4A6EA

Crystal structure of human n-acetylserotonin methyltransferase (asmt) in complex with sam and n-acetylserotonin
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
347
structure length
345
Chain Sequence
MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHGTELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDLSVFPLMCDLGGGAGALAKECMSLYPGCKITVFDIPEVVWTAKQHFSFEEQIDFQEGDFFKDPLPEADLYILARVLHDWADGKCSHLLERIYHTCKPGGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGFRDFQFKKTGAIYDAILARKGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords HYDROXYINDOLE O-METHYLTRANSFERASE
total genus 122
structure length 345
sequence length 347
ec nomenclature ec 2.1.1.4: Acetylserotonin O-methyltransferase.
pdb deposition date 2011-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF16864 Dimerisation2 Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4a6eA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4a6eA02
5BOXA 2B25A 3O31A 3UJ6A 3F6VA 3RJPA 1MD0A 1KA8A 1SMYF 3E6BA 2V1UA 1JG1A 4O29A 2ADMA 4RGSA 2P7IA 7MHTA 1MJAA 2A5YB 2C6YA 2EX4A 4CKEA 3KP6A 4P5OA 2OBFA 3JTHA 4LK0F 3HYIA 1AQJA 1WRJA 5FFXA 2OBPA 3FXRA 5DPMA 3BDDA 3AY0A 5DD4A 1D3YA 2MD5A 4R79A 2BBYA 2BR5A 2ZNZA 1RJEA 5FQNA 2PLWA 1WXWA 4PYOA 5LR6A 3BJAA 1TQPA 5KYGA 2UZ4A 2DFIA 1IXRC 4RGXA 1J9IA 2ORED 2UYOA 2N47A 2J5PA 5LQKA 2FF4A 1L3IA 2EFOA 3IV6A 1FYLA 4RV9A 1YS6A 1RUOA 4HW0A 4IPAA 4RGRA 2WA2A 3WODF 3L09A 2UWMA 2VP3A 4EM0B 1K78A 1RJGA 1N2XA 3OE5A 2HR1A 4A6DA 5D1NA 4XLNF 3UJ9A 2VOPA 2P7HA 1HKTA 2YR2A 5EHIA 1FP1D 3I58A 4DQ0A 5DTRA 1BIAA 4ER7A 3ZMTA 3BWBA 4RS8A 4ZYGA 5LRSA 3EVZA 3OFJA 3SQNA 1JG2A 2L3DA 3UJ8A 3C3YA 3ZN1A 3GUDA 2DULA 1BOOA 3MHTA 3K2ZA 2PV0A 1R1VA 4HV6A 3M6UA 4CDGA 4GGGA 4OIRF 1HW5A 1QYRA 4GOOD 1SD5A 3I64A 2DLLA 4P9FA 4P7FA 3I53A 3CUQB 3TGNA 1ULYA 4E2XA 6PAXA 1KU7A 2ZTHA 3EVEA 5FUBA 3RKYA 3L7WA 4M37A 4OX9Y 4YIFA 4MGRA 5BP7A 3F8FA 5HZMA 5ED4A 2GA9A 3KPVA 1L1EA 1J0RA 1QQIA 4I09A 1KPIA 1VLMA 4OIQF 4POOA 4RVDA 2RNJA 3WU0A 4S04A 1NKVA 2PBFA 2CWEA 3DXXA 4M9SA 2W85A 3IKVA 3FMQA 2AVNA 1XB4A 3W6KB 4RYLA 4R05A 2P41A 3CJNA 4A5NA 2YPRA 4HDUA 3E97A 4BQAA 2CSOA 4HQMA 1FPQA 1FBSA 4HV5A 1PDNC 4KDCA 3SZPA 2F5EA 2UYHA 1FYKA 1BHJA 4FZVA 1QBJA 1JSZA 3OPNA 3G2QA 4U7PB 1TQIA 4UVCA 1IXKA 1IXSB 5DTMA 4XCXA 4ESJA 2IBTA 4QDKA 3LBFA 2M87A 1G38A 4MEYF 2FEZA 4NECA 4YUWA 2CQKA 1ZG5A 3IL2A 2ZO4A 4RTJA 4MNUA 1NW8A 1OYYA 4QTTB 4YV0A 4Z2YA 2R6ZA 3UJCA 3FUUA 5FTWA 2Y0MA 5FULA 5FA5A 4BH9A 2GXGA 1KU3A 1QAMA 4I0AA 2E7XA 3CO6C 2Y1WA 1XCBA 3MWMA 1SUIA 5LQUA 5L3EA 5LQAA 4JXJA 1S29A 4E32A 3GWZA 2PGXA 4OBXA 2V79A 3DXZA 2VZ9A 1LJ9A 3DMFA 4M73A 5FO5A 4C05A 3H92A 2P5VA 2O8XA 1MJBA 4HRAA 1BKYA 2YVLA 4AIHA 2W25A 2P5KA 3QRFF 1K6OA 3AAFA 2BV6A 5HDNA 3BP8A 4BHBA 2JHAA 5E2BA 4N9HA 2KIFA 3ML6A 2EB7A 2NXEA 3PT9A 3FXUA 3G2MA 4X61A 2PEXA 2FU4A 3QP5A 3R24A 3DPLC 5K8VA 4L9VA 1IXCA 1R7JA 2YXDA 2L54A 4GC5A 10MHA 3HVHA 5FLXZ 5EMMA 2WA1A 4KN4X 4EV0A 2ONYA 3BXOA 2NS0A 2K02A 2V74B 4EK9A 3E7PA 3UA3A 4FT2A 4I02A 4F85A 4LD5A 3PFHA 3CUOA 5K09A 3C0KA 2R7FA 5ERIA 3LA7A 1G3TA 4MQ4A 1LNWA 4A5MA 1OR8A 3KP4A 5HLIA 3RIRA 2HTJA 3EEOA 2UYCA 3FPFA 1QANA 3B3FA 3BGDA 2XAQA 1ZGAA 1YQAA 1FBUA 3A7DA 3ZPLA 4XUDA 2DBBA 1G55A 5B1SA 4L18B 4M36A 1BIBA 4PNEA 4XBFA 4EJUA 1HSTA 1HKSA 4S05A 1J5YA 4RAYA 2XKPA 3SMQA 3B5IA 4IV0A 4KIFA 2FE3A 1XMAA 3GRYA 2EFNA 4HGZA 3SVZA 3WTWC 1S7OA 2BYVE 2IFTA 4U7TB 2KW5A 4P96A 3D0SA 1SFEA 1R1TA 3KZYA 1I1GA 2W24A 3FZGA 1FZPB 3HVJA 2XAFA 3BWYA 3RODA 4O3MA 2HYGD 2PI0A 1R74A 2FA5A 3KCCA 1R8XA 4ATNA 2K4JA 3KP5A 5DM2A 4MQ9F 4R6WA 5FQOA 3F6OA 3F3XA 3WSTA 5DD8A 3DEUA 2UXXA 1Z7UA 3UJDA 4MWZA 5GINE 1O57A 4PCLA 5BW5A 5DT2A 2MBFA 1HQCA 2FNPA 4CICA 4CKCA 3CJQA 3KPUA 1WG8A 1EH6A 5KK1A 1VIDA 2NYUA 2AOVA 5D5XB 1XD7A 1INLA 1H0MA 3B3GA 1OKRA 2G71A 1PRYA 5GWXA 5ILSA 2XVMA 2PJPA 2ZIGA 4U7BA 3KETA 1R00A 3VODA 4HX8A 3V7SA 1KQ0A 3GU3A 4ASNA 4BYYA 4B17A 5C1IA 5CVVA 1ORIA 4L9TA 1P4XA 1WQ2A 3UA4A 2P6SA 3KP7A 3BY6A 3F8MA 1LEAA 4D0PA 3ELDA 3P9IA 3ECHA 2P7CB 2OZUA 1OR7A 5HLHA 1G8AA 5HDKA 4C04A 5E8IA 4EMSA 2EJRA 2B0LA 2K86A 3HVIA 2IT0A 3AXSA 2EV6A 3NRVA 3RYPA 2RQPA 2AZTA 3CDHA 3I0TA 2FRXA 4RB2C 3LCVB 2COMA 2IA1A 4LLGF 5EMJA 3L9FA 5KS2A 4A12A 2P40A 3TRKA 2RDPA 3H2BA 2BZGA 5BXYA 1ZLJA 2OQRA 3U81A 3RIEA 5DM4A 5D4RA 4HLXA 5CUQA 3I9FA 3F8CA 4HOBA 4UXNA 3A4TA 5BW4A 5DCMB 4C07A 2FXAA 4YUYA 1XGOA 4QWQA 1ZG3A 1T98A 3KQWA 4DA4A 1ZARA 1CF7A 2QVOA 3P8ZA 3RI4A 2IVMA 2EG5A 2PXXA 5E1MA 1X1CA 3M6XA 8MHTA 2L4MA 4LGWA 3J81K 4KNYA 1TW2A 3EETA 2ZVJA 3WTYC 3KQTA 3DPTA 9MHTA 4AIKA 3UJBA 2BEOA 2JPBA 3O6BB 2EFJA 1UWVA 3PQKA 5K5OA 1H9GA 1O3RA 4M6XA 3M6VA 2C7OA 1QZZA 5HS7A 4KICA 4KT5C 4LG0B 5DSTA 1KQ9A 3U2RA 3ERCA 4BP1A 3I59B 5JHUA 3LQRA 2VN2A 2ELHA 1F4KA 2LNBA 4EQZA 2HQNA 3IHUA 2P4WA 4LB5A 2QQBA 1HW2A 3ELWA 5MHTA 3CJTA 2ZMEB 2OO3A 1ZGJA 3WTXC 2Z33A 4JBAA 3JWIA 2XYVA 2F5FA 4UNOA 3RKWA 4FX4A 5EKUA 3C6MA 2IBSA 2Q0OA 5K0BA 3E5XA 5M5BA 4YFKF 3RPUA 1IZ1A 1Z3CA 3P9NA 3T5XA 2QBYA 2IH5A 3EGIA 3LECA 3CVOA 3TM5A 1KP9A 1KYZA 1IAWA 2HZTA 1FP2A 1BOAA 2WC2A 1JHHA 2A69F 2XRNA 1SKMA 3PLAE 3GFJA 2M45A 1D8JA 4EJVA 2JRTA 2OB2A 1NV8A 