4A66A

Mutations in the neighbourhood of cota-laccase trinuclear site: d116a mutant
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
510
structure length
501
Chain Sequence
b'TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHHEEPEVKTVVHLHGGVTPDDSAGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SPORE COAT PROTEIN A
publication title The Role of Asp116 in the Reductive Cleavage of Dioxygen to Water in Cota Laccase: Assistance During the Proton Transfer Mechanism
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 145
structure length 501
sequence length 510
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a66A03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a66A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a66A02
4HCFA 4HHGA 3NJNA 4ENZA 3SQRA 3FU7A 1ID2A 3G5WA 1MG2C 1SFDA 1V54B 1PCSA 1BYOA 4G72B 1NIAA 2GI0A 1KBVA 2CAKA 4N8UA 3JTBA 3OM3B 1JZJA 3CDZA 1GSKA 2UXVA 5AFAA 2JXMA 2BW5A 4F2FA 1SHXA 4A66A 1MDAA 2VM4A 1J9RA 2MRYA 4YVUA 4AI7A 1A8ZA 1OE3A 3ASNB 1ASQA 2YAEA 1L9PA 4DPCX 1NPNA 1J9SA 2PPFA 2BHFA 4BWTA 3T6WA 3PXLA 3UGEA 2QPEB 2VW4A 3NJGA 2FNWA 4P5SA 5E9NA 2YAFA 1ZPUA 1PLBA 3OD3A 1JXDA 4CSZA 4Q8BA 2EIMB 5F7AA 3H4HA 1V55B 3FQ2A 4KNSA 2PPCA 1A4AA 1WAEA 4UANA 1RZPA 2PP7A 2YQBA 1OCRB 1M57B 1NINA 2XXGA 3OMIB 5I6OA 1JVOA 2PCYA 3X2QB 3FU9A 3FSWA 4NB7A 3KW8A 2CJ3A 4KNUA 2DWTA 3NSDA 1SF5A 6PAZA 1X9UA 1SJMA 2W88A 2FWLB 3V9CA 2DWSA 4M3HA 4EF3A 1GY1A 5B1KA 5I26A 3H4FA 3RYMA 3ZDWA 2PLTA 1B3IA 1BXVA 3NSCA 1PLCA 2YXWA 2AZAA 5I6PA 1WA1X 3OQRA 3TU6A 2H5UA 1GS6X 3WNIA 1NTDA 3MX0B 3EF4A 5F7BA 2BZ7A 4HCGA 1KCWA 1OE2A 4FAAB 2IDSA 1J9QA 3PAVA 4W9ZA 2CUAA 2Y69B 1KCBA 1ZIBA 1ASPA 3CVBA 1XB8A 3EH3B 2FQFA 3S8FB 3FPXA 2H47C 1A4BA 3ZBMA 2XVBA 3CZUB 4AX3A 2X88A 4HHWA 5LDUA 2HX8A 1QHQA 2VMJA 4KO6A 2B08A 1HAWA 2R7EA 1WS7A 5D4JA 2GC4C 1HAUA 1L9QA 4HCIA 2DY2A 2N0MA 4E9SA 5B7MA 3AG3B 3FU8A 2XUWA 4M4RB 4BDVB 1SFHA 2IDTA 2VW6A 2MTAA 3UABA 2BP0B 3ZX1A 1GS7A 1QLEB 3TBBA 2XV0A 3HB3B 2H3XC 3BQVA 3GXUB 1TEFA 1X9RA 2BZCA 2IWFA 3FT0A 4W1TA 1PF3A 3MBWB 1ZDSA 1AQ8A 2UX6A 2OV0A 1NPJA 1AG0A 1WA0X 2IAAC 1JOIA 1PZBA 4ZK8A 1E5ZA 1VLXA 2YAPA 3EH5B 4G7SB 3NJFA 1BXAA 3NT0A 1PNDA 2Y1AA 3GDCA 4BXVA 1JZGA 2XV3A 3DIVA 4GP8B 4AKPA 2I7OA 2YAQA 2FQEA 1MZZA 5B3SB 2UXGA 1SDDB 4DPBX 1E30A 4G7QB 3QPKA 4A2DA 5B1JC 4BWWA 1ILSA 2IDQA 1GS8A 2XXFA 1BXUA 2EIJB 3NJLA 4KO9A 5I5IA 5I6MA 4MFHA 4A2FA 1MG3C 2VSKB 4HAKA 1N70A 3ASOB 1A3ZA 2VW7A 3SBPA 1AR1B 4A68A 3WG7B 1J5DA 2FT7A 2IDFA 1BQ5A 4DPAX 4KOBA 2HX7A 3HEIB 4UF7C 3X1BA 4HALA 3AG4B 2GB2A 1FFTB 1CUOA 1JXFA 1JZFA 1AACA 2Q9OA 3FSZA 1SF3A 2YAOA 3DKHA 3AG1B 1BAWA 4DP9X 1YLBB 4YSTA 3OMAB 1W6WA 1DYZA 4A2HA 2J57A 1EZLA 1FA4A 3EHBB 4E9TA 2YAHA 3NSYA 3IN2A 3NP4A 3X1EA 4E9VA 2BP8B 4YL4A 3V9EA 4YSDA 4DP8X 1KDIA 2PPEA 3EH4B 1NIFA 3CVCA 4AKQA 1WA2X 3IN0A 4A2EA 1JXGA 1PMYA 2ZOOA 3BVDB 1CYWA 1ET7A 1HFUA 2HXAA 2XV2A 3T9WA 4A67A 1W6LA 4YSQA 1NDTA 3NJIA 1GY2A 3QJQB 2QPDB 2GSMB 1WS8A 2BWIA 5I6LA 4KNTA 3AW5A 6PCYA 2IWEA 1XMEB 5TK4A 4E9QA 1PZAA 3ABGA 4DP5X 2FJSA 2VM3A 1ZDQA 4N4YB 5D4HA 4DP6X 5I6NA 4E9WA 1TKWA 3PCYA 1XB3A 3ABKB 1FWXA 3PLYA 3ERXA 3FSVA 3PAZA 5AZUA 2IH9A 3GYRA 4GXFA 3NYKA 3NP3A 3FSAA 4E9XA 2YARA 3FYIB 5B1AB 1ADWA 1IBZA 3X1GA 4G71B 4YVNA 3NJMA 5EHFA 5B7EA 3T6VA 5IY5B 4G70B 1JZIA 2X87A 2BWDA 3WNJA 1EHKB 4JKNA 3AY2A 3QQXA 3ABLB 4GP5B 1E65A 3PPSA 4X4KA 1AZNA 2I85A 4FA7B 2XU9A 3TBCA 1JVLA 3JT2A 1NIEA 4JHUA 1PAZA 4Q89A 2QDVA 2GBAA 2WO2B 3IE9A 1ZV2A 1URIA 3NJHA 1RCYA 3L45A 1NIBA 3X1NA 2PP8A 1BQRA 2HRGA 2HRHA 4BDVA 2B3IA 4QLWA 9PCYA 2JKWA 2EIKB 3FU7B 2BP0A 5I5JA 1KGYE 1KYAA 3ABMB 1AZCA 2P80A 2FTAA 4A2GA 4KOCA 2GIMA 3QJTB 2AANA 1TEGA 2IWKA 3CDZB 4DP1X 2WSDA 4RH4A 5PAZA 1XB6A 1JZEA 1RKRA 3IBOA 4DP4X 1AZRA 4PCYA 1AOZA 4BWUA 7PAZA 2PP9A 2CALA 1GYCA 4P5RA 2E86A 1BYPA 2IH8A 1L9TA 3S3BB 1JERA 1ASOA 3QJSB 5B7FA 1IC0A 1E5YA 1BEXA 2UX7A 1AAJA 1N68A 1AZUA 4WKXA 4BK5C 4YSOA 1SDDA 1AS6A 2FQDA 2ZWNA 2J55A 5TK2A 4TXVB 1SHWA 3WIAA 2PPDA 1TU2A 4E9RA 4PAZA 4NERA 1AS7A 2QT6A 3N55A 1OCCB 5I6KA 4YSEA 2XX1A 4JHVA 2OJ1A 3C75A 3DTUB 4DP0X 2DYSB 2EILB 2OCCB 2PCFA 2IDUA 1M9WA 2CBPA 4L0PB 1GR7A 4BXSV 1CC3A 4K9JA 2VN3A 2UXTA 1IUZA 1QNIA 1MZYA 2P80D 3NSFA 2RACA 2FT8A 3D12B 3FQ1A 4YSUA 2XYBA 2LLNA 2HLEB 1W8EA 3X1FA 1L9SA 3KW7A 3T6XA 1R1CA 1IBYA 1J5CA 3AG2B 2QDWA 1V10A 1AG6A 4YSSA 2GC7C 2NRDA 3SBRA 1OCZB 1PNCA 2FQGA 1M56B 1PY0A 3ZIYA 2YAMA 4YSRA 5D4IA 4YSCA 5ANHA 2BP8A 4UAHA 5B1JA 5AKRA 1OF0A 4AZUA 2ZXWB 3CVDA 1AS8A 2HX9A 2A3TA 2UXFA 3SBQA 4QKTA 2DV6A 2Q5BA 4G7RB 2CCWA 1ZIAA 1AANA 3FYEB 3IEAA 2TSBA 5I5MA 2W8CA 5A7EA 2BW4A 5FC9A 2DYRB 2R7EB 1NZRA 1OV8A 1IKOP 3H56A 2TSAA 2GHZA 3PAUA 2JFCA 1BQKA 3T6ZA 4NAJA 3S8GB 1PZCA 3AZUA 1UATA 2ZONA 8PAZA 3FS9A 1ETJA 1ET5A 1ILUA 2AZUA 3WI9A 4AKOA 2BO0A 1GW0A 3TA4D 1KBWA 1F56A 4F7KA 4YSPA 3UACA 1AIZA 3UAEA 1NICA 3WKPA 1OE1A 4KO5A 1NWPA 2PPAA 4GP4B 4GYBA 1KDJA 2XX0A 4WTQA 4F2EA 2AFNA 1OOWA 2J5WA 2HZHA 1ET8A 5B1BB 7PCYA 1RZQA 3OMNB 2J56A 3T71A 1I53A 4CSPA 3U25A 3CG8A 4GY4A 1L9RA 3WKQA 5I28A 4E9YA 1PLAA 1SNRA 4DP2X 4HZ1A 5PCYA 2XLLA 3QJUB 1DZ0A 1AZBA 2AVFA 4HIPA 1T5KA 3TASA 3S3DB 3FPYA 3NJKA 3S3CB 2FT6A 1CURA 3FQYA 3UAAA 3UADA 4YSAA 1KV7A 1OCOB 2YXVA 2WO3B 3NJJA 2XWZA 1L9OA 3QJRB 2VSMB 2I7SA 1J9TA 1A4CA 1NWOA 1E67A 1A65A 2EINB 1CYXA 3QJVB 4DP7X 1NIDA 3N2JA 1JZHA 4KO7A
