4A6EA

Crystal structure of human n-acetylserotonin methyltransferase (asmt) in complex with sam and n-acetylserotonin
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
347
structure length
345
Chain Sequence
MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHGTELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDLSVFPLMCDLGGGAGALAKECMSLYPGCKITVFDIPEVVWTAKQHFSFEEQIDFQEGDFFKDPLPEADLYILARVLHDWADGKCSHLLERIYHTCKPGGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGFRDFQFKKTGAIYDAILARKGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords HYDROXYINDOLE O-METHYLTRANSFERASE
total genus 122
structure length 345
sequence length 347
ec nomenclature ec 2.1.1.4: Acetylserotonin O-methyltransferase.
pdb deposition date 2011-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF16864 Dimerisation2 Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4a6eA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4a6eA02
4R8HA 5JUWA 5GINE 2YUIA 3FM3A 5E9WA 1Z3CA 3TQSA 3FMRA 3FRIA 5DRTA 1U5TA 1NE2A 1HW1A 2XKPA 4XUDA 1X1CA 3LA3A 4CO8A 4AUKA 1IXSB 4XSZF 4LLNA 4P9UA 1FNNA 4U7BA 2IBTA 3L7WA 5ICGA 4QVKA 4A0ZA 1DPRA 2EA4A 3SSOA 2H1RA 2PG4A 3BOQA 1QBJA 3GYHX 2ISZA 4PIPA 3WU1B 2UYOA 4DNCA 1G4DA 5K0EA 4HOBA 3JAMZ 2C7RA 3SXYA 4UHTA 1ZG1A 2LD4A 2EJUA 1RJEA 1LEBA 1VIDA 3M8EA 3LCCA 4CWAA 3KP5A 2ADUA 5DPMA 3KHKA 3EMBA 1FT9A 3EGVA 2PY6A 1V4RA 4MQ9F 4G6DA 2STTA 2QYOA 5HIJA 5F64A 1ORHA 2HGCA 3FPHA 3DMHA 1FYLA 3W6KB 5LEJA 2XAFA 1IXCA 3CGGA 1FJXA 4RTNA 2RGVA 2UZ4A 2AR0A 1ZLJA 1S3JA 2GXBA 1SD5A 3LA2A 3HM2A 3OZTA 4U88A 2ISYA 4S05A 1MDMA 3OOPA 5DEQA 2PX8A 2I7CA 1Q0TA 4Q4ZF 4YUZA 2IFTA 4PONA 5D1NA 3OE4A 3SR4A 5CVRA 3KP6A 2MA3A 2UWMA 1XVAA 5MHTA 3TR6A 2R7FA 4HF0A 1ON1A 2BH2A 2QY6A 1O57A 4L9TA 3KETA 2FBKA 3DXZA 3RKYA 1O3SA 4IHTA 2K86A 3OE5A 3NVMB 2OU2A 1VE3A 1P1CA 5U4XA 4UXNA 5ERGB 4ZYEA 4RTQA 5E1ZB 1YQAA 4HG2A 4C08A 3VFZA 3TMAA 1ZHFA 2VS1A 4L5JA 5K0BA 2RQPA 4P7KA 1UHMA 4ENMA 1HKQA 1SD6A 2VBZA 1BI2A 2F8LA 3HA3A 4C05A 1XGSA 3H92A 1Z9CA 3Q9SA 2XVMA 4RV9A 4DQ2A 5HILA 2IH5A 4P7GA 2CG4A 2RC4A 3TM5A 3WODF 5HS9A 4OU0A 4X63A 2VP3A 3F22A 3EDPA 5IT9K 3EMDA 3OFKA 2F5FA 1KPGA 4U7DA 3QP5A 1F3LA 2ESHA 2YXEA 4HLYA 3OCJA 4PDKA 4F84A 4U7PB 5K01A 4NHJA 2F5DA 3UA3A 2LDUA 2IGTA 2ZJ2A 3G2PA 3FTEA 3LBFA 2O3FA 4HTFA 2IPQX 4GC9A 4MTDA 