3ZMSA 3GZ6A 5ICFA 2XUBA 4KDPA 4K6MA 4P58A 2NNNA 3EVDA 2MA3A 3LKDA 3M9AA 4E31A 4L9NA 2AS5F 2FPOA 2PY6A 2ZBPA 2ZZNA 5DRYA 5HIKA 2P35A 1PUEE 1FBQA 2NRAC 5AIQA 1XSVA 3HSRA 4E30A 1MHTA 1F5TA 3ZMUA 2PX2A 2OZ6A 3ECOA 1X1AA 3DMGA 4PGHA 2VBXA 3NEUA 4HDVA 4XRFA 1WI9A 2KKOA 1EIZA 5E9WA 3R3HA 2PJDA 5P8WA 3EMDA 3E6CC 3B7PA 3SFZA 4HGYA 3DKWA 2FBHA 4HYEA 4RTLA 2JTVA 2FSWA 2HGCA 4U88A 1Z1DA 4HBLA 1YO5C 2P5LC 1ZREA 3TPZA 5LHGA 1IF1A 5HLGA 1SD7A 4KVZA 3GNLA 2BGCA 5E1ZB 3J7AO 3SXJA 2L02A 1T6SA 3HRMA 3E6DA 1J75A 2HTEA 2EK5A 2IW5A 3DLCA 5E2AA 4PINA 2CG4A 3KQOA 1DDNA 3MEXA 1H1DA 1P6RA 1RI2A 1JR4A 4MTDA 2RV8A 3BWMA 2ZW9A 2O0YA 4GOND 5FCDA 2DI3A 3RKXA 4FS8A 3G73A 1ZRDA 3UJAA 2KIUA 3FPGA 2P6TA 2ZZKA 2IH2A 1S3JA 4CXMA 1XGMA 4NQWA 4PGGA 3WGHA 2ZBKA 4RVFA 4HX4A 3LQQA 1SQGA 4AX8A 1NW7A 3KP3A 1QAOA 1SMTA 2CO5A 4WK8F 3GRUA 4GQBA 3WTUC 3I5UA 5E18F 2M30A 1C0WA 3CO7C 4HG2A 3VYWA 1T0FA 3A7EA 4O5VA 3ZMVA 5HFJA 3HUGA 2ACJA 1U2ZA 2CMHA 5E1OA 2M5WA 1B4AA 2FBIA 2VDWA 4G7ZF 3WE3A 1ZRCA 3MERA 1W7PB 4BAYA 3WG9A 2HEOA 2DW4A 4CYDA 3FUXA 4TV7A 4ISCA 2IA0A 3IRQA 2EFWA 5CVUA 3PX3A 1CGPA 3NVMB 3FXQA 4HF1A 3E5UA 3F8BA 3P9CA 5FA8A 4QTUB 5HOQA 3DULA 2OQGA 5JUWA 2FHPA 3CUQA 2ZIFA 4R8SA 1JE8A 2LKPA 3GFIA 3E8SA 4PYIA 1Z05A 3IWFA 2C7PA 4IVNA 4WX9A 2D2WA 3KZZA 5L3CA 1HNNA 2FOKA 3HP7A 3KFWX 3M33A 4YV1A 2JJQA 1EH8A 1HXDA 3FPJA 2ERCA 5LLQA 1WSUA 4LG1A 5L3GA 4QVKA 1I6XA 1I27A 4GYIA 5EG5A 1YZ3A 1Q1HA 5CCBA 2ZWAA 4BNCA 4Q4ZF 2KRFA 3F8NA 4ENKA 3HRSA 4M6YA 2VE8A 2PT6A 2ZNYA 3EVAA 3GEZA 5K0JA 5EGSA 1TNTA 3I71A 3AJDA 4BXUA 1XVAA 3ZQ7A 3P71T 3V4GA 3N4MA 2Z9OA 4LG0A 4FR0A 2NXNA 3GW2A 1VTNC 1T39A 2O57A 4CXFA 4ESFA 2ESNA 3T8TA 3GVAA 1Z6TA 3F21A 5CVIA 3FF5A 1Y0UA 3V97A 4RVHA 2DK5A 3OE4A 4QLCU 2OZVA 5F6FA 2YSRA 3BT7A 2HMYB 3GO4A 3K0LA 2Z3YA 3NWBA 3IYLW 5FLXK 2AOUA 3MGGA 5EKXA 1W7PA 4UV9A 3DLIA 3HRTA 1SFXA 5D5WB 4GYGA 2AOTB 3TKYA 2R3SA 4C08A 4RX1A 3TKAA 3HTXA 1ODDA 2MC3A 5H6QA 2W84A 2Z6AA 2VC1A 3GFMA 1XCJA 5DV5A 3OU6A 2AOXA 4CTKA 4LK1F 4M74A 1LQ1A 3GGDA 3T7TA 4NB5A 1D2GA 3T0IA 2DU9A 3ELYA 1ZHFA 4M71A 3HA7A 5KQRA 2DAOA 2KIMA 2X0LA 2DO7A 4Q5SF 3ME5A 4B09A 4E2WA 4EGZA 1BJAA 4ZZLA 3LDFA 4KDRA 2HTSA 4N0BA 2BE5F 4AWXB 2P1DA 3FYDA 5CVRA 1P39A 3EVBA 5K01A 5LEKA 2IGTA 3HCCA 2PWYA 3F22A 4DF3A 3H3ZA 2XASA 1RIOH 2JPCA 1NV9A 4RTOA 3ISPA 2CFXA 3L00A 4GO1A 3P97A 3ZMZA 5BS6A 3K6RA 5IH3A 4HSGA 1IUYA 3UZUA 4E70A 1YG2A 1Z9CA 2AOTA 2Y1XA 3N97A 1SG9A 3EVFA 2AXLA 1BI0A 2JSCA 1GVJA 3HRUA 4RVGA 2EFQA 5ILUA 3OCJA 1EJ0A 3TLJA 1J2XA 2HYFA 1B9MA 5TRDA 1BC5A 3MB5A 1F1ZA 1SD4A 3G7UA 3QOPA 2CW0F 4YG2F 2OB1A 3PVCA 4A2UA 2FYTA 2G8NA 3T7SA 2AN3A 5DDGA 5GOZA 3NVKI 3LDGA 2AVDA 2HDCA 1XXLA 2DPMA 1G60A 3HA3A 2VS1A 3FTEA 5D6EA 3C18A 2QBYB 1R6AA 3GYHX 5EQJB 4BY9E 1GXPA 1DUXC 1O9GA 4C4AA 1FX7A 4G6DA 4MHGA 1SD6A 3KQYA 1TW3A 3SZTA 3SM3A 3BWGA 1R5GA 1F38A 3FZVA 5F64A 3D5LA 1D8KA 4P55A 3DMHA 1P91A 2DQRA 1R36A 2QLZA 1AV6A 4A0YA 4GC9A 2YUIA 2BR4A 2OKCA 2JH9A 3BOQA 4KMUX 2L4AA 3V7RA 4AVPA 2G9WA 5DXAA 3WTVC 1FOKA 3ER8A 1WXXA 3GZ5A 1XDUA 2AN4A 3OFKA 4RB1A 5K0CA 2OA4A 2CMGA 4Y30A 3T1BA 3K1MA 3UFBA 1YUBA 3LL7A 3V8JA 5LQRA 4EKIA 4XSZF 1JSXA 4PIPA 3HCDA 2OY0A 5IT3A 3PX2A 2G7UA 3S68A 4WWCA 1YW9A 4RTRA 3JAMK 3KHKA 3AXTA 5CVJA 5DX8A 3SXYA 3M1EA 1DL5A 3C3PA 5E8GA 2MLGA 1WS6A 1YW7A 3BZ6A 4XUEA 2VC0A 2C7RA 1P1CA 1RZ4A 4WXCA 5J8FA 2YX7A 2R7DA 5EMLA 4MQVA 4L5IA 2PVCA 5LSAA 5D1HA 2LSOA 3M8EA 1NE2A 3KKZA 1FBNA 2ZMEA 1YZHA 4IWNA 3KLNA 5E20A 3R60A 3VFZA 2HR3A 4KYWA 1NT2A 2EJUA 2GH1A 3EGEA 2Z6UA 4UHTA 2VE9A 2BM9A 2YXEA 1P92A 4L0ZB 1R5HA 5GM1A 3U9GA 5D6FA 1V3FA 3IHTA 5CD1A 3TO9A 1TBXA 2K4MA 2YU3A 4WXDA 1Y8CA 1DCTA 2XBMA 3V7CA 5JR3A 3QAHA 2UXNA 1MGTA 3NWEA 3RYRA 5F1RA 1YW8A 1MKMA 2P8JA 4RTNA 2IDJA 5DCMA 1IY9A 3QPHA 4ZYDA 3LHDA 5E1WA 1J59A 1UIRA 3HCAA 3KU1A 2RN7A 4KWCA 4LFUA 1MDMA 3ER9A 4GOMD 4JK1X 1T2KA 4KFCA 3HHGA 1JQ3A 4IRHA 2JT1A 1GXQA 1AQIA 4QQKA 4K2EA 2D1VA 2ADUA 1DPRA 2Q41A 2EV0A 4EGYA 4KN7X 3IC7A 3DFGA 1SVUA 4YUVA 1V4RA 1YTYA 2XGXA 3NDIA 2YQZA 4G56A 5EEGA 3ANXA 2DT5A 4R1HA 5F2NA 3OZRA 4ER0A 2QY6A 2B78A 3Q9SA 5FD5A 5E17F 1DUSA 2ZJ2A 1ZG1A 1PJZA 1RI1A 3IRRA 4UOEA 3G2PA 3TDUC 1LDKB 4RB3C 1YYVA 3TFWA 5FD6A 1ZRFA 3DF8A 4ON0A 5DM1A 5HDGA 4OQDA 4X63A 4PONA 4MTEA 5LQJA 2NAZA 4ER3A 4PYMA 3PFGA 5LQCA 1X1DA 2PX5A 3M8FA 4Q48A 5CVDA 5ERGB 3KQSA 5K05A 1M6EX 4ZYHA 5L3FA 1KYWA 4IXAA 1S7AA 3P7NA 2K7LA 1L3CA 1LDJA 4G8XA 2RVCA 2PBIA 4I01A 2ZCWA 2I9KA 5A2QK 4A0ZA 2UYQA 2YTZA 5EVJA 2VDVE 2HNKA 1P4AA 2VODA 3FX3A 2XYQA 5LGNA 3QV2A 1NW5A 1B9NA 3HCBA 3SHFA 1W7PD 4WXHA 4LMYA 5L3DA 1YS7A 1TQMA 4YV2A 3EEYA 5E9JA 5D4SA 2CYYA 5FWDA 4PCAA 5IT9Z 3DR5A 4PYLA 4F84A 5CYVA 2EA2A 2H6BA 3S2WA 1YFHA 2JZYA 3E3VA 1O7LA 2PMUA 2H27A 3V8VA 1JQEA 4I7HA 2NNYA 2GIVA 5EIFA 4F7ZA 1Z91A 3SR4A 1NHAA 3KP2A 2IPQX 3LCUA 3GRVA 2FK8A 1TLHB 3BUSA 2OAZA 1UB9A 3T0YA 1JGSA 1E2XA 4YIIA 5EOVA 5JVTA 3EQLF 3OU2A 5JFRA 4L5JA 2O03A 4M7RA 4HA8A 1EAMA 1U6GA 2D45A 4L9JA 1I1SA 2I7CA 3ZMDA 2P7VB 3FTDA 4HZFA 4OMZA 3D2LA 4E2YA 3QP6A 1VL5A 4Y15A 4EVIA 1QGPA 1G3WA 2PX8A 3MAGA 2VXZA 3EVGA 1UFMA 2PMHA 3BROA 4OIPF 3PS9A 3OOPA 2XAJA 3OZSA 2M8EA 4EM1A 1U2WA 2FBKA 2VDUE 2IRFG 3C1DA 