4A6EA

Crystal structure of human n-acetylserotonin methyltransferase (asmt) in complex with sam and n-acetylserotonin
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
347
structure length
345
Chain Sequence
MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHGTELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDLSVFPLMCDLGGGAGALAKECMSLYPGCKITVFDIPEVVWTAKQHFSFEEQIDFQEGDFFKDPLPEADLYILARVLHDWADGKCSHLLERIYHTCKPGGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGFRDFQFKKTGAIYDAILARKGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords HYDROXYINDOLE O-METHYLTRANSFERASE
total genus 122
structure length 345
sequence length 347
ec nomenclature ec 2.1.1.4: Acetylserotonin O-methyltransferase.
pdb deposition date 2011-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF16864 Dimerisation2 Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4a6eA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4a6eA02
5A2QZ 1DDNA 3V8JA 3B7PA 5LEKA 4B8XA 2P5LC 2PXAA 2IT0A 1F9NA 1ULYA 3ID6C 2BR5A 3G2MA 1ZLJA 2O03A 2RQPA 4GCVA 4CTJA 1ORHA 3P9KA 2CWEA 3RDIA 4KT5C 1R58A 1AQIA 3M6WA 2HYGD 3HRMA 1P91A 4YUWA 1KHHA 5LLQA 3R0AA 3B3FA 2YTZA 3I0TA 1YW9A 2AOXA 4M37A 1RI5A 3C6MA 3MWMA 2KJCA 4HTFB 1GVJA 3RYRA 3HP7A 2V79A 3O7WA 1JG4A 3COAC 3F4KA 4RGSA 1K7AA 3P9CA 2CWWA 1RJGA 2M8EA 3CJNA 3V8LA 2PT9A 3NTVA 4I0AA 1SMYF 1HKQA 1LNWA 2OQRA 3C0KA 3P71T 4G7OF 3R6TA 4LJZF 1KPHA 1YO5C 1RUOA 3DLCA 3JW4A 1NW5A 4QPNA 4X63A 4ER5A 3MHTA 3DLIA 1BC7C 3HRTA 4GC9A 1MJAA 1SQGA 4XSXF 2NNNA 4O5VA 3EPPA 1G6Q1 3TO7A 2B9EA 4OQDA 2HTSA 2CFXA 1MJFA 4BY9E 2LD4A 4DMGA 5E1WA 4C04A 2LNBA 1N2XA 2BZGA 5JHUA 4RB2C 4Q47A 2GAFA 3A25A 3QV2A 3TM5A 3E6CC 5K5RA 2WA1A 5LQKA 2XAFA 1SG9A 1NW7A 1F5TA 4CWAA 2YSRA 1T6SA 3BJ6A 4EM0B 3HVJA 3WE2A 2ZZKA 4MEXF 1RJEA 5FTWA 5G02A 3P2KA 1JQ3A 2N47A 3RKYA 5K0CA 2GIVA 3BZ6A 4ENJA 2XAHA 2ONZA 5CIYA 2GA9A 3X0DA 1LB2A 3H3UA 4KN4X 3BPXA 1QAMA 3K2ZA 4KRGA 5FFZA 5E8RA 2GB4A 2DULA 2D1HA 2VDUE 4LWOA 3MFKA 2XAJA 3CJTA 2AOWA 4UOEA 3UJ6A 2PJPA 1QZYA 1WG8A 3EYIA 4EV0A 3LDUA 2BE5F 5K0LA 1BBYA 1TNSA 1P2FA 4RTOA 1F38A 1YFJA 1XSXA 4L5JA 2CQKA 4ESFA 2JHCA 2WV0A 2OU2A 2OO3A 4XCXA 5LQNA 1PDNC 5ICGA 3GRUA 2AOTA 1S7OA 2H94A 3U2RA 3VODA 1FSHA 2A61A 2ZNYA 2L4MA 3GFIA 2PLYA 3GF2A 1DUSA 1JSZA 3ELWA 5K03A 5DCMA 1PRYA 3GRZA 1G38A 4CDGA 3KP3A 4BHPA 3WTTC 1SD5A 3FRIA 1A04A 4D0PA 1NW8A 1XGNA 3HHHA 4GXOA 2GQQA 2DTRA 3F3XA 1X1AA 3FUTA 4N9HA 4IV0A 3HA3A 4P96A 4RTQA 3G5LA 2JPCA 1IXSB 3HCFA 4GQBA 4C06A 1LJ9A 4I98B 2O0LA 4YUVA 4IHTA 3TRKA 1LDJA 2MBFA 3G5TA 5H02A 4LG1A 3C1DA 3TKAA 4BNCA 3IC7A 1UFKA 3MAGA 2ZFUA 2XVCA 1AOYA 4IRGA 2NNWB 2W25A 1J2XA 5HLHA 3HEMA 4RWZA 3O4FA 3L2CA 1U6GA 1Z3CA 3TQNA 4NQWA 2MA3A 2E1NA 4XBFA 3IYLW 4Q48A 9MHTA 1XDZA 2QQBA 2ISZA 1DUXC 1KP9A 1S7AA 1XSDA 3VB2A 3DXJF 2C6YA 4IWNA 2ZZNA 1D2HA 1QAOA 1ZRDA 2AN3A 2PT6A 3KQVA 2QM3A 5ILVA 1R18A 5EC8A 3EEOA 3G3ZA 2NXCA 3LBFA 2QVOA 3FMSA 2JHAA 1O57A 4AZTA 3BJOA 1JHHA 3HTUA 4A12A 2EX4A 4L9NA 3GO4A 4UVCA 5LGUA 1LDDA 2HMYB 5P8WA 1J5YA 2W85A 1G6NA 4KYWA 3U1DA 2OD5A 4KWCA 4PGGA 1I1GA 3EVFA 1RZ4A 3TDUC 1XCJA 3LWFA 3C7JA 3BUSA 1Q0SA 2W24A 2IA0A 1UHMA 3KU1A 4PNEA 1UCRA 4QWQA 1O3SA 3M9AA 4ENKA 2V9VA 3J80Z 3EUHA 4CKEA 3SXYA 2P1DA 4FX0A 3FM3A 4CXMA 3I53A 2G8NA 3HCEA 5HOQA 5E20A 5DM4A 1D2CA 1HW1A 3VC1A 3OFJA 2P8TA 3CBGA 3NDIA 5K0GA 2P7HA 4RVFA 3NVMB 5K05A 5DLYA 2IJLA 4KW7A 2HKXA 1WXXA 2FBHA 2M87A 5E8GA 1K79A 2ZVJA 2PQ8A 4HF1A 3LCUA 1SFUA 2XAGA 1V3FA 5E2AA 2LSOA 3DXYA 3I4PA 2BV6A 4A0YA 4IPAA 3G2QA 5AONA 5ICFA 5IT9K 4FSXA 1BJAA 2WC2A 4A6DA 3KKZA 1PUEE 1AQJA 3T8TA 1SD6A 4LFUA 1TW2A 5HIJA 4MNUA 1H9GA 1J0RA 4AIHA 2LKPA 2K27A 3RI4A 2EJUA 4HH4A 3M1EA 2VZ9A 2HKOA 5U4XA 1NW6A 1K6OA 2UZKA 1D3YA 1O7FA 3JSOA 2QZ8A 1UHWA 1Z6TA 3M8FA 2CG4A 2V6CA 1GXPA 3FPGA 4EJVA 3LQQA 2O3FA 1T2KA 2CSOA 3GRVA 3SXJA 3I58A 4PYQA 5DDGA 5ERIA 2XAQA 4JQFA 4AUKA 5HZMA 3HSRA 2IBSA 2P5VA 3IRRA 5ICCA 4MGRA 2B78A 3M7GA 4OIOF 4LLLA 2WA2A 2LDUA 4NHJA 4OBWA 1G3YA 5H6QA 3QOXA 2AXLA 4KFCA 3AJDA 3WTUC 1JQDA 2G70A 5DUIA 3Q5FA 2ESRA 3QAHA 3WTSC 1KQ8A 3JTHA 1MJ9A 3OE5A 2STWA 5HIKA 5K0FA 2DT5A 2PY6A 3ER8A 2E7XA 4CGZA 2UWMA 1W7PA 1WZNA 5DX1A 4I09A 1SUIA 2A3SA 5LQUA 1EJ0A 1USSA 4FS8A 2P35A 3GZ6A 5LQAA 4P5OA 5CVJA 2O0YA 1DPRA 1Y8CA 3ABUA 1VP3A 1S6LA 1QANA 1R23A 1WI9A 5FFXA 1J59A 2XBMA 3RPQA 1I9GA 1SD7A 3R0JA 1XGMA 3CDHA 1KIAA 2P7IA 4BH9A 4UV9A 1BOOA 5HS8A 5DSXA 4U7TB 2ZLBA 4MQVA 3CVOA 4XUEA 3W6JB 4Y15A 2P3OA 4HSGA 2K7LA 1JG2A 2PXXA 3BWMA 3GJYA 1XXLA 2ERCA 3KP2A 1R5HA 2H1RA 5HDKA 3ERCA 2UYOA 3FUVA 3G8BA 3QP5A 4A2UA 1G55A 5C1IA 1KPGA 3FPFA 2RKHA 4V0RA 5FUBA 1M6EX 2H11A 4HTFA 3KP4A 3EVDA 4GEKA 1P6RA 5EZSA 4OQEA 3KP6A 3UA4A 1NV9A 2QLZA 2AOTB 1KU3A 4HDUA 3CUQC 1FYKA 3FYDA 1IRFA 1D2GA 4G9YA 3DF8A 2V1XA 2Y48A 3TGNA 1ORIA 2CKDA 3ML6A 3OU6A 3H3ZA 3HCBA 2AR0A 3M6XA 3K0BA 4PYMA 5LRSA 4E2YA 3BJAA 1FBNA 5AIQA 3OZSA 1VQ1A 4HV5A 3GEZA 2OY0A 3HSFA 5LQCA 3OZRA 4ZZLA 5FULA 5GP1A 3M4XA 4OIRF 3IL2A 5FWDA 4R8SA 3KPJA 2GZWA 1IXCA 2MD5A 4C05A 2DPUA 3V7SA 5BQTA 5EGSA 5EOVA 4ER6A 1X1DA 3HHGA 3FUWA 4Q5SF 5CVDA 2IBTA 4HV6A 1I1SA 2XVAA 4F7ZA 1JGSA 3UJ8A 3KR2A 