1W7PA 2O0LA 1N7JA 2ZW9A 4ER0A 3BGVA 3HCBA 1GVJA 2EJTA 2P7CB 3I53A 3V7RA 4GO1A 4DZRA 4HX4A 4A6DA 2NS0A 1NBHA 2ZCJA 3Q5FA 4O6JA 1XMKA 5DUKA 3GRVA 2OAZA 5LQNA 1E2XA 2K4MA 2DQLA 4OMZA 1SQFA 3R4KA 4UVAA 1EJ0A 1U8RA 5FO5A 4EJVA 2ZCWA 2UXXA 2OD5A 2IW5A 5E8GA 5GWXA 4AIJA 1FBSA 4MIKA 2HKOA 1PP7U 4MEXF 3LL7A 5CYVA 2AVDA 2O05A 2MH2A 3WTYC 5LQAA 1EG2A 3T7SA 3IC7A 1XXLA 4GOLD 3TFWA 2G7HA 4KW7A 4LD5A 2AN4A 1ZLKA 3HRUA 2K7LA 5LHGA 3F8CA 3HOSA 5LGTA 4KA4A 1WY7A 2ZBRA 3R61A 1K78B 2BYVE 2ZKZA 2JH9A 3WTUC 4QWQA 1BC7C 3R6TA 1AWCA 3HOTA 5BP7A 2Q2EA 1KU9A 3UJCA 3FMSA 4YV1A 5EIFA 1L3LA 2LNBA 4HX7A 1KR5A 2HDCA 2CW0F 1LJ9A 1XB4A 2UYHA 2XBMA 3EVBA 3RKXA 1VPTA 3KZZA 2W57A 1U3EM 3EUHA 1IXKA 4UVCA 2ZZNA 4QDKA 1X1DA 2XAHA 5G02A 3V8KA 2HTJA 2AS0A 1JG4A 5HDGA 4RB0A 3SFZA 2FBIA 1P92A 4YUVA 4OMYA 2F2EA 5IKMA 3Q9VA 2PBFA 4V0QA 5K5QA 1IRGA 1Y0UA 2XGXA 5CCBA 2P3LA 3DMFA 2C7QA 5FHQA 2EB7A 4RX1A 4N9HA 1PDNC 1FBUA 3LHDA 4PYJA 3BXOA 1DCTA 3KQOA 4HSGA 2MD5A 1WXWA 5LQKA 5HS7A 3UJ6A 1HNNA 4MWZA 3MFKA 3KLNA 4KN7X 5LGNA 2HOEA 3V8VA 4RVGA 2P3QA 3LPMA 1XSDA 3P97A 5CVEA 3KQQA 2IT0A 2O07A 2E5WA 3A27A 4UVBA 2CYYA 2HR3A 2M87A 4HDUA 3I59A 2H6BA 3M33A 3SZTA 1QAQA 1T38A 5DD8A 1Z05A 1MHTA 2XIGA 1XDZA 2BR4A 2VT2A 2HS5A 1B1BA 4I2OA 1WKMA 5LQUA 3C1DA 2P3OA 4R6WA 3B73A 2ZLBA 2HFHA 3M6XA 1B9NA 3G5LA 3HYIA 5DX0A 2VT3A 1F9NA 4GBED 2KJBA 3B7PA 3HCDA 3DULA 1YFHA 4FZVA 1MJFA 2JJQA 4M73A 4I0BA 2M8EA 1JTEA 1XCJA 4RTOA 3MZHA 4M6XA 2GAFA 1V39A 5CLSA 3RYRA 3UJ7A 3H3ZA 2VBXA 2FXAA 4IKPA 4EM0B 1NW3A 2LF8A 2QQ9A 5CD1A 1P4WA 4AVPA 1OKRA 2HNKA 4YV2A 2M30A 1RI1A 2CMGA 2BE5F 2ZBKA 2P8TA 2P6SA 1FLIA 5T64A 1LVAA 4FX4A 4DM3A 4X41A 1WG8A 3S68A 1OYWA 2O8XA 5KQRA 1ZN2A 2ORED 3M6UA 3CLOA 3WTZA 1D2CA 3CBGA 4IHSA 2XVAA 2EWNA 1ZREA 2QUFA 1STZA 4RAYA 3IV6A 2ELHA 3WGHA 1SVUA 4MQ4A 1FWZA 1KPIA 3LSTA 2ZIGA 4IVNA 2ERCA 3ERED 4EJWA 2FQ3A 3DOUA 3KP3A 3D5LA 2A3SA 4BP3A 1S7AA 4R79A 1B9MA 5DD4A 3G3ZA 2N47A 5E1BA 3TOAA 3C0KA 5F2KA 4ER5A 1INLA 5EEHA 5LEKA 2IDKA 2G71A 3BJAA 5EPEA 5DCFA 1K78A 3L2CA 2GB4A 4ER3A 5JI6A 3F3XA 3ZN1A 4MQVA 4OINF 3T7TA 3I5UA 3DPLC 5E2AA 3DXXA 4YUYA 2LKPA 5E9JA 4FX0A 4L0YB 3A25A 3GZ6A 1UWVA 1KU7A 2P35A 3IYLW 3OU7A 1SG9A 3G73A 2Z99A 2JSCA 2OZUA 2B2CA 4KVZA 4R8SA 3QOXA 2XRNA 1RJDA 3R0AA 3WTXC 3ZMTA 5DM2A 4P58A 5HIIA 4HGYA 3AWIA 1JHFA 5FFZA 2FK7A 1U5TB 4JQFA 