5AIPA 2H11A 2G1PA 3WTTC 3NQOA 3TOBA 1ONVA 3V8KA 4P7KA 3KR9A 5K0GA 3E6MA 4UUVA 3MAJA 1VP3A 4OINF 4YFXF 5C9ZA 3LCCA 4OMYA 3FM5A 1KPHA 2TDXA 1L3BA 2EFPA 1RI5A 1IRGA 1ZN2A 2K27A 3BPVA 2EV5A 4Y2HA 2F5DA 5GP1A 4HQEA 3C7JA 4R8RA 3R9XB 3HHHA 2ZIEA 2A6HF 1SFUA 4HX7A 5C0OE 5DLYA 3LA3A 4A6EA 3DOUA 1H9TA 1PP8F 1XJ5A 3QPTA 3GJYA 3EUHA 3GX4X 4QPNA 1K7AA 1KU9A 1TPYA 1NBHA 3FUVA 1VE3A 3NW9A 4I98B 2E7WA 1HW1A 4WVLA 4DKJA 3FRIA 1IRFA 1FWZA 1BC8C 1S8NA 2F2EA 1P4WA 2PSSA 2JG3A 1JTFA 3PFIA 4LWOA 4IV8A 1B6AA 4P7GA 2HQRA 3BPXA 4IF4A 3DV8A 3J81Z 1XN7A 1G6Q1 2GQQA 3CUQC 5A2QZ 5BQTA 3BZBA 2ZXJA 3FPHA 2GAFA 2XVAA 5D5VB 3P9KA 3R4KA 4X60A 1RI3A 1PP7U 3GLXA 4DQ2A 2DPDA 4RTSA 5ICCA 3ORHA 3TQSA 4CWAA 1OPCA 5KQSA 1ZH5A 3VC1A 3EYIA 2XAHA 1EV7A 4MIKA 3R6SA 2ONZA 3G89A 3MFKA 1RJFA 4RAZA 4ZZDA 3R61A 3FRHA 1OYWA 3IWZA 3ZP5A 4ZTBA 4E2ZA 2AOWA 2W57A 1DP7P 4GXOA 5CIYA 2ZULA 3GFLA 2ZBQA 4ENNA 3HCFA 1W4MA 3BJOA 2ZWVA 2ZCJA 3LA2A 2FRHA 2KJBA 2ESHA 2O05A 3SSMA 4RTKA 2MLKA 3IKTA 4GBED 5FGMA 4EKGA 4N9IA 5K5RA 3G5TA 5DSXA 5LRRA 3UWPA 4MEXF 3DH0A 3FUTA 4IKPA 3CGGA 4CGZA 5HS8A 2GLUA 4ETSA 2GS9A 3J80K 3GCZA 1EH7A 2QUFA 4GEKA 4DNCA 5FHQA 2G72A 1UHWA 1G8SA 1WKMA 2LD4A 3J80Z 3KE2A 1VBFA 3HTSB 3B3JA 3BJ6A 3COAC 4IHTA 5J6XA 4EJTA 3BKXA 5KVAA 1ON1A 2GXBA 3KR1A 3ELKA 3G88A 4FSDA 4OBWA 3CKKA 4G7OF 5D8KB 3TDZC 1BBYA 1N7IA 3OU7A 3A27A 2ZFWA 1L0OC 4EJWA 2WTEA 1MZBA 4OA5A 3SSOA 3BGIA 4DM3A 3O3KA 3JTGA 2OU2A 1FNNA 1YF3A 2EA4A 5AONA 4EQQA 3E05A 4OU0A 4DCMA 1AWCA 3MTEA 4UVBA 2RC4A 5EIWA 5F2OA 4L0YB 5HS9A 1U3EM 3EMBA 5CVEA 2A3SA 3R6TA 2PT9A 2O06A 4FP9A 3WGGA 4HAMA 3HA5A 2DK8A 3K9TA 5LQNA 4H0EA 4M72A 2A14A 3M70A 2NXJA 5E8RA 5IKMA 5LHIA 3RDIA 2B9EA 4RSRA 4G7HF 4X41A 1G3YA 1KU2A 5HIMA 4G6QA 3CCFA 2ZFUA 4QQNA 2XV4S 2O6GE 1KXZA 3Q9VA 3R0JA 4U0WA 1KR5A 4LLNA 2PFBA 5DUKA 2OYRA 3KQVA 3KQQA 2D1HA 1W5TA 4Q47A 1JXSA 1AOYA 3DXJF 3IEIA 3WU1B 3FUWA 4ER6A 1T43A 2E5WA 1XDSA 3R0AA 1FT9A 2V9VA 3MZYA 2GWRA 4RWZA 4JQFA 3X0DA 4U7DA 3GDHA 5K1YA 1G6NA 2I62A 1BM9A 3HM2A 5E9QA 1RI4A 5G02A 1BC7C 3FMSA 1FC3A 2PKWA 3QOXA 2V7EA 3TOAA 1NBIA 1VP9A 4IJAA 5JI6A 3ABTA 2CL5A 1BI3A 5GIOE 5GM2A 4AZVA 5HVQC 2HFHA 3K0BA 4F86A 3P2IA 1QZYA 4MTLA 1UFKA 2BM8A 3LKZA 4BHPA 2STWA 1XSXA 5H6RA 2VT3A 3CLOA 4PDKA 3MQ2A 1QO0D 5HIIA 2P8TA 3KQMA 3PTAA 2RGVA 4IRGA 1EQAA 5DX1A 1HMYA 1IN7A 2A07F 3F23A 3JAMZ 3EPPA 4GF5A 2QYOA 1RJDA 2ZSUA 5ICEA 1YFJA 2H6CA 1VPTA 2XYRA 4O6JA 3GF2A 1ZAOA 2Q8KA 3DTNA 2IA2A 4GOLD 3LSTA 3K69A 3EYYA 4HC4A 4HH4A 2GA1A 2VOOA 1IN4A 1ORHA 3HTUA 1WY7A 2NP6A 3G5LA 1Z6RA 3SX0A 5KVRA 5T67A 2XKOA 1SQFA 4R8HA 1X1BA 4U0YA 3MTIA 2BR3A 3WE2A 1JTEA 2XHKA 1R1UA 3MZHA 2VBYA 1YFLA 1WZNA 2STTA 4G9YA 3FM3A 4HF2A 3HEMA 4KUMA 5DUIA 4LB6B 2IDKA 5ICGA 1T38A 4FT8A 2J5OA 5J8CA 1IN5A 2MH2A 1REPC 5T64A 1FY7A 2VBWA 2O07A 1R22A 2AR0A 2HKXA 2QQAA 3MQ0A 3EGVA 2CWWA 5HILA 2O61A 1IM8A 4HTFB 4PYNA 4WCGA 3BWCA 1L9KA 2K4BA 3HOSA 2P3LA 4OQEA 4CHUA 1O54A 1LDDA 1FJXA 1JHFA 4XLPF 2HWKA 4PYJA 3UBTA 1O3QA 4AUKA 3VOEA 5DWQA 2EWNA 5L3BA 1JG4A 3AWIA 1L3LA 5K0EA 5F2KA 3KPJA 2Z6QA 2O0LA 3W6JB 3GRRA 3BKWA 1KQ8A 4FT4A 1QPMA 4M9XA 3FWEA 2QZ8A 2PXCA 1GHCA 1ON2A 3KR0A 1S6LA 4UVAA 2IP2A 1XCLA 1KPGA 5HIJA 4I0BA 3F72A 2FNAA 5DM0A 4I2OA 4M9ZA 3TO7A 3MCTA 3KLOA 1NW6A 4QVGA 5LGUA 2KJCA 3FMRA 1G4DA 4L7VA 4RGUA 5CCXA 4PWYA 1KIAA 4IHSA 3I54A 1YB2A 5U4XA 2OXTA 3KPWA 2HS5A 4QDJA 1MJFA 4AZSA 3DQVC 1U5TC 2YX4A 3ELUA 1JG3A 4XSXF 5EMKA 3T8RA 5BMZA 1KHHA 4CZZA 1SUSA 3VSEA 3HSFA 3M4XA 2IJLA 2PQ8A 2ZKZA 1XGSA 4C06A 1CF7B 2G70A 3LAJA 1BI2A 1FSHA 3FPEA 2VT2A 3JWGA 3OV8A 1U78A 4FSXA 2QM3A 3CJRA 2QWWA 5GIPE 4BHCA 1IW7F 1XMKA 2HOEA 2UZKA 2H1RA 1VQ1A 4BLUA 1B42A 4ZYEA 3WTSC 3TOSA 4DCGA 4AZTA 1D2CA 1IN6A 3Q5FA 2Y48A 5T6BA 3HVKA 3REOA 1YIOA 2ZZMA 2F5CA 2V6CA 5CJ9A 2DPUA 1O3TA 5FB2A 1AF7A 1X19A 3L2CA 3LDUA 4P9UA 5EZSA 5CM2Z 3THSA 3TO6A 3I4PA 5BPDA 2AS0A 1SAXA 1B59A 3DP7A 3H3UA 3TMAA 3PB3A 2IPXA 3G2OA 2X4HA 1I9GA 2YXLA 2V1DA 2EJTA 4FX0A 1NW3A 1UCRA 1ZYRF 4HF0A 3JWHA 3P2KA 3Q7EA 2Y75A 1DPUA 5LHHA 3CBGA 2CGPA 3RTRA 1G3SA 2WK1A 3VB2A 5FADA 3V8LA 4Y13A 2A61A 2XVCA 4UV8A 3L8DA 3ABUA 4ENJA 4KRGA 5FHRA 3T7RA 2Z5UA 1FSEA 3QU6A 3R0QA 4DZRA 4KMFA 2JHCA 3G8BA 3E23A 4KIGA 5EEHA 3KQPA 5E1DA 3PQJA 4LLLA 1O9HA 5DX0A 1TNSA 5DRTA 3G8AA 3TR6A 1R23A 2QENA 3NMUF 1UHMA 2M1BA 2HV9A 3B89A 1B1BA 4OOIA 3ZN0A 4B8XA 2CKDA 5K0LA 4KIBA 4OA8A 3LAPA 3BGVA 3GXOA 4RTQA 2P3QA 2XIGA 5EHGA 2MH9A 3I59A 3KPYA 1D5VA 3LX6A 5BPIA 5DTQA 2ETHA 5LEJA 1IN8A 2V1XA 1U8RA 3A25A 3QU3A 3O2PE 3F4KA 1QAQA 1F9NA 2FQ3A 1LVAA 2QE6A 3O7WA 1V39A 2VONA 4GUAA 4PYKA 3E5QA 1XDZA 3EDPA 4YMGA 3HIFA 2QRVB 4NHJA 1WWXA 5IT9K 1XCVA 2DTRA 1MJ9A 1RUNA 1LEBA 3K1NA 2YX1A 2H09A 4KW7A 4BP3A 1BI1A 2B3TA 4V0RA 1I4WA 3NDJA 2C7QA 4MHTA 2NXCA 1I5ZA 3HNRA 4Y17A 3KR2A 4XUCA 2WWYA 4PIMA 2F8LA 2ZLBA 4AZWA 3B73A 3A26A 4OIOF 4IRIA 3O4FA 5K0NA 1P1BA 1W5SA 2L01A 2LF8A 1K79A 3OZTA 3FHZA 4LECA 4HTFA 1XTPA 3ULQB 1RNLA 4PZJA 4PCQA 4AD9A 4HLYA 4P7JA 4YMHA 1JQDA 3WTZA 2ZBRA 4AIJA 4CTJA 3Q87B 1ZQ9A 3B02A 4V0QA 4DMGA 2RKHA 3FTCA 2PN6A 3JWJA 1FYMA 2Q2EA 1USTA 4ESBA 3LFKA 1HKQA 3JSPA 1D2HA 5E1XA 2E1NA 2FMYA 3NJRA 1EG2A 2PG4A 2YR0A 5HOOA 2JH8A 