4CXFA 4LB5A 1ON1A 4R1HA 1CF7B 5T67A 2WK1A 5FB2A 1ZH5A 3HRSA 2AVNA 1QZZA 3T7TA 2G1PA 2AS0A 4RB1A 2MC3A 3R4KA 3NRVA 2E1CA 1J75A 1L1EA 1KA8A 1O9GA 1HMYA 4QVGA 4KIGA 1T43A 1T0FA 2P5KA 2ZMEB 3E6MA 3GZ5A 4IV8A 4HA8A 3DPTA 4ENNA 4YUZA 2C7PA 4WVLA 3CUQA 4YFXF 1PP7U 3FXUA 4I7HA 4X1OA 4MTDA 3EVBA 3Q9VA 1ZYRF 1F1ZA 1VTNC 1ONVA 3PLAE 4UVAA 4P55A 4M71A 1YW7A 3EQLF 1U5TC 2H6BA 1KU9A 3C3YA 1BIBA 1XMKA 3BXOA 3UWPA 3O6BB 2PBFA 2XASA 6PAXA 3UJCA 4G56A 1BKYA 1UB9A 4O29A 2FK8A 1OYWA 4RB0A 1NBHA 4L0ZB 2ZBPA 3EVGA 5EMJA 5K09A 3DH0A 3K6RA 3SX0A 2FHPA 3GFJA 4PYLA 1O3RA 2VC1A 2QWWA 2K4JA 3OZTA 3P2EA 3BKWA 2VT3A 3KE2A 3VFZA 4U7PB 3KP7A 1RI3A 2YXEA 2OKCA 5H6RA 4KUMA 5A2QK 1G8AA 4CICA 4YFNF 3ZN1A 3ERED 2NXNA 1VE3A 4AWXB 2IIPA 2IRFG 3TR6A 2Z6QA 3SFZA 3E97A 4KICA 1Z05A 3KQOA 4HZFA 3GWZA 2OZVA 1WSUA 5IT3A 5HLGA 2DQLA 5LGTA 5DSTA 1JE8A 4X61A 5DX8A 2B0LA 4YG2F 4R8HA 4G6DA 2HOEA 3OOPA 2PX4A 5FQOA 3ZMZA 3N4MA 4HF2A 3RKXA 1ZGAA 2QUFA 3UA3A 3PFIA 1YS7A 3QOPA 1U2ZA 5F64A 1YZ3A 1SFXA 3BGDA 4IJAA 3B89A 4K6MA 1HXDA 3PX3A 1IY9A 4LMYA 4HAMA 1UFMA 3KQYA 3IV6A 4RTLA 4LLNA 2PBIA 3T0YA 3E3VA 2RDPA 1NHAA 5HEKA 5TJJA 4B09A 3WSTA 2DPDA 4A5NA 3J81K 1R5GA 4MHGA 1N7JA 4HOBA 3J80K 4PINA 3RW9A 2O61A 2QQAA 3LA3A 5DYMA 1J9IA 2PSSA 3FHZA 3A7EA 4AX8A 3BPVA 1JG3A 2FE3A 4QTUB 3A7DA 5E9QA 4C4AA 4LG0A 4O3MA 3KHKA 1QGPA 2XKOA 4MQ9F 4ER7A 5BS6A 5DD4A 1P1BA 3HA7A 5HS7A 4E2ZA 1O54A 2EFQA 1S8NA 3PQJA 1YZHA 4CKBA 4KMUX 3PTAA 4HGYA 2PGXA 2JH8A 4P58A 1ZRFA 4FGZA 1KQ0A 1YUBA 3DMHA 4TV7A 2X0LA 1T38A 3LCCA 4QLCU 1H0MA 3JAMZ 5FA8A 4EM2A 3R0QA 3SSNA 2DU9A 1MZBA 4FHTA 1QBJA 3D2LA 5EIWA 2ZBQA 5AIPA 2G7UA 4E2WA 2RV8A 1OR7A 2R7DA 4ON0A 4KA4A 3C3WA 3FPEA 2DW4A 3U9GA 2BR4A 4RYLA 1VLMA 2YVLA 2HTJA 3S68A 1WRJA 1F4KA 1EQAA 1YLFA 2ZULA 2A5YB 3HVHA 2JRTA 5KYGA 3MTEA 1KGSA 4GOLD 2CW0F 2HEOA 2BGCA 2EV6A 2CYYA 1BOAA 3PT9A 2DK5A 5L3EA 2VE9A 4CYDA 2XYRA 2QE6A 3ORHA 2P41A 3W6KB 4BYYA 3LDFA 3ZPLA 2XUBA 3JWGA 3VSEA 5KQRA 3O3KA 1FPQA 2JJQA 3UJ9A 1BHJA 1FOKA 1WKMA 4YV0A 5BOXA 1U78A 3WGIA 3P2IA 4HW0A 3ANXA 3EVEA 3LX6A 5E1ZB 3LGAA 1FP1D 1K78B 5HILA 3HNRA 4MHTA 2ONYA 4RGUA 2O07A 2AZTA 3G73A 1IM8A 2VODA 4YFKF 4YMGA 5CM2Z 4S04A 1W5TA 4IF4A 3P7NA 3P8ZA 1Z91A 1HW2A 2BM9A 2FXAA 4MIKA 5FLXZ 2QBYA 2VT2A 4RGXA 4FT8A 4DZRA 1MGTA 1JXSA 1ZHFA 3D5LA 3L7WA 2XYVA 5GINE 1ZG3A 1SUSA 2EFJA 2QY6A 4I2OA 2G72A 2K86A 2A14A 2QENA 1TQPA 1YYVA 5DUKA 4ZH4F 5HDNA 2M45A 3RYPA 2AVDA 5DTMA 1U5TB 4I0BA 1YQAA 3KQPA 1O3TA 3IHUA 3MQ0A 3KZZA 5D4RA 1QPMA 3KLOA 1YIOA 3FX3A 3F72A 4HG2A 4EKGA 5FO5A 4U0YA 2XRNA 4HQMA 1I6XA 1ZAOA 3NW9A 3HTXA 2ETHA 4FT2A 5HS9A 3K69A 4PYJA 3EETA 2MLKA 1TBXA 3F23A 1D5VA 2HS5A 4R05A 2AN4A 2YXLA 1SVUA 4ESJA 3MZHA 2JSCA 1W7PB 5D6FA 4WX9A 2FRHA 4MWZA 5DPMA 2YQZA 5FGMA 1H1DA 2RGVA 4ATNA 4DA4A 4BQAA 1XGOA 5CJ9A 3AAFA 4FZVA 2G71A 3A27A 4UNOA 5L3DA 3RIRA 4BLUA 4P9UA 1RUNA 5K0JA 1LVAA 2X4HA 5L3BA 3NEUA 2AOUB 2GWRA 2JH9A 2PJDA 2A69F 3LFKA 4L7VA 2ELHA 2OZ6A 4WXDA 4PYOA 5FWAA 2P8JA 2XROA 4CTKA 1IN7A 4ETSA 3GW2A 1I1NA 3NDJA 3E6BA 3EDPA 2CO5A 3GCZA 4M9ZA 3F8CA 3KR0A 3WU0A 4E30A 5FADA 2OAZA 4HX7A 3NWEA 4PZJA 3LCVB 1UWVA 1MHTA 2P6SA 3BDDA 3T7RA 4ZYEA 4QVKA 2YX7A 2YR0A 3KQTA 1FX7A 2KW5A 2BH2A 4M73A 3GIWA 1YB2A 2QBYB 1UIRA 5CVUA 5HDGA 1XJ5A 2C7QA 3M8EA 3NWBA 2EV5A 3T1BA 4E31A 1ZQ9A 2QRVA 2EFWA 2ZCWA 2F5FA 3MAJA 1O7LA 4M6YA 2EFOA 2F5CA 1B59A 2FRXA 3I9FA 2PKWA 2OQGA 1WS6A 3SVZA 1RJFA 1I5ZA 5D8KB 2OBFA 3R24A 4L5IA 4XSZF 3ZQ7A 2HQNA 3RPUA 2F5EA 3UJAA 3DFGA 3CO7C 5GIPE 4RB3C 3WTVC 3FRHA 4A6EA 2P40A 1U5TA 2ZWVA 1U2WA 1RNLA 1VL5A 3IWZA 3PX2A 1M0EA 1OR8A 4FSDA 4YV1A 1IF1A 5LGNA 4PONA 4DNCA 2DLLA 4HC4A 4GF5A 2EA4A 2FK7A 3J7AO 3EGIA 4BLVA 4QQKA 4U0VA 4FT4A 5JFRA 4X41A 2GPYA 2IDKA 4U0WA 5F6FA 3FTDA 4LLGF 4EGZA 3R6SA 4DQ2A 4HX4A 3E5XA 2XYQA 4IKPA 3KFWX 2E5WA 2GA1A 2FSWA 4OBXA 2FU4A 3WTXC 3CO6C 1ZARA 1IN8A 2B2CA 3SSMA 2EK5A 3T8RA 1I27A 1R6AA 4E2XA 1B1BA 1NE2A 3N97A 3RIEA 2PMUA 3E7PA 2H09A 5HIIA 2UYCA 2FMLA 4BP3A 4WXCA 5LHIA 3SHFA 3AXTA 3I54A 2A6HF 4M72A 2ZSUA 3QPHA 3HVKA 4JXJA 4EJWA 3LDGA 3JWJA 2NP6A 4R8RA 2FYTA 3H92A 3BP8A 3P9NA 1L3CA 2FOKA 1GHCA 4IRIA 3EYYA 1YFHA 2BM8A 3TOSA 3Q9SA 5M5BA 3LA2A 2RN7A 2FNPA 3FXQA 1MKMA 3HSEA 1BN5A 1IAWA 5CD1A 4PWYA 5D5WB 1XSVA 3C6KA 3KQSA 2EJRA 4GOND 1R00A 3M70A 3K1MA 2R3SA 3KEOA 1KYZA 1XTPA 1E2XA 2VE8A 4OINF 2Z6AA 4XLNF 2DPMA 2RNJA 5D5UB 3CGGA 3KPUA 5J6XA 3GVAA 3ELKA 4E32A 4F86A 2Z5UA 4M9SA 4DCGA 2UXNA 2VONA 2QQ9A 4YV2A 2V7EA 1TTYA 3VYWA 1T98A 4X60A 4CHUA 5FHQA 3UJDA 4AIKA 3BWCA 1L3LA 2DK8A 4LECA 2ORED 3SR4A 4YIIA 4BHCA 2FBKA 3RTRA 2KJBA 1ZKDA 3BROA 5DM1A 3DR5A 3NJRA 3BT7A 1XCLA 1IN5A 1EIZA 5FCDA 3K1PA 3DV8A 4FP9A 2CGPA 1IW7F 5BPIA 1X1CA 3R3HA 2GAUA 3R60A 2ESNA 2BR3A 2ZIFA 2GXBA 1YF3A 3WGGA 1R8YA 3ELYA 2P3LA 2P7CB 1X19A 4UHTA 1QAQA 3DTNA 3FPJA 2QYOA 5DCMB 2AN5A 1V4RA 3ZMSA 4M9XA 1IN6A 3GFMA 3EVCA 10MHA 2IVMA 3ELDA 2J5PA 4RTPA 4EKIA 5EEHA 2FBIA 5FQNA 1B4AA 2JPBA 1R22A 1S29A 2O05A 4QDKA 2Q0OA 3OU2A 1BM9A 3V8VA 3GFLA 3MB5A 1TW3A 3LA7A 3CUOA 1TQIA 1XB4A 4A0XA 5JVTA 2GH1A 3ELUA 1RI7A 4BAYA 1DL5A 1NKVA 4JBAA 3A4TA 1USTA 1ZG1A 3KQQA 4QTTB 3FTFA 4JK1X 3F8MA 4WWCA 4DM3A 4HLXA 1IN4A 