chains in the Genus database with same CATH superfamily
4LCUB 2NYYD 4HETA 5BV7B 2QQLL 4M43H 3UYRL 3T1FB 2AK4A 4G83A 4BINA 3RDTD 5BW7C 1NFDE 4Z23A 4F37F 4E41A 1KBVA 3NOIA 3OM3B 4K3GA 2IH3A 4EOWH 2H6PB 1KTDA 4UQCA 3DVIA 5L4MA 3S35X 1RVFL 3GWJA 1GSKA 1CF1A 1Q38A 4B7IA 3KNBB 3OL2A 4U6YA 4PJCA 2BW5A 3N40F 4BSWA 3LQAH 5AOMA 3WNOA 2VXVL 5SWSD 5F1KC 2KZ1B 4WO4C 5LWYH 4AYGA 2QMJA 4R8WH 2XACC 2HN7A 3NJGA 3BZFA 2X4SA 2AJSH 4WI4A 5EU7E 4H8WL 1H0DB 5FF6A 2ICEC 2O5XL 5C6WH 4DUVA 3R7QA 2DQIH 2WP3O 4N3TA 1INDL 5F6HI 1KCUL 2HRLA 2VLRD 4OIIL 5F93C 3QCUL 2PPCA 2D0HA 1PEZA 3BUBA 4JFXB 1F4AA 1F00I 1AE6H 1X7QB 2PP7A 4GKNB 4IMLB 2AK1H 3D34A 5E4IA 3U6XS 4NUJB 5SWZA 4UTAL 5IMOB 5FGRA 3QIBD 3PGCA 3FK3A 3KW8A 1CXLA 1NCDL 4O5LH 4Y1AE 1NGPL 3EYOB 4JFHE 4Y4FC 4YX2H 4A6YH 4RNRA 2NW3B 3ZDWA 4LPXA 3GSVA 3UAJA 1WA1X 3FCSB 3VFTB 1CJYA 4OZHF 3QJXA 1ZA3A 1QEWA 3A21A 3BJLA 2WIIA 4Z7OB 2IDSA 1EEUA 1HH9A 4DCQA 4UM9D 3DX0A 2MNUA 3O6FA 5LG1A 1OAQL 1S7XA 3S4SG 1MHEB 2AQNA 5FYJD 4OM1L 4GQ9L 2VL4A 1WV7T 3UTSD 1ZV9A 2GTWB 1YMMB 2WLJA 1ZTXL 5C0RL 1YC7A 4N1EA 4LKXB 5IFHH 2XVBA 3A6CH 5JOFB 4QGYA 1RHFA 3L3GA 1BMZA 1GC1H 3QXAA 1CGXA 2R7EA 3CFQA 3U79A 4YHML 1F45A 4O00A 2DW5A 1CGUA 1GZPB 2CRIA 3EYUL 3G5XA 5T3XH 3IXTA 2DF3A 2DY2A 2D0FA 3ZXAC 4P4KD 1E4KA 5C0BA 3MV9B 4M6NH 2WXPA 5BNXD 1WK0A 3CFBA 4U49A 5LNEA 3L6FA 5CP7A 1DFXA 1HNGA 4GIAA 2JI3A 5F1IA 1RQ5A 1HIML 1J87A 2NCMA 4C57C 1Q9WB 2BP3A 4ZOCA 1ZTXE 1IC4L 3GPEA 2A6JA 1NAMA 3TONA 3V79C 3WIHH 4IS6A 2PW1A 2OMYA 1KTCA 3BWSA 4IJ3C 4WI3A 2GUOB 2APXA 2ZICA 3RZCB 4HEMA 4JREB 1VLXA 3FQRA 2YAPA 1HSBA 1VACA 5C8JA 5LG6A 3KM2A 5ID0A 5DTFA 3L3JA 3GDCA 3L2NA 3H53A 5K1JA 1T20A 2FWOB 1ZK9A 3LZRA 5CR8A 2P8PA 1UJTA 5FO7A 1A7RH 1UFUA 4N9GB 1CDUA 1G6RH 3GJFB 5DD1H 4L8DB 4A2DA 3V0AC 2R69H 4MNGE 5DJDA 4YDNA 1Y1DA 4XMZA 3VRJA 1E27A 2DBJA 4HPHA 2OMVA 4GRMB 4XNMA 4LAQH 3C60A 1JV2B 2YC1B 4X5QA 3UJJH 4M5ZH 4KXDA 3WG7B 1UCBL 5D5ME 4JO1L 4HIXH 2CR3A 3N3EA 2FHCA 4LNRA 1NFIB 1RSFA 4M6AA 5DFVC 3VFMA 3FCTA 5IWLC 1FIGL 3M17B 4I77L 3IJSA 2BHZA 4V1DB 4U05A 5GJTH 1NGWA 1I9RH 2X4OA 1BD2B 4LARH 3SPJA 1JZFA 2HWZH 3BAWA 5SV3A 3VWJC 3WLWD 2YAOA 1N5AA 5C92A 5I1CL 4P05A 3CHOA 3NIFB 4FQ2H 4QHNA 2IALA 4OLVH 4QRTA 2ZP8A 5GRUH 3UOAB 1XBDA 5IIEA 4NCC2 2F53B 1XF2A 3IFNH 1IQDA 1ORQA 4KJWC 1AVAA 4PY8I 3UC2A 5GSRA 2VAAB 4I2XE 4TSBH 1RZKH 4PRIB 4AKQA 4D0BA 1QW8A 4NEHB 2VDRH 4FULA 3MLYH 4PG2C 4QRRB 3V6OC 5A6MA 1F3JB 4YK4C 3AB0B 4H8PA 1B0GB 3LKNA 5DGQA 1NDTA 3FHEA 4Z77B 2GSMB 4K9EL 2BOCB 1GGBH 4DVRL 3T4YA 4BFFA 3VFVB 5T1DL 2F53A 3F6JA 3HRZA 3MGAA 4JY5H 2V5SA 1E4WL 5CP3A 3OG4B 1JK9A 1NDGA 2BS9A 4WFEE 2XHNA 3RDTB 2Q86A 3TBWB 2APTA 5DSCB 1TKWA 4Z7UA 1I8UA 2M2DA 5EDXA 4JCMA 1LLAA 3GSXA 2X7LB 4QRRA 1N0XH 4XMPL 2V2TB 1FBIL 1TJGH 1GJIA 2FX7L 2WQSA 4KJPD 3LSOB 3MX0A 3DV6A 3UTOA 4L37A 3B9KD 3NJMA 1XF4A 1BYNA 1RZ7H 2CR0A 4K7PH 1UXSA 5SWSB 5B7EA 4A37A 2FEJA 5KS9E 4L0ZA 1FV1A 3D7PA 4X6DA 3GSNL 4OT1H 4NPJA 5CSZB 2VL5B 4ORGB 1FJ1B 2Y1YA 4YZFE 2P5PA 2O6FA 5I5RA 5FA4A 2X3AA 2XU9A 4PRBB 2XY2A 4MDJB 5E1GA 2D7TH 3WXWL 1LO4L 4UDTA 4PBVC 1JPSH 3K8MA 3TF7C 1MH5B 3WTXA 2ED8A 5D71H 1S3KL 3X1NA 4N0CD 3C8KA 2W07B 1Y6NR 4OLXL 1I1FB 1WFMA 3CN2A 3BPLC 3FUMA 4OGYL 2F15A 3V4UL 2HTLD 2IQAA 3NGBB 3LQAC 1JN6B 3PIQA 1IKNA 4KRNA 2FO4B 1QTYT 2OSXA 3MOBH 4HPOH 4JFUA 2F54D 1ODUA 3K2UL 5KTEH 2XXMB 4A63A 1GGIH 3FQUB 1XGYH 4HEPG 1JZEA 4NQSA 3MRDB 1UXMA 4PPTA 5CCHE 2VE6B 5F7UA 3FU6A 1CFMA 1FL3B 1FVCA 1ZHNA 2JKIS 2YIHA 3ZE2F 1CFQA 4UM9B 2OSLB 4EXKA 2WXOA 4JJOA 3TESA 1QUPA 2J71A 4QHLA 2DL2A 4EO5A 1MCOL 3MMEA 2ZSWA 3BDYL 5IBUB 1AD0B 1PY9A 3I2CH 2UV3A 1KGCD 3CZEA 2WKGA 1Q9KA 2XZCL 3RE0A 3E1F1 5D1ZA 3PGFL 4GI6A 3T2NH 1X5XA 4KDWA 2VLKE 1XL6A 4W9GC 5IQ9A 1A7PH 3GMPA 4TVUA 3UZQB 4Z95L 2CGRL 4N2CA 3DHJA 3U82B 1C5CH 1AP2B 3MLVL 3NVQA 4BH7A 2FJFA 4HKJA 3DX6A 5D96B 1R3JA 2CRYA 1NC2D 4U1HA 3GUFA 5EBMA 4P4KB 1MHPH 3B9EA 4DP0X 2OTUB 4PTTB 3LPGA 3WIFA 4JDEB 1CBVH 3O45A 3WD5L 5F3HB 4BXSV 3WMSA 4W9KC 4BD4A 1PPIA 1J88A 5F1NA 5IBLC 1NFDA 1YN7B 5FYLE 1IE5A 3BSZA 4JHAH 1TTCA 4JFFD 1JZ3A 3GKWL 5I19L 3K0WA 5D7JD 2HLEB 5BQ7A 3U0WL 3DMMC 1EZSA 3HUJF 5T8IA 4AQEA 1E0OB 3DTDA 1OAKH 1K4DA 4TUUA 1S2EA 4MJHA 2RFXB 1XEDA 1KJ2L 3MDJA 3FFDB 3SDDA 2PR4H 3VXOA 2BP8A 1M05A 2HLAA 2HT2D 3BE1L 3BKYH 4Y1AB 5INCA 3IDYB 4A2MA 4GQPH 3STZA 1YEFH 2YJQA 4RLDA 4K3HA 4YDMA 2A3TA 3Q01A 1NUGA 3DYOA 3PJSB 4GRLB 1YEJH 1QRNE 1FO0H 5DK2B 3ARFB 5A16B 4BCXA 3CBJB 4QHMA 5AZEL 3VDCA 3FB5A 2Y1VA 3E8VA 1NZRA 1P7QA 3KVQA 3L3OB 4HWNA 4OJAA 4ZUTA 4ZFOA 2GYSA 5BO1H 3LNHA 1I8MA 1NEUA 3FQXB 1FNFA 1BF2A 2DLFL 3CVIL 1IEBB 3QUYB 1SHSA 1U93B 2DI9A 3QEGH 1AQKL 4TQEH 5T33L 1NJ9B 5GRVL 5DC4B 2O5YL 1QFWL 2MNWA 1EZVX 3PJSA 4FLQA 1EVUA 2YXMA 3ARFA 1MI5D 1FIEA 4PJ7A 1JV5B 1ULVA 4ZXBB 4PRPA 4FYTA 4R2GC 4HFUL 1LGVA 2D0GA 1WIUA 3EBAA 5GRYA 3S34H 2F19H 1SXNA 3VFRA 3TNNB 3RWEA 4LEBA 3K72A 4ONHB 1IEBA 4QJ5B 5HYSB 5DHMC 15C8L 3O3UN 