3GRZA 3M6WA 3TM4A 5DXJA 3THRA 2QRVA 3U1DA 2HKOA 3VC2A 1R18A 2AOUB 4RTMA 4PYQA 1RI7A 3KEOA 2I6GA 2ISYA 1XSDA 3CC8A 3NTVA 2O3FA 5DYMA 1LB2A 4ZH4F 5D5UB 1U5TA 2A6EF 2PXAA 2DQLA 3RPQA 2NYXA 5ILVA 1F3LA 2ESRA 5D8LB 3LPMA 2AN5A 4WF2A 3VEPA 1ZKDA 2GA2A 5DCFA 4CO8A 2NNWB 1HSJA 2H94A 1J7KA 1HBXG 1STZA 1R8YA 2OD5A 5CLSA 1KGSA 1Q0TA 2WV0A 4U0VA 3FTFA 5LGTA 2LDUA 2GB4A 3TQNA 2IH4A 4YUZA 1XGNA 4FHTA 2FK7A 3EVCA 4G94A 1O3SA 2E1CA 1A04A 1ZLKA 4ER5A 1U5TB 3LGAA 3K1PA 5K5QA 3HCEA 4C03A 3M7GA 5E8JA 4GCVA 3GIWA 5K03A 2GPYA 3KEQA 5EC8A 3P2EA 2HWVA 3SSNA 4A0XA 5E1BA 3RW9A 1P2FA 2G7HA 4X1OA 1FLIA 4M38A 3ROUA 2A68F 2PX4A 3JW4A 4BLVA 5LBQA 1OYIA 3ERED 3UJ7A 2NP7A 5FFZA 1I1NA 4YFNF 1K78B 2ISZA 2B2CA 5TJJA 2GZWA 2IIPA 4LJZF 1YLFA 1QNTA 2Z99A 1M6YA 2FCAA 4EM2A 2H00A 3SGLA 2OPBA 2XAGA 4QPPA 3HSEA 4RTPA 3JSOA 3MCZA 3DUWA 1BN5A 4RB0A 2GAUA 2VBZA 1O7FA 1USSA 5HEKA 2QQ9A 3FYCA 4YUXA 5FWAA 1X3UA 3C3WA 3QOWA 2PLYA 2FMLA 2JHPA 5EPEA 1N7JA 4H0NA 3ID6C 5EZQA 3WGIA 5H02A 4EJOA 2PWPA 1R58A 3DXYA 2BH2A 1MDMB 4R6XA 3HOTA 2XROA 4E33A 1E17A 5H20A 1Q0SA 5DEQA 4CKBA 5K0FA 3CTAA 4BLWA 2LF7A 3GO5A 3LWFA 3G3ZA 3C6KA 3LBYA 4LWPA 1M0EA 4ENMA 1TTYA 1EJ6A 4KA4A 2P3OA 1OMIA 4FGZA
chains in the Genus database with same CATH superfamily
2WYOA 5L6LB 5KYYB 2DXIA 1B3RA 3PPYA 4YPFA 4MP3A 1HGXA 4FWIB 3CMYA 4K05A 4WN3A 3E6BA 4V2GA 3OLZA 4OQYA 4Q7MB 1EFVA 4XCVA 5ER9A 5EWJB 4BVAA 2DDBA 2OFOA 1Z74A 2ADMA 5EXSA 2P7IA 1PHPA 5IAKA 3VAAA 1KI7A 1TZBA 4HPJB 2A5YB 2C6YA 1VKHA 3GZNA 4I8IA 4YJ3F 4GEGA 3OZWA 2OBFA 3MINA 3IBGA 3JTHA 2WSLA 1G6OA 3AF5A 3D7LA 4QYMA 4N18A 3RROA 1FLAA 1CY0A 3S15J 1MMAA 3MGBA 2BTOA 2BMWA 4B3MB 3U7GA 1JMYA 4KQMA 4AKTA 4F1WA 3L2RA 3T3GA 4R79A 1CULC 5C31A 4EW6A 3V3TA 5IZCC 2WKQA 1RJEA 3HYRA 1BS2A 5I7OA 4AKIA 2H1CA 1DTWB 3LYUA 4AY3A 1JQ5A 1WXWA 3KXDA 1Z67A 4PYOA 1CV2A 2W11A 4W5TA 3BHNA 4K0KB 1VZ3A 1QU2A 4R1QA 3EPKA 2ORED 4EKDA 1SOUA 2BLNA 3MJSA 3QEBZ 3BJMA 2IELA 2N47A 2J5PA 3FZQA 1LLQA 5LQKA 3EOZA 4RIFA 2UZAA 2FF4A 2LOOA 1S4MA 4LOHA 5TQ0A 1L4HA 2CUEA 1E5XA 1M6VA 2WSIA 1RKVA 2X3UA 1FYLA 3GTOJ 2W5UA 1YS6A 4MINA 4OATA 3TJZA 2QYSA 4DQLA 3F6EX 2V59A 1J2YA 2BKXA 1G21E 4IPAA 3AERA 3OIVA 3QSGA 4FPXA 4JI3B 3FBGA 3VZQA 3L09A 1MB9A 1T9KA 5F23A 1DBSA 1ECLA 4BJ1A 4D0NA 3O8CA 3ABKH 4EM0B 5HNFA 5KI6A 5I51A 5H16A 3UEOA 2I6TA 2QTHA 4XLNF 3HDJA 2X86A 1RAFA 1E0DA 2VOPA 1RHKA 1R9TJ 2HFKA 1XE3A 2VBIA 2YWHA 1CUVA 1F6DA 2E35A 3JZDA 1FP1D 4A3DJ 5EHIA 3V8RA 4LRTB 5I45A 5AOBA 1ISJA 1XWWA 5ALMA 1HYQA 4AO7A 1CQIA 3ZGKA 2D0OB 3ZMTA 1JDTA 3D8HA 1H23A 1E7YA 1YZKA 2V6MA 3BLYA 4HF7A 4L73A 4A8JA 2H29A 3PO3J 5C4GB 3KTFA 5LRSA 1EWVA 5T4BA 1QVZA 3OFJA 4KFTA 3DGFC 1WCV1 3G0CA 5KBYA 3KSAC 3NEPX 3MTGA 4NCHA 3C3YA 1AGXA 5E38A 3O6VA 2UUZA 3PC8A 1UBGA 2ACVA 1HEUA 4HV6A 1I2MA 1MX9A 1D1SA 2WAEA 2C9MA 2GN9A 3KAQA 3M6UA 2W9XA 4HRXA 2CFOA 2I55A 3NTQA 2BW3A 3O21A 1FYEA 3SC2B 4HLUC 4AJEA 2B82A 1HW5A 1A72A 3CLHA 2B7EA 1PO7A 2YRXA 4NYMQ 2L7KA 3U3JA 3I64A 1MW8X 1D8AA 1PT8A 3PRJA 1HDIA 3Q0EA 2MR5A 4BE9A 5J1UA 4D5GA 3KKQA 5EHZA 1N33B 1HXHA 4HD8A 4K6HA 2IU3A 2ZRLA 1ULYA 4IHQA 1YJXA 4QA9A 2ZTHA 1SVOA 1HSOA 3RKYA 2CJWA 2JATA 4UMEA 1I2BA 1P1RA 1NAHA 4KGZA 4WZBE 3IUYA 1GUUA 4O8ZA 1VRWA 2WWRA 1VQPI 1Q22A 3UUGA 3F8FA 3JRFA 1LFBA 2V7BA 4M1KA 4GIBA 2JKVA 1L1EA 3GCXA 3VJKA 4OIQF 3QE9Y 2NMVA 1MV5A 1UZUA 2QJFA 3PIIA 1JFVA 4RYDA 3A4VA 1DRWA 4Y1FA 1UPTA 5JJ5A 3OTWA 4OXQA 4DNPA 5HS6A 1GA1A 2QMEA 3L40A 1UKAA 1Z4IA 2IHZA 2L0KA 4M9SA 3G8YA 3PV0A 4ZT3A 4AG3A 4BZWA 1F2VA 1EPUA 1N75A 2W85A 5JJLA 1A7KA 3IKVA 1P18A 4E7PA 3BWXA 2VDLB 4ZDIA 4XN3A 3JQ6A 4TLLB 3T5GA 1FW6A 1COWA 1X0XA 4RYLA 5I7WA 2P41A 2ZYRA 4V2UA 2LR0A 2CZCA 1QC5A 2O2ZA 5LZ5A 3H5AA 1W1UA 2C07A 2C5LA 3UFXA 2CSOA 2J59A 5IDVA 1TEHA 3ZDAA 2GNPA 4HZIA 1E5DA 2V4MA 4K3UA 4A3IJ 3CE9A 5TEVA 1FBSA 2PL5A 2EFDB 3P2YA 1PP4A 4OI1A 4INOA 1GIAA 4RK7A 5CHYA 5I3ZA 2WVGA 4MYCA 3WGKA 2P65A 4HWTA 3FXAA 3OPNA 3FK6A 3G2QA 2OC6A 2GRAA 3N7AA 4LSWA 5KNLA 2C5FA 1POGA 4JCCA 4L8YA 5IYDJ 1LFPA 1NIPA 3LJKA 3V1TC 2OCKA 3ENQA 4A8TA 4CDRA 2HH9A 4QG3A 3LH5A 4I9UA 4XCXA 4OQXA 7YASA 3EIFA 4QDKA 3SC2A 3K8ZA 3CD6I 2IBTA 3HNPA 2FEZA 4LOLA 3U0BA 1G3RA 1N6RA 2FA9A 4M0UA 3BR6A 3ZX5A 4DG9A 1M2JA 5TARA 4R31A 5IANA 2RE8A 3Q2KA 4O4HA 4WOBA 1ZG5A 3UMFA 1LH0A 1LLDA 2HXYA 5AHXA 2OOKA 5F12A 3ML1A 4QTTB 4YV0A 1MMNA 2PUHA 3BRCA 3UGTA 3H1AA 4EPRA 1M1EB 1W7AA 3M9LA 5A3SA 4Y98A 1F9AA 5BPFA 4A2WA 5AHWA 2FUEA 3G5AA 4QO7A 1ZH0A 4WPGA 2Y0MA 1QHNA 4JP5A 4JC8A 4PQGA 4R3UC 2CMDA 3TR0A 2OM6A 2JGEA 4N39A 5F9MA 4AY2A 2PLNA 3A1SA 4P4GA 1KU3A 5LQUA 1URPA 1JR3A 1PT9A 3R23A 4RABA 1SUIA 1PGNA 2R44A 2WUDA 1LXCA 2BGKA 1VQ8I 2PXHA 4M9RA 4M21A 4MRSA 3Q3IA 3BC8A 2DODA 2WINI 4JXJA 5KZMB 3GWZA 1WU8A 2PGXA 4OBXA 4L2IA 2VZ9A 1GQYA 1C7FA 3ZV3A 3HO1A 3V6LA 1JWBB 2VCYA 4IHXA 3ESDA 1R9MA 4M73A 5F0HA 1Z0KA 3B6AA 3AV3A 3JD1A 2VJQA 4EPWA 3F7NA 4IH9A 2IIVA 4QE3A 4C05A 2H08A 2EZLA 4DV2B 2P9TA 4NJEB 2WJJA 4G4SP 4Y6QA 2FFQA 5A4AA 1J24A 2O8XA 3I39X 2RI0A 4RPHA 3JD0A 4HRAA 3BMQA 1UMCA 3UV7A 1BKYA 1S8AA 2XBLA 4LSZA 5GADJ 4XSVA 2W25A 2DUNA 3CURA 1YI0A 2P5KA 5BNTA 1L8AA 1QE3A 2Z58A 1K6OA 2BFNA 2BV6A 4OI0A 1DWUA 3KZVA 5DHUA 4RPCA 