1NV9A 2ZZKA 2EG5A 1IZ1A 2STWA 2WK1A 3ZMUA 2J5OA 3GO5A 4Y17A 4CTKA 1N2XA 2V1DA 3ZN0A 2PJPA 1O54A 4ESJA 3C6KA 3AXTA 4EQQA 5EMKA 2ZIFA 5EZQA 4DA4A 3GRZA 1USSA 3ORHA 1RI7A 5FWAA 2YX4A 2FMYA 3ECOA 1YFJA 2YSRA 3X0DA 3MAGA 2Z6UA 1I1GA 4RGXA 1R1UA 2VC1A 1F38A 3PT9A 1O9GA 2WC2A 2HYGD 2NNNA 1TW3A 5E20A 1M6EX 4DQ0A 1RUOA 2ZFUA 2G70A 1G3SA 2PFBA 2G8NA 5E1WA 3FXQA 5J6XA 3AJDA 1QGPA 3CUQA 3FTDA 2AOUB 4IRHA 2Y1WA 2DLLA 1WS6A 1TQPA 3BUSA 3NVKI 3ZMZA 2RVCA 4AD9A 1TPYA 3JWGA 5K5RA 5LHIA 4G9YA 1HKSA 3J81Z 3IHUA 1I5ZA 1KYZA 4C06A 2XYVA 3CJTA 2Q41A 5KK1A 4ASNA 1B59A 1RI4A 3I4PA 5DCMA 3PLAE 2XYQA 3FPGA 2FMLA 2PLYA 5CVIA 1TW2A 4EJOA 1UIRA 2IP2A 7MHTA 2VDUE 2ZVJA 1TQMA 3HHHA 1IRFA 5K0CA 4A5MA 3F21A 4R8RA 3LCVB 3E7PA 2LF7A 3REOA 4RGSA 4OX9Y 5CVVA 4HTFB 3N97A 3V8LA 5D4RA 1BOOA 1KU3A 4G56A 4S04A 1FSHA 3HVJA 2Y48A 4U0VA 3Q7EA 1LDKB 3ABTA 4QLCU 4EGYA 2GS9A 1CF7A 5L3DA 4MTLA 5D5XB 1YYVA 1BHJA 5L3CA 4OIRF 2PLWA 5K0JA 3BP8A 4I0AA 2NRAC 4PINA 4RYLA 3R0JA 1L9KA 4E2WA 1WSUA 3RODA 1C0WA 4OIOF 5D6EA 2CMHA 1W4MA 1VBFA 4K6MA 5EKXA 2GWRA 5FULA 1ZKDA 4L7VA 2WWYA 4PGGA 1W5SA 1IN7A 3DMGA 1DUXC 5DXAA 2Z6AA 1F1ZA 2UXNA 1R00A 3JWIA 1G6NA 3LAPA 2NXNA 3A26A 3KQTA 4C04A 1MJBA 2XASA 2V1XA 2FNAA 3FXRA 2OB2A 1RI5A 4LECA 2BV6A 4DCMA 3EETA 5CIYA 1KQ8A 4KRGA 4CXMA 2IA0A 3V7SA 2EA2A 2CGPA 4CZZA 2PN6A 3MCZA 3FUXA 1EV7A 1Z6RA 4GYGA 3FYCA 2ZWVA 5EMLA 2P41A 2HV9A 2RDPA 4L9JA 2FF4A 2QQAA 1LQ1A 3BWYA 4OBWA 3PX2A 4RVFA 4KDRA 1BM9A 3P9CA 1SQGA 3MAJA 3HNRA 5EHGA 3UJDA 3EEOA 4EM2A 1CGPA 4F7ZA 2H94A 5L3GA 4KDPA 2NP7A 1TLHB 4M7RA 3GFLA 4YUXA 3F8BA 1TNSA 3TLJA 3BJ6A 3V97A 3KQYA 4I01A 4YFNF 1YW9A 4UV8A 1LB2A 1G3TA 5D8LB 1RJGA 3CUOA 3A7DA 4PNEA 3ULQB 1R5HA 2Q8KA 4A0YA 4F86A 4E33A 5K0FA 2AOXA 3ER9A 1RI2A 3BWBA 3SM3A 3NQOA 3LDUA 4JK1X 3HVKA 3HRSA 3RI4A 3AY0A 3LA7A 4EVIA 4ESFA 3E5XA 4FT2A 2ACJA 1WQ2A 1LNWA 4Y13A 3NDIA 2YQZA 4ENJA 3CUQB 1JHHA 4LG1A 3QP6A 3F6VA 1R8XA 4OA5A 3S2WA 3T0IA 5E17F 3EVEA 3PX3A 3TM4A 1XGMA 4HA8A 4EKGA 4RSRA 2EFNA 4P55A 1XJ5A 2QENA 2P40A 3SHFA 1NKVA 4EKIA 2GQQA 4EK9A 2EV6A 3LECA 3KCCA 1L3BA 1KU2A 4DKJA 4QQNA 1AQJA 4BQAA 5H6RA 3E05A 1HW5A 1KQ9A 4HDVA 3SVZA 2PGXA 3HCEA 3LAJA 4GF5A 5KS2A 1MGTA 5HOQA 3MCTA 2RKHA 3VEPA 3BWMA 4C4AA 4H0NA 2ESRA 1IN5A 3U9GA 3LDGA 1YG2A 5GIOE 1YS6A 4RGUA 1AQIA 2ZIEA 4M6YA 3VC1A 1IY9A 3GFIA 4E2ZA 5BXYA 1AOYA 