1PJZA 1EJ6A 3HCAA 5L3FA 4KMFA 5CLSA 2I62A 2IPQX 3LL7A 2VBZA 4OMZA 4PCLA 3BZBA 5FD6A 4IHSA 1NBIA 3JTGA 3CJRA 5GM1A 2PI0A 3FZVA 4RVHA 4KDRA 5J8CA 2FNAA 2HYFA 1SAXA 4OIPF 4PYKA 4A5MA 1YS6A 4POOA 3HOTA 5EG5A 4P9FA 1R1TA 2XKPA 3G2OA 3FUXA 1FZPB 5K01A 2OZUA 5GOZA 2GXGA 1B9MA 2IGTA 4K2EA 4U7BA 2JG3A 3G88A 1X3UA 4GYIA 5D8LB 3OFKA 5CCBA 2HGCA 2VBWA 3C3PA 2M1BA 2IA1A 2OBPA 2P6TA 1IZ1A 1EH6A 4ESBA 4N9IA 1LQ1A 2ZCJA 3L9FA 3LSTA 2V1DA 2I9KA 2IH2A 1OMIA 3EMDA 3E05A 4OA5A 3I59B 4PCAA 2OXTA 1YTYA 1Z7UA 2M5WA 2UZ4A 2YR2A 4GOMD 1XD7A 5HOOA 2CMGA 3V97A 5EEGA 5E8JA 2VC0A 3BGVA 2XV4S 3OCJA 3TFWA 2COMA 5LHGA 4KVZA 3JWIA 2PMHA 3O31A 4H0NA 4BXUA 5DTRA 2ZKZA 1VIDA 3KZYA 3WTWC 4YUYA 1HKSA 3F6VA 2ZFWA 3E5QA 1B42A 3BWGA 4AD9A 1KU2A 1EAMA 3G8AA 3WTYC 4RAYA 5E17F 2VBYA 3TM4A 2H6CA 2ZWAA 5LBQA 4ISCA 4G6QA 2VBXA 4PGHA 3GNLA 5BW5A 4GGGA 3GLXA 2NXJA 4ENMA 1S3JA 2O06A 4DCMA 4IXAA 2ZBKA 2R7FA 2Z99A 4EJTA 4UXNA 2GS9A 2HR3A 2HQRA 3F6OA 3FTCA 3TQSA 1OKRA 1JG1A 5J8FA 4XLPF 4E70A 1YG2A 2XVMA 3KR9A 1FYMA 3JWHA 2Y1XA 1JTFA 2NXEA 4RGRA 1TNTA 4Y30A 2K02A 1FBUA 4RV9A 5JUWA 5DT2A 2PFBA 1SQFA 4YIFA 3FWEA 5DX0A 3GRYA 1KQ9A 2HWVA 1P4WA 3E6DA 5ED4A 1BC5A 5LQJA 3VOEA 4RS8A 2O6GE 2CMHA 1JHFA 1SD4A 2NRAC 4HLYA 1KU7A 1IXRC 2OA4A 1P39A 4EJOA 4RSRA 3M6UA 4Z2YA 2G9WA 3CLOA 4ZYHA 3DOUA 3F21A 4G7ZF 1P1CA 1Z6RA 3QOWA 3DULA 1P4XA 1H9TA 4RAZA 4HX8A 2BEOA 2ZIEA 1SKMA 4RTKA 3HTSB 3KLNA 4PYNA 1NT2A 1L3IA 3ULQB 2I6GA 2XGXA 3E5UA 3BOQA 3PVCA 3V7RA 3F8BA 3I5UA 4OOIA 3E23A 3LKDA 4GYGA 2DAOA 1YFLA 3ZMTA 5IKMA 4P7JA 5E18F 2HZTA 3WGHA 1BI0A 3GGDA 5LEJA 2PWPA 3OV8A 4HGZA 4DF3A 1CGPA 3MCTA 5EIFA 3K0LA 3ISPA 3L00A 3L8DA 1G3TA 2PLWA 2E7WA 2FQ3A 3WTZA 3TO6A 1SFEA 1FLIA 5E9WA 5D1HA 1NV8A 4HRAA 1FT9A 2L3DA 2NS0A 1G4DA 3CCFA 3IHTA 5D4SA 2VN2A 5EKUA 1R1VA 3DMGA 5FLXK 3Q7EA 5DCFA 2DBBA 3GO5A 5F1RA 2UYHA 1L9KA 3E8SA 5EMKA 3PFGA 5DV5A 3O2PE 1QNTA 3K9TA 3CJQA 1O3QA 1RJDA 1XVAA 2EJTA 2KIFA 2DFIA 1R8XA 2PX5A 4MQ4A 5E9JA 2L54A 2ZXJA 3KPVA 3RKWA 4G94A 1WQ2A 3KR1A 2ESHA 3LAJA 4BLWA 1Y0UA 3HIFA 2EFNA 4HDVA 4QQNA 2XIGA 1P92A 1ODDA 2ZO4A 3OU7A 2Q8KA 4Q4ZF 2VDVE 1EH7A 4E33A 4RTNA 5K0BA 1M6YA 3PS9A 4PCQA 2ADUA 4AVPA 4S05A 5E1XA 3BWYA 5E1OA 1FSEA 1MDMB 3UZUA 4G8XA 1ZRCA 1FYLA 2ZIGA 4EQQA 2FA5A 5ILSA 1GXQA 3I59A 5L3GA 2W57A 3DXXA 1U8RA 4C08A 1Z1DA 3R61A 3TMAA 4BHBA 1K78A 1KYWA 3THSA 3VC2A 8MHTA 3ER9A 2PWYA 4GOOD 2VS1A 4QDJA 5JI6A 5DTQA 5E2BA 4BP1A 2UYQA 2ISYA 3B02A 4WK8F 3NVKI 5K0EA 3KCCA 4LK0F 5JR3A 5LHHA 1BC8C 1R36A 2M30A 2OB1A 4YUXA 5KS2A 3LBYA 1BI2A 4UV8A 2TDXA 2YPRA 2NYUA 1U3EM 3HOSA 1G3WA 4U7DA 1RI4A 4QPPA 4R6XA 1C0WA 4OMYA 5D1NA 4EGYA 3B3GA 1OYYA 3KQMA 2Z33A 1L0OC 1W5SA 5DM0A 3KPYA 3LQRA 3CUQB 3QP6A 1INLA 3EVAA 4O6JA 2Y1WA 2P7VB 1ZLKA 2H27A 1D8KA 3ABTA 4C07A 4LWPA 2PX8A 2HNKA 2EB7A 5KQSA 1I4WA 1RI2A 1JR4A 3SGLA 2HWKA 2WTEA 3G89A 3MQ2A 2C7OA 3MEXA 5EPEA 4OIQF 3REOA 2HDCA 2O57A 3UJ7A 2G7HA 4M38A 2L4AA 1JSXA 2AS5F 1ON2A 1XMAA 4R6WA 2Y75A 4RX1A 4KIFA 2AOVA 3G7UA 5LRRA 3DP7A 4ER3A 5K1YA 3KEQA 4AZVA 5TRDA 1AV6A 1AWCA 1HQCA 1REPC 5ICEA 2Z9OA 3QPTA 1VPTA 2YX1A 3GXOA 2UXXA 1VP9A 1D8JA 4Y2HA 3WU1B 1X1BA 4PYIA 3FTEA 3T5XA 3EEYA 3HUGA 2PV0A 1QO0D 3GUDA 4A0ZA 5F2OA 5K0NA 4MEYF 2HR1A 5DXAA 4KIBA 1FNNA 4IRHA 5HFJA 4UVBA 2D1VA 1QYRA 4F84A 4R79A 4P7GA 3QU3A 5BPDA 2F5DA 4ZYGA 2IH5A 3KPWA 3ZN0A 4OU0A 1HSJA 2MLGA 3QRFF 1W7PD 3PB3A 5F2NA 2D2WA 2P3QA 1E17A 2RVCA 2O8XA 2ACJA 2I7CA 2FCAA 1BI3A 4OA8A 2KIMA 1QQIA 2BBYA 3IKTA 2C7RA 4AZSA 5BMZA 1MDMA 2Y0MA 3NQOA 3I64A 3HCDA 2L01A 3ME5A 4EVIA 3ECOA 3ZMVA 2VXZA 4FX4A 3IWFA 3RJPA 1ZREA 3DMFA 1OPCA 2D45A 2H00A 3PQKA 5K8VA 2JTVA 2KIUA 2QRVB 1DPUA 3OE4A 3GDHA 3DUWA 5LSAA 1STZA 5CVRA 3FPHA 1R1UA 2A07F 4WF2A 1DCTA 4XRFA 5CYVA 3MERA 4P7FA 4GBED 3RODA 2ZJ2A 1SMTA 4I01A 2YXDA 2EFPA 2JHPA 5IT9Z 2LF7A 2NAZA 4NB5A 3C18A 5D5VB 2VOPA 1MJBA 5GM2A 3GRRA 3ZP5A 5EZQA 3HYIA 2MH9A 2OYRA 2NNYA 1LDKB 2YU3A 4M36A 3GYHX 2IFTA 2V74B 3MTIA 2Q2EA 5CVIA 1TQMA 4PIPA 5CUQA 1KXZA 3UJBA 5EMLA 5BXYA 5C9ZA 3SZPA 2EWNA 3AWIA 5CVEA 4GUAA 1XDSA 5KVAA 4RTJA 1XN7A 5E1MA 3UFBA 4L9VA 4M74A 3ZMUA 3AY0A 4RTSA 3EGVA 1FP2A 3ECHA 4B17A 2ZW9A 3KP5A 3TLJA 2LF8A 2Q41A 3PFHA 4N0BA 5L3CA 2J5OA 1R7JA 5DXJA 2IH4A 3A26A 3LPMA 5LQRA 3GX4X 3F8NA 1IRGA 4V0QA 2A6EF 2P4WA 3F22A 1HBXG 5HIMA 3FZGA 5FD5A 3EGEA 3HA5A 4U88A 5DWQA 3Q87B 3DKWA 1FBSA 2PG4A 3QU6A 2VP3A 1L3BA 3IKVA 2PEXA 3WG9A 1W4MA 3NMUF 2RC4A 2DQRA 2IW5A 4L9JA 1HW5A 2ZZMA 1XGSA 1FC3A 3DXZA 1IUYA 2ZNZA 1BIAA 4LK1F 1O9HA 3FUUA 3LKZA 4XUDA 2ZMEA 4KNYA 1FBQA 5DRYA 3K1NA 1N7IA 3D0SA 1LEAA 4GO1A 5CCXA 3FMRA 3HCCA 3TDZC 1FJXA 1R74A 5E8IA 5GWXA 4RTMA 3FYCA 3P9IA 3R9XB 2PX2A 1OYIA 3LHDA 4M7RA 3TO9A 2Z6UA 3MZYA 3KETA 4ZZDA 1WWXA 4CO8A 2WWYA 2EV0A 1XCVA 1HSTA 4L18B 1ZGJA 4CZZA 5DRTA 1T39A 5IH3A 5EKXA 2EG5A 5FA5A 2JZYA 4HYEA 3B73A 2BYVE 4WXHA 5CVVA 4DKJA 4AIJA 2NYXA 3HM2A 4G7HF 5D5XB 3U81A 2IPXA 1EV7A 1LEBA 4RVDA 5DM2A 2F8LA 1G3SA 3T0IA 4ASNA 3SQNA 4ZTBA 5HVQC 2CL5A 2PN6A 3FXRA 2OPBA 4L0YB 4HQEA 5F2KA 5KK1A 3AXSA 2JT1A 4EM1A 3H2BA 3FF5A 5E1BA 3FM5A 2PVCA 2FF4A 4M6XA 2EA2A 4DQ0A 3B5IA 2YX4A 3ROUA 3M6VA 5EHIA 1Q0TA 3T7SA 3UBTA 4WCGA 4HBLA 4MTEA 3CTAA 3L09A 