS0H 2BVYA 2X1OA 2WSKA 4KY2A 4HW6A 2HVKB 1YNLL 4E41E 4YXKH 5B3SB 2NY0B 3MLZL 4QJ5B 1QATA 2D31A 2H9GB 4IHBA 4NJAH 1EVTC 4Z95L 1HDMA 5M7QA 4JPIA 3X1NA 5JUEL 2I9TB 5JNYA 3RNKB 2JJSA 2NSMA 4MNHA 2WLMA 3FL7A 2FT8A 3FB7B 2GJ6E 4G71B 5K1VA 3VI4F 1NGXB 4TPRH 3OF6A 4M93C 3R0NA 4KWUA 3AM8A 4QCIB 1MCPH 1R46A 3B9DA 5EF3A 1I9RH 4Z0BL 2H32H 2NNRA 5FUCC 4IHOB 5ACZA 1RZQA 3BP4B 1IAIL 2FEEI 3NIFB 1Z7JA 4FKEA 4J8RB 5D9SA 3VH8B 4ZMPA 4OJCA 1XH2A 1SPDA 1LP9E 2AK4A 4CU7A 1UD4A 5E6RB 3RVUC 5I71C 3E8VA 1KBVA 1GW0A 1ZT4A 3O2VH 4ZQTA 4XPBH 1TYJA 1MFVA 1FCGA 4W9ZA 5DD3L 4LLUA 2JCWA 1MFCL 4NUGH 2VDKH 3S35L 3SKNB 1ZLEA 1JUFB 3P2TA 1QFWH 2EACA 4S1DD 4DKAA 4MCZB 3GSUA 1QI5A 5DYOA 4NPJA 4Y16D 3V0IA 2NW2B 2ZX8A 5F44A 3HS0C 4KK6C 4JY4A 3BEVA 4GRMB 5DHDA 5I1HL 1UZ6E 1RURH 2X38A 3TNMA 1JK9B 4MMXA 4ONHA 5D1XD 2UWEB 3HLKA 4NZUL 3T4AB 4FQXB 2P24A 3UIZA 1JWMA 3JV4B 1A02N 3HC4H 4ELME 32C2B 3P73A 1Y1DA 2X6VA 4F8QA 1VKXB 5IQ7H 4DCQB 1TR7A 2HG5A 2FO1A 3S36H 1ET5A 5J6HB 1EBAA 2E59A 1W8EA 3UAFA 4FC3E 4UNVA 5F3BB 4ZODA 1PQZB 3FONA 5CSGA 3RIFF 4R97C 4J4PA 5BVPL 2VXSH 2PXYD 3ULAB 5ERWB 3VI4B 4Y19B 2IANA 4DQOH 2RH0A 3QH3A 3ABGA 2EAEA 3VA6A 5JLZA 4HFUL 1K85A 1PZDA 4C47A 3HIZA 2C3HA 1FL5B 4XPTH 1WUNT 4UTAA 5K1JA 2BNRD 4GSUA 1G7PA 3SOTA 5IVXA 3CE1A 3NSCA 4Y4HB 1S3KL 2X6CA 3L5XH 5GZNC 4JO4L 3REWA 4LL1A 2N59A 4Q9CA 1E9QA 3MOQA 3K8KA 1JGDB 2PNDA 4EI6B 1MG2C 3MLUL 3N04A 4ZXBB 4AEFA 3LS5H 4X5XA 4QOKB 3U6RA 4GUPA 2QADB 2R0ZL 4OZFB 4PJDE 3RY6C 3GEWB 4AQAA 4NQCE 1NPJA 2V5TA 2XXFA 4JFDE 4NN7C 4CBPA 4CJ0A 2PPFA 3KPQB 4MB1A 2VSDA 2SEBB 1PF3A 1AGEA 2FIKA 2HAZA 1UXMA 3FT0A 3D9AH 3C5XA 3TO4C 1S9WB 2UZXA 4M56A 2YEZB 3B3BA 1N2RB 4UT6A 3NH7H 1A3RL 2VXQL 2HMIC 1LD9B 5BZZA 5LLIC 4XMXA 1MREH 2CLRB 2JSFA 4OKVB 4ZMNA 4WTQA 1YNTF 3G5ZA 3O8XC 1DSFH 3OLIA 4LSQH 1S78C 4M1DL 3QRFM 1CFNA 3CX2A 3N85L 1Z9LA 4W9HC 2VKXA 2FDBP 4KZEH 2D0GA 3VWJC 3C9NB 4NQVB 2OXHB 1F11B 3ARWA 4EBQL 1RUAH 4U1KA 3HN3A 2JFCA 2O5XH 3MNWB 2Y36L 1SUHA 3TBSB 4JK0D 4G42A 1QPXA 4HISA 3CSYA 1EEYA 4MQ7A 4DGVL 2MQGA 5D6CB 3I02A 5DTFB 5E99H 4O58L 5I1IL 5BRZA 1NFIB 4RFOL 3X3GL 3QJXA 1F4XH 1TZHA 1XCTA 4QHMB 3UO8B 1KB5H 4YEFA 4NZDA 4MD5A 4XR8C 1JNLL 3COOA 5AZ2L 3KWXA 2A9ML 4YSUA 5MERA 1JGEB 3FOLA 3G5XA 3AMKA 1KCSL 3CLFH 4IOIB 5CIPB 1U42A 2XG5A 3KPMA 1RLWA 5DWUL 4FQHA 1HH9B 2CBMA 3D1MC 5E1GA 2A1WL 4UQ2B 4AEIL 3VFUA 3T0EA 1FL3A 3EO0A 3SGDI 4LHUG 3L2LA 3QEGH 3RWDB 5AW5B 1SLWA 1LWRA 2ZXEB 3TLRA 2FBRA 4TSBH 5B4MD 5TK2A 4WI0A 3KXFE 4W9JC 4O4YH 4QAMB 3W11C 2EUZA 4AY0A 4GG8A 1WLHA 1NQBA 3VM5A 3F5WB 3SCMD 4OD2A 2CMRH 3U0WL 3LTVA 5D1ZD 1NKGA 1G5AA 1XVSA 1ZT7B 3CFMA 4CVXA 4C83B 1REIA 2A38A 1YNTB 1IL1B 2OJEB 3SQOL 4JQIA 2W9DH 3EJQA 4MB5A 4UNTA 4XPHL 4WU5B 5GRJH 3SKOA 1JFHA 4M1GH 1QO3A 3S48A 4H7VA 1FZJB 5IB1A 4DGYH 5IF0B 1FRGH 4KPHL 2DW5A 4I3RL 1RJYA 1JWSB 4N8CH 1J5OL 4FHBD 1KB9J 1JCKA 4M7ZC 3V0EA 1HHGB 5F7EL 5CGYD 3ZHDA 2V37A 3KPPA 2I5YH 3ARED 3DYPA 1U93A 1ET8A 1L3WA 2VR6A 3TCTA 1WWAX 2WVVB 5ETUB 1B2WH 5IEKB 3RVVD 1FJ1A 2NY4D 2VXUH 1M4KA 3QQ4B 5A3IC 1NC4A 1A4JB 3WJJA 3FQ2A 1BECA 4S0SD 4BINA 3QAZB 1LYQA 1VFBB 4WY7H 3UGXA 4DKDC 4P2CG 1HCFX 2VR7A 2Q3ZA 1J0ZA 1L0QA 2PCXA 3PL6D 4X6CA 3LN4B 3QQNA 3VTTA 1ZGLB 3M1CA 1OD7A 1RZGB 2NSXA 4FQQA 3Q8CA 5KANI 1XAUA 1ETA1 2P49B 3HAEB 2ITCA 3CXDH 4DN3L 4PCSA 3APMA 1A5FL 4S1QL 4NNPH 5K59F 2QR0A 1CGUA 2OM5A 4UBDC 3HUJF 3K72B 2CXKA 2Y6TE 4MA7L 4G1EB 4ZFOA 4PR5B 4Q9RH 3L3JB 2LTQC 5CR8A 3E9UA 2YUXA 4OLEA 4KI5F 4P23C 5F1KC 3I6KA 4RQQA 3PG2A 2WXHA 3LKRA 3MUGB 3OMNB 4HFWA 3AG2B 2V3FA 2CUIA 3QG7H 4GW4B 4ANUA 3FT9A 2NY2C 2A77L 3GIVB 1PLAA 1GJIA 3RL1A 1CDJA 3MLWH 1FVEB 2D4FA 2YPVA 4UAOC 2JK5A 3DOHA 2C5DC 3ZIYA 1G7JB 2E3VA 2IFFL 4AENA 3D2TA 1A7QH 1Z66A 3NIFE 3RI5F 5GGSY 4XOBA 4IIQC 1S5HA 3GSNL 1LO4L 4XBPA 2D9QB 5KWYC 3TP4A 4NSKA 1W72L 3V6OE 4X80H 3RUGA 2X41A 4YSOA 3DO4A 3AWGA 1TZIB 2OYKA 4DK5A 1S9XB 3NRQA 3W81A 5FGBC 4X9HA 4YDIL 1SYVA 5F7MC 5K39B 5GS0L 5E2VH 1XF4A 1BCIA 5JO5B 1UWXK 3VTAA 2FWOB 3O3BB 1JPFB 1BREA 1AQDB 3C75A 3IS1X 3VXSE 1FO0A 1GOFA 4QIRA 2G60L 5D1QE 1QFWI 4FG4A 5HPMB 3A3YB 1UFUA 5HY9A 4IU2B 1XF3B 