2KIUA 2VOPA 3FXUA 5E18F 4CDGA 2YPRA 5AIPA 4YMGA 2IA1A 4FGZA 3R6SA 2ADMA 3M8FA 3EVCA 1B6AA 3LKDA 1IM8A 3BJOA 2FYTA 1T2KA 2YVLA 3TGNA 5LSAA 5L3EA 1YIOA 3GVAA 4RGRA 1JSZA 2H00A 3LX6A 3RKWA 3G2MA 1SFUA 4HZFA 3ER8A 3R9XB 1NW6A 2JRTA 2PVCA 1J0RA 2Q0OA 3DF8A 5FA5A 2I62A 5D8KB 3DTNA 4XUEA 4KICA 2JT1A 1L1EA 3DKWA 2PWPA 4KYWA 4IPAA 3NDJA 3FPEA 4IF4A 3RIEA 5B1SA 5CVUA 3GRRA 1YZ3A 2QLZA 2GA9A 2QE6A 4E30A 2HZTA 2BZGA 1H9GA 3GXOA 2OPBA 3I64A 3LCUA 4F85A 2VBWA 2CWEA 2CFXA 4ZTBA 2P4WA 3COAC 5L3BA 1X19A 3EQLF 3PTAA 2PXCA 2B78A 1J7KA 3ANXA 3GFJA 5GP1A 3HCFA 1YFLA 2KJCA 1UB9A 4AIHA 4RVHA 3B89A 3C7JA 2CSOA 3K69A 3FRHA 4QPPA 3B3JA 3BROA 4M71A 4XSXF 2HTSA 3IHTA 4ER7A 1JTFA 1HXDA 2OO3A 5K8VA 3ME5A 4PYOA 3TQNA 1G3YA 5K0GA 2L4AA 2F5CA 2ZMEB 3DLCA 5DCMB 5KQSA 3LKZA 1J75A 2NP6A 2PT6A 3HSRA 5HDNA 1YZHA 2BGCA 4HYEA 4HH4A 3SZPA 4E32A 2JTVA 2HR1A 3FTFA 5E1OA 4EMSA 2OKCA 3KR9A 2IBSA 5EKUA 4EJTA 4FR0A 4PCAA 2Y0MA 2V9VA 1YTYA 5LQRA 3E3VA 3VOEA 4OIQF 4XRFA 3ZMSA 3EVZA 4C03A 3B02A 3IRQA 5C0OE 1SAXA 2O6GE 3D0SA 5FADA 4DCGA 1REPC 5LLQA 3QOWA 2WTEA 2MC3A 2IRFG 1QAMA 3HSEA 5K0LA 4R05A 2NYUA 4A5NA 2YXLA 2B0LA 1J2XA 3EEYA 1GXQA 3K6RA 1JG2A 3B3GA 4E70A 2QBYB 5E9QA 2R7DA 5DUIA 5ICFA 3NJRA 3LQRA 4KT5C 2NXEA 4DMGA 3SSMA 3UJ9A 4KMUX 3WGIA 1QANA 1RIOH 2BM9A 1MZBA 2AOUA 2AVNA 1OYYA 3OV8A 2M5WA 3F4KA 3VSEA 1HQCA 1S7OA 5BPIA 1G38A 2YX7A 4EQZA 1GHCA 3IKVA 2VDVE 3M6VA 3C3YA 4EJUA 3UFBA 2AOWA 3MQ2A 2DT5A 2AZTA 3ELKA 5H20A 3EGEA 1IN6A 5HOOA 4M9XA 1FYKA 1MJ9A 1E17A 3ROUA 5DV5A 5D5VB 2OZVA 4K2EA 1BC5A 5FQNA 2PXAA 4LFUA 1K7AA 4CGZA 2NNWB 3GWZA 5ERIA 2PV0A 3TOSA 3F8FA 3KFWX 2C7PA 1ON2A 3WSTA 4OA8A 3O31A 4PWYA 3G8AA 5KYGA 5GIPE 1SFEA 2XV4S 2PSSA 4Z2YA 3GF2A 1YUBA 2G9WA 4IRIA 3B5IA 4PYLA 1ZRCA 4RS8A 2L4MA 1R74A 1NW8A 4IXAA 5DM1A 1F5TA 1ZQ9A 4BAYA 3UBTA 4ER6A 3LBYA 1O3QA 1I27A 5CVDA 3U81A 1FX7A 4IV0A 3I71A 4GGGA 1RUNA 3OZSA 4M9ZA 1KQ0A 2P5KA 4XCXA 5DX8A 3ECHA 1O7LA 3MTIA 1XN7A 5K09A 1P4XA 4ZYDA 4E2XA 1R8YA 4CICA 3NEUA 4PGHA 3V7CA 3PFHA 2ZMEA 5LRRA 3FHZA 4YG2F 1FBQA 1U78A 1EH6A 3KPVA 2GA1A 3FUVA 3KR1A 3P71T 1I1NA 3LDFA 1OR8A 3NTVA 1W7PB 2A14A 1HMYA 4OQEA 2Z3YA 2XAGA 2DI3A 4GOND 2Z6QA 1O9HA 3VODA 3FZGA 3RYPA 3T0YA 5F1RA 4BP1A 3FZVA 2IA2A 4OOIA 4FS8A 3E6BA 2D45A 3HSFA 1A04A 4BHCA 4A6EA 5IT3A 3MGGA 4RWZA 3GO4A 1FPQA 3U1DA 5HVQC 1P6RA 3KEOA 4JXJA 