5CIPA 3MLSL 2FT6A 5J6GB 2TRYA 2QLYA 2Q3ZA 2H1PL 1GW6A 2Y22A 4MAUL 1FHNA 4K3JH 5C0AE 1ZT4B 2JKLA 3F01A 1HH6B 4F15B 4IEFB 1E67A 3TVMB 4DQOH 1WISA 5ABZA 3VA2C 3HZMA 5AKTA 3HZKA 5IV2A 1D7DA 2ALAA 4S1RL 1SYSB 2XNAA 4M6OH 1J1PL 4Z1PA 1LEKB 1LO0L 4LKCB 1EXUA 5D1XC 3CLWA 1G7MB 2E8YA 4X7TA 5CS7A 4HHGA 4YUEH 4Y16C 1SFDA 5IJDC 4KV5F 4NPYA 4G72B 1NIAA 2K70A 1NMBH 1DVUA 3BVXA 4Y19E 3TA3D 2HG5A 2JK5B 2W60A 2Y7QA 4MZ2A 2OMUB 4WJ5B 4QO1B 5EZIL 3SOBL 3V4PH 5HHOE 2WLMA 5F88A 3VYOA 3QDJD 4MNGB 1RZKC 4BJLA 2AEPH 1CLYH 4XNAA 4PCSA 5T1LA 1SYSA 4HMCA 1M3JA 2X4TB 4L1SA 4X6CF 4EPSA 4V33A 3S36H 4R5TA 1D5IL 5IM7A 2YAEA 1TDQA 2RQEA 3V95A 3DOSB 3VW3L 2DQUL 1GCYA 1ND0B 2OULB 3MC0A 3V6FA 3ZHLA 1JPGB 4AQ1B 3LH9A 2VW4A 1DBMH 5IESH 1RV6X 1T7WA 2EYTB 1V05A 3IKCB 1BLNB 5IF0B 3FT4B 2YAFA 1KPVA 1CGYA 5B39B 3LXCA 4WU7B 3E8UH 2WINA 2KQNA 3VD4A 1YEIL 2KERA 2J2ZB 2X70A 3BQUC 5BVPL 3OAZK 1ZS8A 4IOFC 2R0ZL 1GVIA 4GQZA 3IB4A 3U1PA 3ARDD 3L5WB 1G7HB 2ZOTA 3E80A 3OKKB 5CEXB 1KSRA 1IGYA 3DTXB 1EEYB 1MKFA 4ODSL 4FFZL 2IV9A 5D93C 4HXAH 4EAEA 5D5MA 3D09A 4EI5A 5KWYC 4AQ1A 4KH2A 2NLJB 4GG8B 5IBTL 4I2XB 4AEIL 4EDWH 5I26A 2F54B 2R8SL 2ZYIA 5DJ6A 2E7HA 1BXVA 1KYFA 2MSPA 2D9CA 3G08A 3TU6A 4OSUL 5DF0A 2NTFB 1R0AH 1DVFB 4NFBA 2Z0UA 1OHZA 1GH7A 4XOAA 5I30L 43CAA 4OZIE 5JHAA 2QBWA 4UI2A 4JO4L 4HOMA 1BIHA 5C3LD 1CDGA 5FFLA 3PHQA 4YLQT 4XRCA 3RFZB 2FBOJ 5DFAA 3MYJA 5IFAL 1AI1H 4FNUA 5D6CA 4OF0A 4FS0A 4X6FB 1L0PA 2E9WA 3JSSA 3UZEC 4AENB 1R5IB 2NSXA 2VDKH 2X89A 1YYLH 1AY1H 1RK0B 35C8L 1TOXA 1QHQA 3D0VB 5EN2A 2DQTL 4CVZA 5D4JA 2WXJA 3TO4D 3UG5A 3X3GH 2YD5A 3ZRFC 3WEAA 4O2FB 1V3MA 2XKUA 3A6OA 3IGUA 4JPWH 1NGXA 2N0MA 2Y5QA 4CKQA 5C0NC 2DWYA 3VFSA 1UM4L 5FOBA 1HE8A 3MGOA 3SE8L 3UTQA 1MF2L 1A1MB 2FZ3A 3BH9B 3TIDB 1CB4A 1DDHB 4LT7A 4P46C 4AIZB 3W38A 1TEFA 2EDXA 3TH2T 3UZQA 3SDXE 3OGOE 2HH0L 2IWFA 1DBKH 5FHAL 3X13A 1CLZL 4IBUA 1IAMA 4KHTH 5D2NA 3MBWB 5D7JB 1OQXA 1AQ8A 4KRMB 1J9CT 3BLPX 4DKTA 5E2WH 1CDYA 1PX4A 5HY9A 3O8XA 5T3ZL 3K6DA 3Q2LA 2XA3A 1UT1A 4DWHA 3DURB 1DJSA 4TSCL 1KELH 4M5YH 4EBQH 5CEZL 5TFSL 3SBWC 5KS9A 3EOBA 5C08E 2RALA 5ADPL 2AS5M 4BXVA 2EACA 3T77B 1VGEH 5E0FA 5DHEA 1RK1A 2I7OA 2FQEA 1ZXQA 4FFYH 4DKEH 2CG9X 1FFOB 4HWEH 4BSJA 4KK9C 3O3EB 1PVHA 2Y07H 4JMNA 1T5WB 1NGQL 2CH8A 2VR4A 3CSTA 3GSNB 4PRNB 1VEOA 3IE4A 4M8RA 3HR5A 3VQMA 4XNXH 1SJVA 3RX8A 1U95A 1GYAA 3D4CA 3EGSB 4P5TC 1EFXA 3QH3A 1BOGA 3U36A 4KQ4L 1DQDH 4KX8A 4OD1L 1U2HA 4S11A 5AW6B 2LHAA 1NCNA 5AUMB 5ANMB 2X2YA 3B56A 1T1WB 3KJ6L 4TTDC 5T3ZE 3T77A 4LXFA 2QQQA 5CEZE 3DOHA 3BD5A 1COBA 4XCEB 2FO1A 3V9FA 1Q0EA 2BH0A 3QQNA 1Z9OA 4AV5A 1KTJA 2F8XC 4W4NA 2F1BA 2VLKB 4WK2B 2EDDA 1ADQH 5GRZA 1KBBA 1FNSL 1JXFA 2D4DA 2E47A 1ZV5A 2VXSH 4PP2B 5CZVL 4LSUH 1SY6L 2BIHA 1JNLL 2F6AA 4MS6A 5AB1A 1IGJA 2OTWB 1JZ5A 1MWAH 2X41A 1TIUA 1ZVYA 3NIDF 4WV1C 5FLVA 2R29A 4QY8B 5DLML 3NSJA 4YC2B 2OXHA 2NY6C 5KANI 4YHPA 1PKOA 1KMGA 1ET7A 1SJEB 2WQVA 3LMJL 1U58A 1DLHA 1MRDL 1W6LA 3I6SA 1R75A 2PYFB 4DKDC 3QUXA 1A6AB 2B1HL 3E7JA 2K0RA 2ITDA 5B3JF 1JFQL 2NT0A 3GMRA 1RZGB 4UNTA 1KCRH 2EC9U 3LRKA 3WTYA 4X99B 4E9QA 2FEEI 4P2OB 5AENA 1DVQA 4DP5X 4F8QA 2J25A 4IJTA 4OF3A 1Z9LA 4APQB 1MCNA 4PJDA 3RU8L 4DP6X 3GS4A 3AAZA 4GFXA 4MJIA 5FXCH 3OAZH 1QVOB 4W6YB 4NJ9H 1Z7JA 4OLUL 1MIMH 1SGKA 1SVZA 2CJUL 4NKIL 3UO1L 2P44B 4D7PA 5EUOF 5GZNA 1A6WH 4OCRL 3TNMB 1VFBB 2EUZA 3MCLL 4X7CC 5DVNA 3L7FB 3ZHDA 3O2WH 3U7YH 1KULA 2K6WA 3WJJC 4UM8B 2HFGH 5HYQB 3IFLL 4ENEC 1UH3A 5LVEA 3B7RL 3EOTL 4UT6A 5L9DH 3UC0H 1FRGH 4PIRF 3ZW3A 4C59B 3U46B 1KJ2B 1KN4H 3L4YA 5AVSB 4NWTL 4HULB 3S2AA 5CEZD 3WFBH 1QPKA 5ID1B 4JO8A 4TPRH 2EDHA 2KBGA 1XCTB 3DYMA 1QABA 1QRNA 4GKSA 4HJ0C 1A7BA 2CBQA 4NZRH 5FKAB 4OCMC 1FG2A 3R8BB 4ZYKA 1PAZA 4LF3A 3EG9A 1KN2L 2Q2EB 5E08H 2IAMA 2GBAA 5KBPA 1JCKA 3EXJA 1KYDA 2VDOL 3T8XA 3KPSD 3DVGA 3H9SE 1XGRA 1UT9A 4JG0L 5EG6C 5I76B 2V9RA 4XBEH 1BQRA 4BV1A 3BAXA 5M95B 4I3RH 4M4RA 1A3LH 1LO2L 1NDMA 2ZUVA 5DMGD 3C5ZA 2HPOA 5CGYD 1D5ZB 1F90H 1AHWC 5HD8C 4CN4A 4LGSB 2KT6A 3IXAA 1JGLL 2VUKA 1G1OA 3B2UD 4MQSB 1SUJA 1HKFA 2XWBB 5C0AB 3LDBB 3O0RL 1S7UB 2XQ0A 4MJJA 3IBOA 4WDIB 4UIKH 3QVAA 1EDHA 1H6EA 1EO8H 4JO2H 5GJSH 3QUML 2DQHL 1QYGH 1DSFL 2FVNA 2YA0A 2A38A 4UIMA 3J2PA 3A5VA 4PJXF 4X50A 4ZMXA 4DGUA 2A1WH 2NY4D 4XMUA 4QUOA 1UXLA 2COVD 2P5EA 3HC3H 2CBOA 3AGVA 5C0JA 4MCYB 3KEHA 5EBLA 1DN2A 1CDBA 5EZPA 3SO3B 1E5YA 3DVNA 3QIWD 3RDJA 4HX1B 4BK5C 4UT9H 4DO5A 4XN5A 1IC7H 1R3LA 2ODHA 2QV4A 5CD3B 5IB2B 5L2KA 4KRPC 5MP6H 1GAFL 2OFQA 3MNDA 3WDHA 5HHOB 3TO4B 2ESVE 2AQ1A 5DZNA 2YUWA 4XB8A 3LS5L 4KXCA 3J07A 4JFPB 1EHLL 4F58L 4FQLH 4R90H 3DTUB 1L5GA 2GEQA 1HEHC 2BVPA 2BIIA 5AVRB 2LAGB 3GMQB 5ENWB 1G9ML 3DGDA 3LN5A 1I9IH 5LAXA 2WUCL 2C34A 2JV6A 2CIIA 4Y19A 4A2LA 2CKBH 5DJZB 1U2YA 5BOJA 1OB0A 1OZTG 3LXUX 1FGNH 1J5CA 5EBWA 1I1AC 2F1EA 2HTKD 2QDWA 1NEZB 1XQ4A 2Z7ZA 4ZX6A 1PG7L 2V8LA 3K2KA 4QOKE 5MI0C 4HJIA 2DMGA 1JGVH 1OF0A 5AKRA 4ZS7H 1OP5K 2ZCLH 4OB5L 2A9AA 1YEDA 3FTWA 3VXRE 1EAJA 5AVTB 1BOYA 2A73B 4XNQB 1QA9B 1EEZA 1OTSD 5A2BA 1P1ZB 1LXMA 1CK0L 2PCXA 2V5RA 4F7TB 4H20H 3TPUA 5IB5A 5KSAB 2VR9A 5I1GH 3IMWA 5JOPD 3A4FA 5FKPB 1RJLA 3LNIA 