3FQXA 4QY8A 4W6WB 4TQEL 2ORBH 4ZAKC 3NZ8A 1I7RB 3QDMB 5BS0B 1SJEB 3I6LD 1S9YB 4E2OA 3CPLA 1AQKH 1SEQL 4TPRL 4XPGH 5DDHB 4E5XA 1DVYA 2Y4SA 3GSRA 4Q4IA 3DXAE 1I9RL 3HUJB 4MB3A 1E4HA 2I7OA 2BNUB 3MKGA 3BZ4A 1EJOH 1CICB 4FMVA 4HUKB 1SHMA 4JRXB 4LGSB 4HKBB 2CUHA 2DIBA 4YGVB 3C6EA 1RY7B 3OWRA 4WUUB 3OB0K 1K4CA 2YD9A 3O2VL 3RWCB 2ZD0A 1ULVA 4XPBL 5I16A 1VCBC 3RGVA 4K7FA 3ROOB 4OCXH 5LDSA 2XDHA 4HCIA 4NUGL 1A6WH 1I31A 2QPFA 2VDKL 4DKFH 4LKXA 2MRYA 5BZWA 5E6ID 4YXLL 4G8EB 2UXTA 4MB4A 4YL4A 3SE4C 4DP1X 4L1LA 1I8MB 3QZOA 3KYOA 4QWWC 4LPVA 3K91A 4Z0XA 4G2AA 1DQMH 4WUKL 3UZQA 4ZQKB 1RURL 1JTPA 4JM0A 5DZNA 1FIGH 3F12B 4OZGB 4C59B 4ZS6C 2CBTA 2RGSA 3I50H 3PWPB 1QZNA 4AV0A 3MQIA 1G5GA 1QACA 3B37A 2JKLA 1LO5A 2XETA 3P2BA 1SVCP 5IQ7L 2B1AH 3OZKA 1FYTD 1H9VA 5F9DC 1JIBA 2XBTA 2CLVB 1BMGA 2HTLD 1I75A 4KRPB 1GW6A 5C1MB 1XZ0A 2FO4B 2A6IB 1JTTA 1QFUL 5TH2A 1NBQA 3MV11 4H8UA 4DPRA 4G7VH 3OKEA 2QSQA 3IAPA 3JWNH 2R27A 4WZ9A 2WQVA 4XNXH 1FZMA 2IBZY 4P2QB 2NW3B 5KAQG 1HQRB 4XP4L 3MROA 3PABB 3DO7B 3PGCB 1T83A 3L5XL 3QULB 5ALCH 1UEYA 2QQLL 1OAJA 4FX5A 2W38A 3BGFC 1AD9B 1FH2A 3BXNB 3FRPB 3PWVA 1HTYA 4JR9H 4PJ7E 4K23L 5SX5K 2KZKA 4K0OA 3IBEA 1CF8H 1AP2B 1QNZH 4PJIA 4XX1G 2C34A 3VXUD 1T04B 2Z8VC 4FQ2H 5DR5H 2XHNA 1P5VB 3ARYA 5FFGA 2HUEA 3GMOA 3V9FA 4H8HA 4O5LH 3SHSA 4BK5C 4GMTH 1C12A 4RMWA 1X9RA 3S3BB 3D9AL 1BM3H 4HK3J 1WFIA 4ONGH 4XZUA 3HS0B 3V4PB 3W56A 3RIFK 4OFKA 3IGAB 4Z77B 1PZCA 3B2UD 4E9WA 3NH7L 3WLBA 3ZT7A 2QLVB 5KW9H 2OSYA 1FAIH 4YBQD 4WSKA 4KTGA 4DKEH 5GS0C 3ULUL 4KAQL 2EDBA 4UIKH 5HGDB 3QIUB 2D0HA 1CU4H 4PRNB 4FF9A 4H0LC 1IKFH 4PGBB 1GIGH 1P6FA 3LS4L 3Q1SH 2V4LA 1GYWA 2XICA 3KPTA 3N41F 3OKMB 5JOPE 1WA2X 1IGMH 2VERA 1RUAL 4I87A 4K7PH 1U8HB 3RE0A 5EORL 1IX2A 4J2QA 2GTWA 3AQXA 2W60B 1E4KC 4Z8FH 1A1NB 3F83A 4Z3TA 5E99L 1KLFB 1RIHL 4KQ3H 4UTAH 2NDFA 4EI5C 1MFUA 1AO7B 3PREA 3R18A 1SHXA 4GKNB 3WHXB 4IRSB 3FBKA 1MAJA 1QWUA 4PYHA 4E9VA 3VFMB 3LXCA 4HUCA 4QRFA 4UINH 4ES9A 1RHFA 2FGWL 4EN3A 4UM8B 1ACXA 4IOFD 1XMWA 4JVWA 4APQA 4MAUH 1I8KA 1KCVH 1CJYA 3GO1H 4M5SA 1NOFA 4KX7A 3MRHB 3SPIA 1XF2B 4Z9KB 1SOXA 1MIML 2F54B 2DLEA 1VENA 4GEIA 4RLDA 1D7BA 1WFMA 4JS7A 4OCLC 5ESAB 4F3FA 5EEWA 5DEGB 2RHEA 2WYHA 4MNGA 1FC2D 1YDPA 5EOCH 4UT6H 1TQWA 2PO6B 1I1RA 2WXOA 2Z4TA 4OF8A 4QRRE 5CU9A 3WIHA 3H54A 5EU7E 3SGEI 2H1PH 4UDTA 3FU7B 1TYRA 2A9NH 4JFQB 3L7FB 3SEPA 4OZIE 5DHVA 1L9QA 5IK3A 4OLYL 3D39D 5I18L 1M9WA 1MCJA 4ICXA 4M1GL 4IBLT 1S7TB 4HUMB 3QZWA 3QJOA 3PWUA 1MCFA 4GAJH 3N41B 2WHVA 4P2OB 4PJXE 2BSEA 2KL6A 2H2PC 2DWYA 2F8XC 1CTMA 1RH8A 3GRBA 3N44F 2Z64C 2FD6H 5IW1B 2DYSB 4Z3EA 5CUSL 2I5YL 3UC0L 2L8AA 4FA6A 1P7KA 3IM1A 5B1JA 1NUFA 1CFSA 1LL1A 2V2WA 4TNVK 2PPCA 2ZKHH 5EU3A 8CGTA 4X9IA 3AWEA 4XCFH 4X6BA 4Z78A 5D7IE 1TITA 1SEBB 1A6AB 3MBEB 2PTTB 3QZNA 5DJZB 3DOIA 4LNRA 3BUDA 5DQJA 1MCQA 3H9SD 3M1OA 4UZUA 1Z2KA 4X7FC 4P2RD 5EOTB 2FWLB 1OTSD 4U1NA 2WD0A 2DL9A 5DD5H 5FO7A 3UABA 3S96B 5D8JH 2R0KH 3UTSA 3H55A 3CXDL 5F93C 4LHJB 4NQXA 5EF1A 5C2BH 4UTBA 1HSBB 4BH8B 1A7NH 5IROC 1ZVSB 2X4SB 1DJWA 5EOQH 4L9LA 1U8PA 1P1VA 4Q9RL 1ZLUK 1OTTD 1SXCA 3TVMA 3X2QB 3B2PA 1HHHA 2AFNA 4DZBB 3THMH 4YHIA 4PGZA 4JG1H 3D33A 2G4EA 4JQIH 5JIMA 2AJSL 2QEJA 4TVSa 3QDME 4OCWH 3MUZ1 5JHAA 3BOVA 5KS9A 3ULUC 4WHYH 2AKRA 2XYBA 4TUKH 1P4LB 3RQ3A 3MLWL 3WE1A 4BRVA 4XO3A 4IS6A 4B9CA 4J3OD 3HUJE 3ZRCC 4BSWB 3OKDA 4F8PA 4NGHL 1HHJA 4PRHD 5ID1B 4MD0A 2BSTA 4QO1A 2XCMC 3N44B 3Q8AA 1A7QL 4JDEB 4PCKA 3CXHJ 4R5XA 4M7ZB 3VDAA 4WQOA 4AQ8C 2VN3A 2NTSP 3WN5A 5LGJB 2JQMA 1LGVA 1LJMA 4I7ZC 3OXRB 3ORJA 4L1SA 3G9AB 4X80L 5EBMA 5KYWA 1WFTA 3FT4A 1F2QA 2NUPB 5L4MA 3VB9A 2O61B 4DPBX 3VD3A 3FUDA 5I1AA 3UX9B 2VIRA 1B90A 3G04A 4D3CH 5T3XE 2C9PA 5J7CC 4YHYC 1G9NH 4AYEC 4PJ8D 3DMMA 4GO9A 8PAZA 5IEHA 1I9JL 1EEUA 1F90L 1LEIB 1NGZA 5FYKE 4JY5L 1QSVA 1VDGA 1OQOA 2E6PA 1UCBH 4X8CA 4AGMA 4A67A 1PX8A 5ICUA 5F0LB 1NBVH 3CFBB 1FZOB 3L3GB 4G8IA 4PSPA 3PAUA 4P04A 5JDSB 1XCXA 3X17A 3O3AB 4WLCA 5HHPA 1RUQH 4G5AA 1VSCA 5EEYA 2X3AA 3ATBA 4MNQB 3W0WA 5K9KB 1AQKL 1NCAL 3OKOA 1G4MA 4U1LB 2YAMA 2G9KA 3GSXA 3VXPB 3HR6A 3O3EA 4P5KB 3OAWA 