4I98B 4RTSA 2NNYA 2A61A 3QAHA 3C18A 3GLXA 1L3CA 2JZYA 1T43A 4EGZA 3NMUF 4CXFA 3CKKA 3MQ0A 2ZTHA 4U0WA 2MBFA 2XAJA 2R6ZA 3I58A 1QNTA 2XAQA 4GEKA 2UYQA 3I59B 3UJAA 5ILVA 3SMQA 4KIGA 1EH8A 2OZ6A 3G88A 3KE2A 4IJAA 2A69F 2HEOA 4NECA 3DH0A 3GRUA 5EQJB 4CYDA 4BNCA 1W5TA 4HRAA 2FRHA 5CCXA 4LGWA 1ZGAA 2ZSUA 8MHTA 5K5OA 3G2OA 5A2QZ 3CTAA 3IEIA 2BBYA 1IXRC 2O03A 3A7EA 2ZWAA 3OZRA 3TKYA 1MJAA 5JR3A 1O3RA 2DO7A 3KR2A 3E6MA 1D2GA 2X4HA 4GOMD 3EGIA 1N7IA 5GM2A 2DTRA 3KPWA 1JE8A 4B8XA 4KN4X 1S8NA 3ZMDA 1V3FA 1XD7A 5LHHA 5DTMA 4GXOA 5BS6A 2VODA 3EVAA 2R3SA 5C9ZA 5ILUA 3DPTA 2YR2A 2WA2A 3GGDA 5HEKA 4AZVA 4O5VA 1EJ6A 5FD6A 3H2BA 3NWEA 2CWWA 1BN5A 4X60A 4YIIA 3L09A 1QAOA 3KEQA 3L00A 5E1XA 2VC0A 1JGSA 3V8JA 3R3HA 3JWJA 4R6XA 2H27A 1TQIA 4E2YA 4KIBA 1NV8A 4G6QA 4PYKA 1P91A 1D8KA 4ZZLA 3PQKA 2KIFA 2KRFA 3JW4A 4LMYA 3WTTC 1R58A 4L5IA 4LLLA 3BDDA 1YS7A 3CCFA 1SKMA 4U0YA 5CUQA 3TO9A 5FTWA 5AONA 1ONVA 4HLXA 3UZUA 5ILSA 3T8RA 4AZSA 2QRVA 4FSDA 4CTJA 1KHHA 2DULA 3J80Z 2DPDA 5CVJA 3MTEA 3IL2A 1R18A 1J9IA 1ZG3A 1WI9A 4D0PA 4O3MA 2LSOA 3O3KA 1H0MA 3TRKA 4PIMA 3P9KA 5D1HA 2OBPA 3JAMK 3P7NA 4WWCA 3HA5A 1R7JA 4N0BA 4IRGA 1R1VA 2PWYA 4LWPA 1XSXA 2JPBA 4HGZA 3D2LA 4AWXB 1SD7A 2DPUA 3GRYA 4ATNA 5HS8A 5FHRA 2V1UA 1D8JA 2CQKA 1NW5A 2ZBPA 4P7FA 1U5TC 3BWGA 1YF3A 3EYIA 4X1OA 3LFKA 5FUBA 5EVJA 4RB2C 4L18B 2PX5A 5LQCA 1I1SA 4RB1A 1AF7A 3DUWA 3ABUA 1ZYRF 5L3FA 1BKYA 2VOOA 4PZJA 3F8MA 1ZARA 5AIQA 1EQAA 2Z5UA 3M9AA 1WXXA 2E1NA 5EEGA 2VN2A 2IPXA 3BWCA 5EG5A 3TKAA 5K03A 2ZZMA 3TDZC 2K4JA 4MEYF 2G1PA 3GX4X 5KVAA 1I9GA 9MHTA 1Z7UA 3FX3A 3QV2A 1Y8CA 2VZ9A 2QBYA 2DFIA 5F2OA 3GDHA 1X3UA 2AOTB 5LRSA 1FP2A 1MKMA 1D3YA 2ONYA 3TO7A 1EH7A 3RW9A 4TV7A 3WG9A 2KKOA 4LK0F 3C3PA 1RJFA 3WE2A 2AS5F 3KQSA 4M72A 4FHTA 2O0YA 2EJRA 5P8WA 3UWPA 3SXJA 5GOZA 3IRRA 2NXJA 5EZSA 3IKTA 3G2QA 4CKEA 1BC8C 4Q48A 2YX1A 1LEAA 2XYRA 3BZBA 4LK1F 4ZZDA 1ZG5A 2W24A 4WVLA 3JSPA 4MGRA 2P7HA 3AAFA 2G7UA 3TDUC 2L01A 5EGSA 2DPMA 2W85A 4BXUA 4XLPF 1NW7A 2Y1XA 2Z33A 3I9FA 3FWEA 3CUQC 2ZNZA 2HYFA 3JTHA 4EV0A 1D5VA 1KGSA 2GH1A 2D1VA 3ML6A 3PQJA 2Y75A 3P9IA 1PJZA 3QOPA 1MDMB 3SGLA 3H3UA 1VQ1A 3DFGA 1X1AA 1WZNA 4ZYGA 2CO5A 5E8RA 2HQNA 4CKCA 3FYDA 4AIKA 3KR0A 1UCRA 3GIWA 1ODDA 2BR5A 1XCVA 4ENKA 1PUEE 2XUBA 3QRFF 4IWNA 3T7RA 2G72A 5CJ9A 2QWWA 5BMZA 2VXZA 4G7ZF 5KVRA 3RTRA 4HF2A 