3FH7A 1R5VB 3Q6GL 1FVEB 1TVBB 3D25B 5F3FA 2Z31B 1BEYL 5MEQB 3HE7C 4WUUD 5EEUA 4TNGA 1FE8L 4PD4K 4HK3J 4ICXA 2CO1A 4YSPA 3DIDA 1TPXC 4Q6IA 4GP4B 1ZAGA 1QA9A 5L2JB 3KPOA 3RGHA 3FF8A 4UMGA 3T0EC 4YAQA 7PCYA 5MERA 2LFGA 4PJ8B 1I53A 1MREH 1H5BC 2DYPA 4HWBL 5FKPA 4JLRB 1FZMA 5TQ2L 2EDQA 1BECA 5JIPA 4B50A 3LPOA 4OZIA 4HYTB 4XNZC 4Z0BL 2CPUA 3OZ9H 4FG6D 3PNWA 3WUWB 1T6WA 3UDWA 1YAIA 5I71B 2LQRA 2FJHB 1T2JA 4UYPA 3UAAA 4JX0A 1VERA 2H32A 3I6KB 3KEDA 5L7XH 1OCOB 3NJJA 4WHYH 2R1XB 4X4ZA 4AJWA 3TV3L 3C6EA 4XXWA 1F4HA 4N90D 5F6IC 2XG4A 3RNKA 4U1NA 3GIZL 4QXTA 3SKJL 2R23A 4L8SA 3APFA 1NIDA 3HZVB 3BFWA 4LGRB 1KXQE 3FRPG 1WH0A 4R83A 1IVTA 1MCBA 4FKKA 4M7JL 4JUSA 4B3VA 5C08B 5JZ7D 5HDBF 5DLLA 2JTDA 3VXUE 5I74C 2EDJA 2APFA 2A6DA 1UM5H 4AL8L 4MD0A 3SDAD 3AXLA 4JKLA 3ABZA 3SDXA 3ZZ1A 3FH5A 5FW8A 4PGZA 2EXWC 2UXVA 1ZA6A 2L7QA 5D7IE 2JXMA 4R7VA 3SDYL 2QADC 5FAAA 3WY4A 5BZDA 2XTLA 3I74A 1OE3A 3FTSA 3OKOB 1GGCH 1O0VA 2MNJB 4WHDA 4A7SA 5I1IL 1Q72L 4DPCX 1VKXA 4FXKA 4EKJA 2ENSA 4WGKA 3X12A 4K5LA 4N2GA 3DX2A 4H2CA 4UTCA 4AQ8A 2APWA 2WQWA 1E3XA 2NPLX 1KIUA 3I3EA 4G6MH 2ED7A 4WKZB 3QQ4B 3WHE0 2ORBH 4X80L 3RL1B 4AEHL 5HPMA 4JPVH 4PJBE 2APBA 4N2BA 3WXVH 3LKOA 3DSNB 4NQEE 3WE6A 4NT6B 1CE1L 4Z8FH 4IDJH 3VVVA 4Q6YA 2ZCZA 2X2HA 4L1HA 4LPVA 4IRJB 4OCXH 4HXBH 1KLFA 2DWTA 3QXUA 3V6ZB 1PQZB 2P26A 3GSRA 4I18C 3RYMA 2BNUA 3NSCA 1OGAA 1HQ4A 4UILL 4XO5A 5KSVA 2H5UA 3WENA 3AREC 2JLLA 4HGWB 3ZL2A 3QG7L 3OXRA 2EYRB 2YRLA 2N7SA 4WU5B 1ZE3C 5EOQH 3V0JA 1OE2A 3ULSB 4FAAB 5HI3D 5DFWH 1U8QA 3D3VD 5I1HL 1AJ7H 4XWGH 5D4QA 1HL5A 1A9EA 3BVNB 3MRPB 3MRRB 3N0AA 3DBXA 3UBXA 2EIZA 2JQZA 1TXKA 4I0PD 5K9JL 3TO2B 3QK0A 2YKKA 1G7IB 4FNLL 3DHPA 5DMYA 2BY3A 1KOAA 2F5BL 3T2OA 2X4QA 3IMBA 2HX8A 1M4KA 1NAMH 2VUYA 3F2LA 3N85H 4FQJL 3INUL 5AW0B 5D6DA 4PWGA 1CDHA 1N19A 2GC4C 3CXHK 3GMMB 3MA7B 3MNZB 4HCIA 4YHKL 1J7VR 2WXFA 4GT0A 1OP5H 4KK5C 1WEJH 4XVSL 3S96A 3QDGA 3RIFF 3ILPA 1BPVA 1QZNA 2BS71 2IDTA 2PO6D 5KANG 2DS4A 3WFDL 1YVLA 4R4BA 3TBBA 2W0LA 4AT6B 2K6YA 4JQVC 4CKVX 3KL5A 4WEEA 4C47A 3RBGA 4P04A 3MV8D 4RSVA 2VR8A 2DLTA 2X2IA 1TEYA 1OF2B 4MRCA 2A9NL 2D9QB 2DQGH 3BIKB 3JTTA 2UX6A 1A14L 3CLFH 25C8H 1DTUA 1FLRH 2OZNA 4EQ3A 5B38B 3A22A 1X4ZA 3BPCB 4G7SB 4HUWA 5FCSH 3H9SB 4IKLA 4NQED 1L0YA 3O6MH 4Z7VE 4LE8A 5CN3A 4KX9A 1H3VA 5GISH 4EUPB 4KU1A 5AAWC 4JDZB 5HPOA 2JJTA 2UVFA 4M93B 5KYWB 1BVKA 4DPBX 5EZLB 4IGBC 3GFUA 3HVNA 5IQ7L 1G7LB 4BWWA 2WOBA 3MUJA 1ILSA 5AW1B 3HZYB 3APDA 1FLTX 1KB5L 2CCVA 5JOEA 4JANB 4WWKD 3KHOA 4WUUB 1CGSH 2VW7A 4S0TD 2Q87A 3Q5YA 3H9SA 4MS8D 2AABH 2FWSA 3C6LC 2C1PA 1N18A 5D7SH 1IGCH 2KZKA 1YO4A 1JK8B 4ESKA 3BFOA 3GGWA 3KR3L 3TP4A 4H88L 2VDOB 3V7AG 2X5PA 4PWJA 1NBYA 1OY3B 1N7ML 3FN0L 1K6QH 4F7CB 1B2WH 1EO7A 3TN0D 3ML8A 5ETUA 3MAWA 3THML 2ZD0A 4ZG1A 1H8NA 1I3RB 4ZMZA 2IBBA 3BEWA 2Q9OA 3H6AA 3H3PH 1OALA 2ESVB 2UYLB 1Y0LB 1M6UA 1USZA 2JB5H 2MOGA 3I84A 2OMTB 4IK6A 5E6ID 3B83A 3MOAL 4WI0A 4YHNA 3MLRL 5CP3H 1N6QH 3IN2A 2GTZA 3RUGE 5KJRL 2GBTA 3HHRB 1JNHB 3TCXA 3QUMB 5CGTA 4NDMA 1YSOA 1WA2X 3QIUB 1FDLH 2ZOOA 4OQTL 3EDJA 1CYWA 4P2RA 4F7CA 1JYWA 1ZWIB 2WOYA 3ARBB 5TE4H 5I18L 3QEUB 2DWXA 2VDMB 4G6KH 4AY0A 3DX1A 1DBAL 2AXFA 3NJIA 3MR9B 4HQQH 3QDMD 4MNHB 5DUBA 1R3IL 2BVOA 2ESVA 5F1SA 5TPWL 2UYLA 4KKLD 3HI5H 1UD2A 2WO4A 1D5XA 2OMTA 4RESB 2W65A 3VI4E 4MASA 3HBGA 1C5BL 4C83B 1M7IA 4QOKB 2J73A 4EN3D 3MRNB 1P4BL 4AK1A 4KVPA 4E9WA 3VXQB 1EXGA 4JQXC 5ICZA 5DD3L 1Z66A 3HAEB 3W0WD 4J4PC 2JELL 1S9XA 3LIZL 4M7KH 5D1ZI 5JIHA 4KBPA 2NX5A 4OJFL 3KPTA 3DHMA 3F7YB 2VWEE 1AYRA 1QKZH 1JTOA 2YKLH 3NIGF 2HKHL 2BIQA 4DGVL 3GUTA 1NC4A 3K5SA 3QHFH 1C1EL 1I82A 1OB1A 4ZW8A 4EVNB 3B2MA 2VR3A 2NDFA 1IT9L 2EEBA 2YPKB 3DXAA 3H42H 3L8QA 4PQXA 1BFOB 4LLAA 1JE6A 4QOKA 2P8LB 1ITBB 3F5WB 1CN4A 4YIQB 4DEWA 1VA9A 1N67A 4GUPA 5EORH 3ILDA 5EPMB 2G3MA 2AI0L 2UY7A 4NO0D 2AQQA 3GXFA 3VXRA 3ZTNH 4W9HC 3UP1A 2JSFA 2XWRA 3QEQD 3ZE2B 4V2CB 4R4FL 5J6HB 4IBTA 1PZ3A 2P47B 4GXVL 4NQUA 2AQPA 5T5FA 3BKJH 2FD6H 4YDVA 4J27A 1MUJA 2W81C 4YHLH 3VGDA 4XAKD 4L4VA 1ZVSB 4HUVB 2O6EA 4M7LL 5ESQB 3QNXA 4ZMQA 4QLWA 1JI1A 1LDPH 1UWXK 4JS7A 1KYAA 3PP3K 1B0IA 1YDPB 3KPMA 3VSVA 4A2GA 4BSVB 1LILA 4EDXA 2BS8A 2IPTH 4WHYG 3WELA 3ETBJ 4MGXA 4P4RB 1ORSB 3QI9B 4U3CA 4Z0XB 3CDZB 4DP1X 2JJWA 1MHHA 3CZLA 5DO2D 1CU4L 1NEPA 3H9HA 4FQXD 2Y7MA 1QR4A 5LBGA 2Q3XA 3QFJD 4GAGH 1FL6A 1FYTD 1Q0XL 3B4NA 4NZUH 4E9LA 1RH8A 1P7KB 1EGJA 3JUZA 3UAJC 2B7DT 3BP6A 2YMOA 1GYCA 3MN8A 3PP4L 2YA2A 4U7MA 3D5OF 4UUJB 2WVTA 3O3DB 1KXTA 1ZHBB 4U6HA 3BD4A 3K6SB 4JVWA 2ZF9A 3VXUB 3IDGA 1KCSL 3O6FC 4BSVA 5AAPA 4MVBC 1N8ZA 2YD9A 4LHUA 4AK2A 3BSZH 1IB5A 1J0HA 1RUMH 3MJ7A 4PB0L 2E7LA 3UTTE 2CHXA 3RB5A 1HINH 5K1NA 3C6SB 3V52L 2ZWSA 4YOKA 3FO0L 3HHMA 1H3UA 6TAAA 4FQHB 4QKXB 1A2YA 5D7IB 4GW4B 3VUAA 2GJZA 3FB8A 4YHZH 1UB5B 3CFDB 3ILQD 4N87A 1AGDB 4RMTA 1KXQA 3O3AA 1MDTA 2ZKMX 5CILH 1KIPB 4KDVA 3RNQA 1CC3A 1VCBC 2LABA 4MDRA 3MRMB 4FFVD 1AQHA 1E4KC 3MV8B 1LEIB 1JWSB 2QHRL 3I85A 4NQCE 2J6EL 2KS0A 3FQ1A 4XO8A 3AADB 2NTSP 3MCG1 3QQ9D 3IBEA 4XN7A 1IC1A 5ALCH 4WVRA 4PJBB 5FYKD 1MCQA 1IBYA 1JIBA 1DQTA 2NRDA 1OCZB 3KGUA 4NQEB 5DJ2A 3K7UA 5C0DB 