4UREA 1LSOA 5DGXA 3A3PA 1C4KA 2LDBA 2WP8J 1OGIA 3HFRA 1G7TA 4FFPA 5FFNA 1H4QA 2O5CA 1Z8FA 1QCYA 3DDOA 3J7ZI 2PEXA 1OZHA 3FGOA 4DSNA 1Z82A 3CX4A 2XPWA 3EXIB 3R24A 4Q1FA 3FTPA 4NCJA 2ZPAA 3BXPA 4ETMA 4ENTA 4M76B 1LRKA 3JZMA 4V39A 3CVVA 1IXCA 1MPXA 2J87A 3IPCA 2L54A 1ETYA 4MW4A 10MHA 4FTHA 5FLXZ 1B72A 2J30A 5CA1F 4PC2A 4TX1A 1NNSA 4IDPA 2P8SA 3SNHA 5K6TA 4QRDA 5FTJA 4TLCA 1HE1C 2X40A 2NS0A 4DZPA 1QHIA 1NUSA 1VQ9I 2XUKA 3QY9A 1AY0A 4UZEA 4R7ZA 3KZOA 2ET6A 2C2ZA 3IJ5A 4RZHA 1YFZA 2XA2A 3TOCA 3K9FC 1LW6E 1EVKA 1Z3XA 2HNBA 4B7XA 5KPJA 3BZWA 5A9SA 3WWDA 3PKJA 3ZIAA 1YUNA 2RHHA 2CNOA 4NLLA 4M0CA 1M5RA 1G3TA 4MQ4A 4A5MA 5DHQA 3KP4A 3RIRA 5IDWA 1MGOA 1SD2A 2HHCA 4NFLA 2QRMA 3VO8A 2OV4A 3EEOA 1ZINA 3PQCA 1PGOA 1QANA 2G1AA 1O77A 2ZI7A 4TMWA 1I3NA 4K1LA 3B8EA 2VJOA 4R2XA 2EF1A 1FBUA 3A7DA 3LPNA 4P7BA 4B6OA 4DREA 4QG7A 1T0FC 1DJOA 2XZOA 4LJ9A 2HU2A 1G4AE 2FOXA 2R79A 1G55A 5B1SA 2VPPA 1R4AA 1KEPA 5KJ6A 4PNEA 3WKEA 5CDHA 2QMYA 3HZOA 4I6JA 2CFSA 3TG2A 1O94C 5JQWA 2NN3C 4EJUA 4G4GA 3O8NA 5AJHA 1Y3FE 4OSOA 4RAYA 4LI3X 1VJTA 5AKXA 3VOSA 3TP0A 5CK4A 1XNHA 3KDSE 3K31A 4L6CA 3U7FB 1JNXX 1PEAA 4A3MJ 3GRYA 4HFMA 2FDCA 1N2EA 3EC7A 3I1JA 2ZRPA 4HGZA 3DTVA 4NBRA 4M3BA 2BYVE 1VBNA 1RIFA 2FLKA 3S2DJ 4ZYUA 1WCIB 4G9BA 1RP7A 5KKNB 3C39A 1YK0A 4OU4A 3AYZB 5I7UA 1FLDA 3MFQA 4ZVQA 1R1TA 3KZYA 2W24A 4XORA 1AXEA 1FZPB 1W5AA 2XAFA 1IBKB 4NZYA 3BWYA 3CVJA 1HUQA 5JAOA 1XJWA 3N8DA 4O3MA 3ZHVA 5EIHA 2WLSA 3ETLA 3KHUA 4X44A 4CNQA 2FA5A 4ATNA 1DIRA 3HYCA 2JAPA 3KP5A 5EI5A 4PSKA 1IG3A 3TGPA 4MQ9F 3F6OA 1S6YA 2CYAA 3LOQA 4QXMA 2IGOA 3F3XA 3DHVA 4LC1A 3SZLA 1NRXA 3WSTA 1BWPA 1FFEA 3DCYA 4TS1A 5HTKA 3MT0A 3DEUA 5KOJB 1Z7UA 2WG1A 2IL1A 4JJIA 1O57A 2FEPA 4PCLA 4L8LA 5EJ9A 3LHSA 3UB4A 5BT9A 3AO0B 1RMYA 4QXRA 1NPDA 3DPIA 3K73O 1U8CB 1P77A 4YRLA 1G59A 3CJQA 3IEUA 2BUCA 1EH6A 2AZ4A 2AFRA 4NNOA 4MGZR 3CH6A 2SCUA 4L5CA 3C6YA 3TL4X 5FLXA 3KIPA 2NYUA 2NO0A 1OLUA 2HMWA 1XQ1A 2O2XA 2VVTA 4YJKA 1TM7E 1PF7E 1IFXA 2JRLA 2R8EA 3B3GA 1OUMA 5ADVA 2FOLA 1S2NA 2XOKD 3WYDA 4N5DA 4Z4IA 2L9NA 4D6XA 1RVDA 2CU7A 2EERA 1ACMA 4AXXA 4J0QA 1YACA 3I5MA 3I9LA 2AQHA 2RMKA 3MD0A 5DN6D 3KZ1E 1JFSA 3P9QA 1CQXA 3M3HA 4AYTA 4ASNA 2OFFA 5EIAA 3G82C 3TIIA 4P81A 2LKCA 2IEIA 2NV6A 1EF4A 1IUKA 2OBNA 5CQGA 2AHOA 3GLLA 5TF0A 3MMZA 4FDLA 1CRQA 1MF7A 4BVKA 4L9TA 3DLHA 4RO0A 4DQKA 4CMIA 1NYRA 2HEIA 2PV7A 2WKRA 2P6SA 4QPJC 1LBQA 2GZDA 2IEYA 2I6FA 1BGWA 4E03A 2A59A 3BQNB 1A9TA 4J00A 3P9IA 1VJRA 3ELDA 3H16A 3ECHA 4H1UA 4RCZA 3U4CA 2YXBA 2DAPA 3HSSA 1KO4A 1I7PA 2GTPA 1YHQI 1E5QA 4C4YA 1N6IA 1VLLA 4WRRA 3IQFA 3ONDA 4I4CA 3RIHA 3HDVA 3LHKA 4UHFA 3HVIA 2EJRA 2B0LA 2K86A 2CYBA 3L2UA 5LJLA 2IT0A 2P9HA 3HB4X 3BN3A 1L4UA 4KIUA 4Q82A 2AZTA 4RFVA 2DQKA 1EZZA 5A2QA 2AO9A 1M76A 4A2QA 1ERDA 3OPYI 4B31A 1DXOA 4BP8A 3LCVB 3WYEA 1RLMA 1SKQA 2COMA 2CDNA 3EC1A 4PEVA 4ZVNA 1B6GA 3T9EA 4ALNA 4D9GA 3ROEA 2P90A 5HKBA 2IXBA 1J4AA 2BKVA 2OGTA 5EMJA 4CF6A 4AY6A 1OV4A 4REQB 3HZRA 3IUSA 3K6KA 4URVR 4NAUA 5KTMA 4LITA 4KXXA 4YR9A 3N8NA 5DI9A 3EGXB 4JT8A 2OTCA 4S2UA 4UE3S 2X2EA 4IQ0A 2VN8A 4F5DA 1WJ5A 1L5RA 2V97A 1YR8A 4FWBA 4HQLA 4JB0A 2JJYA 5DM4A 4EWLA 4X91A 3F8CA 2X6QA 4HOBA 4HGPA 5JEEA 2JVKA 2N1MA 3BIOA 1AHPA 2KI5A 3KEGA 5IVIA 3OZAA 4LZLA 3WB9A 3X43A 4C07A 3IP7A 4GS5A 3LTEA 4QWQA 4NCKA 3NNSA 5EAIA 3IUOA 4QBTA 4K9PA 1NTCA 2YRFA 1RWBA 2QTZA 3ER6A 3GEMA 3HB5X 2R8RA 3P8ZA 4UM9B 4KRYA 2FOWA 1M6WA 2EG5A 1LTHR 3BE6A 3BHIA 1IZ9A 2C82A 4KXUA 5AI4A 4CIDA 4DLXA 4EVQA 3PT5A 2DJ5A 3CE6A 4LHWA 5AI8A 5CQEA 1IWBB 2CEAA 2JIZD 4JU8A 1E1RA 2ZVJA 3WTYC 4RA9A 4BPRA 3E2IA 4HAVA 4AMGA 4ZYYA 2CFTA 5IPFA 1EFKA 1U1FA 5TVGA 1LFAA 1B4DA 1UODA 2JPBA 2PCJA 2C59A 2EFJA 4QEDA 1E1QA 1UWVA 2ENUA 4Q4AA 2C5AA 2V58A 2ZWOA 3HOXJ 2RCNA 2WQZA 2NZJA 1JIJA 4E7IA 5E7QA 4D3YA 3U19A 4FGWA 1O3RA 4MVJD 1WNFA 4M6XA 1SIOA 5AUPB 5FOXA 5BNZA 5EG0B 4E22A 4ZYVA 4UBLA 3TI7A 5BSGA 1NMXA 1PE0A 2REBA 4H27A 4JQYA 3A6JA 2D7DA 1JDBB 2VBGA 3DT8A 2PMEA 2A92A 5GTHC 5A5VA 2CQQA 1NG6A 3I59B 2Y6UA 1WZUA 1VHQA 1Y33E 1U5CA 2X6XA 3IP3A 4QLAA 3TL2A 4TLBA 1T36B 3TAHA 3VR5A 1C5KA 3NKFA 4TWBA 2D0IA 3KEMA 3O90A 1I0ZA 1D7AA 2FWPA 4MGKR 4HUTA 3E5MA 2D13A 4OIMA 2HJSA 2EWVA 4MS4B 1LQTA 2JRMA 3IHUA 3AI3A 4WK0B 3W1EA 3ZK8A 2IHUA 3VH3A 1P45A 2EW1A 4MQUA 3ND8A 3AUTA 3E2PA 1V9CA 4MGEA 4D43A 2ECQA 4QOHA 3ELWA 4DLNA 2JLXA 4NQRA 1WP9A 4DILA 3IVMA 3QBTA 5BYJA 2QL9A 3ZIAD 4CV2A 4DTIA 2ZRIA 1JUMA 1LB1B 4ZK6A 5L40A 1U3WA 5AVKA 3FWPA 4HH3C 4RY0A 1II8A 2F5FA 1JX6A 3RKWA 2A86A 1JPVA 4AECA 1PAUA 4D0LB 5IJ0B 3C6MA 2IBSA 2JK1A 2Q0OA 4BEWA 2CUNA 1UDCA 1Z88A 2APJA 4RZIA 3U80A 2CWDA 4ZT5A 5HGXA 2KRHA 1ITZA 5MN5A 4ZWNA 2EBHX 5FL7A 3CEJA 1DB3A 1MUUA 4KOEC 2X14A 1E6UA 4KR0A 2QNRA 4QNMA 1JQLB 1Y9JA 2SNIE 4FKZA 3W7AA 1SBZA 1WULS 1AURA 2BBSA 3CVOA 4Z9AA 3X2FA 1T3GA 4DEVA 1KYZA 5LBTA 1W0UA 4KAXA 3AINA 4A8JC 1EXVA 3QGMA 4I5GA 3ROKA 4CCAA 2WIJA 1V43A 4YJ2B 4P2GA 4KFSA 5K8IA 1ZGGA 4JWTA 3S2UA 4DNFA 5F27A 1SBCA 3CW8X 5F08A 4BY7J 3PJGA 4IIHA 3UPDA 4UNRA 4OB7A 1ZPDA 5CA1A 3PLAE 1DLJA 2I5UA 3K9CA 1U1EA 3BMOB 3W6NA 3ZU4A 3MIZA 2OPTA 1GNVA 3E58A 3C85A 4QARA 3ZMSA 4QUIA 4UJ5A 2G82A 1QQAA 1F0NA 4G36A 5KCMA 