1J7KA 1JQEA 2FPOA 5H20A 3MGGA 2R6ZA 3VEPA 1PP8F 1XCBA 4EMSA 3EVZA 3BY6A 4RTRA 4PDKA 3SSOA 3M33A 4NECA 5EMMA 4XUCA 3HVIA 2K4BA 3IEIA 1FWZA 1Z9CA 2STTA 5DD8A 1HNNA 4FR0A 3DEUA 3SZTA 2W84A 1G8SA 2AOUA 3LAPA 1ZN2A 2B25A 5BP7A 2YUIA 4RVGA 3TOBA 3WE3A 5C0OE 4P7KA 1NW3A 5DEQA 2HV9A 3DPLC 1HKTA 2HTEA 2NP7A 3THRA 5LR6A 3SMQA 3ZMDA 3FMQA 5HLIA 2OB2A 4PIMA 1YW8A 2PXCA 2VDWA 5EQJB 4ZYDA 4C03A 4UUVA 2A68F 4IVNA 3J81Z 1MD0A 3EMBA 3JSPA 4AZWA 5T64A 1DP7P 4Y13A 4EQZA 1JTEA 4HF0A 1RIOH 3CKKA 3BGIA 1F3LA 5K5OA 3CC8A 5ERGB 3V4GA 5D6EA 4KN7X 1TPYA 3KQWA 4F85A 2HFHA 4ER0A 2GA2A 4CKCA 1AF7A 1RI1A 3TOAA 2XHKA 1P4AA 4LG0B 1ZG5A 4EK9A 3TKYA 3HRUA 2IP2A 3JAMK 5GIOE 4KDPA 1WXWA 2IDJA 3IRQA 2Z3YA 4OX9Y 1V39A 5EHGA 2B3TA 3LECA 1B9NA 2DI3A 3DQVC 4I02A 2GLUA 2IA2A 4LD5A 4YMHA 3BWBA 1WY7A 2ADMA 5K5QA 3OPNA 4GC5A 1FY7A 5MHTA 2L02A 3V7CA 1B6AA 1XDUA 2ZTHA 3I71A 2VOOA 5FHRA 3B3JA 3S2WA 4LGWA 2ZBRA 1KR5A 1TLHB 4KDCA 1Q1HA 2K4MA 4MTLA 2V1UA 3P97A 1BI1A 3WODF 3SM3A 1G60A 1EG2A 5BW4A 2F2EA 1CF7A 5E1DA 2KRFA 3BKXA 1VBFA 3G2PA 2MH2A 3GU3A 5B1SA 5T6BA 4L9TA 7MHTA 2KKOA 4LB6B 4H0EA 5KVRA 2DO7A 2FEZA 5ILUA 3V8KA 3TPZA 1KPIA 2FMYA 4EJUA 5EVJA 3MCZA 3F8FA 1IXKA 4Y17A 1EH8A
chains in the Genus database with same CATH superfamily
2QZSA 4BJ5C 1NXQA 1T9KA 1OIWA 2B0JA 3NWTA 2GKSA 2QQ5A 4LITA 2W98A 1T0UA 2EZ4A 3EW9A 4JP5A 3VUEA 4V1CB 2O8EA 3I6IA 1SHZA 1VSBA 1S4MA 2O1XA 1N2CA 2VEDA 5I9MA 4C4PA 1A3CA 3OFVA 1PI3A 4S1PA 3TZCA 5C35A 1ULYA 3GN2A 1PQWA 1E61A 3KC2A 2O03A 2CNLA 4ZT3A 4BV3A 4RIHA 4YAUA 2O8VA 2QN6A 5ARDA 4JI6B 4ESHA 3TQTA 2FQWA 3KKPA 5IANA 2P6PA 4Y9TA 4BDTA 5EJGA 3S15J 3K94A 1TAQA 3F73A 2FQYA 1JKQC 1VJ0A 3OR2C 3RYCB 1BDMA 2VOJA 2ZJ3A 2CWEA 1XEXA 3ZHYA 1UK6A 4TOIA 4CG2A 5HKAA 2JS7A 3LIPA 3AM5A 4RAOA 1ZCBA 2J07A 3O6VA 4YUWA 1OTHA 1L5VA 5LLQA 1KSHA 2W43A 2ZYHA 3AG5A 3PYLA 1Q7BA 2YTZA 1YW9A 2WTXA 3EBOA 1XIVA 2AOXA 3K16A 3PUJA 5KWJA 2YCLA 3MK31 4PLTA 3MWMA 1F12A 2WJJA 3CLHA 1GVJA 2GTPA 3HCWA 3QG5A 5I01A 1TQDA 3EH2A 1D6SA 1VJ5A 3VHRA 3GPLA 5DBEX 2H0AA 3O7WA 1DBPA 5JCJA 3C15C 2OJED 4KYIB 4HNUA 1M1ZA 2WUWE 1GCGA 2GPAA 3F4KA 1AKNA 3B7GA 2B83A 3AEZA 3KNZA 4Y2YA 4B4OA 5CA0F 1Z82A 3DP9A 1DG9A 2ZRAA 3SFVA 3VXKA 5K01A 2M8EA 3V8LA 2PT9A 2P9FA 2QM8A 2X51A 3NTVA 1V37A 2MSNA 2D5IA 4I0AA 1D5CA 2FJUA 5DI3A 3VJKA 2H1HA 1J90A 1YC5A 1ORTA 2F4NA 1BXGA 2OHXA 1KJ9A 2PK3A 2WC1A 3P71T 4GPIB 3ZGVA 3VKGA 1KRWA 4BU2A 2VQEB 3P9XA 2ZB3A 1HOTA 1FS6A 5ALYA 5TT0A 4DLBA 2ES4A 3JW4A 4JWKA 2YV5A 1BDBA 4HUTA 3RYFB 2P9TA 3GLGB 2HPVA 5KX5B 3HRTA 5FKNA 1PTKA 1MPXA 1NRIA 1UMQA 2ZJAA 4GC9A 3DTKA 1PZEA 1VMDA 4OJKA 4Q4JA 3R5SA 1RC8A 4XGKA 4XSXF 5KTOA 2WMYA 4PHFA 4WESB 4TZ0A 1M2VB 5TIIA 1Z6PA 2MSCB 1R37A 5BNFA 1WQ4A 1G6Q1 2NQ2C 1DO0A 4O1IA 4UU0A 1ETOA 1ZI9A 2B9EA 2VDOB 1LUJB 1J2EA 4CV3A 3KZKA 2A6PA 2FPIA 4OQDA 4RWEA 5CAEA 5KNDA 1T9CA 1MJFA 4BY9E 1FFSA 2LD4A 4JP1A 2VP9A 1BE0A 2HLDA 2XUHA 3B20A 1GTMA 3GELA 2ZXHA 2BAGA 1N2XA 3QNUA 1FSZA 1FDSA 2QV0A 2VP4A 1ZN7A 2R6FA 3IQHX 4GM1A 4Q9IA 4MV0A 4Q47A 1NQVA 3OKFA 4X0EA 5K5RA 5A5GA 1RESA 4ESEA 3C2GA 1SXJD 2C5SA 4CIWA 3STHA 3LLUA 3I04M 1JJFA 1TU0A 3RFVA 5AW1A 4IIJA 4L50A 1GGKA 2O7VA 1STOA 4JOSA 1VQPI 1HEYA 2BY0A 4UHDA 2WYUA 4D0RA 1F5TA 3CH5A 1ZCZA 3L8MA 2PGLA 1T6SA 1I6HJ 3P9SA 3NRBA 4I9FA 5EQTA 3WMEA 1U99A 3WE2A 5C4IA 5I7VA 2PLAA 4MEXF 1MEEA 3BDIA 4NMLA 5FTWA 1MFZA 4E2XA 3P2KA 3TMKA 2HK6A 3K8QA 2W93A 3IAS2 3FSGA 5A1TA 4B6FA 4RXTA 3S70A 4B1RA 1FDRA 2GF2A 1HZZA 2J33A 3U4CA 1ZTRA 4ENJA 1Q15A 2X0DA 1FUKA 2VPWA 3NWSA 4WHMA 1OFTA 1E3SA 1N5MA 1VQNI 4FISA 2VDRB 3FD8A 2BF7A 4ND8B 1ODSA 2HU2A 3CCQI 4U2EA 4E11A 1CBUA 1AS2A 2WWWA 2OBYA 3BD6A 3F97A 2FN3A 1LB2A 4HADA 2DBRA 3RVJA 4E12A 5C5EA 3DFZA 3BPXA 1E1NA 1SK9A 3ED1A 3KOUA 4LOKA 5I7FA 3U5ZB 1DJQA 1Z38A 2PMZA 2KJQA 3OYKA 1IQ0A 2VHUA 5GIPE 4LIUA 5H0IA 2X1EA 3KELA 4LWOA 3RZDJ 1MZPA 1QIKA 1SVWA 2C4TA 4ZVMA 4PLWA 2XAJA 1QE5A 3CJTA 2AOWA 3G2LA 5BQOA 5CPBA 3HYTA 3UJ6A 2PJPA 1ITZA 4GNKA 2VTKA 5BPFA 3MTBA 4MPDA 1YAJA 3ACBA 4EO4A 1B0UA 4AC0A 3LDUA 1NZFA 2GYVA 4QHYA 3R44A 4RCVA 3RPUD 3HY6A 3OYCA 1H88C 1B2LA 2QZ4A 1TKRA 3AV3A 3SJMA 4RHYA 4MYHA 1F38A 4JFAA 3DT9A 3FHNA 2QGFA 2P2ZA 2X48A 3BFVA 3QWIA 4QG7A 1NVWQ 5ICGA 2B3DA 3IIEA 1JHDA 4NYJR 5EINA 4GXQA 4LEIA 4WZ6A 4AJIA 1MJGA 2J0UA 2M0MA 2WOOA 2XYHA 2YQ5A 2IDZA 5DYTA 2L4MA 3NAGA 1WO8A 3VU9A 3IQEA 4BS9A 3OZ7A 4HUJA 1LV8A 1Z5GA 5FV4A 5IMSA 1QHHA 1N5LA 1JSZA 2O0HA 3E9MA 4DPMA 4WGFA 5K03A 5ERYA 2Q4RA 4KO8A 3S7TA 2AG6A 2XTJA 2YW9A 2ASVA 3R7NA 1JBKA 4PRZA 3RSLA 1CJTC 4Z7NB 1P5JA 3KP3A 2DHRA 3K9BA 4L22A 2DPGA 2ZYVX 3OJWA 2X19A 4FK8A 3M82A 3H7IA 1A04A 4J3FA 4YCDA 3CW8X 2ZE5A 1NW8A 1XGNA 2NOJB 1N25A 1GNQA 3FUTA 3OEYA 4NWIA 3DCYA 5AI4A 3ZN2A 4C7JA 4DREA 4HDQB 1RS0A 1PTJA 3R7WB 4BE2A 2YFQA 4RDHA 1PGNA 2HWUA 3ZDZB 4P96A 3IAUA 4JA0A 4XVHA 1LSSA 1B8OA 4OXXA 4XEUA 4LYEA 3WYEA 1IAQA 5BR4A 2JGIA 2GRUA 1MIJA 3CLUD 4I98B 1WSBA 3OO1A 4JLKA 4C3ZA 2DHQA 4OJNA 4IHTA 4EYEA 3U1BA 2A57A 3ABZA 3TRKA 2Y9ZA 4MVJF 4CF7A 4TN1A 4BO4A 2MBFA 3HDVA 4PPYA 4UNNA 4O59O 3T9DA 3T94A 4ANFA 5TJ9A 3TKAA 4AQDA 3DE2X 1XZKA 3PP8A 3RSZA 1BW9A 1RZ3A 3FB1A 3IC7A 1AOXA 3DLTA 1ETHA 3RTCA 1QHEA 1UFKA 