1WZKA 1J8RA 1MW3A 1R3KB 4AUYA 2YAMA 2KLRA 4G9DB 1O9WA 1KBGH 4NUGL 5EULV 4OLWH 2R0KL 1I9JH 2YSTA 4HJTA 4ZW6A 5KSBE 2HX9A 3EGXB 2R1WA 3IDXL 4KKRA 5BXFA 1JMZA 4E5XA 1CFNB 4JM2B 4N22A 4Y2LA 5KG9A 2VZVA 3BXNB 4DN4H 4NQXA 2CLZA 2GJPA 5HDQL 2EE3A 3TM6A 4FERA 3KE0A 4FXLA 1BAFH 2NYZA 2R4RL 3ECUA 4WWKB 5K9KA 3HG3A 4JFDD 2LFEA 3FAWA 4PJAF 3WGVB 4DT2A 3WLBA 4KROD 1K5WA 3DGCR 2X10A 5MEOA 5TGBA 3OAUL 2G3XA 2DQCL 4I89A 3DO3A 4IMKC 5CIPH 3IDJB 3C60C 1IAKB 1IU1A 2WTRA 3B2PA 1QOKA 4JKPL 4OZ4A 1IX2A 4BEIA 3ARGD 3CHSA 2DQFB 5E8OB 3KJ4C 3TN0B 5IK3B 4WTQA 5IREA 1YY9C 1T1YB 4JM2A 4LOUD 4OCWL 4AUJA 1FCGA 4UAOB 4ZFFA 4RFEA 3P4NA 3IJHB 4IW4C 4O9HL 1SOQA 3HG1E 1WD9A 1UWGH 4L1TA 4NC0B 4OF7A 1SM3H 1JPTL 1SNRA 3E2HC 1FSKC 2HFTA 2P5WD 1DZ0A 4KVCH 4N5UA 2VDLH 4K23L 4KMQA 1G7PA 4QNPF 4ZFGH 1DUZB 3TIEA 3MLTB 5JQHC 5KYXA 4AV4A 2K6ZA 2OMNA 4HIHB 1PD1A 4UOW1 1SOSA 5EOCL 4A55A 4RWYL 1U8IA 4PV8A 4IIQB 4CUCA 3JV6A 4WW2F 3NPSB 4WTZA 5FWQA 5DWUL 1IQWL 3JVFC 1ZTXH 1JPFA 3WKML 2LU3A 4OM0L 4ZPVA 3IFOA 1WHOA 1IL1B 3JWDL 3MI6A 2O6CA 1A21A 3P0VL 2BRQA 3N2JA 4KJYB 5D7LD 3QULA 4EN3B 5C2BL 1F3DH 2HLFD 1INQA 5IVZA 1JF1A 3W0WB 4Z7VB 3WNNA 3AQDA 5C6TH 2X12A 3HRZC 1A3RL 2CLRB 3NZ8B 2J4WL 2VMDA 5D2LE 5JIDA 4P49A 1MNUH 1FNEA 5E9DE 1JZJA 4XCNB 2UY6A 3UROR 1OOAA 3VB8A 1F58H 3BCFA 1KPUA 4TUKH 3ZKNC 3S8WA 1DJYA 4TNFA 5K39B 3KHQA 1T04B 3VGAC 1E2VA 1IC4H 1UWXH 4ZTOH 5MHSE 1WCBB 2WLIB 3PP3H 5KVGH 4WWOA 4YDIL 1NCBL 1R3HA 4DVBA 4Y2OA 2VUOA 2WXMA 2YMXL 5DUML 3LRSA 5IJBC 2QPEB 3EJJX 1BPLB 1Q9OB 2RAMA 1NGZB 3WN5A 1ZPUA 4ONOA 2OMXA 5CCJA 3BUYA 5F44A 4NQDE 3ZRSA 3Q43A 1V55B 5JDJA 5B8CB 3WS3B 3GMOA 2WBJC 1P4IH 3KWWB 1YNTB 4HWZB 1C5DA 1AIFB 1M57B 2JWYA 4G82A 1WCBA 1A7OL 1MFBH 4IBWA 1HILA 3Q8AA 1KB5B 4JFOA 3G6AA 4RSYA 3WEXA 4Z5RB 1JZ2A 1GOFA 1UJ3A 1I8KB 2W88A 2DQ6A 3ROLB 2B9BA 1CLOL 4PB9L 2QV2A 2VLME 3E3QE 3EJQA 1A1OA 3OQRA 2DIBA 4QRUA 4FQXB 1MCPL 3MACH 4OFQA 5I15L 3QFJB 1JHLH 1N64L 5I0ZA 4MX7B 1M6OB 4UB0H 5EIIA 4HIEB 5GGVL 2D31A 5F97E 3EO1A 3TCLB 5JXAH 4P48A 4LOVA 1KCLA 3VB9A 3E9TA 1BSIA 4BFIB 5I1CH 5IGXH 3VI4B 2KMWA 4AE0A 4WW1B 3RUGA 3RL2A 5CJXA 4NI6A 3ZOAA 4ZAKB 1UD6A 1CXKA 1F18A 2VRAA 3KYKH 4YDJB 4I48B 5I6XC 1WT5A 4M7ZC 5IOKA 2DQMA 5D1ZC 2BY2A 1UD5A 5L4JA 2QHLA 1AZVA 4AVIA 1YYCA 3MUGB 1FFNB 4XO9A 2V3DA 3CVHL 4A7GA 3ZE1F 1GYVA 1MFEL 4I0CC 5C0IB 1CXFA 2Y23A 3PV6B 3UIYA 1RMFL 4MXWL 3ZTEA 1QNZL 2Y7SA 5FK9B 5E4AA 5F7LB 2BP0B 3V0EA 2J1XA 2K78A 2YBRA 1KEGL 2C4FT 2V37A 3BQVA 4WY7H 1GZHC 4U1SB 1OANA 1HYSD 2WXNA 2ATPB 5F72S 4N8VB 3MRBA 1HHGA 2VLRA 3GLAA 1HCFX 2EUVA 3RWDB 2ADGA 3VFWB 3MUGA 2A74B 3GNML 4PRAA 3KLHD 2IG2H 1WA0X 5C0CE 3AS2A 3KLAA 3BCDA 4Y5YA 1Z32X 5GRWA 2Q20A 2R51A 4HDIB 1EUTA 4KI5F 2EXYD 2I5YL 1SXCA 2ADIA 3TJEH 2XV3A 4NKDA 4WAFA 3HC4H 1RU9L 4W9LC 3SDDC 3MBXH 4NRXA 5JPMA 1YUKB 2FGZA 3BVVA 4LPUA 1ZEAL 1R46A 2IDQA 2ERJC 5E8DL 4JFDB 1E7UA 2FB4L 4GMTH 5HHPB 1E40A 5IJVB 3IJEA 1X5HA 5L6YL 1CDCA 5GGQH 1TZHB 4MNQD 2OI9C 1AFVH 1ZT7B 3SE9L 3QC6X 2EABA 3CQPA 4Y5VB 3DGGB 1I3GH 2FR4A 3Q8EA 4F2ME 2R29H 3ARGB 3L1EA 4WCYL 2E46A 2MQ0A 4QF1B 4UZGA 2YK1H 4YPGB 4LPTA 3UTSA 4OLXH 2WBWB 2RB8A 1IGIH 3CK0L 3OVUB 1XGUA 2WZ0A 5CFHA 3S88H 3HEIB 1TYJA 5CUSH 5C07D 1I4FA 3UTTB 4APXB 2VH5H 1WAAA 5HHPA 5FB8A 1A6ZB 4HZLB 3MREB 3OKNA 4O58H 5K59E 2E5EA 4TVSa 4MMZA 1ETB1 3M1BA 3V0GA 4U6XB 5GS0D 2ICWB 3WFHB 5J57B 5FDWB 3F6LA 1R9FA 2ADFH 4N5EC 1O6SB 4TUJB 4YL4A 4DO4A 4AVJA 3U4BH 4Z7WE 2FEDC 1ZVHA 3H85A 1H9DA 3A6BL 2EE0A 3OZKA 2MCPH 3GBNH 3BVWA 5FYLH 3OKLA 4A7TA 3N42F 2J72A 1WBYB 3PWUB 4AMKL 4NQCB 4KVNL 3S98A 5JHLA 1SOXA 1FVDB 1SJHB 2GW5A 1BXXA 1VGKB 1S9YA 3HHSB 3U7WH 1RZIB 2BWIA 4MMXB 1OGTB 4GBXD 4H13C 4PEEA 4QCIB 1CLVA 2IWEA 2VITA 2CK0H 5D7LB 3QGVA 5JIKA 5J11C 4HKXA 5CNHA 1FC2D 2NY2B 1F4YH 3ARWA 4XVUD 2UWEA 2XWDA 3KYMA 5DJXB 4J6RH 2KYIA 3UZVB 5DD6B 4I13B 3SDCD 2BMKA 3HE6C 3NDZE 4OIAA 4XP6H 5DZAA 2AW2A 1X9LA 5KSBB 3FSVA 3IMSA 1AHMA 4JJ5A 2XSKA 3WD5H 3E0GA 3U1SL 4E9XA 1P5VB 5DEGA 4NQVA 1V3KA 3TYFB 1KG0A 1QBAA 2EICA 3FO1B 3GSUA 5HVGB 1RPQA 5IMKB 1SZNA 3MUUA 3TTSA 3CLEL 3U0WH 4LCYB 4YNYB 2YGOA 2ZOLB 2V0AA 4D0DA 1M2OA 1KC5H 1ZHLA 4P5KB 5E0QA 2VKXA 3MNMA 1NQBA 1WBZA 4X5RA 2WWKT 5DQDL 5FO8B 1X5ZA 5DJ8B 1V7MH 2WGNB 4I4WB 1WFIA 2O5ZH 3KPRE 1U3ZA 1OD7A 3CPLB 4PV1C 3JBG7 4JHBA 2YWYA 2Q1EA 3HG1B 1RURH 1W72L 1ZGLA 2IV8A 3BP7A 1CR9L 1A7NH 1THCA 4N0UB 3FRUB 4LLDB 5EV7A 2YPVA 3BW9A 4U6VL 4XC1H 4G9FD 1A5FH 1WZ1H 4GI8A 4X5WA 5EA0L 3VD3A 4OIBA 1A47A 4G5ZH 1PZ5B 1AZCA 2DLFH 3OHXA 4UQ2B 5IROC 1K3ZA 2ALWA 3QFGA 5IKCB 4FXGA 5I16A 1CF8H 2FX8H 1OM3H 5E24E 4PJFA 1C08A 3QUKB 4EI5C 3P73B 5DEFA 4W81A 2WSDA 3EGDB 3R06B 4QT5B 1CVSC 1LE5B 2XVGA 1SRDA 1DANT 1TJHL 4Z6AT 2WLYA 1KNOA 2B4CC 5DDHA 5GZOA 1U8CB 4KZCA 4JFYA 1LO5A 5TDPB 2WXHA 2AXJA 1T0MB 3Q9QA 3FNKA 3GB7B 4KKBD 4XMVA 1LMKA 4WHTA 4QHUA 2AXGB 3CZGA 2ID5A 1Q9LB 2KUTA 3O11A 1JERA 3IJ8A 3GSQB 4LBEB 3ZQXA 4TQIA 2HJKB 5CU5A 5I82A 2QQNL 4WKXA 4MA7L 4ZFQA 2OJEB 3DRQB 2J55A 2DJMA 3HS0B 4LHQB 4F7MB 3MRLA 3NK3A 4Q97A 3PUUA 5E9DB 4OI8A 5BMFH 1NCOA 2G5BA 3HBQA 1Z1WA 4L2YA 1BCIA 4X42A 4EIGB 3B9KA 1UZ8B 4MAUH 4XZUA 5AALA 4W6XB 1BBJA 1I7UA 4YQXL 