2FOKA 2EX4A 3O4FA 1WRJA 3KQWA 4IV8A 1ZRDA 5D5WB 3I54A 1G8SA 1P39A 2FPOA 3R0QA 4E31A 5T6BA 4FSXA 1UFMA 4CKBA 3QU3A 3G89A 3L9FA 3DXJF 2A5YB 5E8IA 5DYMA 1RZ4A 2AN5A 5K0NA 2W25A 4RTPA 5DLYA 3KU1A 1MD0A 1KYWA 2FBHA 1R5GA 3E97A 5EOVA 3RJPA 3UA4A 4BLUA 3HVIA 2FEZA 1Q0SA 3LGAA 4MNUA 4YFXF 2IDJA 4YMHA 4KWCA 3ELUA 2IIPA 3CO7C 4Y30A 3K1PA 3FF5A 1BBYA 1JXSA 4GQBA 3HTUA 4HC4A 1G6Q1 5H02A 5JVTA 3EPPA 4MHGA 1B42A 2K27A 4M9SA 2AOTA 4MTEA 3FUUA 1JR4A 3VYWA 2A07F 2ZFWA 2EV0A 5DX1A 2HQRA 1UHWA 4NQWA 2I6GA 4GUAA 5DSTA 1BI0A 2YXDA 5FFXA 1XGOA 4BY9E 1B4AA 3OU2A 5FCDA 4XBFA 1HBXG 4ZYHA 2V74B 4YIFA 1HSTA 1ZAOA 3G7UA 1ZH5A 3FUTA 2D1HA 1QZZA 3GW2A 3G5TA 4OIPF 3K0LA 4G7OF 2P6TA 3HCCA 5EHIA 4HAMA 1FP1D 4KNYA 2FU4A 2FNPA 4X61A 3DEUA 2M1BA 2QRVB 4AX8A 3O2PE 2JHPA 2EFWA 3O6BB 2PXXA 2FRXA 3THSA 3RPQA 2OB1A 5ICEA 3E23A 3DP7A 2H09A 3U2RA 3KPYA 4N9IA 2AOVA 3KPJA 3TPZA 1BI3A 5D6FA 4Y2HA 2XROA 1Q1HA 3WGGA 3P2EA 2PI0A 5DTQA 2XKOA 1VLMA 5M5BA 4LJZF 2C6YA 1WWXA 4WXCA 3GJYA 1Z6TA 4I7HA 3C6MA 5DWQA 3OPNA 1TBXA 2H6CA 3HHGA 5T67A 5EMMA 3T8TA 2V7EA 1QO0D 1JG3A 2DQRA 3JWHA 3HA7A 2BEOA 3PB3A 3KQMA 3KP4A 4GC5A 5K05A 3OU6A 1DP7P 4M74A 2GA2A 3V4GA 4Q47A 3F6OA 3E6DA 1FBNA 4YFKF 3FUWA 2RV8A 5LR6A 4P5OA 1YW8A 3BGDA 2QQBA 1J5YA 1SUIA 3JSOA 2O06A 3DV8A 2YTZA 3MWMA 4QPNA 1OYIA 3KQPA 4UNOA 3BT7A 2F5EA 5TRDA 1BIBA 2OQGA 1DUSA 1P2FA 3P2IA 4RTRA 3O7WA 3DLIA 2ZXJA 1EAMA 2P8JA 4LB5A 4BHBA 1JQ3A 2H11A 4WXDA 1G3WA 5JHUA 4HF1A 4P7JA 1TNTA 2K02A 1R36A 2EK5A 3K0BA 3ELYA 4M37A 1OMIA 2FSWA 1ORIA 2L3DA 1FSEA 3E5QA 4PYNA 2PEXA 2IH4A 3WTWC 1UFKA 2E7XA 3CJQA 2M45A 5DSXA 5K1YA 3NWBA 1H1DA 2RN7A 4KDCA 3CC8A 1JQEA 4B09A 3N4MA 1I4WA 2C7OA 1DPUA 1XTPA 5BW4A 1I6XA 5DXJA 4BHPA 2DBBA 5FQOA 4KUMA 1RI3A 4KIFA 1KXZA 3ZP5A 4L9NA 4M38A 3MZYA 3HRTA 5IT9Z 2K4BA 2QM3A 2O61A 2KW5A 3KKZA 1VP9A 4R1HA 3P9NA 5E1DA 2EV5A 4HW0A 4U7TB 4LWOA 5GM1A 4QQKA 2WV0A 3WU0A 1XDSA 10MHA 4PCLA 2B25A 1L0OC 2B9EA 1R23A 3EVFA 3EYYA 5DT2A 2IH2A 4XLNF 1DDNA 4L9VA 4I09A 1NBIA 2HKXA 2QVOA 1AV6A 4GCVA 3ID6C 3F23A 3RDIA 2ZULA 5DDGA 1USTA 3GCZA 5IH3A 1IW7F 5BW5A 4WXHA 2XHKA 1XCLA 3KP2A 2YU3A 3ZPLA 2GPYA 3FTCA 1HSJA 4MHTA 1CF7B 5DTRA 2P7IA 1U6GA 4NB5A 2GLUA 2MLGA 4YV0A 3K9TA 3J7AO 2HTEA 4PYIA 4V0RA 4AZTA 4RB3C 5EMJA 4A0XA 2NAZA 6PAXA 2BM8A 3MERA 3UJBA 3E6CC 4GOOD 3BGIA 1BOAA 2OXTA 4GYIA 2ONZA 2ZNYA 