1I1AC 4X7TA 5SWSA 3AGWA 4JKPH 2FLBT 1PD1A 2NXYD 3HC2A 3K4DA 3MRIA 4NUMA 5HGBA 5ABAA 4XMWA 1R3KB 2HRPL 3HR5B 4JLRA 5H94A 3SDCD 4AQ1C 5T1DH 2FSEA 4X4XA 1ERNA 2ZNXA 3DYOA 3QJFA 4P23B 1MCHA 5A2FA 2X4OA 5G4OA 1M2VA 4GKZB 25C8H 1XTMA 3GBMH 4HP5A 4HJ1A 2Z35B 2NY2B 2UY6B 5TQ2H 2XQYA 1KDIA 2XX1A 3V79C 5IFAH 2VRAA 1A6VH 5DRZA 1SHWA 3ZZQA 3CFQA 4L3AA 4JJHA 5DUBA 3L3DA 3NABH 4NDMA 5T1LD 5L9DL 4XNDA 1BFOB 1JK8B 4FADA 1PS3A 4S1DC 4IIQB 2A83A 2ZSVA 4Y16C 3WAKA 1LWHA 1EEZB 5EBGA 4IDJH 5HGHB 3HKZA 2Y07L 5B7EA 1UWEH 2I60H 2YKLL 4LEEA 2F58L 4L18A 4MJIA 1CGTA 4KBPA 4XCYB 1XD1A 1TCRB 4P2YA 1KWGA 3I50L 3MDJA 1SFDA 1SJXA 4GAFB 5D1XC 4PJBF 1NUNB 1FO0H 1HVXA 2WQSA 3H0TA 3MZTA 3PQYE 4APQD 3IKKA 4CADA 3V4VB 1W80A 1O6SA 1L0XA 2WWMD 2WVSA 3MYJA 4HIXH 3RURA 3BQUA 3RPBA 4FXGC 2XWRA 3UERA 5F9WC 4BFKA 2OW6A 2CHDA 5HGGS 4PW9A 5ANMA 3W5NA 2BS71 2WWKO 3X1FA 1INQA 5IFHH 2ZCLH 2VABB 3OBAA 4IRJA 2QQQA 3QUXA 3U1SL 3MRBB 1USQA 2F7PA 4P3DB 4EVNB 4ZMZA 1U3HB 4UOZA 4X6EB 1Y6KR 3LEYH 4Y88A 2J6EA 3CN1A 2PXYC 5C97A 4Y1AB 5B1BB 2F7IA 3O3UN 4R96A 4NHCL 3QNZA 5IP4A 1X5HA 1XMEB 4IW4C 3JTTA 4OZFG 3L4YA 4OF5A 2IDSA 1BXVA 4U1HB 4AQOA 2Y5EA 1JZEA 4HZ1A 5F0JB 3ZK0A 3L81A 1S7WB 2HKAA 1QUNA 1T2XA 2DTSA 4KQ0A 4CN4A 5CNHA 5E6UB 4KX9A 4YHMH 2VISB 2WJ7A 3G6AA 4JR9L 5HDLA 5DHXB 5KJRL 4CC4A 4I5BB 1JPST 4PP2A 1ZSHA 1YYMH 3CFKB 4I2XA 2PP7A 4NC1E 2XBDA 5DD1L 4NPYA 2XTLA 1JVOA 2R1XB 1NEZB 1B6DA 2MOQA 3L08A 1OO2A 1JZ8A 4XC3H 3TCLA 2YMTA 4X7CC 2COVD 4TOYL 1KYDA 2VN5A 2G30A 3QQXA 1S7XA 4GMTL 5C3TA 1SNRA 2G4GA 2R29L 4LFHG 4NQEA 4X83A 4PWJA 4RNRA 3EJJX 4XE0A 4ONGL 5CU5A 3CBKB 5AVYB 1W15A 4QRQB 4WJ5A 4HV8B 2VLMD 2R4RL 4FTDA 4HU8A 2R2CA 1UKTA 2EXYD 3QJRB 5KW9L 4PTTB 4PJBB 4N2OA 4WHTA 3QEUB 4G9FD 4W68A 3VRLF 4FERA 3S37X 3RNQA 1KTKE 3WKML 3KS0J 5GGSA 5C0JA 3EG9B 3T8MA 4AXWB 3HZMB 4R0LA 5ICYA 4NWUH 4ERSL 2WO2B 4G7YL 4FXKC 3VWKD 1OHZA 4WTXA 1IGML 1VACA 2BHYA 3BLPX 4HJ0C 4JZJA 1U3YA 3DNKA 1GYAA 3PDOA 2A6KB 3G08A 4J1UB 3IJHB 4LEBA 4JY6A 5TGBA 1CE1L 2KMWA 5E1IA 2NCMA 4CW1B 2P5PA 2CLZA 1FNLA 1Q1JH 2EE2A 1IBHA 4EAEA 4A2DA 4M4RA 3TV8A 1SDYA 3KLAB 5IFJA 1UGNA 1GMIA 2ADIA 4HIPA 1TSRA 3KJ4C 2OZ4A 3IT8D 2V8LA 3BW9A 4KMLB 4UINL 1Q9OB 2KPWA 2R0LH 1FH5L 5I5JA 1V55B 4MAYA 5KJ7E 1E28A 1MH5A 4ODTH 5FW6A 3GO1L 1JWUA 3FTXA 4EUPB 4ETQA 3VD9A 4X98B 4GJTB 4TQPA 5EHFA 3SODB 5FYLD 4PJEA 2HT4D 3DIFB 4R90L 3GB7B 5HI3D 1ZLSL 3PWLB 5DJXB 1UUSA 2XWTB 1KCBA 3DWTA 1VZIA 1A9EB 3ZTCC 2WLYA 4NFDA 4TTDD 3X3FL 3NCXA 5JYMA 4PJ9A 5FGRA 3CHSA 5DA4A 5EOCL 3B1TA 4O51A 3FK3A 4FFZL 5B4MC 5AOLA 4G9DB 1WS8A 4G72B 5CHNA 1A7OH 5D7JC 2ZG3A 3TYFB 4JHVA 1SXBA 3SCMC 3HB3D 1AKJA 2L4OA 4R4ND 3NUKA 4X5LA 1PAMA 4OQ1A 5D1ZC 4PY8J 4WW2C 4K07A 2YIHA 4U6YA 2OR8A 5JIHA 2BIPA 4JPVH 4RMTA 5DSCB 3O4LA 1MWOA 2X3CA 3T2OA 1YN7A 3K71B 5IJDC 3EHBB 5JA8B 2IBGA 2QMJA 1T80A 2PYEB 1CO1A 2JJSC 3RHWF 1C5DA 3P0GB 2EO7A 4IJTA 4LF3B 3CZLA 1HL8A 1BOGA 1IBDA 1XD0A 3FO2B 5GS2D 4MMYA 1YAZA 4HHGA 5H35B 2QV2A 4L3EA 4U6XB 5CGYC 5DJCB 4OZ4B 2OMVB 3AREC 3U4EA 2ZKHL 3NA9L 2H32B 1G9HA 3BPCA 4WENB 5D96C 2D73A 1T1ZA 4I18A 4U7MA 4EI5B 2WXKA 2VQ1A 5AVSB 4OQTA 3E38A 2WXLA 2NY4C 4BKTC 1QUPA 2C4XA 4L4TA 5DZOA 4QTIH 1UWYA 3F58H 3QJSB 1LK3L 1DQKA 5MI0B 4F2MB 4ODSL 4YNYB 2W95A 3MLPA 1OAKH 5FCSH 3CFCL 1R3HA 2FX7H 1NDMA 3PL6C 5DD5L 3KWWA 3MRGA 3DGCR 4OD3H 1OP3K 5A2IH 2CHNA 1F1GA 1JNNH 4XH2B 5FOBB 2VDKB 1HL4A 1NBYA 2QPEB 2X28A 1BBDH 1A7NL 3BUQA 1TU2A 5C0AD 4G8GB 3U6XA 5DMKB 5EEVA 3WIHH 4HETA 2OTWA 4MMXC 2WGXA 4XGZB 4HA1A 5H2BB 4PRPB 2QVKA 5KSVA 4PS4H 5DHVH 4D9LH 2AEQL 1OEZW 4BA8A 5HDBF 3J7HA 2YLKA 2GK2A 3D85A 1KLGB 5I1GL 4S10A 1IEBB 4MNQE 3AQZA 1RERA 1T0MA 2ENQA 2O6CA 3CFJB 1KCLA 3HA0A 2HFEA 1J87A 3PAYA 4KC3B 3K6NA 4GRLB 2RB8A 4R7NA 5D4IA 3RJDA 1AAJA 1Z9PA 3KPRD 1R5WB 2F8VA 1YYCA 3C8KB 3HZ3A 3VW3H 4PVNA 5F88A 1FCCA 1AD0A 5FDWA 1EHNA 3BO8A 1U8CB 3QO1A 1UXSB 1GCFA 3HE7A 1UKSA 2HVJA 3LH2H 3FFCD 3LXUX 4IBSA 1DR9A 1WVZA 4DJMA 4JN1L 5D5MF 4E9LA 4D3CL 2X6MA 3GS7A 3BIKB 2A74B 3WDHA 1G9NL 1G43A 3BWUC 3VD1A 3GMLB 1X5FA 3KCPB 3DROB 1XGUA 4UV7H 1U2YA 3KW7A 5FWRA 5GPRA 3ZTNL 3NJMA 3CMGA 5J13C 