1K5NB 2VQ1A 4LLWB 1NCJA 5IHUL 1T0MA 3PPEA 4J12A 4PJGA 4ZOBA 1XF3B 5FUCC 3S37X 5F7EH 2EILB 1KB9J 3CSYB 3C09C 3D2UD 4FYSA 2AQ2A 1E9OB 4QAMB 1YNLL 4XMXA 4U2ZA 3NCJH 2EKSA 2FSEB 5D2LA 1ONQA 2YRPA 3MGTA 4J8QA 4KKAD 4QRFA 2XQYA 3OC8A 3II1A 1O9VA 3CZNA 5D1QD 4BA0A 3ETBF 1GCFA 1TQSA 1L9SA 4NQDB 1KV3A 3T6XA 3WEBA 4ANVA 3HG0A 3ZKXB 3JWNH 5D2NC 3PWVB 4HIJB 4WTXA 4A1RA 2XA8H 4HCRA 2Z8SA 3MRGA 1Z9SB 3FKUS 4EXPX 4HK0B 1FFPA 4N2FA 4NYLA 5HGBA 3O8XC 4BFJA 5B1JA 1MCKA 1K2DB 5F89A 3L9RB 4PJEA 1AS8A 3RVTC 1OARH 2N01B 2UXFA 4L18A 5DWPA 4F8LA 1LM8V 2R4SH 2DV6A 3ULVH 3IVKA 2F68X 2J1ZA 2Y6SC 2W8CA 4OV5B 5LCVL 1REIA 1N59A 4D3CH 4L29A 4BCYA 3MJ9A 1OSEA 5C0EA 2DDQH 4P23D 4AMXA 2TSAA 1T1XA 1LP9E 3KXFE 1YEIH 3V6OE 2J5LC 2JKXA 3CQFA 2ZX6A 4CDGC 3BLBA 3FS9A 2W0KA 4FQPA 4I87A 4MLSA 2EVJA 2BO0A 2QVFB 4ZQKA 3S7GA 3L9RA 5I1KL 3LEYH 4FNQA 2H32H 1O7SA 2YFNA 3KDMA 3BAEH 3EBHA 4PJ9D 2C1OA 2F7OA 2IJ0C 4PJHE 1ET8A 3ZDYF 1LNUA 2G2PA 5F0LB 3RTLA 2WIMA 2MKLC 4J23A 1AQMA 3D4ZA 1AD9A 1AGEB 3EYVB 4K8RD 4M43L 4LVEA 3U6RA 1NC2A 4L9LA 1SQMA 4LLUB 3SGJA 2YHGA 3U0TA 5FFOA 3MLXH 2GABA 3OGCB 2J20A 1MJUH 1IZKA 1JL8A 3ULUE 5KBKA 4N1HB 5TDOB 4EOWL 4LSDA 4POZC 3ARRA 1BIIB 1CDIA 3VXMD 4LK4A 3IK2A 4LRIA 2EDOA 3VWKB 1SEBB 3DA0A 4FJYA 4JFFA 3Q8CA 5CO1A 1TQWA 3LQAL 4HC1A 2MCG1 3ZT7A 1GTNA 3TZVD 5D8JH 3U9PH 2MPVA 5LWYL 2I07A 3QXWA 4Y2DC 3LRMA 1MFDH 1PZDA 1MLCB 4R8WL 5DFVD 5CEYB 3WJLA 3PAYA 5IB4A 2I60H 2Y7LA 5C0CB 2AJSL 2CUIA 3QUXC 3LB6D 4FF9A 4RGND 4A7QA 5JHDE 3W39A 3QJHB 1LK2A 4Q2ZA 4N2IA 2DQIL 3CVHB 3UBXI 1V54B 4ZOEA 1A6PA 2B8OT 3SE8H 5CJ5A 2XKNB 1A9BB 1AE6L 2G4GA 3D69A 1SBBA 2AK1L 4I9WD 1D6EA 3DX7B 4QJ3B 4CNIA 2X6VA 4Y2NA 4DEPC 4CBPA 5J1AA 2G2RB 4O5LL 2ZOKA 3KGTA 1GOGA 1SHXA 2GUYA 2VT0A 4NKOA 4YX2L 3N40P 4A6YL 4DETA 4H5SB 1J9RA 2F7RA 1YMHB 5D72H 3OKEB 3PY9A 4XN4A 3S35L 1FNGB 4CN6A 2DTMH 3DDGA 3SYAA 5GZNC 4PM1A 3MBEB 4D9RD 1SYVA 1KLUA 4F2MB 3UGEA 1MEXH 1S7QA 4H8QA 2HVKA 3G5ZB 2GSIA 4TYUA 1CDJA 4PRDB 1OAJA 2R2EA 4IKJA 1MI5A 4RMWA 2X0UA 5LBSA 4MZ3A 1IBFA 2VDPH 2QFPA 4M3JA 4P5MA 2AAVA 4WWNA 4WRLA 3CUPA 4LVNC 4KGJA 3G6JA 3U30C 4TRPH 1HOCB 2GK2A 4MA3B 4CVXB 1J5HA 3FOLA 5H2BA 1Y07A 2IAMC 4KNUA 3A6CL 4MD4A 3BO8B 1BX2B 5IFHL 2NY1D 3AABA 3PABB 3V9CA 3X3FL 2X3BA 4Z7WB 5DMKA 1GC1L 3GLEA 3G9AB 4DW2H 1RZJC 4PRHE 4OTXH 5FW7A 1ZMYA 5T3XL 2Y5TB 1DE4B 3C5ZC 4M6NL 3P2DA 4WO4B 4PIBA 1FZKB 1YPZF 5LJYH 3ZYJA 5FIEA 5BW7A 1W0VB 4WNQB 4ELMF 4G1MA 2ICEB 2XFXA 3HS9A 1TZGH 3F7VB 4PTUB 2ICCA 4ODXA 3UH8A 2WKOF 3LKQA 4NRZA 3S4SB 4DGIH 3CZKA 3T65B 3GMNA 2EDMA 3WIHL 1LD9A 4R96B 3T3PF 3QXVA 1RJYA 3TA3A 3NRFA 4XGZA 7CGTA 2CHZA 1JYXA 2VMJA 3PQYE 3QDJA 4OKDA 4WEUD 1U92B 2ZXCA 1VPOH 3HCVA 1XH2A 3JWOH 1IAOB 4GAAA 5DU7A 5TE7H 4Y4FB 5LGJA 3MLWH 4KX7A 2WAHA 3Q13A 1A7RL 3EFOB 3IPBA 4PTUA 4AGPA 1G6RL 4DJMA 5DD1L 4Y9GA 4JY6B 1ZSDA 2R69L 4M00A 1PDKA 2H3XC 1OSZA 4LAQL 3GJEA 1DR9A 4H25A 2ZWYA 1PF3A 3EO0A 2DWDB 1DQKA 2HJFB 3KDPB 4MAYD 3UJJL 5DK0A 1XGZA 2H1LM 4M5ZL 1TQUA 5E6RB 3VXPB 3KPRB 4HIXL 1CE6A 5ISZD 3A4AA 1O5DT 1DJWA 1U8MA 5BS0E 5EC1B 4IHBA 2IAAC 3ARDA 4XBGB 2CJUH 3EH5B 2HKFH 1IEHA 3RPIA 5GGSA 3HVDA 2Q8BH 4CMMA 2Y1AA 5GJTL 2WM0A 3LH2H 1I9RL 4LARL 3REVB 2DKSA 2HWZL 1HHJA 3DK2A 1Z3GH 2UXGA 1SDDB 2H1XA 4FQ2L 4Q58C 3EHBC 5GRUL 5EU6D 4OLVL 5TH2B 3RWFB 2DWDA 3EOTH 4OJYA 3HN5A 3IFNL 1IGTA 4NS0A 3MUY1 1UACH 3O4LE 4MBRA 4P23B 3P77A 3NJLA 3FFCD 2VSKB 5ITFB 5E94A 2BLFA 4TSBL 1RZKL 1KJVB 3MA9H 3WO3B 2VDRL 3QNFA 1O7DE 1USQA 2B77A 3H55A 1S78C 3MLYL 4PMEA 1X9QA 5ECJE 4F3FB 3HMWH 2A9MH 1W72B 3UTZB 5GGRA 2ZG3A 5ICXA 4AQAB 3JWNC 1SBSH 2YLKA 4X5XB 2JCCA 2Z93B 2JH2A 1KT2B 3DMMD 2X4UB 1PZSA 1GGBL 4IJ3B 2FLMA 1V7NH 3OF6D 5ACLA 1CYGA 5D1XE 4DK3A 1FFQA 5DEJA 4JY5L 3HJ0A 2CO2A 4Q6IC 2J7LA 1YLBB 5E7BA 4QGTA 3ULVC 3PQYD 3HG4A 1FA4A 5HYFA 5T3XD 3B3IB 4E2OA 4F80A 1N5YH 1N0XL 2GIXA 3SODB 3V9EA 4YSDA 3DUHA 1TJGL 3IDMA 5EO0B 2V33A 1KT2A 4OZGE 2GFBA 2PCPB 5JPNB 1DQVA 3BVDB 1FH5H 1PMYA 3AMKA 1G6VK 4AJVA 2E8ZA 1RZ7L 1U8KA 3UDWC 2VDMH 4I85A 4BHUA 4Q9RL 4PGCB 5CHNA 4K7PL 2F18A 4K71B 4QXGH 5IHZA 4Q7DA 3QJQB 4BFGA 5CD5D 3W82A 2VSDA 4GKLA 2E9JA 1U91B 3JWNG 2K9UA 5HDWA 4OT1L 6PCYA 4MBOA 4G8GE 2ZKHH 4UQ3B 4XXWC 5I1AB 4ZS6C 1ZDQA 4JL2A 2G75B 4LU5H 2WYIA 2OX5B 5BOZG 2IH1A 2ITCB 2D7TL 3FB7B 1G7QB 2D3NA 2MOQA 5E6SB 1ZLWK 2ATKB 5BRZD 3VWJB 4R2GD 1JPSL 4M56A 4YGVA 2CIKB 1JJUA 3VM5A 3NYKA 3TPKA 4I1RA 1QSFD 3B6SB 5D71L 1EDQA 1BZQK 3FYIB 3R4DA 1TQTA 2CHWA 2KH2B 3AGWA 3GBMH 4NHCH 5T5FH 4HZAA 2BOBB 2WMPA 3QRLA 3RVUD 4AM0A 5GS2D 5IWLA 2BNRE 5ADOH 4PV9A 4WUKH 2Y36H 3JXAA 3MRFA 2IPUK 1LP9B 3KXFB 3MOBL 5IY5B 4HPOL 3J7HA 3DJ9A 4YK4B 4W93A 4HJ1A 1UD8A 4DESA 4TUOB 2FIKA 4RZCB 4C8XA 1GGIL 5KTEL 1UD4A 1XGYL 4XPBH 4ZUSB 4K5PA 3CAFA 4Y8AA 1KYOJ 3KYOB 5AVVB 3REWB 2IAND 4JRFA 5ABAA 4JJHA 4FXKC 3SQBA 3K8LA 3CFKA 1RULH 4PJHB 4LFHG 2NZ9D 3NMEA 3SKMA 1FZOA 3P9MB 3VTMA 4AQ8C 3I2CL 2B0SH 1U6AH 1ZLSH 1EGJH 3NRPA 3O9WA 4QYOA 4CVUA 1PLGH 2AF2A 3GTTA 3T2NL 4XNBA 5A6LA 1Q8MA 3PDOA 2R59A 1A7PL 4RZCA 1R4XA 2C3WA 3J8F7 2ZAIA 2XRAH 1C5CL 4L4JA 3MRQB 3A23A 3M07A 2DI7A 2OMZB 3ME0A 4OGZA 1GHFH 3VI3F 4F7PB 3EYQD 2A6KA 2V3EA 1MHPL 5ALBH 4LEXH 