4KFCA 3L8DA 3GZ5A 3FMQA 5BPDA 5HLIA 1SFXA 4P9FA 5F2NA 1L3IA 2FCAA 1T6SA 2XVCA 2VBYA 1LDJA 2PBIA 3F72A 1M6YA 2PT9A 3GU3A 1RNLA 4HV5A 3KP7A 4LB6B 4RVDA 2DU9A 4OQDA 1VTNC 3P2KA 4PYMA 1K79A 2OQRA 4BH9A 2E7WA 4ETSA 2PKWA 4QTUB 1ULYA 3BKWA 4UV9A 4OBXA 5HZMA 2JPCA 2P1DA 1OPCA 3IWZA 1KA8A 2VONA 2V6CA 3PFGA 4LLGF 1O7FA 2D2WA 2L54A 1IN4A 2GZWA 2ZBQA 3NW9A 4QDJA 5E1MA 2WA1A 4RTMA 4HQEA 3QPTA 3RPUA 2PX4A 4Y15A 2NXCA 3K1MA 4HX8A 5E8JA 2DW4A 3JTGA 3HCAA 1ZRFA 1YO5C 3J80K 3PVCA 2EFOA 4M36A 3NRVA 3MB5A 4WK8F 5J8FA 5HIMA 5F6FA 3VB2A 1NT2A 5HLGA 3CJNA 1QQIA 3GUDA 3Q87B 5C1IA 4PYQA 3ELWA 1JSXA 2B3TA 4WX9A 1YW7A 3DQVC 5JFRA 5FLXK 1YLFA 2MLKA 4CHUA 5ED4A 1GXPA 4BLWA 1S29A 3DR5A 3M1EA 3WTSC 3BPVA 2UYCA 1XCBA 3BPXA 1IUYA 2JHAA 3HTSB 3ISPA 1FOKA 2P7VB 1PRYA 5HLHA 3A4TA 1BIAA 3AXSA 1SMTA 2JH8A 3R60A 2PJDA 3HVHA 3THRA 4LG0B 3C3WA 4P96A 2AXLA 2X0LA 1XGNA 2HMYB 3LWFA 3HRMA 2EFQA 2FHPA 4G7HF 1NHAA 5DM0A 2BR3A 5FGMA 1T0FA 2DK8A 4H0EA 4L0ZB 2JG3A 3PS9A 2J5PA 5BQTA 2VE9A 2DAOA 4A2UA 4Q5SF 5E2BA 3FPJA 3HP7A 2GXGA 3W6JB 1G55A 3EVGA 1ZGJA 5ICCA 2KIMA 3KZYA 1KP9A 3R24A 4AZWA 5HFJA 5A2QK 1LDDA 2QZ8A 4RTJA 1G8AA 4QVGA 2P5VA 3M70A 4QTTB 5FWDA 4G94A 3CVOA 2MH9A 4KMFA 1T39A 3SQNA 5FD5A 2IVMA 3J81K 1H9TA 1SMYF 2A6EF 1R22A 4I02A 3BKXA 2OYRA 1D2HA 1Z1DA 1R6AA 1DL5A 4YUWA 1R1TA 3E5UA 5BOXA 3QPHA 3IWFA 2L02A 3GEZA 1KPHA 4FT4A 5FB2A 4RTKA 2Z9OA 1FY7A 2PQ8A 3G8BA 3ERCA 3WTVC 1X1BA 1OR7A 2UZKA 1Z91A 2HWVA 3QU6A 2HWKA 2PMUA 2CL5A 3CO6C 3DXYA 3HEMA 1EIZA 2FK8A 1JQDA 2JHCA 3WE3A 1IF1A 2ZO4A 5H6QA 1XDUA 2VE8A 4ENNA 2FE3A 2O57A 5J8CA 2IJLA 3MHTA 2RNJA 4EM1A 3VC2A 1SUSA 4WF2A 5HDKA 1VL5A 3GFMA 4BYYA 2OY0A 4ISCA 4RTLA 5LBQA 4ESBA 4A12A 3F8NA 1O3TA 1P1BA 3HTXA 3SSNA 3M7GA 3KQVA 2ETHA 3TOBA 3K1NA 3RIRA 2V79A 3TO6A 2TDXA 3ZMVA 3M6WA 2P5LC 1P4AA 4O29A 4XUCA 4ZH4F 1M0EA 1W7PD 1U2ZA 3CDHA 4UOEA 3KLOA 1K6OA 3OFJA 2W84A 3SX0A 2VDWA 5FA8A 1SD4A 3HUGA 2GAUA 5DM4A 3UJ8A 5LQJA 2A68F 1BI1A 3HIFA 2DK5A 1YB2A 2EFPA 1IAWA 1BJAA 4DF3A 2A6HF 2OBFA 2I9KA 3T5XA 5D5UB 3CJRA 1G60A 2PX2A 4POOA 5HIKA 5DRYA 4UUVA 4PCQA 3EVDA 3E8SA 3KPUA 1KIAA 4HQMA 3B3FA 3ZQ7A 5LGUA 3MEXA 1VP3A 3I0TA 4LG0A 4C07A 5FLXZ 1TTYA 3BY6A 1XMAA 1QZYA 2AN3A 1HW2A 1JG1A 1XSVA 4BLVA 3LQQA 3BZ6A 1T98A 4JBAA 4HBLA 1FC3A 4G8XA 1U2WA 3K2ZA 1FYMA 5TJJA 2FA5A 1QYRA 5D4SA 3FPFA 2YR0A 3T1BA 1HKTA 4HV6A 2OA4A 3PFIA 2CKDA 5EIWA 2E1CA 4RAZA 2COMA 2PMHA 5CM2Z 4B17A 3P8ZA 2EFJA 2GIVA 1IN8A 1PP8F 3M4XA 5EC8A 1F4KA 4FP9A 4FT8A 2ESNA 3ELDA 3GNLA 4ON0A 4WCGA 3FM5A 1QPMA 2NYXA 1FZPB 1J59A 1S6LA