4KDPA 4U7GA 5D87A 3VSBA 3UJ9A 1D4AA 3ORRA 4FC7A 3Q12A 2NNNA 1YJ9I 3GTMJ 3M9AA 4ZV4A 1I3OA 4J43A 3T7IA 4DA0A 4NI5A 4GI5A 2FPOA 3W5DA 1F3OA 4KRXA 3U5ZB 3RIXA 2LP0A 2JLAA 2GPAA 2P35A 1JIVA 4FMCB 2NRAC 4BCCA 2IZZA 2PUAA 3WNCA 4LKRA 1XSVA 1I3KA 3TTUA 1DWQA 3ZW9A 1OWOA 3HSRA 1OU0A 1V55H 3VO9A 2A1UB 2EKBA 4D3SA 5K3AA 3T35A 1MHTA 4A16A 3ZMUA 4BGDA 1PS9A 1U4OA 2JEZA 2HBZA 3TMKA 4NCBA 1C50A 3SQDA 3G49A 3MZ0A 4RJIA 4PGHA 4D8VA 5AVQA 2VBXA 2Z8ZA 4MDHA 2EX1A 1DXYA 1OWPA 4O2LA 4QUDA 2D2FA 2J4DA 1WI9A 2PMBA 1SUCA 1WJGA 4I5EA 2KKOA 3HJEA 3DBHB 1NC1A 3JQFC 3L0SA 4I1RA 4JBIA 4FXPA 4W6QA 5E9WA 3RRYA 2VJPA 2JA6J 4FISA 2P6PA 1NFQA 1E0SA 1OSNA 2VHQA 3FJ1A 3PDWA 4FBMA 2Q2EB 3RS4A 1PFGA 4QYTA 4HGYA 1E3QA 2CLIB 1Q1EA 1KYYA 3JRAA 3EBLA 3TVYA 1G16A 4U88A 2GGSA 1UEIA 1KZ6A 1X8KA 2VF7A 5DGCA 4AN1A 1Z1DA 1TJNA 2BY2A 2G6TA 2Z16A 1KI3A 2DU8A 1S3FA 4HBLA 1Z7YA 2AZDA 3CP2A 1X7YB 2J9FA 1YO5C 2WWHA 2CFCA 3QG5A 4BGIA 2ZROA 1M8KA 1OI3A 1VL0A 2O1XA 4BZXA 1UBJS 4HVLA 4P31A 5TE9A 1KNXA 3TPZA 1UQTA 5TY0A 4YAEA 1HQKA 5HLGA 1SD7A 3ACBA 4ZOCA 4BO5A 3DTKA 2GAIA 2GF2A 2P11A 3D54D 4KVAA 5EQDA 3VR4A 1UZNA 5LQJA 2GFHA 2YWRA 4I81A 5I8ZA 3HUUA 4OI4A 3SXJA 1T6SA 4A0QA 5J58A 4GR4A 3D0KA 4IWYA 5CTJA 4YAGA 2R66A 3GY0A 1J75A 2HTEA 3NKVA 3PDIA 4H4CA 4AURA 3ICEA 3WGJA 1GLNA 4CLXA 2IW5A 2JJ2A 4WKOA 3D3EA 4MVYA 1H8AC 1USVA 1ZUD1 4GDMA 4PO9A 4Y2GA 5ISMA 3P20A 1COWD 2O0KA 4PBTA 5AKEA 1P6RA 3FNBA 4NMHA 5EJ2A 2QN1A 2QQEA 5TGTA 3C3JA 2WF8A 4EPVA 4IL6C 1D3AA 1XZJA 4FASD 1VI5A 2F3QA 2Q3EA 5AXBA 3Q1KA 1W0KA 4EPXA 1WB6A 1K88A 2OHJA 3QVLA 1ZMTA 1SANA 4L5BA 2O0YA 3RYTC 1I80A 1X7YA 2J9FB 3EZ9A 4GOND 4F6CA 4QTYA 3U44B 3DB1A 3NAZA 1CUCA 2DI3A 2WVAA 4TOIA 4KPYA 2ZUEA 1UM9A 2FGJA 4FS8A 3IT3A 5SYAA 2RKWA 3LFUA 1ZJ6A 3H18A 1ULBA 1JPJA 4X93A 5FWNA 3STVA 3KOWA 4HDMA 4MKXA 2BFBA 2BGTA 2LD5A 4GP6A 4J9VA 4MO2A 4QAJA 2ZBKA 4RVFA 2HQ5A 4S1PA 3K0EA 4F21A 5HR5A 5LP6B 2BFCA 4UM8B 4WNAB 5KTTA 3PP8A 1SQGA 3DBHA 3IRVA 1C3VA 1IOVA 3H9CA 4FYWA 1VMEA 4WADA 5IT0A 4CL0A 1NW7A 3IE0A 4XQEA 4B84A 2DMQA 4KR7A 4LZZA 1LUJB 2OUMA 1MOPA 2Y2VA 5ESXA 5A0FA 5AVVA 1R6RA 1J8FA 2IPMA 3VSKA 3A3OA 4W63A 1SMTA 4P2BA 3D3KA 2CO5A 4WK8F 1Y3CE 4GVPA 4IDOA 4R9SA 3WTUC 3I5UA 1TU0A 2ZTVA 3GLFE 1C30B 1NVWQ 1S96A 2X13A 3IBFA 3OQJA 3CF4A 3SEQA 1DQPA 2DA1A 1PYOA 1Z5UA 3MWDB 2AQIA 3R4VA 3VYWA 3ZHUA 3GL9A 3C7AA 3MPUA 2YYYA 4IEJA 2AMLA 2ACJA 1TO2E 3HJAA 2CMHA 1Y9ZA 2KZGA 3G23A 2LGJA 1XVTA 2H0RA 3SJ7A 2JIQA 4AYXA 4CV0A 1YQTA 2NQTA 1UPBA 1B4AA 3G2BA 3BB1A 4X20B 2I71A 3FFXA 4BX3A 4ECAA 1UINA 2J5KA 3DDZX 3E3OA 2O8FB 3FNRA 1P62B 5CGQB 4G7ZF 4GX1A 1GPJA 2IITA 1ZRCA 2EJVA 3A6KA 1F06A 1E2KA 3MERA 1D4OA 4C4TA 1AU7A 1JDZA 3K2QA 2GYVA 5JSQA 2J0SA 3QWIA 2DW4A 3BG9A 4CYDA 2GFQA 2LLKA 1K3TA 1GTRA 3LVBA 2GTIA 3D7SA 4ISCA 1AQNA 2PWAA 4URWR 4KGXA 1USWA 1X1EA 2M2IA 2ZJYA 3QVXA 4K28A 3WTBA 5CKTA 3WYAA 3ZNQA 1YQ9A 4BRSA 3H3FA 4R2MA 3PRHA 3ROTA 2FLVA 1ZCZA 1U7PA 4AN4A 2E18A 3R1IA 4UAVA 4HF1A 2FR1A 3P0JA 1UZAA 2ID9A 5DW0A 1F7UA 1MR3F 5HOQA 1PNQA 4FQ8A 2OQGA 1IONA 4DBLC 4KQJA 3QKIA 3RRJA 4B3HA 1Z18A 3RC8A 4EUKA 1PQ4A 4D8XA 3E35A 3AW9A 4PYIA 3HU3A 1Z05A 4M7OA 4EF4A 3UMMA 2WMDA 1OCPA 2B34A 2ORYA 4EJSB 1G9XA 1RYDA 4ZALA 3DMTC 5IKEA 3TNLA 3KCQA 5L3CA 2JFNA 3I6QA 2LNDA 1K7CA 3L7DA 4YT8A 3D81A 4E5PA 3M33A 1G0NA 4JIGA 4PTZA 4KISA 2HA3A 3CCSI 1NZJA 4KUEA 1RYBA 3UANA 4HB0A 3KWLA 1XUOA 2W6MA 1HM5A 2ERCA 4OOEA 1R6UA 1GL6A 1K5DA 2Q0HA 3D3WA 1JXMA 4RZ3A 3EVTA 2K2QB 4KAAA 2XGEA 4UPDA 4N5NA 3HH8A 4D3FA 3AR5A 4WLUA 4Q3DA 5EG5A 1YZ3A 4MOWA 4URUR 5LD2C 3IPAA 1OA0A 1XQ9A 4UVIA 3NHYA 5JH7B 1T3ZA 3IOMA 5CCBA 1O6CA 1VLQA 4BNCA 2ZWAA 1J5XA 1NJ8A 2W58A 1YOBA 2HBYA 4N47A 3TN7A 4E0BA 5BSHA 3F74A 4JDPA 3LX5A 1G63A 3E53A 3ZGYA 1TUBA 4CL2A 3LGXA 2PGIA 2PT6A 3QX8A 3WLFA 3BL8A 2CYCA 1BFKA 3H6HA 3QLTA 2CXUA 4HEHA 4HXFB 4MH0R 5K45A 2IDMA 4F11A 4LJLA 1N9GB 2YMLA 2C4KA 5D3ZA 2JJMA 4H0CA 4CRWB 3TFOA 3A36A 3I71A 1JAZA 3PIDA 4DV3B 1ZGCA 3VU1A 2AEEA 2V6JA 4IMIB 1PEDA 1U7ZA 1YZYA 1U2GA 3CLRC 3HWX1 3V4GA 4KPFC 4U2BA 5F33A 4PSVA 2PMFA 4EKYA 1OOEA 1NXQA 1U0JA 5CNIA 2GLXA 2ZRGA 3WLKX 5CLGA 1ZNWA 2NTJA 2WR8A 3GW2A 2WUGA 3JTEA 3MF4A 3O4GA 4HZGA 4IOMA 5KDOA 4C3OB 3BVPA 1IOZA 3IAUA 5IZ4A 3TXAA 4FN5A 4M88A 2OR3A 5IC4A 1UBUS 4RPJA 2C94A 5HCUA 2DMTA 4X7BA 3DTIA 5CVIA 1M2FA 1QKKA 1S9DA 2J07A 2Y0EA 5ADHA 4PNPA 2GVNA 3V97A 4RVHA 3QF7A 3EEQA 1ZAYA 1JAHA 4UUBA 1TOAA 4LOKA 3L0OA 3WTCA 2MSWA 1NX9A 1V16B 2WNSA 3T7EA 3JRHA 4CYCB 3HP4A 2AWNA 3BSWA 4XOPA 5FLXK 1S2GA 3WWCA 1PNTA 4JITA 3W5SA 4Q37A 1XRRA 1JUPA 3VU0A 3W6OA 2I2WA 3CUUA 4DT1B 1FMVA 3PC6A 1WHSB 3E9DA 3K9GA 3OQNA 4F8EA 2YIDA 2L7ZA 2YFHA 3U48A 3K4CA 1NY6A 3KUDA 1OISA 2I34A 3LUFA 3RFFA 3SFIA 2MC3A 2ZIWB 3OS2A 2FETA 3HKEB 2J3JA 2W84A 4P32A 5ARCA 3GFMA 3TSWA 1MOSA 1WB5A 2R48A 3HBMA 4E5YA 4MUJA 5I7SA 3OU6A 2AOXA 3NTRA 2I6XA 1WJDA 2C8VA 3V1MA 1YKSA 2HU7A 2ZUVA 2GJ8A 2WJVA 1JR3D 3C70A 1XMJA 1SVIA 4H59A 4NU0A 4Y1RB 4LK1F 4M74A 1BHSA 1LQ1A 5DT9A 3DU5A 3T4PA 5LMZA 1BX0A 4O5OA 4RJ2A 3UHAA 4C7XA 4GZ5A 3I8OA 1V5FA 1OGJA 1K7EB 1U8AA 3VR3D 1WZEA 3L5OA 5HCIA 1QV7A 2PD3A 2YINC 3TZQA 3ZE7A 1EP3B 4E3ZA 3BTUA 3THYB 3HA7A 5L3SA 1B1CA 4NE2A 