1JPTL 4M7KH 5DD6B 5AVZB 4IEFA 4F2EA 1COBA 4AZ8A 3FNKA 4ZTEA 1MN4A 4TVPH 3DDFA 4IGBA 5F6IC 4KZ0A 4LPUA 2OTUB 3T4YA 2X7LA 3QK0A 4UTBH 1S7RB 3VNYA 3VXTB 1M6OA 3HJ0A 2Z92B 3BAKA 3FTGA 2EQDA 2AXHA 3L8QA 5LNDA 5E08L 1GMEA 1NGYB 5GRUL 3D3VD 2EC9T 4G80A 3OV6A 5HD8D 2AQSA 2P4AB 1AZRA 4L8SA 5T1DL 1A7PH 3ILPB 4UF7C 4BXSV 5HDBB 3U82B 4L48A 3M1BB 2ZX7A 3IE4A 1B4LA 2CHZA 4QXWA 2OMTA 1B2YA 1G84A 2YPVL 25C8L 3T2LA 4XHQA 3ATDA 2VLLA 5E8DL 1EHXA 3GHEL 5TQ2L 3HNTH 2OQJB 3QE5A 4FZ8H 3SDXE 3HRZA 3KR3L 2P5WA 4Q6KA 4Y1SA 1A6VL 4YFDB 3HE6D 4QTFA 5CS7A 2YBRA 5DHEA 2WBJD 1P84K 4JPWL 4DUWA 2H1LM 4PY7A 5E6IC 1EHKB 4J2XA 2GUOB 3ARDB 2NXZB 3MGTA 2H4EA 3RRQA 5HVWA 1DBBH 4OGYL 2ZUWA 1IVTA 3N1GC 1R6VA 3C5SA 1IC5H 3DJ9A 1N6UA 4HGWB 2I60L 5DLLA 1NJ9B 3PHQB 1HXYA 4HUXA 2ED9A 1MJ8H 2UVEA 5D5MB 5IHZB 3K7UA 3NK3A 4MAYD 1FO0L 2YD6A 3FOMB 4AMXA 1C5CL 3IMVA 5F3HB 1HINH 4CDHA 1KB5B 3WTXA 1DBAL 2VDLH 4X5RA 5G4NA 3V0JA 1JV2A 1F56A 1KGYE 2ZUSA 3B56A 3HHRB 1QG3A 2I26N 3Q6FB 4Z7NE 4PWEA 3B9VA 3EH4B 4N5UA 2HTLC 2R1YA 4G11A 5HI5D 5IVOA 3B2DC 2D3JA 3FRPG 3OHXC 4PJBE 3GXDA 3V9EA 3ZQWA 5JIPA 2MPVA 1BX2A 5JMRA 2Z7ZA 4G6ML 1WHOA 1F13A 3ECBA 3TFKD 4PGCB 2BSRA 3W2DH 2Z4QB 5E5LA 1I1AB 5K33A 4LDEB 4L1BA 5JW4M 4KJQD 1DQJB 2ARJB 1JZIA 2WKGA 3CHPA 4AQ1B 3AWFA 4AZUA 2WOBA 3MLSH 3W9DB 4N8UA 5F7NC 1QKZH 3N3EA 4CVWA 2OA9A 1IKNC 2K3TA 1PCSA 5B1AB 3EYVB 5I66B 5F7DA 3PHSA 4I9XA 3TEUA 1MHEA 1RJZA 2JKWA 3NCYP 4XAWH 4EIZC 1ZTMA 3LHPH 1HK6A 5CEXA 1QLRB 2A0LC 2F9BT 2J88H 4FNLL 4HPOH 1O9VA 4L3ED 2W59A 2K9UA 3CVBA 5F72S 2OX5B 4DK6A 1TZ8A 2QGDA 4HZLB 2XVKA 4N2KA 1GPOL 3EUDA 2GBAA 3WFCH 1NCBH 1R3IL 2FX9H 4QMEA 1NCNA 1FI8C 1KXTB 1A9BB 4BFIB 4ZDHA 4MFHA 1RU9L 3B2UC 4L4TD 5IB4A 2XZCH 1QSFD 5F70A 4QRPE 3FTSA 4W4NA 2FECL 4PYGA 3WNIA 4AT6B 1G9NC 3UZVA 2OAAA 1HYRC 2FUQA 1NGPL 4PJHE 5EC2B 2BCMA 5MENB 4NOFA 5F9WB 4YO0A 3ZTJH 1BAFH 4PGDA 3NZHL 1BGXL 5I74C 2J6EH 3IKCB 1D5BB 1HHKA 3ZE0B 1PPIA 2TRHA 2FZ3A 3H7BB 3VRIB 4EDXB 2VTFA 2PXYB 3VRLE 3EYSL 4WGVB 2AQQA 4X7EC 2BCKB 2NY7H 3UTQB 1AXIB 1I8LA 1V3MA 5FO8B 1IC4H 1AHWB 2GY5A 1XWVA 5CBEA 4A7VA 4E9QA 3A4FA 4BQ9A 1X7TA 4DUVA 5I19L 4JO3H 4ZG1A 2R0LL 1PEZA 2B7DT 2J2ZA 1UB6B 4FMFA 4LLAA 4C58B 1BVZA 1PNDA 3QR2A 4HGKC 3ZLQC 4XO5A 4ODTL 4IOFC 1M7XA 4LBAA 5K69A 2Q8BL 3B9KA 4L1TA 2WLIB 3OMZA 2V5SA 1JAEA 2ZQKA 3W9EA 4E0RA 1E3FA 8FABA 4C4BA 4FLHA 1WD8A 4POZD 1PJ9A 2XI9A 3EDFA 3DTUB 4KK5D 2EDOA 3RBGA 4XMLL 1QBLH 3VX1A 1OF2A 1XR8A 4XCEA 4RGND 3SBRA 3MCG1 4MWFA 4JFYA 3RBSA 3S36X 1IU1A 1I1FA 4F2ME 4L8CA 3AXHA 3RJOA 3GZQA 3B34A 4PREB 4UT7L 1EDQA 2CALA 1RSFA 1JVLA 1M6UA 1XXFC 3K4ZA 2YSSA 3Q5YA 5KYYB 3IWUA 2K45A 2EZ0C 2VLRB 1CD9B 4MDIB 1HU8A 3O0RL 1AIFA 2ZUTA 4OTXH 1FNAA 3H42H 2HFFA 1TETL 1X9UA 2D7NA 4NRXB 4ODHL 4XVUC 3LPWA 2G5RA 4G8GE 1J05A 1P1ZA 3UYRL 1AGBA 4UM9B 5BXFB 1UZ8B 3VFOA 4FXKB 4WIQA 1RZIA 2BPBA 1SXSA 2ITDA 3Q0HA 4L9DA 4MXVE 1WV7T 2FJHA 2NPLX 1NC2B 3IJ9A 3AG3B 3FB6B 1L9NA 1SJVA 3ARFA 4JG0L 1F1DA 1FFOB 2FJFB 3GIZL 4B95C 2WZAA 1E2WA 2FO8A 2N1KA 2ZXCA 4XN2A 4BXVA 2O6DA 3WFEH 2IVFC 2OXGB 3D05A 5J8OA 2OZ4H 4FP8H 1VGEH 4P3CL 5D7SL 2V9UA 2UZIH 4PRDA 3G5YB 5EZLB 5C09B 3MV7A 4XMPH 1F8TH 3KJ4B 2OMUB 7PCYA 4BWTA 1DSWA 2YQBA 1RKRA 1MCSA 2PCFB 1T0PB 3F58L 4C56D 5MEQB 1DLHB 3V55A 1YMMB 4JO1L 1BQHB 5C6TH 2F15A 2XBZA 1TJHL 3LIZA 2Q3AA 2IAMD 4NNYB 4NUJA 5C08A 5ITFA 4KMTL 2F74A 1OTSC 3EFOB 4LLMB 1HJBC 3Q5TA 4XWGH 1WK0A 5D93C 2B4CH 3E3QE 1JNNL 5IMKB 3KNBA 4RISL 5AD0B 3HMXA 5ISZA 5ACMA 3PP4H 12E8H 3Q9QA 1MW0A 5E9DB 1T66D 3WIHL 5FR3A 4B3EA 3WNNA 4FJ6A 2EDRA 4DP4X 1OCZB 1A8ZA 2OR7A 1GC1H 1OTTC 1YC7A 5D7JB 2WINB 3ARSA 3H4HA 4PS4L 2P52A 4NZRL 5HHOE 3STZA 1OP9A 4H88H 1EERB 1N68A 4NKOA 4UV4H 4XP9L 5D70H 2QDWA 2D31B 2JV6A 4G7RB 4IOSA 1DQVA 3IETA 4HXBL 4J3OC 1HDMB 3MACL 4JPIB 4DAGH 4LOVA 4UB0H 3VI3A 4BFRA 4ENED 5JNYB 3S3DB 5KBDA 4MNHB 3IVKA 4PWHA 3A0OA 2MCG1 3VW3L 4LESA 3BD3A 3CSBA 4L0ZA 4B7IA 3KDPB 1CDBA 1OP4A 4LVHB 1K5NA 5C7XH 2E7LA 5E2JA 1IE4A 3CVHL 4HF5H 4UOQA 1S9KC 3DTDA 5ACZB 3WTTA 4OQTH 4NM4H 3NEOA 5KVFL 4WHDA 5D9SB 1T83C 1TG8A 1EIBA 5IVXF 3E6HA 3VM7A 5BO1H 5DFVC 3OD3A 2AK4B 