3MAGA 4IIFA 4MYDA 3JRNA 5DISB 3GQBB 2XVCA 2JDIA 3EQZA 1NXPA 2W25A 5HLHA 1QH1A 3HEMA 4ZK2A 2L7FP 4HGPA 4RWZA 5FP0A 2AQ8A 2OZPA 4J6FA 3RTGA 1V11A 3VDMA 5CEEA 3G68A 3O4FA 1U0FA 4YRSA 3M4OJ 1Z3CA 3K9QO 3IA7A 4LGYA 5AJHA 3ZY4A 4NQWA 5LPNA 4XBFA 2BJWA 9MHTA 4IJ6A 3THWA 2QQBA 1DUXC 1O96B 5INTA 5LBIA 1F60A 1CYDA 3ZD9A 2W58A 2GD1O 3VB2A 1JXOA 4Z9YA 3O1HB 2XZPA 4RQAA 4AAYA 2C6YA 3RK0A 5EZYA 1K8QA 1DJMA 4ZWNA 1D2HA 1CLUA 1R8SA 1QAOA 4NZ9A 2LMDA 2Y2VA 1E9SA 3MS2A 4V0MA 3LSHA 4H4KC 2RG7A 4OAQA 5FJIA 1APLC 3OIQA 1ZRDA 2QZ9A 2ZK7A 1WCXA 3KQVA 5G41A 2QM3A 2PJRA 3CF2A 5ILVA 1AA9A 2A9FA 4ZVSA 5IHPA 5HJ7A 3ZZTA 2O5CA 4HH3C 4JQCA 3AZOA 1WX1A 4GT1A 5EC8A 1LDNA 4BTVA 1OLXB 1GRQA 3HY4A 3G3ZA 1H1LB 1AU9A 2PKCA 3WBBA 2JVJA 4J0FA 3AHGA 1ECFA 1YZYA 2JHAA 3FH0A 4AZTA 2BGIA 4ZCPA 4DV2B 2EWMA 1QRUA 4A12A 3GLVA 4FDAA 3P7MA 3DLHA 1XTVA 1Z34A 2JIZA 4L9NA 3N8GA 4BAZA 3JR7A 3R09A 4IXMA 2IPLA 3KEYA 3CSDA 4O0LA 4OOFA 2D2VA 2QL5A 3CT4A 3KL2A 3D6NB 4OJTA 1GRRA 4AMZA 1IBKB 4YRMA 4PX2A 5FFNA 1KDRA 4G84A 2C77A 4RHCA 3G7SA 4N18A 2COBA 4TZKA 2VTEA 3U40A 5H8WA 1IPFA 1T9ZA 4FPXA 1MEJA 2TYSB 1J33A 4I55F 2ZB9A 3I9JA 3UW1A 2ZUVA 3RC7A 3KVOA 2X4DA 7ABPA 3TDUC 1KZ4A 1LVGA 3OYJA 1NI3A 3TTVA 3BILA 3LWFA 3C7JA 3C4QA 4TTQA 3BUSA 1JHAA 2YC4C 5AOVA 3ZHQA 4X54A 3NTUA 4MROA 4F4UA 4GBJA 2IA0A 4A03A 4XORA 1RM4A 4PIVA 1FBTA 1D2RA 2LWIA 2QU7A 3P96A 1KI1A 2ONJA 2JJ2D 2ZKIA 3QFRA 2CSUA 3SXYA 1XRRA 2WWHA 3CEMA 1VJGA 2QE7D 3IURA 1EFAA 1L5KA 4GVXA 2CK3A 1NKTA 2ADOA 2MMGA 2FU5C 4ZMSA 2YASA 5IZ4A 3ADCA 3DAYA 3HCEA 3N0VA 5FTNA 2D00A 3LY5A 3PSHA 2OCXA 5DM4A 4AY4A 4CEJA 1JR2A 1C0LA 1D2CA 4BKMA 4I6ZA 2BFFA 3VC1A 2HSEA 3OFJA 3CKLA 2HXGA 2WV9A 3NDIA 1VIMA 2NOAA 2OESA 1H2HA 3NP9A 3QVJA 3GFFA 3AO0B 4IXTA 4MKZA 3QVGA 1UFVA 1FU7A 1E1DA 1ONNA 4KW7A 1WXXA 2FBHA 1L7RA 4MKIA 4NESA 2OGZA 4V0LA 3R0ZA 3FMFA 5E8GA 2CW7A 1Z8FA 2JCXA 2L19A 4IGKA 4TTVA 4ZU1X 4B6GA 5CFZA 2AUMA 3B9RA 3J7AC 4WCFA 4KGZA 4HF1A 3LCUA 4JC0A 4NZZA 1SFUA 4W6QA 3HDYA 4LFAB 1K2VN 2XAGA 3SHWA 1JHRA 3LRTA 3H9QA 4DB2A 4E51A 1FDUA 3DXYA 1X7XA 1XRJA 3A9SA 3LC2O 2PUBA 4DCCA 3HKZN 2R96A 3Q7QA 4KXQA 4BMPB 5ICFA 4LTNA 2VHJA 1UK7A 3QVMA 4YIKA 1U7WA 3WOHA 1K97A 1QV6A 2DYSH 3NATA 4AT1A 1JA1A 2BUBA 5BW8A 4K0RA 2PUGA 1PWEA 3JRIA 1MAWA 3BJMA 3VPCA 6NULA 3NU1A 3RHSA 1DAHA 1TCVA 5E6UB 4BKQA 4MNUA 2VTVA 3H1TA 2E2WA 4I9GA 4KR3A 3LX8A 2XKAA 4XKVA 1J0RA 1EP1B 3LVFO 3RSQA 2EJUA 2P6MA 1HY3A 1TTHA 3BGSA 2K9NA 2PNFA 4MARA 1S7EA 4ALJA 4EP1A 4XKBA 5KYTA 4XGRA 2DQYA 4EYQA 1JKFA 3T4EA 1NW6A 4AROA 1K6OA 4WFQA 4TQUS 4Q3OA 1O7FA 4YA6A 4BLTA 3T7JA 3WQBA 2QU8A 4F1JA 3ISVA 3C3EA 1JHOA 2FE4A 1UHWA 3CLTD 4MW4A 4BWYA 4OLHA 4UOZA 3HEFA 1XLTA 5F21A 2PUAA 1GXPA 1IHPA 1TIBA 4XX1A 3ZHXA 3LQQA 2ZRDA 3CUVA 3NHZA 3PNLA 1N33B 3HYSA 1PV4A 3PJGA 4OAOA 1GVDA 2FEOA 1C4XA 5ERIA 2CVOA 4JOQA 2Q3CA 4PZYA 5E4YA 4Y6PA 3HSRA 4KEAA 5HZMA 4R0MA 2HQ5A 2LZ0A 2IBSA 2HFJA 2P5VA 3WS7A 3IRRA 4MGRA 4PSVA 4QA9A 3K4JA 2UUAB 1Z0UA 3M7GA 2OHJA 1E3QA 4F5YA 4NHJA 3MUNA 4WK4B 2XOEA 2J4DA 1G3YA 1Z6QA 2ZPUA 1CZOA 2FPXA 2JIOA 4D3ZA 2MR5A 4CCAA 1YKGA 1RT9A 4PJNA 3AJDA 3GBVA 2P9CA 2I3BA 3ETHA 4I99A 1FNDA 2G70A 4KGDA 4PHCA 4TWJA 4F1WA 5C44J 2C4MA 5LMZA 4OU4A 3Q5FA 2ESRA 2XRYA 2GNPA 5FL3A 4EB0A 3JTHA 3ZGXA 4D92A 1HQKA 2XNHA 4YECA 1MJ9A 2P0WA 3BCBA 2X2PA 4ILKA 3ZGOA 3AUUA 4AIIA 4LJ9A 1LNZA 4F5WA 5JDIA 2PY6A 5AKYA 4CGZA 1U3GA 4O2BF 5ERXA 2UWMA 2C7QA 2R1VA 2WHEA 3ZWBA 1KJZA 3MRSA 2GJSA 2AFHA 3BXXA 4LQ4A 4REQB 1EUZA 1NMEA 2CMFA 2WM3A 1SUIA 3GFVA 3PC8A 5LQUA 4EYOA 1TYEB 4Q37A 3H2GA 3BJZA 2GASA 3U4IA 4ZOQI 1VGVA 5ALLA 4L8VA 3I6MA 3SBDA 3GZ6A 1XVVA 1E58A 2LRDA 5LQAA 1SQ5A 2IDMA 1H5QA 1DV1A 1E1QA 2XSZD 1Y8CA 4QLBA 1OLSB 5C53B 3CX8A 2GM3A 4MQEB 3DKVA 5FFXA 2R00C 5ES3A 2QUKA 5FOTA 1BD4A 1NOJA 4B80A 5ITVA 4ZIRA 1TU3A 1EFRA 1SD7A 5J47A 1S8AA 4YRRA 1JEYB 4X95A 2OG1A 1BMDA 4BH9A 1ZNQO 4OAPA 2I4IA 3FX2A 2OILA 1AN9A 1RLJA 1U8AA 4IH4A 4P3YA 4RABA 2B2XA 5B3AA 3VV2A 2NSYA 4EPTA 3VTKA 4MQVA 2PUVA 4DDTA 2OK7A 2O52A 2PAFA 4XUEA 4HAIA 3SHOA 4BGVA 5AJVB 1I5RA 3LPCA 4K6KA 3W2EA 4E5DA 3JALB 2PS3A 2RC5A 1NLFA 1U7DA 3HKCB 1JG2A 3TOCA 5M5YJ 4ZCLA 1IAVA 2XUPA 2G5CA 3V9AA 3EIFA 2W8ZA 2APJA 4GXNA 4ZVNA 4R7ZA 4H6XA 4FEYA 3LUBA 5DI3B 3ZI7A 3EZ7A 3IKJA 4G9BA 1R5HA 1I4TD 5HDKA 1PGJA 3CNLA 3Q3VA 4MO9A 5AD1A 2GFHA 1I7QB 5A3JA 3E81A 3FDZA 3G13A 1WXEA 1ZGWA 4FX5A 3FUVA 1I3AA 1I4DD 4A2UA 1MF7A 3G8BA 1JHQA 2EKLA 3E70C 3HU1A 4MRPA 5ECGC 1WPQA 1KPGA 5FI3A 1SKBA 4HGNA 5LN1A 1NXVA 1KVQA 2C1ZA 1OGIA 2GYWA 2JKZA 3EBPA 3M4JA 4V0RA 1AGXA 1H8HD 1JYSA 4DDHA 3BTLA 4GE3A 4Y7NJ 5CNIA 4TMZA 1LNSA 4BKXA 1X39A 1TM1E 4HTFA 2YHAA 4QE3A 1Y80A 2Z3ZA 3MILA 1XZAA 1JHYA 4BCDA 1P6RA 1KFKB 1G7CA 1Q95A 1T1GA 3AQ4A 1P80A 1NV9A 2FW6A 1OAOA 2PS1A 3FCEA 1BSVA 3WSVA 3CUQC 1J39A 4E08A 2OD9A 5JBIA 1IRFA 1D2GA 3DF8A 2Y48A 2UV8A 1YXMA 4LGCA 1ULAA 2RBEA 2VJNA 4TUYF 3RSFA 1O77A 2GZ3A 3OU6A 2AMYA 3KWFA 4RD6A 1KK1A 4N0EA 2XC7A 1Z83A 4X7BA 4YBZA 5AHXA 3ULKA 3K0BA 2P27A 3AGPA 2ZUDA 4AG5A 3RV4A 5F7XA 4E2YA 4RH0A 3K30A 2P3SA 4JP0A 2AQFA 2D0DA 4DR1B 3PQ3A 1T0PA 2VNKA 5AIQA 4OGFA 1V8DA 3USZA 5A71A 2YYYA 3PPIA 1Y3DE 2FZCA 1NMSA 3GEZA 1RBMA 1TPZA 3PG5A 