4KPHH 4AZ8B 1LEGB 1N3NB 1FL5A 1EAQA 4E42B 3KPPB 3L4TA 1XGQA 1ZOXA 1ES0B 4YXKH 1CBVL 2BSED 2SEBB 3FUFA 4RAVB 3DX8A 3HPLB 2QR0B 4N2HA 4H26A 1AOZA 3TF4A 3CX5K 5DHXB 2WLLB 4JHAL 4RAHA 5TQ2H 3AS1A 5JHDB 1AXSA 2JIXB 4UDUB 5LO7A 1I7TB 3ESNA 1AYOA 2IFFH 1OAKL 3CN4A 3KWXA 3NRQA 5CWSB 1HDMA 2FQDA 2H3NB 4IOFD 5EN3A 4NO5A 4ONGH 2N56A 4YO0A 3KLLA 3BPLB 4E9RA 5MEND 2PR4L 3IDIB 1UQSB 3MRKB 3VD7A 4JVUA 3BKYL 4JPIA 5T1KB 4PJCF 1UXWB 1YEFL 3DYPA 4KKCC 4KI5D 3WTUA 1YN6A 5D6DC 1YEJL 4L0PB 3MNWA 3ZE0F 1FO0L 3P1VA 1MCEA 4WFGE 1AMYA 4XPGH 4QWWC 43C9A 1MCCA 3KG5A 1K4CA 1D5MA 1DSWA 1AQDA 4JZOB 4OAWA 4PG9B 4PVBA 5BO1L 1WUNT 3MRCA 3C8HA 4OUUA 4CC4A 3HI6L 3QEGL 3JT0A 1Z0NA 5KEZA 4V11A 5IEKB 3F62A 4TQEL 5GSVA 3VXSD 3VD2A 3KPSA 3VH8A 3W9DA 5IQLA 4HH9B 3UBXG 2CLVA 3P3SA 4P2QE 1E5UI 3B5HA 3QXDA 3JWOC 4YS4A 2ZXWB 4A6YB 1JMXA 1U8NA 4D9QD 1IM9D 3WGUB 2OL3L 3SBQA 3S34L 2F19L 2YZ1A 4G7RB 1ZK5A 2CCWA 3LS4H 5E7FA 5IVXE 4UNVA 2WVVA 3LZFH 2JJTC 1DEEB 4G8FA 3S3JA 4G6FD 1BZ9B 1HYRC 2VLLB 2GHWB 3VA6A 1PZCA 3C5JB 2OMWB 3COOA 2ZONA 4L23A 8PAZA 1JRHI 2EZ0C 3EOYG 1EFQA 3GXNA 5IOPA 1E4XI 4K3JL 4H44C 3DMMB 4F7KA 1PJWA 3QIWA 3CDYA 4DQOL 4GRWE 1Z5YD 2XX0A 1T3FA 4PVNA 4TF4A 3N43B 1U4FA 4WK4B 4UTBA 1QSVA 4NN5C 5BZWB 1D5BB 4PRHA 1X5JA 4M6OL 2YPLD 1LQBC 3FO9A 4LP8A 3PQYB 5IB1B 2JB6A 5HXMA 3RRQA 1XO8A 4YUEL 4E9YA 1PLAA 2JF1A 4FFWD 4WSJA 1ZLWH 4QAWA 5E2VH 1ZJAA 4MQXD 1PD6A 4LAJH 1NMBL 3KCPB 4HIPA 4Y4KD 4JGMA 3FPYA 4KK9D 3HIZA 2VMFA 2K7PA 4LIQE 2VLJE 4JFEE 3I50H 1IKFL 3O6KH 2I26N 1YEWA 2WAQA 4J3TA 2AEPL 1CLYL 2KPWA 2D4FA 1PX3A 2XWZA 4BZ2H 1DQML 2IVFC 2JMRA 4HUCA 3GI9H 3KBEA 4GQRA 4JRXE 4ZNEA 2PW2A 3CZSA 2AKRB 3S36L 2JKTM 4FNLH 1WC7A 3SE4A 2NUTA 1UZGA 1R24B 1S9WA 2EDFA 2VB5A 3H54A 1LVEA 3JYBA 1JRHH 4RIRB 1DBML 1ZHKA 4IKIA 5IESL 1E4XH 1WDAA 3NCCB 4X4XB 4KO7A 2NNFA 5DT1H 5DC0A 1OO2A 2NDGA 4L8BA 1SN5A 2GITB 3E8UL 3SQRA 3VE0B 3DUUA 5BRZB 1ZPLA 4R2GB 1BVOA 1L4IA 5DRZA 3PL6A 5CFAA 3SPVA 4GG6E 1HHHB 1G6RB 4MB4A 1KIQB 2WKLA 1HT6A 1M7DB 1SQ2N 3WCYA 4DHLA 1XTMA 1E8XA 2Z35B 3ASWA 3KWVA 2YD7A 3O4LB 3R1GH 4B9ZA 3QS2A 4HXAL 1OVZA 2X09A 4A66A 5BS0A 3AMLA 4BGLA 4EDWL 2F8IA 4O02A 2B3RA 1TVHA 2ZUSA 1WWAX 2Q76A 4NUPA 5C7ZA 5K69A 1R0AL 2Q0ZX 4FTVE 4XMTA 1RJCA 3FUKA 3IPFA 5F7DA 4BRJA 5JHMA 4GW1B 3ROOA 1TQCC 2W5PA 1JXDA 3VG9B 3LQMA 5DCCA 1MJ7H 5D1XB 3LEXA 3D85B 1T1ZA 2L7JA 2H6UA 3U2SB 1SMDA 4QJ4B 1A4AA 4UANA 5IQ7H 4Y16B 3KPNB 1AI1L 1NINA 1QQDB 3FQWB 4NB7A 1EIBA 4XCFH 1XZ0A 3I6LD 2VDKL 2EEDA 4Y5XA 5IMMA 5E6UB 1SF5A 1MQKL 1YYLL 6PAZA 1AY1L 1QBLH 4P2YA 2DWSA 5LUMA 1KIRB 1U33A 2YR3A 2VDRB 2IF7A 3X3GL 1F2XK 3OXSA 1X4YA 2AZAA 4RX4D 5I8CB 3TBVA 2AV7B 2NY0C 4JPWL 3RGVC 3EUDA 4BH8B 4NENA 5HI5D 3ZE1B 2NR6D 2YQGA 4HCGA 1K8IB 3NAAH 4ENED 4RMSA 3W9EB 3MLUH 4NKMB 2A6IB 4JRYD 1KCVH 3L08A 4LEEA 3NCFB 5FECB 4DAGH 4G8GB 4QRAA 1DBKL 3EJCA 4KHTL 1K8DB 4HJ0D 4J1UB 3BQUB 5BJTB 4OGAD 4WI2A 2EDNA 3M86A 3UTPE 1KIRA 4OZGA 5E2WL 4QRPD 3FUNA 4NZDA 4Y88A 4Z7UF 4YE0A 2E4TA 3GPSA 3HC0B 3SDAA 5AVWB 2WZ5A 2Q10A 3L2LA 5CMAA 5LNDA 1KUMA 1AGBA 2WPGA 1KELL 4M5YL 1FZJA 1CICA 4EBQL 5MENB 5D93B 5EOTA 4S1QH 4OLZH 4TNVK 2ZWZA 1VGEL 4G43B 3RVXC 3W11C 4ZZFA 1DBAH 1EAPB 2BNRB 4LOFA 4FFYL 4DKEL 1BZ8A 4HWEL 1YEEH 3OX8A 4PWIA 2ZX7A 5DJAA 1H3PH 2Y07L 1JTTA 3G3LA 4XMLH 5D9SA 1E8YA 4X6DF 4XNXL 4RQQB 3OB8A 1KY6A 2PWHA 4JFQA 4N2AA 1SHMA 3BGFC 2ZPKH 2YD8A 1TO5A 1P4BH 3VD5A 1NGYB 3X17A 1DQDL 3L3IB 3P54A 1M1SA 2WUBH 4NQQA 4NP4L 2KZBA 1A6TB 3LPFA 4KC3B 3KPQB 2BSTA 2ENYA 3VXSB 3G9VA 3MV7D 2XQYK 4HUMB 1ML0A 2AJXH 1AG0A 4L3EE 2WQRA 1PZBA 2PTTB 4GINA 4XPHH 2E59A 4S0HA 3K81A 5JLZB 2EVGA 3T0EE 1AC0A 2GJ6E 1CO1A 1AO7D 5FR3A 3L3DB 3N06B 3F7QA 1FAIL 1PZ2A 1ADQL 2NXZD 3SKOB 3VRLF 3TX4A 2YAQA 3MNVA 1LWHA 3EYFB 2VXSL 4LHUG 4NAMA 2QVMA 4U1LA 4ATTA 3ISYA 4LASH 4WTWA 5ICUA 3GXMA 3QO0A 3TEXA 4LSUL 3OJDA 4ZMAT 2DMHA 2QGDA 2Q2LA 1TU2B 1D9KD 3WU1A 1DN0A 4MMYB 1MWAL 5HYIA 5I0XA 5IG7A 5I6MA 2FRGP 4YR6B 1N70A 5F9AC 2IOIA 3FUJA 4P46B 3D3VA 1R5WA 4GXVH 4MCZB 2PYED 3OJVC 3Q3GA 1R34A 4I0PA 1WFOA 3N42B 2Y6TE 1PEWA 4H40A 1JZ6A 1I1YA 2VDNH 1JNNL 4M7LH 5H35B 5J3HD 4IRSD 2FJGA 2K7QA 2FYYB 3SIKA 1KCRL 2NUPB 4BYHA 3HUJA 3IGLA 5JHLH 5I75C 2BWQA 3HA0A 4Z3JA 2WCPA 3CDCA 1B9ZA 5I2IA 4S2SA 5DQJA 4FYRA 3QSKB 3OMAB 4FL4B 2D3LA 1E90A 1FNAA 1JZ7A 4J3UA 3L3KB 2ZAGA 4D94A 3JTSB 3AFLA 3AXIA 3FB6B 3NP4A 4NJ9L 4PW4A 5M7QA 1AH1A 1HNFA 2PO6A 2V2WB 4ETYA 1MIML 5JDSB 4E5XG 5EEXA 4PJIE 4P5TB 2ED9A 1A6WL 1HFUA 2IFGA 2NUPA 4ZUUA 1RI8A 2XV2A 1NFDF 1J05A 3M8OL 2HAZA 3BHBA 1DDTA 1V27A 3O2WL 3U7YL 3BEVA 2O61A 1S7TA 4Y9FA 3TBSA 3TBYA 4ABUA 2HFGL 1AGFB 2EVIA 4K0OA 3F58H 4FHBD 1DL7H 5L9DL 3UC0L 1RSYA 1KN4L 1BLIA 1NA8A 3N0PB 3N9GH 2XZQH 4DUXA 1SMOA 3DK0A 1ACYH 3WFBL 4H0LC 3FT2A 3FUDA 3MU3A 4TPRL 2AJZA 4NZRL 4P2QB 4XPAH 4G80A 3RWHA 2GJ6D 5JO5B 2FK9A 5EU4A 5FGCE 5J06A 4TMPA 3RZCC 4G6JH 5E08L 2FEEL 1TZ8A 1P4LB 2ILLA 1FO0B 1H6TA 1MCWM 2RCSH 4GMSH 2BSCA 3Q0HA 5IVXB 1QPXA 5I17A 4XBEL 4FNTA 3DETC 4WV1B 4I3RL 1A3LL 2X9WA 3ZMRA 4JHWH 4Q74A 1HKLH 3MCKB 1CD1B 1ZLVK 1F90L 2YPVH 4HV8B 2V7NA 4XZ4A 1WWWX 3H0TA 4MJ6B 2VABB 3NFNA 2LE9A 4OH2A 1J48A 4I1NB 1EHKB 1MXGA 