2Y2WA 2BIOA 5B1KA 4ADIA 5DUPL 4PJ8C 5A2LH 2NY4B 4RCAA 1ZT4B 1S46A 3QHTC 4V1DA 2R15A 2VLKA 2WLJA 5K93A 4BH7A 4LLUB 4UTBL 2XU9A 4E68A 3BZEA 1U8KA 3GGWA 3GSUB 2DYPD 5DYOB 1NZRA 3VACA 4I89A 4F9LC 1MCNA 3LEVL 1GA2A 5F21B 4JY4B 3BEVB 4PEEA 3TNMB 4MMXB 1FE8L 2AXJA 2NXYC 3CZUB 4ONHB 3BMVA 5FYJD 1P4UA 3SDCC 3DO3A 4Q89A 2DIJA 2P24B 3BKCL 5I0VA 2ZSWA 4ONOA 2K8QA 1MW3A 1JWMB 2LLLA 2O4EA 4P06A 2FBOJ 2VZSA 3DLQR 3UDWC 3PU7A 3LDBC 3NSJA 1MJ7L 2YXFA 3LRLA 3P73B 1O5DT 1PZ3A 4N0CD 1EFXA 2HG5B 4FKKA 5JOEA 3SJVE 5AOIA 4XOCA 3MR9A 3FONB 4F7CA 3QWNA 3RAJH 3C09C 3KYKL 3FN0H 4ZO6A 1NCGA 2IANB 3FQ1A 3QUGA 3BT2L 3QH3B 1LO3H 3ZE2F 3GRWL 5JLZB 4K3EH 5L8LB 5IB2A 2OI9B 4I0CC 1ACYH 1T4WA 3BH8A 5IVXB 1G7PB 3ZKMC 2RACA 4DT2A 1LNUA 4EN3C 3FU0A 2C1OA 4APQC 3REWB 1AXSA 3KD4A 3MCKA 1HINL 1E9QB 2WWMC 4PFEA 4Y0GA 4X5XB 1E4XH 4AQAB 4GUPB 3U6RB 2WW8A 2X4TA 5D7KE 3HI1A 4XT1C 3ZT5A 1EXHA 1NLDH 1XF5A 5I23A 4PBXA 1RQ5A 4OIAA 4HQQH 2DQIH 1AGEB 3PHAA 4ZTOL 2FIKB 1SN2A 2HWZH 2H3XC 2B16A 4AM0A 1RVFH 3BGAA 3HEIB 3HG1E 4KROD 3RJQB 3L3OA 2AJVL 3ZZSA 2NX5D 4XVJL 2UZXB 4TS6A 1OE2A 4IRZH 4WK4B 4HAFA 1EDHA 3R06A 4XMVA 5MENE 2V7HA 1OARH 1U4FA 2N7BA 3ARVA 3GMQA 1IB5A 2VO8A 2XFXA 4KKBD 4W4OA 5JIDA 3QEQE 4LCUA 3BSZA 2DWDA 4M5YH 1M57B 3G5ZB 1D9KD 4YDLC 4YUEH 5GRVK 1QKZL 2NY5H 3KE0A 1PZSA 1YCSA 2HH0H 4HWZA 3T0DA 1CFNB 2BFVH 4PUBL 4GI6A 2ICEA 5KSUA 3ULVD 2BVQA 4DP7X 3FT2A 1QRNE 1EAPA 3TZVD 1H3PL 2DQFA 3NAAL 4U1KB 1P4IH 4LE8A 2XQBH 3OZLA 3V9CA 1O9ZA 2H2SD 4G42B 1CB4A 2IIJA 4DETA 3MV8A 3QGVA 3CSYB 1EEYB 1SBSL 4MQ7B 4WI7A 1AQ8A 1WWWX 1XAKA 2ZAHA 3I02B 3WFCL 4JM2A 5JR1L 2JI1A 3C6SA 1NCBL 4PLKD 1P4BL 5BRZB 2MCPH 2XZCL 2VXTL 2YPKA 1TZHB 1XCTB 2EXYC 4PD4J 1O7DC 4M6OH 4JUTA 3V4UL 1RPUA 3WNMA 4KNSA 4MD5B 5MERB 3FH8A 3LRKA 4AWJC 1NINA 5CWSA 4J6RL 3FOLB 3G5XB 2F1AA 3O41A 3N06B 2Q7NA 3LSOA 3T6QC 2XG5B 3KPMB 5JXAH 1JOIA 4FQHB 1NCUA 1QLFA 3RB7A 3T0EB 3VFUB 1FL3B 3EO0B 4X6CF 3GJFA 1Y0LA 4HSQA 1PKOA 3U9UA 3VWKC 4DQAA 3QIBA 1R47A 5ELIA 4E41A 1KBKA 1ZA6A 5AFAA 2CRIA 4KO9A 1KYFA 4UU9A 2BO0A 5MP6H 2ITEA 5CJ5A 5JIQA 2VLRE 3C08L 2J1WA 4L9LC 4WI0B 3UAAA 4EUPG 3NJFA 5CM1A 4GG8B 3LN9A 2NY7L 3DSNA 1DVFA 4OD2B 5C2UB 2WLNA 1IC4L 1EANA 1XCQA 2GJ6A 3OM3B 3KCWA 2FNWA 3ES6A 3PRZA 2E9BA 5BOPA 3GKWH 4CVXB 2VW4A 1OK8A 4AX3A 1KN4L 5C0CE 1CLYH 3SD2A 4PV8A 4P59H 3KYAA 3SKOB 1QO3B 3ZMRA 5A2JH 5KANG 4PLJD 5IQOA 1S7QA 1TPXC 3ZQXA 5IB1B 2FB4L 1LP9A 1LK2A 2D03L 1TF4A 4I9WD 1ID5I 5DCCA 1RJYB 2HT4C 3CSPA 3DIVA 3D18A 5HI3C 1Z5HA 3TX4A 2JJWA 3UTPE 1BJ8A 1F41A 4P46A 1X7SA 5C09E 3APFA 1S5IH 5AW0B 3KPPB 4B97A 4TTDC 5FM4A 1U93B 3EADA 4Z1PA 1QBMH 2CUAA 1ZTXE 2DWSA 4I3GA 4LHUD 4P4KD 4QXTA 2IPTH 4JFXA 3ZUNC 3RUGF 1YMME 3EO9H 4EXPX 1P6AB 1VZGA 4Y2LA 5GRYA 1MFDH 3VMOA 1O9WA 3HB3C 1FJ1B 1D2OA 4OGXL 5HYJE 2YAOA 1O5PA 4R4NC 4CAGA 2QMKA 2V17H 1NC4B 1UUNA 1RULH 5I28A 4NO0A 4OTXL 3I9IA 3MN8A 4V1DD 5L2KE 2X70A 2RBLA 4TULL 4OGQC 1PX4A 5I6NA 2YD0A 4WDIA 1CUOA 5JOFB 6FABL 3QZPA 4X6CB 5E9DE 2IOOA 1EO8H 3POCA 3S0PA 2J20A 4FQQB 1WAEA 1OSPH 5I74B 2B1HH 3BN3B 2FL5A 2ITCB 3Q06A 4J3WA 1RZKL 3GLAA 2QR0B 2F53D 1R4XA 3HLAA 1K5WA 1UENA 5C0RL 5LXGL 4U1GB 2FHCA 4ZFOB 1A6ZA 3KS0H 3B2VH 3KHQA 2C9XA 4GIPD 4JFHE 1WISA 2UZIL 4E9TA 4HJGA 1VCAA 4JFTA 4PV9A 2FCBA 3I6KB 3CLWA 4JFSA 4RQQB 3D5OF 3L95A 4QXUH 5DRXA 3LKRB 1MHPL 2BP5M 2C9RA 4HFWB 4A63A 3IF1A 3QWRD 4LSPH 9CGTA 1P5UA 1IQWL 3RL1B 5A43C 4ANWA 4JRLA 1U8OA 2JK5B 2GJPA 4FKHA 3HNSH 5DFWH 4Z76A 1RZJL 4D9QD 2MOGA 2LR4A 2Q9OA 4GQ9H 4XWGL 2YUVA 1J0HA 4AENB 2NNAA 1D3CA 3NSFA 3UG3A 3OGCA 1S5HB 35C8L 3OLDA 4FTVE 4XBPB 5ADOL 2AV1A 1Q8MA 2AK4E 2CDFA 2N01B 1HILA 4F7EA 3DX6A 1OL0A 12E8L 4NSKB 4HJSA 4NQCA 1LWJA 3RUGB 2XV2A 2VW7A 3I84A 3QORD 4JFDA 5DK2A 4JN2A 4BFEA 5B3JE 1AS8A 1TJIH 3PJLA 4NQDD 2LVEA 1RZPA 3H9HA 3TJHD 1SYVB 3O6LH 3WGUB 4YSAA 1XF4B 1HI6A 1QSEA 4JG9A 2VDPH 2Y23A 1FO0B 1RFDH 3P77A 3GT6A 1L7TH 4P5RA 2XUWA 4HCRH 4N0YL 4YHNA 1TKWA 5HY9B 4F7MA 3FQXB 4QY8B 2E4FA 3DARA 4HUUA 3NZ8B 3JZYA 3RB5A 3TJEL 4DAGL 1ZA3A 4UB0L 2DM4A 2X89A 5I8KH 4ODWA 3CPLB 2A6JA 4G43A 4E5XB 3GSRB 4U0RC 5C7XL 4UQIM 1PSKH 4KTEL 