1ILEA 1I7SB 3C43A 3RASA 2H2AA 1TADA 2ZWOA 2YW2A 3B51X 4MV7A 5F9HA 1E1RA 3H11B 4RV5A 2PLNA 5JAPA 3ZBUA 4JX6A 4BDYA 1RZVA 1XD8A 2HXSA 3GARA 4WKCA 3EULA 1IXCA 2Z3VA 4GPBA 3SHTA 2PM8A 2YVAA 2XF8A 2Q2OA 3UGTA 3S1LA 2GEFA 2DSTA 2DPUA 2ORIA 2KLBA 2ZTLA 3ZVKA 4CEIB 2B37A 3DQPA 3JRDA 3FVRA 3ORSA 3AHEA 2VQHA 3F3YA 3QEMB 2JAXA 2ZR0A 5EOVA 5T4EA 1QRTA 3UENA 4J19A 2HQ1A 1RWWA 3H4TA 4C0BA 1O6ZA 2I7TA 4MSUA 5JO0A 2WY8Q 5KQPA 4HV6A 1I1SA 2XZDA 1ML4A 5HDQA 3OYGA 3H3VK 1RKWA 3NEPX 5FWXB 3PIOF 3KR2A 4CXFA 2G6BA 4GPZA 2P75A 4MK4A 5T67A 4DYDA 1NYRA 3HA2A 4ZKDA 2WK1A 4EHAA 5F0HA 1WOYA 2C4KA 3D7RA 1XRMA 1GAEO 3HN2A 3IUQA 2JGAA 3T7TA 1LW6E 2DDAA 1DKLA 4URHA 3JZAA 3LW7A 4OXKA 1RZRA 3B9BA 2XE7A 5JYCA 2MC3A 3NRVA 2E1CA 5AJWA 1SKYB 5HS6A 4MCHA 1IEWA 1L1EA 3GN1A 5TPWA 3T5BA 1WQ3A 4PRLA 2XE4A 1JI0A 4U7JA 4QVGA 1T43A 3ONWA 4YLGA 3OIGA 2P5KA 4HA8A 1I3OA 2BMJA 3G8CA 3UWSA 4YUZA 1DCMA 4XYLA 2EBUA 3GMDA 3PUXA 3TI7A 2IA5A 1UBMS 3PEEA 2FQQA 4H16A 3H18A 3S3MA 1B0ZA 3TEDA 4MGKR 4WJKB 3VH2A 4D4JA 5I7OA 5EIXA 2J3HA 2J6CA 1PJSA 1IMOA 2W1OA 1ONVA 3PLAE 1M9NA 1GPKA 4M71A 1YW7A 3EQLF 2BMEA 2OZKA 4UUSB 2QMUA 2AI3A 4O1MA 3PE4A 4PPNA 3UHFA 4MS3A 1M1UA 1QIJA 2H6BA 2C8VA 1IV6A 2RAEA 3JQFA 4GR9A 4W1RA 3S6JA 3TTTA 3BRWD 5IT4A 3BXOA 3T6KA 1UCFA 4N01A 2HHHB 4CNQA 4BC0A 2IUYA 5EJIA 2B7BA 2Q1WA 2ZETA 2ZGVA 5A7GA 2GVDC 1KDYA 3UJCA 3EIUA 3TZKA 2J3EA 4XEHA 4D82A 1Z2DA 1UB9A 4TKUB 2JFVA 2CL7X 3UIEA 2JMWA 3PDIA 1NBHA 3KTFA 4HAWA 4DJTA 4H27A 2A59A 3KB1A 3A0HC 1XBTA 2H3EA 4G8BA 3SJAA 3O8CA 4INOA 1A5ZA 1RKTA 3OYLA 3GFJA 1WOMA 4CQMB 2NVTJ 5B1BH 1LEHA 4N3CA 2AD5A 2AG1A 1AA7A 1IK4A 2QLBA 4MI1A 4Y6RA 4ZPXA 1X58A 5AW3A 3G8DA 3V4RA 3IUOA 3QJYA 3P2EA 5A0TA 3RS5A 2CXNA 3GEHA 2I2XB 5BV0A 2G9NA 5L3QB 4BNLA 2AHQA 4TRJA 2WJWA 3VKWA 3KP7A 2C9DA 5ENZA 1RADA 2OKCA 4Y6QA 3WHKA 3ZE1B 4KUMA 2ZJYA 1HT2E 1UMDA 1E69A 3W3AD 2V3CC 3AESB 2I4TA 1H9AA 1FIUA 1QE0A 5CDSA 3BAFA 1H5NA 1JXQA 3WX0A 1KVTA 4B3DA 3TR6A 2IIPA 4B46A 3NHKA 2WU3A 4Z0TA 4ISBA 3WLAA 2V7FA 4PJ0C 2TMGA 3CRVA 5B1IA 5BXQC 1DKQA 1HDCA 1UFRA 2EF0A 4UE3S 4TVSA 4ZZ3A 2P91A 3AC0A 3GWZA 3AESA 3TD6A 3EY9A 5DNYB 2DQLA 2BEVA 2OQIA 1JE8A 3CCCA 1D4OA 4X61A 4PFKA 5C5CA 3CH7A 1USGA 2WAXA 2G0EA 3DLAA 3JQAD 3DAPA 4MUFA 1ISHA 4NIMA 1JIKA 3GMEA 4G6DA 1BVRA 1L8OA 4LBWA 6ABPA 2JCGA 3CQZJ 3KKKA 3IILA 3TKLA 2JFNA 3LKVA 4LVOA 2NU7B 1JR3A 4IEFB 2O0JA 3IMFA 1U0GA 4Z86A 2DPHA 2IS4A 3UICA 1CUUA 2I65A 3I1JA 4IQ4A 3RKXA 2XMDA 2QUFA 5AKXA 1Q50A 5JJ5A 3PFIA 4C4TA 1KOFA 1B6TA 5F64A 3KCQA 4KDEA 1SFXA 1NVKA 4M7WA 4R9RA 1C5KA 4BYGA 4IJAA 5KTTA 1FW6A 2CSXA 4K6MA 2A5FA 4ENQA 3DF9A 4MA0A 3KQYA 2VG8A 1OCOH 4LLNA 2OO5A 1XLTC 3KPHA 2ZAOA 2CXHA 5FL7A 1S3SA 2HEIA 1NHAA 2CD7A 1JAYA 2WU8A 1NHGA 3RYTC 4BVHA 5KKAA 1P2GA 5LNK1 4K9DA 1NPYA 2IU0A 3JV7A 3UK0A 4PPQA 1R5GA 4N0DA 4HOBA 3J80K 1S9DA 1D6JA 3M2TA 3D1LA 1V7CA 1AGPA 3MCUA 3ABMH 4P0TA 4LXXA 2HU9A 3LA3A 3C8MA 2PSSA 1PLJA 2ADFA 3OWXA 5C18A 3DDWA 4EB8A 3C3BA 4PFOA 4YP6A 2ZRJA 3F90A 2R25B 3AP2A 1QGUA 1HL3A 1WJDA 1ZVQA 2C2YA 5MFPA 4LG0A 4DBQA 1G6OA 3VNSA 2AJTA 4JSYA 2M3AA 5JWRA 2XKOA 1OB5A 3ETNA 1UJ8A 1PJCA 4FNAA 4BX0A 3V2GA 1TJNA 3F1LA 3QNWA 4Y9RA 4E03A 2OD7A 3BSFA 2I2FA 4IDBA 4ER7A 3R3ZA 4CKEB 4HWOA 4H60A 5T4FA 3SC4A 1HE8B 3IMCA 1QA6A 2PUFA 3DU5A 4YMUA 5IUNC 4BVKA 4Z9XA 3X1WA 4BVBA 1KQ0A 2BBWA 2X6OA 2ZVQX 3L8EA 3QUQA 1CUAA 1TTTA 1C7QA 2X0LA 1T38A 1DQZA 4C1NA 3WWDA 1T2VA 4QLCU 4BDSA 1I32A 1H0MA 1G41A 4K9SA 1SAUA 1Z7EA 1WUKS 3S2GA 4AJ2A 2Y0SA 3DAGA 2QLMA 3KU4A 3WLSA 3NT2A 3VV3A 1Z36A 5AK6A 4RDXA 5J43A 4ZO8A 2C82A 2DU9A 2Q5HA 4P3KA 3HGGA 3B5EA 4IDPA 3NM5A 1EBUA 2L0KA 2GF0A 3F2IA 5JAQA 5IP7J 2CJPA 3RPEA 3ZE2B 4D8YA 3D2LA 1UQRA 4L0QA 5EIWA 1V2HE 3VSDA 3PR2B 5AIPA 2Z2YA 3GL9A 4E2WA 5AVKA 1HDPA 3H5AA 4ZYZA 5H81A 1M6WA 4KA4A 4BBSJ 1R3DA 4OI0A 3LUHA 2BR4A 5KAPA 3A10A 1GTJ1 2A0FA 1W2GA 4CMHA 4M3DA 4ZEMA 3RQIA 5ISMA 3AF3A 3ND5A 4KQIA 1UOOA 2MU1A 4L8FA 1IO2A 4LRTB 4MX8A 4MI6A 2FR8A 2YWJA 4ASUD 2MIIA 3HM9A 1KGSA 1VI0A 2FV8A 4INJA 4D02A 3LHFA 3QOFA 5DHFA 5FOXA 1VHDA 2A5LA 3ASUA 4N3BA 1BOAA 4DC0A 4N7RA 4X7PA 5L3EA 4G0OA 4JP2A 4DYHA 1CF4A 1Q92A 4KG7A 1NC1A 4DQDA 2LY2A 2XYRA 4ALKA 5GPBA 4DXAA 2P41A 2G7MC 2HA4A 4BYYA 1G1AA 3ZPLA 3LDFA 3QE4A 5G3YA 3JWGA 5A03A 1SUEA 2JJ1D 1YR6A 3HB7A 5CDFA 1P74A 1DKRA 4CDMA 5KQRA 1MEOA 5IS2A 2K9QA 4GMFA 3E3OA 4MS4B 5AT1A 2CYCA 1BHJA 1SCKA 2XCQA 3L0CA 4P8RA 3L0BA 3IAM2 1Y0BA 1WKMA 2RJNA 3NBZC 1W5CC 1IJWC 3IT0A 1T4DA 3M6AA 3MF4A 3WGIA 5J2UA 3BR2A 1S0UA 3TSOA 2QX6A 4U3JA 4HW0A 1W5EA 3EVEA 4QVIA 1W0KA 4W1SA 4HNTA 1K78B 5HILA 1JEAA 2WJPA 3HNRA 4HPXB 2ZYTX 1WZIA 1U9OA 2WKPA 4QATA 2R79A 4JENA 3KE8A 5C7OO 4GKKB 1N6RA 1QBGA 1ZK0A 2VLBA 3K72B 3M89A 1NU6A 4G5HA 4TV9A 5CM2Z 1W5TA 2Y27A 3TRFA 1Q11A 3L7AA 4I50F 4LDQA 2UZ1A 4D81A 1Z91A 3MGAA 2B7LA 4L3VA 2CV1A 3LSJA 4KPYA 2BZTA 4PV7A 2VT2A 5AVTA 4Z7QB 4FT8A 1Y5RA 2V4UA 4KRYA 4DZRA 4N0PA 2GK4A 4CI0B 1M1YB 1PLKA 3MSXA 3L7WA 2DCUA 2QMOA 2XYVA 5IKPA 2ZAMA 4KLCA 1MGOA 4UNQA 4LJ6A 5K0TA 3PL1A 1XU9A 3L77A 1UZCA 4QPCA 5CH5A 3T3IA 3VNQA 3WWCA 4K8RB 4HEA1 4P35A 2EFJA 2IPOA 3MGKA 4XOPA 1YR8A 3KM0A 3OE7A 4MV4A 4RV4A 5EWLA 3W3ZB 2EIMH 4CFZA 1YDHA 4TUYB 