1QLEH 5T1MA 2XTJC 2Z4TA 2EE6A 4QTHA 5EF0A 4UIKL 1HE7A 4XPFH 4NZ8A 4EZMA 1EO8L 4WTZG 4M8QB 5CLWA 5CZXC 2TAAA 4JO2L 5GJSL 1QYGL 4JHUA 4G42A 3ZUNC 4BKLA 1YECH 4HUXA 5EWIH 3QWRD 3SD2A 4Q89A 2OL3B 2IPKA 2A1WL 3GKZA 1IM3B 4TNWK 3HC3L 5EUKB 4XX1G 4DFHA 5E6IA 1JP5A 2ZNWA 4TS6A 5IUCA 2ATAA 3GRWA 4UT9L 1NBZA 4AC2A 4U4BA 1IC7L 3VMPA 2HRGA 3IF1B 5MP6L 3K6OA 5C0GB 2P80A 3IFPB 3V8CA 3P3UA 5F7KC 3G5YA 3P3RA 2EDBA 3L5HA 2V5MA 3EH2A 3WFCH 3P3TA 2NW2B 5PAZA 4FQ1H 4UQ9A 4ISVB 4JQIA 4FQLL 4R90L 3QDMA 1I8IB 1KJ3L 2B5IC 3DPBB 3H1ZA 3L7EA 5ACZA 5BUGA 3GIVA 4XBPA 2BCKB 2X38A 4G11A 4QTFA 3ARTA 4X6CA 4N24A 1AZRA 4JRYB 3RURA 1UEMA 2YSSB 5HYJE 1J0IA 1I9IL 3OR7B 4MDIB 2E6JA 2OTPA 3L95A 4MWFA 5DJ0B 3IYLW 3OKMB 4B7LA 1A1NB 4ZUWB 2VQUA 2P7TB 3PWLA 4YBLC 3V7AE 2CKBL 3QNYA 3DV4A 1IC0A 3HNTH 2VLJA 4JFEA 1AAJA 3EO9H 1T2QH 4FQQA 4YSOA 1FGNL 2NYYC 4BIKA 5A3ID 2HP4A 4GG6B 3I6GB 1U8JA 1SHWA 3QPXH 4XAWH 1QWUA 4JRXA 4C4UA 4NFCA 3RDTC 5CJXC 1QATA 4LO9A 1OLZA 4PAZA 4WIQA 1AS7A 2PWEA 4GW5B 3IAPA 1JGVL 3G6DL 3BP4A 4G6AC 4ZS7L 3UPCA 2ZCLL 4HCRH 1AHWB 1WT5C 4QRQB 2XX1A 4W9EC 4C4KO 2I9TB 1MFAH 2VISB 4KK8D 4YEEA 3BWAB 2PCFA 3WKMH 4NNXA 5DGRA 3BUDA 3S0PA 1ETZA 3UBFA 1XEUA 5C09E 4H20L 3CHQA 3LIUA 5G5DB 4PSRA 5FCUH 4TLUA 4NO0A 5I1GL 1XH1A 5LGHH 2XI9A 2GAZB 1IC5H 2HB0A 2V9UA 3GXIA 3MROB 4FTVB 5AD0B 1J18A 5DI8B 1QHPA 1RJZB 4IHOA 3QEQA 3FHQA 5ERWA 1EO5A 3SJVE 3MJ9H 3MV7B 5EIIG 5JR1H 3CXFA 3ZUCA 1UA6L 1BJMA 1NL0H 1HWHB 1S7SA 4D8PA 4L5FH 2FQGA 1OTUD 3QO1A 4G8AC 1AO7B 3RWGB 3B9VA 1PY0A 1BM3H 2ADJA 2X4PA 3C08H 2AMUA 5DYFA 4YSCA 4KRPB 4AZUA 1S7RA 2OCJA 4PS4H 4TVPE 4Y5YC 5D5MF 4U33A 2GT9A 1MREL 1M71B 3PHOB 1CT8A 4YDIH 2VAJA 1RK7A 3QIBC 4KFMA 3T0DA 4WHCA 2WQXA 1FCCA 1WF5A 1VCAA 1D9KB 2L7UA 3OZ9L 4XT1C 3H2PA 3AM8A 2UZIH 2IQ9H 1M9SA 3PV7A 2YUZA 1FYTA 5J0BA 5JPMC 1KTLA 1KGXA 1RUPH 2XN9E 1JPEA 4C56E 4HS3A 1EMTH 2J1YA 5L7XL 2WZ6A 2EIDA 1OTTD 3NPZB 1AR1D 3L5XH 5AZ2H 4HBCH 5JORB 4OJDH 2ZWLT 3DI3B 4L1LA 3ZYIA 1SLXA 3JV0A 5KW9H 5MEPA 4D2NA 4JFSA 4L05A 2YEZA 4KO5A 2WJ5A 4QRSB 4LCWE 2ZUTA 5CGMA 1P7BA 3OR6B 4PFEA 3N5AA 4HUNB 4F2EA 4EZKA 4HC1H 2W91A 3O41B 5CJBA 1OAUH 2XWTA 2AITA 4ADGA 3OMNB 3DUSA 1OAZH 3TBTB 3ZQ9A 1BF5A 1L0QA 3DOIA 5I28A 2PXYD 1PFOA 4OQTA 5EIVA 4H7VA 4HLZH 3E9UA 1MCPH 1S9VB 3WY1A 2F58H 3QCTH 2A77H 3BH4A 3DVFA 5I8KH 1UM5L 3UERA 3UPRB 3NJKA 5HYEA 1Q1JH 3S3CB 2AK4E 2N7BA 1JDAA 4HUUB 2W0FA 3QUZD 2HT3C 1NOFA 1SOKA 4MMZC 4YSAA 3IKKA 1I1AA 2HFEA 1QO3B 2HYMA 4FI7A 1UOWA 3HE7B 4DKFH 4PJCE 3GSWA 5F0MB 1JGEB 3B43A 1ZLVH 3VXNA 1GGCL 1J9TA 2P8MB 3GMLA 2GIYA 4IIZA 3RVWD 2EINB 2NZ1A 3OG6B 2HT4D 4WFFD 4BFRA 1TTAA 4HSQA 4JZNB 5EFIA 4JCWA 1JUFB 2ICES 2CDEB 3Q5TA 4G6ML 5E2UH 3FRPB 4HCFA 3NJNA 3T0EB 1T5XB 2GJ6B 2ORBL 5KS9F 2V2XB 2QVIA 3VSTA 4JPVL 1XH0A 1JWUB 1XH3B 1UG9A 3WXVL 4ODTH 5TDNB 4KZDH 2RBLA 2IADB 5LBSH 1TZIA 3UL4A 4XNZB 4Z8FL 4LLMA 4NGHH 4IDJL 2CE6A 4YZFF 1QR1B 3IDYC 4ELKA 4OCXL 4HXBL 3CZFA 3BSHA 3IGFA 4Y4HD 5GIRA 5KZCD 5F8RC 1EXHA 1NCUA 3EDFA 2W9DH 4L3EA 5CN1A 2MRYA 4YVUA 2Z8WC 5G2NA 2XN9D 1S8DA 1CFSA 1MPAL 3PFQA 1L9PA 3LV3A 1NPNA 3F64A 1S7VA 5HGGS 5CAYB 4H8WC 4KZEH 2ZP0T 3L3OC 4BWTA 3QQDB 5IMLB 1XGPA 1XSIA 3FUHA 1H5BA 1I3VA 3C5SB 3ELQA 1E9PB 4Q9BA 5F6IB 3H9ZA 5EOQL 2ZXQA 3QJFA 2VR5A 4TULH 1V3JA 2GK0B 2EE9A 4CSZA 4PLJD 1ZLUH 4Z78B 1N4XH 4NHUA 5C97A 1AJ7L 3FU5A 4LLVA 4XWGL 3ZY7A 1FQ9C 3FQ2A 2VDQH 2L3BA 4HKZB 2NYKA 4G8IA 2QKIB 5I74B 1UVQA 3AROA 2P5WA 3VU2A 3WLWC 2X4NB 1MWAB 3D9AH 5SV4A 3D0LA 1BF8A 1T7VA 3VFPB 3GBLA 1NAML 3N85L 4GSRA 4MSWB 3KLDA 4E41D 3WEOA 2QADB 2NNAA 4OBRA 4PJIB 4XOEA 4F37K 3QG6B 5CBAB 1O9ZA 1WEJL 3WNIA 3NEOA 4YE4H 4FI6A 1HXYB 4L9DA 5EUOA 3OHXC 3UCRA 3HB3C 5F7BA 3KYNB 8FABA 2J1KA 4FXGC 3CU1A 5GGUA 4P3WA 4UQAA 5C0BE 1VFAB 3S5YA 3L1OH 4KITB 1J9QA 2XWXA 1TFHA 1U3HD 4B5ZA 2NXYC 4BZYA 5L0QC 4I5BB 4ZQTA 2CUAA 2IXQA 4XOCA 5GZOC 1E28B 5BVJB 2CO6B 1H6FA 4OCSH 1I31A 5TQ0H 4HHAB 2DQGL 3TEUA 3CLFL 2FBRA 25C8L 2J8HA 1FLRL 2H47C 2OCFD 2XPGB 5AVZB 4N8PA 3ORJA 5I66A 3MODH 1HHKB 4ODUB 1T22A 5KOMC 5ELIA 4BGDA 2RHEA 3DHUA 2B1AH 2DBLH 3FH8A 4KTYA 1DJHA 4YLBA 1U8PA 3O6ML 2VN7A 4HEME 4LDCA 4FKHA 1TJIH 1EBPA 4I18B 1AKJA 3ESOA 5SWZD 4KJPC 4YDKH 3QEHA 1ZT1B 3B9KC 2VW6A 1GJWA 3GRBA 3AREB 1KPRB 2E0PA 2MWCA 4HIIA 1J1XH 1NPUA 2F7IA 1CTOA 4ZX5A 3FT0A 1XTLA 3N6YA 1CGSL 3UAJD 4BHUI 1U3YA 2J21A 5LGYA 2AABL 5HGDB 5D7SL 4X98B 1GL4B 4P57A 1IGCL 5FYJU 5DURD 1XR8A 3H7LA 4F33B 4OUOA 3OKDA 2OYKA 1K6QL 2MIZA 2V7HA 1B2WL 1EBAA 1NM4A 3DNKA 5DRWB 1JZGA 1F8TH 1P1VA 5DD5H 4N0CC 3CHRA 3PGDA 3H3PL 1UTDA 3HN3A 2QLVB 4PYGA 1O7VA 3U9UB 3GBDA 1S5HB 2JB5L 5B1JC 1SXAA 2XPYA 4B9IA 3L1FA 4GAYA 2HTLC 2XXFA 2FL5B 4CW1B 4IYKA 2HJLB 3Q05A 1N6QL 3VDBA 3K80A 3DDFA 4X7SH 5AW2B 2VIRA 2Z92B 4RVBA 3RG1C 4WGVB 2VXQA 3ASOB 1YUHB 1PIGA 3TXAA 4GH7B 3AT9A 5J8OA 2ZUXA 3AU1A 3MYZA 1AR1B 3EDDA 1OEZW 4EJ1C 1FDLL 2XBZA 5E70A 5C0BD 5INDB 3O0LA 2F2HA 5HYJB 3VD9A 4Z7IA 3ATDA 5TE4L 3SE3A 2G9HA 4G6KL 1J0YA 3RAJH 4HQQL 4N85A 1MVYA 1YMMD 2G5RA 4U3XA 2XQYG 2AEQH 1XCXA 5I1DA 4E0RB 4YHIB 3HI5L 2O6DA 2LGNA 1YEKH 4Q52A 3RPBA 2D3JA 1DFBH 3CU7A 1JGDA 1AACA 2K4WA 4MXVE 4YFLI 3X11A 1KBPA 2GCYA 4LGPB