4HF5L 4OAWA 4F8NA 3CX5K 3HTLX 3QS2A 1I3UA 3BZ4B 4NM4L 4Y9GA 5C0BD 1A7RH 3VSTA 2HTKD 2G2NA 2XSKA 3K6IA 1YSOA 5BO1L 1M3JA 3D30A 3NCEB 2WB7A 5IB3A 4TUUA 1CDCA 2IV9A 4PVLA 4PJFA 4CC4C 1KXQE 5CJXA 1K4CB 3LIZH 5KN5A 3RZCC 1IGFH 1AGFA 4OCYH 3V52H 5I16B 3RGVB 3FZUD 4K7FB 3TIEA 1U8NA 3ESMA 4PJIF 4XVOA 5DU7A 5E51A 4XXDA 4TV3A 3UEZA 5IHWA 1QVOA 3ZDYF 5GS1A 4LKXB 3VXRA 5IJKC 5BZWB 3HMXH 3ZE1E 2EVGA 1KY7A 4WCYH 5DEJA 5F96H 4CMHB 1Y6NR 1BFSA 4N6QA 4L4VD 3KYOB 2DJMA 4Z0XB 1B6UA 1F3DJ 2OJZH 3BVWA 3QNYA 4XN5A 4WWPA 3WNKA 3UZQB 3ZDZE 5LJYH 4Y2DA 2PR4L 1GGUA 3DUSA 3EJYC 5HD8C 3EYOA 3IDMA 1IM3A 3BUYA 3UMNA 2V3EA 5DLML 1WHPA 2WP3O 3II2A 3KXFA 4LLWA 1MHCA 1AGCA 4JL1A 4ATTA 1AZVA 4GIOA 2HLFC 5ICXA 4GRWE 1LO5B 3CDGA 1LE9A 3K8MA 4I3SL 3S34H 4WEMB 1EBPA 5AB9A 2D2OA 3HE6C 3ASWA 1XZ0B 1ACCA 4HWNA 1EX0A 4TF4A 5TH2B 3FN0L 3Q2NA 1MFEL 1FZKA 4GS7B 2WBJC 2XY1A 2F18A 5KVDE 1RZKC 3L5WA 3OKEB 1D5XA 3ZSSA 4IKKA 4NERA 1J9SA 4NENA 1PZ5A 1FZMB 5DURB 1VB9A 3RTQD 1CBJA 4N85A 4UOJA 3MROB 3RFZC 2DQCH 1ZRUA 3BVVA 4MAYC 1UASA 3PWVB 4ZO7A 4Q6IA 4A2HA 4BE5A 4DEWA 5AAWC 3CDYA 4PBDA 3GQFA 2JKNA 1VFMA 3LMJL 2KI6A 1DUYA 3FAXA 2DKSA 1NAKH 1Q0YL 2ZOTA 3ZE2E 4M8QA 1E4XL 4PJIB 1GZHA 2GJJA 5DVMA 5IOKA 1RLBA 4HKJA 4Q52A 3ZDYB 1NLDL 1RZJC 1U58A 3GMOB 4PB0L 3AG1B 5HI5C 3V8OA 5IGXH 1KYOJ 5B3NA 2HWZL 1C12B 3PP3K 4LVEA 1RVFL 2F6AA 1Z0MA 2A4ZA 4XZUB 3UJIL 3MJ9A 3Q01A 4XRCA 4BYHA 3TFKC 1OM9A 4ZO8A 4CUCA 2JQZA 2D7TL 3WLBB 2CCVA 4DHLA 1OARL 4N20A 2XTJD 3K6SA 3MV9E 4LAQL 4KJQC 2I69A 2TSAA 5A16A 3M86A 3BVUA 4HH8A 3WXVH 2WYZA 2NY1B 3V0FA 1BVLA 1KBPA 2HH0L 2J55A 3GHBH 2ZWNA 3OMIB 3BUPA 2A9DA 4YH6A 3WUWA 3GXIA 1NM4A 4EZJA 4JO5A 4ZX3A 1QEXA 2C7UA 4WSJA 5CF3A 1ADQA 2GTWB 1PAZA 3C09B 4LT7A 2AF2A 3QRGH 4PG2A 2YBGA 4JRYA 1ZK5A 4GKLA 4FCAA 2XN9D 5AW3B 1KPVA 2J57A 3MJ6A 2MCPL 1BZOA 3ZGIA 1JF6A 1Q0EA 3D0AA 4EN3B 3KEHA 4APQB 4N6RA 5AG9A 1I8KB 4IBWA 3GJEA 4L4JA 5F7YC 5BUGA 3MZGB 3RYMA 3B9AA 3BH9A 4JPSA 1UADC 3VXSA 2JKXA 4KY1H 3VGDA 3QUMA 2EYSA 3KYMA 5D1QA 4B5ZA 4F3FB 3QHZL 1A64A 1QW8A 4MNGB 4AUUA 1HNFA 3HI5L 3J27A 3WENA 1YDPB 4JFDD 1TO4A 1ZEAL 4EXKA 2O1AA 1BHGA 4RAVA 3RKDD 1H9DA 3V6BR 4QXGL 4DTGH 4X6CE 3PDGA 3D52A 4UDTB 4W9LC 5JTWA 1JXFA 3ZHKA 5CZVH 5KYXA 3DXAA 1X6LA 3EGXA 3RL2A 5DHVB 5IK3B 3WJLC 1YEHH 3QCVH 1IC1A 1SM3L 4AKOA 4ZD3H 5KS9F 1KEGL 3FMGL 1X5JA 3PAZA 2BNQD 1W0VA 5DVOA 3QZWB 1ZIAA 2XPGA 1DUZA 3PWUB 3G3LA 4BFFA 15C8L 1KTDA 2VSMB 5IBLD 3KGSA 2APFA 4NAQA 2GIYA 4M02A 2WNKA 4G6FB 4KK5C 3MBXL 4BFNA 3JWOL 1S5IL 1UXWA 2DLHA 1PNCA 4PRID 4DOHB 1MELA 1RIVL 1RP9A 4FQLH 4YPGA 1UWGH 1MAKA 2ZNWA 1QBML 4RGNC 1P7KB 3F2LA 2V2WB 1CFSB 2IPTL 3MA9H 2LV4A 5EU3B 2YO3A 4Y5VC 4PGJA 1JZJA 2BK8A 3ZR6A 1HOCA 4XVTL 4X6BB 1QHPA 2AV7A 4KGJA 5FYJL 1MFDL 3QDHA 4Z78B 5I2IA 4RMRA 2KERA 4MD4A 4KNQA 3A67H 3TH4T 2Y5TA 2H8PA 2V17L 2GC4C 3CZSA 4EZMA 3BFQG 4BJLA 4LNRB 4AC2A 5DQJB 3GJFH 2ADJA 4WEBH 3SGJC 1BQLL 4IGBC 3UIYA 4XB7A 4Q56A 1AG6A 2CPCA 4U1NB 5HVGB 3BMWA 3NG5A 5FO7B 4S0TD 2OR9H 3RUGE 1A0QH 4N1EA 2J25A 4R4FH 3TURA 4J7RA 2FIRT 1DBJH 1P7QD 2P80A 3UTSB 4NQXB 3FN9A 1G7IA 2Q5BA 5T1KA 1BQHG 2G3MA 1HL9A 4Y2DD 2J73A 2XWJA 1GZQA 4JKMA 4P9MH 1U8PB 4L8SC 3QARA 4TVUA 2VYRE 1XDTT 3TVMB 1HHHB 1A8JH 1H8OA 4YHIB 2QSCH 5FLUA 1ODUA 2BRQA 1DLFL 3QFDA 2FQEA 1YYLL 4JFFD 4AV4A 2HLEB 2FQFA 5FUCE 4PGEA 3IRZA 2FRGP 5KS9B 2AKRB 2WGNB 1QZ1A 3RDJA 4GBXA 1GTNA 1P9MC 4IS6B 3RILA 4LU5L 1EGJL 3OKDB 4PY8I 3OR7A 2IAMC 4RMBA 1HHJB 4MD0B 3AS1A 2BSTB 4GQ9L 4PJ7A 1B4JH 4QO1B 4YQXH 4QLWA 1E2ZA 3L3HA 1H6EA 1TIUA 4QUOA 3ZUCA 2FLRT 2MOVA 2HSIA 2TAAA 3QO0A 2R9HD 3WN5B 4PVBA 2F5BH 2YMXL 3R8BB 4M6MH 2QHRL 4OFVA 3CK0L 1T66C 5EBMB 5KYWB 1ASQA 3BAEL 1I8IA 3FT4B 3CBJB 3MRJA 4G83A 4ZOEA 5I1AB 2CK0H 2VIRB 3G04B 3L4TA 4IBZA 1CIDA 5K9OA 2R0WH 3DMMB 2V9RA 3NCCB 1SY6A 3OR6A 4LARL 5IEHB 1TTCA 3QNXA 1NGZB 1L7TL 2EE9A 2ZT9C 3ECWA 3QQ9D 5CD5D 3QUKA 2XOTA 2NZ9C 2C3VA 4XCNA 1FORH 3QC6X 4LPYA 3TA3D 1U6AL 5BRQA 2JCCE 3JWNG 1IGJA 2VDLB 3MRPA 3BDYH 4G8IB 4LAJH 3WHE1 2HJLA 1KGCE 3M88A 1G6RL 5HHPB 4ENEC 3W0WB 3OKOB 1HZHH 3GSXB 1JF1A 4WKZA 4WWNA 1KCUH 1PSKL 1PLGH 3AABA 4JM4H 