3GAMA 5DUKA 3MVPA 4JBXA 3BICA 2M45A 5AUNB 3L6UA 3RWOA 5BVHA 5DTMA 4R0NA 1RXYA 1U5TB 3GROA 3NIFB 4Y98A 4LMRA 4YJ3F 5LXTF 1YQAA 1LB1B 2ZDQA 3KQPA 5DWDA 4URXR 2PX6A 3NRCA 2OG2A 3MQ0A 5FKKA 4H6PA 5IX8A 2OKGA 4LKRA 3OTHA 3KZZA 1RWVA 2Q6LA 3BIXA 1RWXA 1ZMBA 2OLJA 1IOVA 3A04A 3WA7A 1Z73A 5FROA 2I1WA 4M1TA 2HLPA 4BNUA 5CD9A 5A7FA 3FYUB 3LMMA 4N03A 4HQMA 4TYQA 5A4AA 1ZAOA 2K9LA 1IL0A 1XA3A 2WVJA 3FSRA 4AXBA 4BAUA 4FT2A 3K0AB 3ZQQA 2EP7A 2OBBA 1JSRA 4EHFA 3K69A 1C4WA 4BNKA 4K6HA 3Q8WA 1T9GR 3EXHC 5E7QA 4TMTA 3U19A 2W2PA 4I9NA 4NULA 5G40A 4E13A 2VUIB 2NO9A 2YXLA 2WRZA 3E9ZA 2DFKB 1KEEB 3K1AA 5FUYA 1RCTE 2RD2A 1N2JA 2FRHA 3LM8A 1U4OA 4JWTA 4MWZA 5KJEA 2HOQA 1UJ2A 2VRNA 3AUYA 4E6EA 4YPVA 1UM9B 1N9KA 2C58A 3MIZA 3QOYA 2BHNA 4LJ4A 1OBHA 5TJHA 2WVHA 3LW8A 1UOPA 3AR2A 1LX7A 2GYUA 2NM0A 3AAFA 1USKA 3M7IA 3UFXA 1TJ4A 2J09A 4P9UA 4OHBA 1CQIB 1W96A 2J3LA 3CRRA 5FPYA 5FOSA 3NHLA 4B45A 5C8YB 3AM1A 3BRQA 2VZEA 3M4ZA 1NN3A 2CV0A 3K92A 1GLGA 3AM3A 2GWRA 2FZGA 2UZIR 3EGDA 1CX9B 3BL8A 2EKDA 4TWRA 1M5UA 3LFKA 5FRMA 4B8YA 4F72A 4KXYA 3EDYA 4ANJA 3WIUA 1CR2A 2VK4A 3I5YA 4ETSA 2YHIA 1I1NA 4FFBB 2CXTA 4HQKA 5EWMB 4HX2A 2HXIA 2XUOA 4M9ZA 5I8ZA 2O2ZA 1U65A 3E1GA 3WLPA 5FADA 3FRJA 4N0MA 2IWRA 1JT2A 1UMCA 4BLSA 2VSYA 3OZFA 4RENA 2BE9A 5JH7A 3VNVA 5IJXA 4BJ1A 2P6SA 1QRDA 3QITA 3S0JA 1DX9A 1D5YA 2BN4A 2EATA 2PBLA 3F6PA 5JC8A 5BR7A 3RG2A 3KQTA 2UUZA 2YR0A 1FX7A 1EJ2A 1EFLA 2FPKA 5L9AA 4WY2A 1PFUA 2KW5A 2FPPB 3IHKA 3M8KA 1OXUA 4JKIA 4R5MA 2HUPA 2BEWA 3DTTA 1I80A 5TGTA 4X92A 1M7GA 5CVUA 3MT8A 1YJWI 1N4AA 3L40A 4NU0A 3SC3A 3WLQA 3MJRA 3ZIAA 4PHTA 1NFQA 1K5PA 5J23A 2VF2A 1N6LA 3IUSA 2I7DA 1AVTA 1NMQA 5D51S 1Q3KA 1B8PA 4LSZA 4PU0A 4E31A 1ZQ9A 2C1XA 1XAHA 3QF7A 3VBCA 3ZU2A 3PA6A 5L95A 3Q3GE 4AB1A 2EFWA 2VKEA 3QPAA 1DVRA 2MSEB 3PJRA 4OQZA 1MB0A 1QWOA 5K6AA 3GLIA 4CL3A 1GTZA 1V3TA 3MNFA 4ZYTA 2EZKA 3GVCA 2F5CA 1DJOA 4F71A 1BXZA 2CS3A 1DPFA 3MWFA 3HSSA 4GZMA 3L0IB 2OQGA 2FLVA 2GHTA 1QM5A 2X8JA 4PUSA 1RJFA 2QUJA 1CY8A 3A4MA 4GLLA 4WE3A 3S5UA 1MD9A 4BV2A 1VPEA 3ZXSA 2OBFA 5DYNA 4PQEA 1B73A 3AZPA 3WHLA 2HQNA 2M7BA 2V7UA 3E3NA 3UJAA 3SJCA 2ZRBA 3PBKA 3CRMA 3AONB 1X8LA 2XQVA 3HI6A 4M8SA 4RB3C 1C0PA 3K0CC 4XLCA 2GBCA 3WTVC 1FA9A 3JQFC 4G9GA 2WWIA 4HVAA 3FRHA 4A6EA 4CM8B 1T56A 8ABPA 1UC9A 4JLBA 3SG0A 2Z83A 4ZT7A 5CH8A 2DC1A 3SYLA 2JA5J 3CUYA 4PX9A 1IF1A 3SZLA 5LGNA 3I04A 4AP9A 5BN5A 1E9VA 1DAFA 3SJBA 1TJ5A 4HWSA 3DBOB 4MVJH 1JJBA 2CU7A 2IXAA 1V5FA 2E2HJ 3DOOA 1WZEA 2EA4A 3GNSA 3QVTA 4MP8A 2R48A 4ND7A 4FASD 5AH0A 3UXHA 3ZK8A 5BV8A 4QQKA 2QAGA 1L7EA 3F47A 3QYPA 4MLDA 3T7IA 4WOBA 2G07A 4FM9A 1DE0A 1ZM7A 3KXDA 2A1IA 3AG2H 3ODGA 1YVDA 1GEGA 2R2AA 4IRXA 4YO8A 3TGLA 4U0WA 3DB1A 3VR4D 1M8GA 2MSYA 1KI3A 1SJ9A 2XGDA 4ZJYA 4IHKA 4V39A 5FBZA 4LRUA 4NJMB 1LPAB 1PVEA 4IZ6A 5K7ZA 1OBVA 1LX6A 1KQ3A 2KM1A 2Z08A 3BFXA 4OD0A 2X3UA 3R6SA 4DQ2A 2HUNA 4UE6A 1DLJA 1X8XA 1SUAA 1K68A 4BO2A 2G08A 2Q7OE 3DLPX 1BKSB 2IPMA 3CUWA 4LJRA 3DV9A 1IZYA 1VHTA 5DM0A 1UFQA 3C14C 2A9RA 2GJ4A 2FSWA 2G67A 2FWPA 3CIOA 3RIHA 4BEVA 3IP4B 1TIKA 1B0AA 3R2JA 1ETUA 1TD1A 4RCZA 3RROA 4ZYXA 2RREA 3CO6C 4IDQA 1OLUA 3T9BA 3U7EB 2M0CA 3R6GA 1YJ9I 4PLCA 1P62B 2EK5A 3T8RA 1C3XA 2IAIA 2EL7A 1FFBA 2W4SA 3AL0B 1KFCB 1NE2A 4YCMA 4GOKA 1G8JA 4L75A 3WHBA 1BCRA 2B99A 3RC9A 3AERB 3WNDA 4QUEA 4N48A 1SOMA 4KXWA 4KR6A 4HH0A 1CS0A 4IDFA 4QQRA 3SXUB 3T4XA 2AR7A 2VVTA 3SCZA 1OQAA 1QGYA 2A6HF 3L7DA 4QFCA 4OUDB 5FOVA 3QPHA 3DWEX 1RXCA 5F0CA 5EEAA 3AETA 3LDGA 3RSNA 3JWJA 3UH0A 1AKRA 2QSZA 1NLMA 1PDWA 1ODIA 4F0JA 3BX1A 3O0TA 1JR3E 1F2TB 5E3IA 3RT1A 2CJJA 1BJZA 3T99A 3WWZA 1VQKI 1UADA 4HJXA 1GHCA 4FHZA 1O95C 4CQJA 3KSBC 2BM8A 2ANCA 3KOYA 3LA2A 3CV3A 2FNPA 3C3AA 3B6AA 3CB4A 3W6UA 2J5KA 4BN4A 4BO0A 5ALZA 1IAWA 4R3NA 1FFXB 1F2TA 4KIUA 4P3XA 4DR5B 3IQZA 2HI3A 4R2MA 4XTCS 2JASA 1EFVA 1E60A 1ADCA 3IQIX 4A7PA 5GTDA 5IBPA 1TF2A 1Y9DA 1OPXA 2D5LA 2FMIA 3I3LA 3KL4A 4UTZA 5LVAA 1KZ9A 3DMYA 1Z56C 3K0HA 4MWTA 4OJQA 5TB5A 1NTCA 2ZSHB 2QRGA 1KYZA 3GBGA 1E2XA 2AWOA 1ZJ6A 2JFHA 3QK7A 4JT9A 2GPWA 4O8ZA 3BZCA 4XLNF 1FLNA 2QMZA 4DCPA 3TQIA 2RNJA 1ISGA 2JH3A 3DZGA 5J6XA 3KPUA 4JX9A 3GVAA 1RWQA 2NUPA 4YRQA 1XHFA 4NENA 4DIOA 3IQFA 2Z5UA 3LVQE 4TLEA 3ONFA 5IDVA 3OQBA 4KZPA 5F78A 1DRJA 3SYKA 2P1ZA 1TUBB 1QPBA 2QQ9A 4EEFG 1R10A 1WPXA 2V5AA 3MOIA 3AT1A 4JNKA 4L27A 4X6UA 2G9ZA 5IC6A 3VYWA 4MWBA 4WKBA 3U4HA 5C5IA 4CT5A 3PIRA 1UKCA 3IUBA 4CHUA 5FHQA 4DZPA 3FB4A 3T3GA 3UHJA 2IYQA 3V5NA 1EUDA 3ZEIA 4Z2AA 4N8DA 5L8VA 3HN7A 3RDPA 1JILA 2I80A 3IDSA 4JX4A 3P5JA 2D7CA 2R66A 1G8YA 1ESEA 2FBKA 4HB3A 3BAZA 3ROZA 3BROA 4QXPA 5J40A 3C6QA 3ER6A 3NCTA 4NK4A 1KIMA 2JN6A 4OM8A 3WYCA 2GBLC 3TEFA 4EI2A 5DGDA 3P45A 4IMPA 5FCDA 3GZNB 3K1PA 1QHNA 2F3PA 5M5WJ 2WD7A 3IPCA 4FP9A 3ADPA 5DEOA 5EQJB 1OLOA 4CDNA 1SFKA 3I61A 3RVOA 2YC2C 4QJBA 1Z4PX 1X1CA 1B41A 2VDMB 2GAUA 3R3HA 1BA3A 3EXG1 3ZCSA 1SELA 3G1UA 1N92A 2GXBA 4S1OA 3UPUA 4WJLA 3DTNA 1W73A 3A6GA 5GMOA 1K63A 3BN3A 4M1KA 3EOBI 1YZFA 1YFZA 3IH2A 4CEHA 3ZMSA 5L45A 3MA0A 4X8OA 3C3CA 1Z4OA 2RHBA 5K4HA 1KKUA 2VAWA 3EVCA 4XRMA 2A0XA 3A1NA 1P2SA 3EDOA 2NU8B 2IVMA 1WRBA 2QSYA 4Z8XA 4B84A 4BFVA 4GGMX 2J5PA 1A2BA 