4RM2A 3K1JA 4I50F 5TGDA 2DAOA 4DDUA 2CV0A 1SQSA 3KVNA 2X0LA 1ESDA 1B16A 1X15A 4UHJA 2E5FA 4A92A 1ZK1A 3OFVA 4B85A 5L8VA 4TYWA 2PUDA 5C37A 5KSOA 1UT6A 4OYRA 1BJAA 4YAJA 5ALWA 5MN6A 3V8QA 1FSFA 1M2EA 2HTSA 1UPXA 2AHQA 1Z6GA 2P1DA 3AVPA 3FYDA 5CVRA 2CLEB 2GPBA 1GV5A 2P9JA 4A91A 2BJVA 4Y6SA 1C81A 4NULA 4Z4FA 1T2NA 4MS1A 4WLNA 3HCCA 5CEJA 2PWYA 3M1CA 1ZOSA 3F22A 2QSYA 1SHJA 3ETGA 2TECE 2XB6A 3DOIA 3N0XA 4JVSB 4AQYB 3H3ZA 3HBFA 3X1MA 2XPCA 3GUCA 5BMVF 3ZIDA 1MKYA 3IPLA 4WFKA 1MENA 1N2ZA 4INJA 3GJ8A 3FGZA 3M5DA 4OQ4A 3GA0A 1CEQA 3ZMZA 5BS6A 2HA4A 3K6RA 1VJ0A 2I76A 1J8QA 1EP2B 3C7DB 2IWRA 4YX9A 3B7GA 4N3GA 1C9MA 2QLTA 5A5EA 2H2FA 2XF2A 3UZUA 4C76A 1M8JA 4E70A 4P5EA 4J8PA 3RR2A 2WAFA 3N97A 1KBZA 2XA9A 5FNVF 3EVFA 1AIPA 2JSCA 1FYDA 1AUVA 1V8DA 4C3VA 3RIGA 1D2RA 1GVJA 1EFPB 5FBQB 4FS3A 4UUPA 4RVGA 3DC7A 2EFQA 5ILUA 1NZDA 3BEOA 2BGLA 3DW3X 3GLSA 4QIWN 4D1QA 1MC8A 4EATA 1ZD1A 2HYFA 2I3BA 2GLOA 2OCDA 3TSCA 3WGUA 1PD1A 2IQIA 1YRNB 1M2NA 4RMIA 4MGIR 1VJ1A 3OWHA 5CHEA 5TS2A 1CR4A 3WKDA 3L7LA 1U7OA 5IUJC 3ZLTA 2R1UA 4IFIA 1KMQA 2R751 2CW0F 4YG2F 3AF1A 3EK2A 4A2UA 3PUJA 2FYTA 3HPQA 4NZMA 4KNWA 4UU1A 4F5YA 2R7VA 4YJFA 4Z1OA 1Z63A 3BQZA 5GOZA 2CLOB 3LDGA 4DFDA 1FQOA 1XYYA 3FG9A 4WASA 2Q1TA 2HDCA 1X58A 1GGJA 1MRSA 1G60A 3FVTA 4IS3A 2Q7OE 4BNKA 3K09C 3LT2A 4NPAA 5HUHA 3Q8MA 3QXHA 2JFGA 2W2KA 5ABPA 5JT1A 2JGFA 4AUXA 1GWNA 1DUXC 1O9GA 1Q2XA 3ADDA 2P4SA 3TLXA 4EGQA 3KQYA 1SD6A 4EFDA 1TW3A 3SZTA 4GQAA 4YJHA 1JHPA 1S8OA 1YU9A 3KQUA 4QXPA 4XRGA 4NOKA 3RVJA 4IXMA 4MA4A 4NYJR 3CN9A 3JQAB 3ZRGA 1OPRA 2C42A 4HBZA 3ZWCA 4DY6A 5BV0A 4GZLA 3CLKA 5L7WA 5FWYB 2I9PA 4RDCA 2PKYX 4D4GA 2QLZA 1ODFA 3WLAA 4CM8A 1J5EB 4WXRA 1S2MA 1GUDA 1YULA 2HBQA 4LTNA 3QPLA 2YUIA 5LXTF 4CKYA 1H2YA 5IARA 4NWIA 3OIWA 4ODIA 4RHUA 3VC7A 3MT7A 3VMFA 3DQPA 1DHTA 1RC8A 2CHFA 2LYCA 1UC4B 4WCFB 5DXAA 4BASA 3KYDA 2HDWA 1I14A 5DTIA 3VR3A 1DKNA 1MQ9A 4G67A 4HPXB 1KR2A 1O5TA 2HXGA 2D2IA 5ESDA 1G19A 5JE8A 3BCBA 3JCZA 3FE2A 2VKDA 1X77A 3LLSA 2JPDA 4BWVA 2CNKA 4NBVA 5K0CA 4KAFA 2WJYA 1T0PA 3PHGA 3S27A 4JI8B 3VKGA 2CMGA 2GJKA 1NQ5A 1P5HA 2AFIA 4Y30A 4D8WA 2AWOA 5G4KA 3R5JA 1M34B 4HNTA 1Z47A 2IVZA 4LGVA 1LSJA 1JSXA 4XRSG 5FBLB 1VKZA 3PX2A 3ADKA 4IOJA 4FKBA 3GHHA 4WWCA 1SEUA 3K4LA 4V3BA 4IIUA 3BK2A 3CFYA 3JAMK 2XXBA 1NF2A 4MO7A 3BRQA 2WSBA 5CVJA 3LXUX 1K2WA 2CC2A 3D2AA 2Z1DA 3LYHA 5L7TA 1U0BB 1RBQA 2F1HA 4G1CA 1YNOA 1M5UA 4H7IA 4ZXPA 5A1JA 5ADWA 2Q3MA 3H36A 1KEUA 2E85A 2NPIA 3BXGA 1NOIA 2R7DA 2BKUA 4TZ0A 1DIAA 3NUQA 1KDRA 1MH1A 2IYRA 3GMSA 4FFVA 1HT1E 1X9GA 1H1LA 1FU8A 3OESA 3F7OA 4BEBA 5FDFA 1ZUIA 3KP1A 1JIIA 2LSOA 2FW8A 1YRLA 1OB2A 3EXG1 2L2QA 1Q19A 1RP1A 4W7IA 4DW6A 1P4SA 3H2IA 3GJ3A 4YECA 1CS4C 5JZ9A 3DZCA 5AR1A 3KLNA 4PU0A 1SBIA 1V95A 5FPQA 4DNQA 1YB6A 5FWXB 2D1RA 2DRIA 2EJUA 2GH1A 3MK31 3ZS9A 5L4NA 2HU8A 4UHTA 2COUA 2Z6UA 1PZXA 3RVDA 1QUFA 4D0RA 2GK7A 3O4RA 3SQXA 1B73A 1SCNE 1O03A 1XCPA 5GM1A 1WBDA 4LJRA 3U9GA 2OV1A 5CD1A 1V3FA 4H3KB 1R0ZA 1BVUA 1A27A 3TO9A 1HMPA 1LBEA 3EIHA 2QG6A 3MRVA 2I80A 5AXDA 5FBVB 4TSFA 5JXJA 1XPUA 4WXDA 4XGQA 2CJXA 2BEVB 2XBMA 3O03A 4R68A 4YONB 4DM7A 1IUOA 5DCLA 1A9YA 1MGTA 3RO7A 2LY9A 2QE7A 2V45A 4QEKA 2PUFA 3PF9A 3FDZA 1K8ZB 3MB8A 4UULA 1YW8A 5ES4B 4DR6B 2QTVA 1B8IB 1BXZA 4OP1A 3TNDA 1IY9A 4ZCMA 2NOGA 3QPHA 3VYRB 1JJFA 4IZZA 2ZQZA 4K3VA 4NJMB 5IAJA 3BEDA 3TPCA 4DLLA 2IT1A 2OCBA 1Q14A 1MBGA 3M83A 4IQ8A 4CG2A 3R77A 1RM4A 4CR7A 4BQIA 1QZTA 3FKSD 1J0EA 2C04A 3ZZUA 4LXTA 5LP6A 2F8SA 2GF0A 2FZGA 4QELA 4QQKA 5FF9A 2ONJA 3G2NA 2ZP1A 4CCMA 2PGDA 4P3KA 1RWWA 4RA9B 2ADUA 3W2GA 1BWSA 3EDMA 1DPRA 4WMLA 5DMXA 4B3BA 3CCJI 3WS7A 3H1TA 2V96A 3H8SA 1GU0A 1YTYA 1HRDA 1CS0B 2DTEA 3H9GA 2BC9A 5ALOA 3QHAA 2OSBA 1LWNA 2TMKA 2W6QA 4PX5A 5EEGA 2NUPB 4D8UA 1QQ5A 3E27A 1NNI1 3JTMA 4GP9A 3L0YA 4WOPA 4HN9A 4ER0A 1VMKA 1HNWB 4X1KA 1L1QA 5DWVA 1G4HA 5FD5A 3PWZA 1ZM3A 3IAM2 5E4FA 3JQAD 4NBLA 3FRJA 4ZC1A 3S4YA 2WBLC 4ADSG 2H4WA 4G25A 4C0SA 1QRRA 1O4WA 2W82A 5ALHA 1IQRA 3GNQA 1RZ3A 2QUBA 3HDTA 4RLSA 4EPTA 2EZTA 3H9EO 3TR5A 2BP7A 1YT5A 2ZJ6A 1R4NB 4G4SO 2R6HA 4REMA 3TZ6A 3FNGA 4RBNA 4CDMA 4OQDA 3ND5A 1B43A 4LTMA 3A4MA 4BFLA 4D46A 2ZR9A 3UK0A 4MI9A 3Q41A 2C31A 1U9IC 3D7KA 3F5FA 3PFGA 4MV0A 3CBQA 3S29A 2PKQP 1X1DA 1W5FA 2GRJA 3MMPA 1I39A 4P9NA 3V7WA 4BV3A 5CB6A 3U3ZA 4GL4A 5GVRA 4OJKA 4Q48A 1KH1A 3KK0A 1KF0A 2NUAB 3DAHA 3IB6A 1N77A 5A0TA 4YLEA 1Y80A 2P27A 3B6IA 1ITYA 3WNDA 4LFBB 1T0HB 3KZNA 2K3PA 4TL9A 3JAWA 3OPYB 2H8WA 1AE1A 2ZOSA 1Q0QA 4QDZA 2CLLB 4PG5A 4ZCIA 3KSRA 1J97A 2DQSA 5KJ1A 3LUCA 5CGZA 4YQZA 1R37A 4M1MA 4I01A 2DHEA 2I9KA 3VUEA 2FUCA 3DA8A 2OMEA 1LI4A 3ZNNA 1HBJA 3HRKA 4PFJA 3RVNA 1CQTA 2PVPA 1H3EA 4HZUB 3L1KA 3L8YA 4F3CA 2UUAB 1WXGA 4CL8A 2V3CC 3DWLE 1EX7A 5LGNA 1B9NA 3K53A 4PZLA 4EY4A 4O59O 3TRFA 3ED1A 4WFIA 3KBBA 3RSQA 2PKQO 3NV9A 4D8TA 2C7QA 1P3DA 1DADA 2BEUB 4LZOA 1SKYE 4JX5A 1UC5B 3LX8A 2EOAA 1PS8A 3FBNB 1SVKA 1ZEMA 5E9JA 1X74A 2YC2C 1M1NB 2JVIA 1XC5A 3I30X 1A97A 3VBEA 2RD2A 2HXSA 1GZHB 4NG4A 3UWDA 2H6BA 3Q72A 1O7LA 1U9NA 1ZRSA 2VTKA 4HQOA 1W85B 4RKFA 1JKIA 2PMUA 1H3FA 3V8VA 4W1RA 4TVSA 3LBHA 5JS8A 1EWYA 1YSCA 1BJRE 2IV7A 1WDWB 3BRSA 2VJNA 