3O3EB 3B8SA 3US9A 5I1JH 1EJ6A 4EKXA 4X7TB 3SKMA 5SWSB 4S1RH 3VXME 3P3YA 5HGBB 3F6LA 3MRIB 3C6LD 3V6FA 1TQVA 2C4FT 5CZRA 5H94B 4JLRB 2EUXA 2FSEB 1LO0H 4X4XB 4PWGA 3QJFB 4Q97A 2VDQH 2NY0D 2WUBH 3NP3A 5C92A 1C9SA 3N50A 2X4OB 5KYUA 1M2VB 2ZCKL 3BH4A 4F8TA 4G5ZL 5B21A 3CQPA 1RZ7H 2XA3A 1L7IL 1KOAA 4OCYL 1JGLH 2NY3B 3A47A 1NIAA 1K9TA 5GGTL 5DRZB 1P7BA 1KUMA 1V7MH 3DHMA 1F4HA 2PWGA 5DUBB 1SDDA 3L3DB 1FSKC 4M00A 4NDMB 2EEBA 3INUL 4TUJA 5HYFA 1BA9A 1NIBA 3JWOC 2A83B 2ZSVB 4UUJA 1Y07A 1FQ9C 3DBXA 3EXJA 3P4NA 1ZGLM 5EZIH 5D7LE 4YHZL 2EDJA 4MJIB 4B96A 3GTTA 3E2HB 4OCSL 2O5NA 6PCYA 5I1KH 1GVIA 3CTTA 1ND0A 2X6BA 3H0TB 4CADB 3X12A 4N86A 1D5IH 4DP5X 1O6SB 3EFDH 3MYJB 2E9IA 3BQUB 3INOA 1SFHA 4QRRA 1XGTA 5C71A 3LQAH 3S34L 5ANMB 2A9AA 1DVSA 1F4YH 1INQB 1KIPA 3VXSD 3N9GL 3FQ4A 1RJLA 1OE1A 2ZUVA 3QUXB 4IRJB 5E8EA 4OZIA 4JVUA 2HFTA 4K9EL 5ECGA 2V9TA 5I1LA 1XH3A 3ETSA 3GMPA 3K2MC 1QRKA 3QFJA 1T20A 4R96B 3RA7H 3P30L 3QNZB 4BV1A 1SBBA 5M95B 4U0RB 2B5IC 1SJHA 4OLXH 3ELQA 3JTTB 4PJXA 1CGSH 2CAKA 3RX7A 3WY3A 5IHUL 3GI9H 4FQXD 3DXAD 4Q9BA 4BGDA 3AACA 1C8PA 2MWCA 1QUNB 2LLGA 2PP8A 2Q3XA 3LD8C 4U4IA 4X8JA 1UOLA 3G6AB 2CDEA 3BE1L 2TSBA 4U3XA 3T1FA 3C2SA 1LEGA 2Z0UA 2DM2A 4PP2B 2VXVH 1EAOA 1RHHA 4I2XB 1NAKL 1KF9B 5HHMB 3NT0A 4NPYB 5D7IA 3H53A 3K2KA 3OKKA 4PJEF 4Y19D 4HIJA 3ABZA 3QXVA 4TM9A 1N4XH 1BJ1J 2VDRL 3TCLB 5E95B 1KXVA 2B15A 5D2NE 1S7XB 2JJTA 5CJOH 5F7UA 4NQEB 4RNRB 4KROC 4H44C 1FC1A 4WJ5B 4Y4HD 2NZIA 1X7QA 4X2UA 4LQ1A 5EA0H 2ZOUA 4MMZC 4KKBC 2IMMA 1XBDA 3LPPA 4WHTB 3MSPA 3MGAA 4EIBA 3GZPA 4MRCA 5J3HD 2IQ9L 3SYCA 5CZXD 4ZXBD 3RNQB 1D9KC 5GGSB 5C0JB 1WE5A 2QADD 4MNGE 3CN2A 5T33L 4R0LB 5ICYB 1MFMA 4G70B 3V0HA 4MS8D 2R69A 4JUSA 3S88H 1IGCL 2UZYA 4JO2L 3T6WA 1BEYH 2WXPA 1VACB 3VXQA 2IQAA 3QQ3A 4JZJB 1FDLH 3K1KC 3PDOB 3TZVC 2ENSA 2NR6A 1MFBH 3U48A 1Q38A 3G08B 1ASOA 2H2SC 4JY6B 5TGBB 1FGVL 2VLJE 4CRPA 3WEBA 2E47A 3DJSA 1EH9A 2CLZB 1UM4L 2DAVA 4R5VA 2WXRA 4UWQB 2OSWA 3CMOH 4M4RB 1NKRA 1WFOA 5IFJB 2ADIB 2ZKXA 1OLLA 4PLKC 4NO2A 4BK4A 3BW9B 4OLZL 3LKPA 4YHLH 5I15L 1E6OH 2DQJH 2JKJA 1SJMA 4MAYB 1GYCA 3BESR 1MH5B 4TRPL 5DEFA 1MDTA 3MI6A 1JWUB 2Y7QA 4ETQB 2YOAA 3AQYA 4DOHE 4F57L 1CIUA 5AQ0A 3VD4A 1EUTA 3KLQA 1T5KA 2ZAIA 1WYJA 4XOEA 1P84J 2ZONA 2WCSA 3SE8L 4PJEB 3VYNA 2HPOA 3M6DA 5T3ZD 2Y69B 4ODVH 3AZUA 1T7VA 2QFRA 4OM1L 5EEZA 4MVBD 4PJ5E 4FFVD 4Y9FA 3MJ9H 3MRNA 4PJ9B 4O51B 3M45A 2P9RA 2ZWYA 5CHNB 4NKMA 1XB6A 2H0FA 3BSZL 4CSPA 5FYKU 1QPPA 1AKJB 4FZEL 4O02A 1F00I 4XOAA 3DSFH 4OGZA 4TVPE 2BS8A 4U6YB 5F7FA 4WFEE 3O4LB 3UTSE 5LBGA 3DJTA 4FFYA 1INEL 1YN7B 4MJJA 4YE4L 4X9BA 3ZL4H 2CRZA 1M1XA 4OV6F 3DHUA 1GGCH 4PLJC 3AB0B 1I9IH 3ZOAA 1ADQH 1N0LA 2XT1B 1C5DB 1AQHA 1MEXH 3IMWA 2WLLA 1CG9A 3Q2LA 1UWXH 4K9EC 1BOGB 4LPXA 3IS0X 2E7LC 1UURA 4MMYB 1KB9K 3KBPA 4FQLL 4L3EB 3BKJH 4LPCA 4M03A 2CM6A 1KV3A 4XNUL 3S4SG 3MA9L 3U4EB 5FFLA 4H5SA 4P4KC 1H3XA 3BPCB 1T1ZB 3QAQA 4I18B 1XBRA 2VQ1B 3A67L 4M43L 2WZ0A 1ROCA 4L4TB 4EO5A 2WTRA 4HU2A 1QBAA 3H1ZA 5T8IA 1IFHH 3KVPA 2EIEA 2EUVA 1RSYA 4YX2L 5CCKL 1R3HB 1QX1A 1NDMB 2Y3NA 3PQYA 3QUMH 3KWWB 1A0QL 1J8HE 3MRGB 2O93L 1A6UL 2DQGH 2WANA 3TT1H 4I1RA 1ETZA 2YQ3A 1OCOB 1NBYB 3OB0H 1KCRH 1TU2B 3VGHA 2P26A 2XWBA 4WFHD 1MKFA 2B9AA 3OZ9H 4KVPA 2FAUA 3TBTA 3GINA 1JD9A 1PG7H 2OTWB 4MSWA 4AGLA 1TZAA 2V5RA 3C2AH 3OKNA 5KSVB 3CG8A 2QSCL 1G6VK 4S2SB 4G3YL 2YQGA 3CC5A 3EFFA 3D85B 1RIUL 3MJ8A 4X6DE 4Y1TA 4JPKH 5CN1A 2CO1A 2WXFA 4F8OA 4LSUL 1T0MB 1XCWA 2HFEB 2H26A 4OFYA 4WWKA 1PKQA 3UROR 4R7NB 4DW2L 1OW0C 3ABLB 5FO9A 4DERA 1Q4NX 2LU4A 4DWHA 5F88B 2HP4A 4RVBA 4NM8L 1AD0B 5FDWB 3BO8B 2F5BL 5IESH 3NACL 2CA3A 2R56L 1PY9A 1N64H 1YEFH 2QSTA 4Q58C 3AY2A 4TLSA 1HJCA 3QO1B 3VQLA 1AG0A 3HE7B 2HVJB 3QORC 4PCTA 3WXWH 2DRUA 1BG9A 1OPGL 4ZW7A 1WWBX 2A99A 3C8HA 3JSSA 4FLOA 3TJHC 4E5XG 3EH1A 3JTBA 5EO1A 1XGUB 4BGLA 1TZGH 1CTNA 3P3UA 5IJVA 2JI3A 2E7CA 1IC7L 1OB0A 4IEFB 4LEXH 2VAAA 3STLA 4AZ8B 4N8VA 3U9PH 3G6DH 3JV6A 5CJQL 1AXTL 3WNLA 4J3SA 4IGBB 5ECJE 3BDYL 1USZA 5GJSH 3T4YB 2X7LB 4RFEA 5I0XA 2JNZA 5KG9A 4FQ1L 4H40A 4RDBA 1M6OB 2VZTA 2AEPH 2R4SH 3FTGB 3TWYA 