3A2MA 1QQ5A 3L8CA 2H08A 2JA1A 2BUAA 4DA9A 4AMGA 2JLBA 1S5LC 6ADHA 2K9MA 3VZDA 2E4XA 5J1SB 1S29A 1CP3A 1SHLA 3R3VA 2JGEA 3N3BC 1J09A 4D9GA 2Q3JA 5FUXA 4C1BA 1ACMA 1MAAA 2WJ4A 2J5BA 4E4YA 2P81A 3I45A 2YY7A 4I2NA 4HUQB 2NXWA 3OU2A 4J0JA 1HK7A 3ETCA 2XHEA 5BSKA 4XGQA 2Q45A 3UV6A 4Z6KA 3PUWA 2KP6A 5J4HA 4CV0A 3JQCA 5LFAA 3CYFA 5FPKA 3W5CA 1Z6GA 4BVFA 1KMNA 2YMMA 3WAJA 3DPUA 2R5WA 1TW3A 4BLRA 3JQ8A 2O3RA 3LA7A 3CUOA 2C4HA 3INRA 3V00A 1PS9A 1OCCH 3K6JA 3R3UA 4QUKA 2I5UA 4ZV7A 4GS5A 4JXKA 2C96A 1YE8A 1I39A 2QJOA 1WUJS 1Y9AA 2ILTA 2VA8A 4NH0A 2F00A 4BAYA 4ZAWA 1DL5A 3DWGA 1EFCA 2V03A 1XSEA 4ZVKA 3ZD6A 2GAAA 3A4TA 4IZHA 1P73A 3LT4A 1ZG1A 2K5UA 3DMDA 3JRGA 2AA3A 3D1VA 3SBOA 2H5IA 2Z2JA 2Q28A 3FTFA 4UUSA 3BULA 1ZBDA 1JX6A 3EXEB 1IN4A 1XCGB 1PJZA 1TK9A 4K87A 1U90A 4LWZA 5CT5A 4A3LJ 2I62A 3PHHA 3LL7A 2VBZA 4X1EA 4Q02A 2QUHA 4REOA 4OMZA 4RY9A 4PCLA 3BZBA 3GJZA 3GLGE 1NBIA 5FD6A 5C46F 2AKEA 2IEIA 3CJRA 3K0KA 1FVOA 3RFXA 4F7WA 3PR1A 121PA 4JMPA 2QW8A 3IP5A 4RVHA 3B2NA 3H9BA 4KDRA 1KMHB 3Q8XB 5AJZA 1B8VA 1JDBC 1RPTA 4IWYA 3T5PA 1Z4JA 1PFQA 2VHTA 4MRMA 4IS3A 1XKQA 4NXNB 1YS6A 4POOA 4DR6B 2G9UA 5EG5A 4IO0A 2CNDA 4JEMA 4P9FA 3RNOA 4B40A 3RRZA 4DNOA 1U3WA 3P0IA 1WAMA 4AO6A 2XKPA 1QYXA 2R7MA 3R23A 1N32B 2UUBB 2Y2UA 3FUXA 2A7QA 3UV3A 3UXYA 1GCIA 4R2JA 1F8FA 1RVDA 5JD4A 2L2OA 4E09A 1ZIXA 2BXYA 2KWIA 4WT7A 4EX6A 3TUIC 4F6RB 1B9MA 1O6GA 2KSQA 3PC6A 2OFXA 4CLRB 3IUNA 4UFOA 3B1XA 5IASA 2NZWA 1U0BB 1S7GA 3MLBA 4P34A 1HQDA 1DQPA 3K4PA 1FFCA 2JG3A 3N28A 2IYEA 2RGGA 3G88A 1Z4MA 2MW8A 3MN1A 3W5UA 3IAS6 2JFZA 1RLIA 3K1JA 2QR3A 3AI1A 3MPUA 3OE1A 1G66A 4YRDA 3KKEA 2QPTA 1JJVA 3G1OA 2I5PO 3AF2A 2HGCA 4G85A 1OSNA 1OX5A 2I7XA 4I14A 5HPYB 4W9MC 4S1NA 1TXGA 1IZ1A 3CTPA 4QBGB 1F4VA 1SR8A 3V1MA 4N9IA 1LQ1A 1LS1A 3AOEC 3ANYB 2BMAA 3MC1A 4RVCA 2ZCJA 3L0YA 1KK0A 1O0BA 3O9MA 4HF7A 4OJYA 3OC6A 5I9LA 2BTQA 2O2CA 3G17A 2IEYA 4C6TA 4B6RA 5G4LA 5GZ3A 3L6EA 5A0VA 1ERDA 3S1RJ 5CNKA 2FPMA 3GT3A 2I9KA 3AG6A 2D4HA 4PFPA 3OS2A 2C4VA 3B82A 4LIPD 7ADHA 1R9GA 3RLIA 1QPIA 4PG8A 3THXA 1V48A 4OA5A 2Y0DA 3I59B 3H5OA 3VH4A 2QD5A 3RV3A 1Z7UA 1K7XB 4X1IA 2VFAA 5EZGA 2FR0A 4CCLA 3DCFA 3EAGA 4L5CA 4MMXB 4Q19A 3GK3A 4F4IA 1SKAA 4BNFA 4GOMD 3WBJA 1YO6A 4MW0A 5BNIA 1I3CA 1Z0IA 3UWDA 2CMGA 3KP1A 2HA3A 4OFBA 2H9IA 4WWHA 4EI9A 2P4QA 2GKGA 1Y3BE 2XV4S 3OCJA 4OMCA 4ES6A 2L9SA 1ULBA 2Q8PA 3JWIA 4H0NA 2VK8A 4KXLA 4BXUA 3M1CA 5DTRA 4D4KA 3DGEC 4BJHB 2DA4A 1H5UA 2P9BA 4LN1A 2HHAA 1HDXA 3MTAA 3TX2A 2AFHE 3CEJA 1QJCA 2ZFWA 1LPOA 1GNPA 3FPLA 1S96A 1U28A 4ZTJA 3OWTA 2HI0A 4IP0A 4IHQA 2O6HA 4AD9A 1UM8A 3O8BA 3WV5A 1WBBA 4RAYA 5L3SA 3T3DA 5BSVA 4Q6BA 1OH6A 2H6CA 1E0KA 1ZVKA 2ZWAA 4KOEC 1NI5A 3DZJA 3CX3A 4IGEA 4UBNA 5EMHA 3SYMA 3FSGD 2VBXA 5JNVA 2BKVA 2CJWA 4TMXA 3BM5A 1IN1A 2WEKA 5K4GA 1P0MA 1XZMA 1N6HA 2ZSAA 5SYAA 4NCAA 3Q7PA 1Z77A 3K2EA 3QFFA 2GCPA 2P5TB 2MDTA 1IONA 4ENMA 5L3SB 2XF2A 1G5PA 1SFRA 2PN1A 3PQEA 5K3BA 4DCMA 1LY1A 3FZEA 5H3CA 3W8DA 3R8XA 5CIWA 1XMVA 1XFDA 1YCDA 3DKRA 3UJHA 2P6OA 2P2SA 4LRXA 1IC8A 5F4BA 2QCOA 2ZBUA 4O4JA 2HQRA 4YGYA 1PWZA 4F93B 5JWOA 2X5NA 3D7NA 5KI6A 4BTEA 4M8LA 3WRVA 4XLPF 4E70A 1YG2A 3Q2OA 4MW7A 1II8B 2YIMA 5KHDA 4TTIA 2Y1XA 1YZGA 1JTFA 1JA0A 1HE3A 2K85A 4RGRA 4A8JB 4QECA 3WDLA 3LQKA 1X77A 2I22A 4LDRA 4Y2VA 1MX3A 3D5EA 2WQ6A 1W581 4RV9A 4OAYA 4J0CA 1RR8C 2LCFA 2IEKA 1ORWA 3PQ7A 3JQPA 3BL6A 3O2QB 3R7AA 4BEHB 4RK4A 1CQXA 2FPWA 2HWVA 3KXIA 1P4WA 4KQ1A 1I2MA 1NNSA 4E6KG 1RACA 2FFHA 3BFJA 4ZOLF 4JJKA 4HLQB 3AHDA 3SS8A 4W5TA 2G25A 3I2IA 4QTXA 4F1KA 4LNUB 3KOOA 2PQMA 3ND6A 3EWNA 2UDPA 2W2VA 3H4VA 3WLEA 3UK1A 1CQTA 1Z74A 3JQAB 4YH1A 5JE8A 5CDHA 4HLYA 1T33A 1MBGA 4B48A 1IXRC 5JFOA 3G8YA 2CFIA 4YRZA 5KWEA 5BSGA 4GKVA 2W6IA 4N4NB 3OT1B 5THQA 4RXMA 3WGNA 5J2UF 3FKJA 4URFA 3OUTA 1R6DA 2II6A 5E3HA 2XMSA 3CLOA 3DOUA 4ZYHA 1T6NA 2VF8A 3F21A 1E7MA 4FC7A 3QYBA 1P1CA 1ZGZA 5GV8A 1MOPA 1QGDA 1PR9A 1E66A 1JDZA 4D4GA 5I7EA 1H2EA 4F9EA 4R2IA 3BE6A 3Q7SA 5F3DA 1L1RA 2JZCA 1DS6A 4RAZA 4YWHA 3VZPA 1C3OA 4MA5A 2OTCA 5A2GA 1PGOA 1NT2A 3LF1A 2AQHA 1PS8A 3ULQB 1FIPA 1J9EA 2I6GA 4JYMA 4B81A 3BOQA 4BVJA 5DCLA 4KITB 3PHGA 4D9CA 2ORYA 4KXXA 3AI3A 3VR5A 4OOIA 3E23A 3K9HA 3BVPA 3PU6A 3TQQA 1OASA 2PVPA 3A3KA 4B6JA 1GZ4A 2VKDA 3ZJYA 1I0LA 3ZWDA 3K4QA 4CR6A 4EHIA 5IKMA 2YRWA 2OCIA 3STVA 3FA2A 1I1QB 3ZNPA 1E94E 3G0HA 4DGSA 2HZTA 3AF0A 5ALQA 3RS7A 5B1EA 2ATIA 3KALA 1G0NA 3I30X 1XD2B 5AKZA 4CL0A 4QDOA 5U9CA 4DBLC 3KG2A 5BQ3A 3ZWCA 5H9WA 2CQ7A 3K0LA 4XR6A 3O4HA 1YE9A 3L00A 2HQSA 1KF0A 3IP1A 1UEIA 2IU6A 3GDOA 1O5OA 5J5CA 2R7KA 3OEED 3CX7A 1ZKMA 2FQ3A 1DT3A 2BHLA 4W5JA 3ZDCA 1XP5A 1XQ1A 2RGWA 5TVKA 1DCFA 5D1HA 1I8TA 1T2AA 2ZPAA 2R1TB 4G0NA 3SZOA 2JD0A 1HO3A 5JS6A 1I3QJ 1G4DA 1JFFA 2HJSA 2R4QA 1E5DA 3HB4X 4O4LB 4YJFB 2HSWA 3NB0A 3TEJA 4HLCA 4C2AA 3I2FA 5L4SA 5D4SA 3DBHA 1L4NA 5EKUA 3FPBA 2OENG 2Q0XA 1RWKA 3DMGA 4FN5A 1MRSA 2P2DA 3N58A 3B60A 3VHXB 3Q7EA 2CYAA 3E2IA 1CV2A 4AJHA 4K9PA 1O0CA 2DBBA 5F1RA 4M6VA 1M2HA 3SFIA 3DTIA 1KYTA 4RK7A 2EVWX 3RVQA 3STTA 2NT4A 4JB2A 4MGIR 2UYHA 4Y6SA 1OZFA 3URKA 3QH4A 3CJQA 1RJDA 2QVGA 1HYBA 1PFWA 2V7GA 3L1PA 1JPVA 2WU4A 2V4MA 2C5HA 3K5WA