5JWRA 1LPSA 3OZFA 2GIVA 4LXXA 2GBGA 2DYKA 2M6KA 3SS8A 3VOBA 1KJQA 5AKJA 3SR4A 2GZSA 1E7MA 3KP2A 2XX3A 4LJSA 1VPLA 2NOJB 2GK3A 2G76A 2W0MA 6ADHA 4I55B 3HADA 2FK8A 1YXMA 3TSOA 3WDLA 2QL5A 3GPBA 1MB0A 3G9QA 2O5RA 2OCCH 3UR3C 1J8DA 2Q1XA 3RSOA 4GI1A 3CN7A 1KZ9A 1RABA 4BAUA 2GJ4A 3ZHSA 1UAYA 2WC1A 3OQHA 4QQ8A 3VAYA 1C29B 3EXG2 1PZHA 4UAUA 1H88C 1L5QA 2SKDA 3LRPA 3RYIA 3ZHYA 2NZVG 5EOVA 4Z6KA 5JFRA 1ODJA 1TAUA 4LDAA 4M7RA 3HL2A 3OEYA 2CXHA 2HOQA 3IDSA 4DIUA 1Z6ZA 1RYEA 2CNWD 1U6GA 1V9SA 4L9JA 1ZRNA 2HHHB 4NFYA 1E99A 4N5HX 2QZSA 2X0JA 4AF8A 2GCPA 1GTL1 2XB9A 4OHPA 1AA9A 1GG2A 2R97A 1HC7A 2Q9CA 3KOUA 3ZZMA 4HZFA 4DRXB 1SC6A 1VL5A 1E9SA 1LQ2A 1WCIA 4MV8A 2DECA 1U0LA 2ZRKA 3HO6A 4KO4S 2ZWMA 1WPKA 1A36A 1U9YA 2AJCA 1Y1SA 1E1YA 2VXZA 4XMYA 2E1RA 2PR7A 3AEZA 1VCIA 3EVGA 3MAGA 3PS9A 4KXWA 3WRXC 5KYWA 2XAJA 3OZSA 3QKSB 4EM1A 4JP8A 4EG4A 1U2WA 4B3XA 1THGA 5I4KA 1DO0A 3HYTA 3SIRA 4BQEA 3ORQA 1NW4A 2XMSA 3E4DA 2PKRA 2O8NA 4AULA 3T3DA 4IGFA 5AM5A 2WU1A 4QFBA 4RF2A 5T6MA 3UBMA 3C1DA 3PNYA 1RRKA 1W76A 4WLFA 5K7FA 3RS8A 3W4KA 2Y92A 4BCBA 4H9GA 2XGDA 2VDMB 2YXNA 3WTTC 2HI3A 2IP1A 3U7JA 1KJYA 4M8IA 3GRCA 3EBOA 2XDAA 2VLIA 3JAKA 1EBBA 1OZFA 1IH8A 4R8KA 4CGYA 1PEKE 1XZQA 3PDHA 3QODA 3BTOA 3MJ4A 3V1LA 1C1DA 2MW8A 1GSAA 1VP3A 2PLAA 3PI6A 2X3FA 4Q12A 5D01A 5CURA 4RPIA 4D9FA 4G1VA 4Z7NB 2YJGA 4HJRA 2FKAA 2TSYB 3ZWBA 2ZMEC 1MVOA 3IO3A 5BV2P 1DV1A 3ZY5A 2TDXA 2QD5A 2V7QD 2OV8A 2F48A 5F1OA 4D74A 2K27A 4XWYA 4YN3A 1J0CA 1XCMA 4W1QA 4Y2HA 4S1VA 3LVRE 3Q40A 4NPHA 4HQEA 1W75A 3L6UA 1ML3A 3DKVA 3RF7A 4TGLA 4DC9A 2NXNB 2GK6A 3L82B 2I33A 4S12A 2EINH 4YIKA 4MI3A 3WJ2A 1Q1BA 1SFUA 2ST1A 3K94A 5IOYA 4HX7A 4G8CA 1AA7A 1P3JA 3PRYA 5C0OE 3BJZA 3LA3A 4A6EA 1F14A 2VQHA 2JAXA 3DOUA 2V5AA 3DWFA 3N58A 3OQVA 4IS2A 3U3OA 5HWSA 5CBPB 2JLQA 3T3EA 6REQB 2HVQA 3BGWA 3WOVA 3CPSA 4EPYA 1XB2A 2RH5A 1O97D 2B8JA 1K7AA 2QSZA 4XQ0A 3ZBTA 5JHHB 2O6HA 2AG1A 4RVOA 1KU9A 3CZ6A 3H1EA 1JLMA 1KNQA 3IEKA 4ZGWA 3EGXA 8ADHA 4U6SA 4A82A 4OHCA 4ZHSA 2AA3A 2DBRA 2YASA 4J7CA 3PFYA 4I98B 1SNYA 3JRNA 4JNCA 1B8VA 4DKJA 2VP0A 4IF6A 1RWXA 1AB6A 1GNSA 4NBUA 3ZHCA 2M4KA 2HMVA 4LJ6A 5CAEB 1IRFA 4Z51A 2AMFA 1HX7A 1S8NA 2F2EA 2PH5A 3L0PA 4BJTA 1YI8A 3PFIA 5BSTA 2LTPA 1WSAA 1WXFA 3RHTA 4MYTA 3AVXA 1H6CA 4GICA 4P7GA 4JK3A 4UUOA 3A2KA 2HQRA 3BPXA 4RBOA 1YR7A 1Z2PX 3AB8A 3GEPA 3L77A 5CH3A 3TJRA 4A26A 5HKAA 3ESYA 1ZU4A 5K0TA 2JK3A 3RTAA 3MRXA 2H1FA 2ZXJA 2Z9BA 3HPGA 1KAEA 3PDCA 4LOIA 3FPHA 2CW5A 4UATA 3TTWA 2XB0X 3CC4I 2G06A 4IJVA 4KO1S 1YI1A 4AY5A 4ZMSA 4IAOA 4ABYA 3B5EA 2VIXA 2NU9B 3P9KA 3M34A 2A9JA 4QGBA 5IEBA 2MGQA 2A57A 3R4KA 4KPGA 5E9AA 2V9KA 3O1JC 5SICE 2Z2JA 2O7OA 3TLBA 1YR2A 5ICCA 1DZ3A 3GMDA 2PH3A 4B45A 3TMOA 1NVVR 3EDYA 3NHUA 1OPCA 4CWAA 5JJBA 1ZH5A 1ADFA 1RRVA 3LP8A 4GYWA 1SB8A 1IL0A 1ZK3A 2ONZA 1GGEA 4MIKA 3QFTA 3EFOA 3RU9A 3RWBA 2HX1A 1C9KA 1Q16A 5JV5A 2DVMA 2VQEB 1GGMA 5HHTA 1EE2A 3OTQA 5A4IS 3RHSA 3A1NA 3IRUA 4HYQA 3WLHA 1J1ZA 3OJ0A 1QYIA 3BQMB 5DCWA 1DP7P 3K2EA 1OROA 1T9BA 2W2MA 4J1NA 2NGRA 2JGIA 3K2BA 1PYGA 1RBYA 1DU4A 5ESRA 4QIHA 4U1RA 2ATXA 4CCLA 2EFCB 3CIFA 4YH1A 1UM8A 3W5UA 2WV1A 3CDLA 3LCRA 3RE1A 2ESHA 4RGBA 4XLLA 3RYHB 4EKNB 5JFOA 1TZKA 5F78A 2F4NA 2O05A 3IKTA 1IRZA 2VPYA 4FFSA 4GBED 5FTNA 4ZVUA 5FGMA 3AY3A 3RDPA 3MWFA 3ZCSA 1WL8A 2J32A 4FOOA 4PLPA 3ADCA 4DDVA 3EXFB 3OT5A 3T95A 4XR6A 2PDAA 3G5TA 3TW4A 5DSXA 1T3LA 1C0LA 2V7UA 1CQJA 5FOSA 4UB6C 3AONB 4AUNA 3BD6A 2RK6A 4IKPA 1QMGA 3CGGA 3WL7A 2VR1A 3GP8A 4CGZA 1U3FA 2GLUA 2Y0DA 3M6MD 2JGJA 4C2AA 2CV2A 4CLRB 4NZNA 1AHIA 1D0VA 4NMXB 3LIPA 2LR8A 2OQVA 4CG0A 1FZTA 1BO6A 4FB5A 2IAIA 1HCRA 1TJ4A 3M6LA 2WTUA 1F6BA 1IHPA 3ESCA 4KPUA 5SV2A 2Q0SA 2LCIA 3G1WA 1T1EA 3AHFA 4N82A 2G9NA 3AVWA 2WBMA 1DDGA 1SHUX 1Z7BA 2OC9A 4OO3A 3J80Z 1ORKA 2L17A 2L9VA 4QJIA 3RUIA 4BX0A 4R2HA 1EXNA 2GNOA 5AOVA 3V33A 1JBKA 4QGSA 5KJCA 4IHTA 3NQ41 5J6XA 1MJHA 4BACA 2EAUA 2AUTA 2GXQA 2Z6VA 3BKXA 2PRKA 2WAYA 3D1JA 3OZEA 2G4VA 2C3OA 5BQFA 1ZESA 2C7OA 1ON1A 3X1DA 2VK2A 3U9TA 1FDTA 5JSHA 4QOFA 1V6CA 4G7OF 2MYPA 4MDEA 3UYLA 1E9DA 1LCIA 2HHJA 4GAEA 3I0MA 3OU7A 4KK4A 3A27A 3ENKA 5REQB 2ZFWA 1W36D 1VYVA 4CF5A 2IYNA 2WTEA 2QRJA 1K66A 3WG7H 2VHUA 1TU4A 4Y33A 3SHWA 2RK4A 4MAFA 1NL3A 4IXTA 4C14A 2IYXA 4MWTA 4FLFA 4XIJA 4FFWA 4DM3A 1GU1A 4BLRA 3O3KA 3JTGA 2OU2A 1YJQA 3EASA 4GKAA 3LQKA 4Y9RA 1EK0A 1RJ9B 2E5ZA 2ZIXA 3FN4A 3LAWA 1YIJI 3K0CA 3HZZA 5B57C 3ETJA 4OU0A 3MG9A 3EIUA 3M2TA 3FOZA 2HRZA 4UVBA 5F2OA 5C5EA 1Z4NA 2ROQA 1MBHA 1V25A 1Y9AA 3EMBA 3PFBA 3SSAA 3UAVA 1RWKA 4JN6B 4RHXA 5AW0A 1I7DA 5GJCA 4AUEA 2XOKA 4C3HJ 1C7QA 3L84A 4X6XA 5EUCA 3FBIB 4JYKA 2EEPA 2O06A 4FP9A 2YZNA 3MCUA 3KSMA 4ZCLA 3UGQA 3AF3A 1A8PA 3FMOB 1TK2A 3WC4A 2J0EA 2FHSA 4B8YA 5LQNA 5MF6A 4M72A 1JGTA 2A14A 2NXJA 3MKLA 1CUZA 2PRZA 3NGXA 3FTNA 3IR7A 4QQRA 4J4TA 2B9EA 2VK8A 4RSRA 4BX8A 5CBPA 2YKGA 1YB1A 3QYAA 3T5BA 5HIMA 4J2TA 4P6VF 4EJFA 5LIPA 2BTQB 2ZFUA 3CCFA 1RYZA 3FAZA 1WB9A 1HDYA 4X0GA 2QW1A 3M2PA 1JEYA 3E8XA 1K75A 1WRBA 1NVEA 3Q3SA 2C5GA 2O2EA 5B3SH 2PH1A 1DHRA 3AU9A 3FCYA 4LLNA 1TO1E 3Q6MA 5K3CA 3TTYA 1V7ZA 3KQQA 3WWYA 4NPCA 2FZVA 3ZOKA 1KK2A 2WJ3A 4LRWA 1N6NA 4Q47A