3ROLA 5SX5H 5I1JL 1KCUL 4IMLA 4JM4L 4YJZL 4QAWA 4G80B 3N1MC 2ZJSL 3E80A 3ETBJ 3IMRA 4W4OC 2DLTA 3NEXA 4L8SB 2BMKA 2JF1A 1LO0L 2ZYHA 2HTKC 2B2XH 1QMUA 3S7GA 3ISRA 5LGKA 1JS4A 2OMTB 5IR1A 5IMMA 4P9HL 2VLLB 1ZV9A 3QDMD 3DV4A 5BS0D 2F1BA 3WL9A 4GIAA 3HRZB 3FZUC 2P5WB 4OD1H 4GEJA 4ZO9A 1V7ML 1SLVA 1DSYA 3IAGC 2YBRB 1E9OA 3UC2A 2YAEA 4XAKE 3X14A 4PY7B 4XTRD 1WITA 3MGTB 2CWRA 3B43A 1CICD 5ID0A 4JRXD 3QWQB 4KI5D 4JAMA 5HTSA 5SWQA 3C5SB 5I8OH 2BJML 2BP3A 2X87A 1M1SA 4ODUA 5CGBA 3QUZA 4EOWH 3S97C 1HXYB 4NAJA 2J56A 4HUXB 4FL4B 3BZDA 4DO4A 5HHME 1OAZH 1SY6H 4WUUD 3P69A 1MY5A 2XIBA 3FKUS 3NQKA 3Q6GL 4ZOCA 3ZGHA 5T3XD 1U92A 3ILDA 4ELDA 4JE4B 2BHZA 1JV2B 3QZMA 4NQEE 7PAZA 5DJDA 1MCLA 2DPKA 4O2CA 1CYWA 3HZVA 5FC9A 2R1YB 4Y89A 5TPWL 5LG1A 3UBFA 1TJMA 3SY6A 1BX2B 3RA7L 1FGNH 3ECBB 1NCWL 2KLTA 3OTTA 4OLXL 4YE0A 3T2NH 2BSRB 2QPDB 3PWPD 2I32A 3AFLA 3QPXL 3RVWD 4YBLC 2OMNA 1NFAA 4RX4A 3TT3H 2VH5L 1BM7A 3RTQC 4MJHA 4ILDA 4DP9X 2ZUUA 1X9LA 3VGGA 4QRSA 3QDGE 4PI0A 5AW9B 3OMAB 2ZF9A 1SOQA 4I77L 5F7DB 4ZX5A 1MHEB 1RJZB 4KRPD 5DVPA 3I3DA 5GIRA 2GSMB 3BP5A 4XCCL 3SZKC 4OF6A 4UMGA 2EEAA 5CEXB 2D7QA 4Q0XH 1TJXA 4TTGA 4M62H 2YJQA 5T1MA 4F80A 1SXZA 2R2HA 4Y7OC 2X1WL 3VNZA 1UA3A 3CU1A 1BP3B 4I48A 1BJMA 1DN0A 3E0GA 1JDCA 4IJ3C 4LCCA 4PIBA 5LO7A 4JHAL 2AEWA 3L2NA 1Q94A 1N5AA 4ZDHB 1P2CA 1YEEH 5IB4B 1ZT1A 5I17A 5ENWA 4KITB 4PJEE 3ZDXF 3FH5A 4KVNH 1JXGA 4Z7OF 5C6WH 3UZVB 3X13A 4AL8H 3K6FA 1MZYA 2VL4A 4HXAH 2BVPA 1F58L 3GXFA 4YO0B 2FATH 3MBWA 2WBXA 1BEYL 4PGDB 1F3DH 1A4AA 3B2XA 4HPYL 1HHKB 5IB5A 2WK2A 5KOMC 2FZ3B 3HJEA 3F7KA 1CD0A 2NQ3A 5CD3A 3FTVA 2VDOH 4PW3A 1HWGB 5FCUL 3O6KL 4IBQA 4XNYH 1L4IA 3SDDA 1OB1A 4R3SA 3CMOL 4TUOA 3U7WL 2HT2C 5CBEB 4W81A 2VR3A 1W91A 4LGPB 4E42A 2GYSA 1PTZA 3QIUD 4H8WH 4P5MA 4YHLL 3KLKA 4D0CA 1E6OL 4UYQA 2WSPA 2J2ZB 3LD8B 5HPOA 4XI5C 4D94A 4BZ2L 3VMPA 3IDYB 4OFYD 2ERJC 4P9HC 3B9KB 1IILE 1ZLUH 3NPZB 3W9EB 4E0RB 8FABB 4FQCL 1KV7A 4KHXH 2BX5A 1NUGA 1J86A 4ODVL 1MLCA 1XIWA 2KUTA 4RMQA 1KCWA 1OF2B 1T6VN 1XR8B 3MJ9L 4XCEB 43CAA 1AO7D 1VZHA 1HN1A 1WZLA 4MX7A 4MWFB 4AV5A 2AS5M 3QZWG 4JFYB 1OANA 4IRSD 5FGCE 1I1FB 4L8CB 1FHGA 4XMKH 5FHBH 1CXFA 3RKDC 2G3XA 2WYIA 2YSSB 3ZDXB 2HX9A 1W0YT 2YC1A 4PP1D 2O6PA 1H6TA 3FO1A 3LZRA 4P49A 4Z7OB 2NNCA 1AIFB 2DQUL 4YSCA 2EDFA 4J6IA 2YD2A 1SYSA 3UTZA 2R69H 2Z7UA 4FI8A 2HFFB 4RGOH 2F54D 2VDPB 2HT3D 2XXGA 3ZL4L 1J05B 1P1ZB 2XA8L 1AGBB 3VFOB 4JQXA 5GGQH 1ADQL 5C07E 5I5RA 1RZIB 2ITDB 1U41A 3VI3F 1AHKA 2FJHB 3ULUE 3BAYA 4BWWA 5IBLC 3FCBA 3ARFB 5K9QI 2PO6D 3UZEC 3KZ8A 1WAPA 1CWVA 4FULA 4LOFA 3NYKA 3SDXA 4YC2C 5JPNA 2VRKA 3CQFA 2YWYA 1CLZL 4YFLI 3QHFL 5EN3A 3N0AA 5FA4A 4PRDB 3MV7B 4JDVA 3ZSTA 2M26A 5C0DA 1OSYA 1KFAL 4CNIA 4EZLA 4AC4A 4R8WH 3JVGA 4XNZB 4P2OD 2ZPKH 1T5WA 3UGEA 5D72H 4NUJB 5C08B 3CNKA 5ITFB 3GFUA 5GS1C 3S3PA 2F74B 3QUML 5FYKH 1VGKA 3CIAA 3WTSA 4M5ZH 1YNKL 5C3LD 2DBLL 2MHAA 2CE6A 2YD4A 3KNBB 1CDYA 2H47C 1KCRL 2EDEA 5ISZB 4N26A 3T6XA 3OZ9L 4M7LT 3EOTL 4W70A 5I1CH 2DN7A 4Y2DC 3KDMA 4O02H 4TNWF 1IZKA 1WZKA 3MUJA 1WBYA 3MBED 4MJ5A 5HYQA 1GKEA 5HXMA 5L8KB 4R7DA 3STZB 2CGZA 3GUTA 1GTFA 4FFYH 4HG4J 1PD6A 4O2FA 3UEQA 4NKOB 2BW5A 6PAZA 1A2YA 1PZUB 4PB9H 4DVRH 2IH1A 3HS8A 3BPOC 3IETB 1JHTA 4QHUA 4L0YA 5SWZA 3U7AA 3S3JA 3IFLH 2AQRA 4OVUA 3VI3B 3IVKB 3I9PA 4AIZA 1JPEA 3OPZH 3UJJH 2J8UE 2X2HA 5I6XC 4S11A 1K5NB 1PVHA 3CXHK 2RTTA 4ACTA 3L7EA 5IESL 2R9HC 1YEFL 2EIBA 3F7VA 4MA1B 1Q9LA 3WIIH 3WXWL 2YA1A 2V3DA 5EZOH 2P5WE 3E6HB 4KFZC 3PNWA 2IO5A 1X9QA 1ILUA 3LXAA 4MCYA 4XBEH 1LXMA 1TZGL 1Q72H 1ZLDA 2OP4H 4LEXL 5AVQB 2CO6A 2AMUA 3QQ9C 1GZHC 5CD5C 4V1DB 2EXSA 3TA3C 5D1XE 1HKLH 2VLKB 1SQMA 1TOXA 4BH7B 4QRPA 3MOAL 1EWHA 1DBML 4MQTB 3V8CA 4BKLA 1AR1B 3R1GH 3BZEB 3QQDA 1N26A 1U8KB 4HJTA 3GEFA 3GGWB 4PJHA 4DN4L 2J3SA 2R4SL 4ZUTA 4TL5A 3F64A 2XN0A 2XZAL 4HIIA 3GXPA 5I73B 2YK1L 1BF5A 4ABQA 2R8SL 3C6LC 2APWA 5LGHL 2NZ1A 5INDA 2ZSWB 1KIUA 1T22A 3TH2T 1UH2A 2NY0C 4H1LG 1IV8A 2Z65C 3VG9C 4BA0A 3RPKA 4PBVC 1EFXB 1J8SA 4PJAA 3IPFA 5E70A 2JKRM 2BNRE 4MNQD 4MRBA 3FQYA 1IAMA 2HRGA 1YG9A 3I75A 3MR9B 4GFXA 4F7CB 3HG3A 4JKNA