chains in the Genus database with same CATH superfamily
3RCOA 1DVRA 1NLFA 3AFNA 3FM3A 1NXVA 1TUBB 2FLWA 4C0WA 4QL3A 2M0CA 4R5MA 3VRHA 1Q7RA 5A06A 3TLGA 5JC8A 4M3EA 4QUJA 2OQ2A 1QP8A 4ZWNA 4ID3A 1C7JA 1P72A 3FMRA 2TYSB 2BGNA 3FRIA 3RANA 3TUIC 2AQFA 3UUWA 4MRPA 3DV2A 4MRAA 1SOAA 3MNFA 3KKPA 1WXFA 3DCYA 4K0RA 2WW8A 3ESDA 1VPDA 1X1CA 1QORA 3OLCX 4FMBB 5A9SA 4AUKA 4XSZF 2CUTA 3AESA 1WKVA 4P9UA 4NATA 1OWNA 4PICA 5K3EA 1EK5A 3AY3A 4U7BA 2Z57A 3U37A 2IBTA 2VRCA 1NUHA 1ZVJA 2WTXA 5DO9A 4AUEA 2AFIA 2XGMA 3L7IA 3AR3A 1NC3A 1TL7C 4A23A 1PYGA 3SSOA 1Q44A 4BIIA 2VZEA 3HCRA 4ZHQA 5T8KA 2B1IA 2H57A 2EIJH 1OXXK 3IELA 4NMLA 4B71A 3F9KA 5DZSA 2AYYA 1C14A 1DCMA 2ZTLA 3K53A 4PIPA 4BVKA 2X7XA 2FUEA 2UYOA 1E0JA 4CL8A 4HOBA 1MO4A 3IVAA 3ZYZA 3ZRGA 1Q22A 6YASA 3E22A 3MSXA 4GICA 5LYJF 1KIFA 2P9FA 1HDEA 4UHTA 2X0IA 3S14J 3AFGA 1E9RA 2DXIA 1VIDA 3RI3A 1XCGB 3UWKA 3V4FA 3L41A 5IK2A 4DWOA 2ADUA 4XDYA 2YMLA 3EGVA 1NI3A 3N0RA 3KXIA 2P6PA 4I5FA 2NMVA 3CCBA 4C6RA 1EI9A 1KL7A 1TZLA 3QW2A 5AUPB 2WSYB 3N05A 4BLPA 4X62B 2H5JA 4LJ7A 2QX8A 4OCZA 3MS7A 1VE1A 5K8IA 3T38A 4YO8A 3HDTA 1JFLA 1UT8A 4MVJG 4EAAA 2QGNA 1ZJ5A 5ALOA 1EGMB 3AF5A 1A9PA 3FPHA 1PUFA 4TROA 3WLTA 5KMGB 1IBKB 1FYLA 3W6KB 3E3OA 1NU8A 3O2SB 3QYPA 3I6IA 3G6WA 4JA0A 3EDCA 4UNSA 2AW5A 2F6CA 2R87A 2BWJA 3SJAA 1FJXA 1MB2A 1WBJB 1Y81A 2FSVC 2W2KA 4NNJA 1J97A 1S3JA 1V4NA 4RKYA 4ESHA 2OHVA 2NZ8A 5COQA 1ZWLA 5TT1A 3OEHD 5KQGA 4MDFA 1HC8A 1YDGA 2OG1A 3D02A 4U88A 2QVXX 3FHLA 3OZTA 4NAUA 1T25A 3UUGA 4XQCA 3U60B 1CNMA 2HIMA 2V65A 3AQIA 3DOEA 3HHPA 4MUBA 1MNAA 4CETA 4C0AC 5TQ2B 4Q4ZF 2HQBA 1Z3YA 3KP6A 1G3RA 4JBNA 2ZIXB 5EYPB 2QE7A 2GTHA 3IDSA 4F9GA 1KP3A 3VVLA 4TYMA 2R7FA 5FT9A 3PYXA 3GY0A 5EHIA 1G5RA 1Z5PA 2RBEA 3WKCA 1QFXA 1PG2A 1V3TA 3MXTA 5B7NA 1TM5E 5CDGA 5I7HA 1K8YB 4OXYA 5ALXA 4ACBA 4BVBA 1JHMA 4MQ5A 1O3SA 4E7ZA 4OM7A 4QXMA 2QXYA 4G5FA 2NT4A 1D2AA 3GZJA 4NHEA 3DZGA 3DT9A 2QLTA 3W5JA 5LOVF 3OO0A 3FNEA 3ZD7A 4JEHA 5ERGB 1UZLA 1QDEA 4CV1A 4ZYEA 2ZKLA 2QVYX 1EMDA 3ISTA 5KNBA 3QU9A 2P9TA 4UMFA 1IN1A 2E3JA 1RQRA 2V1NA 1H1TA 2XF2A 1OBFO 4OHBA 4Q00A 1AURA 1LPAB 3D43A 4C08A 4D4MA 1SXJA 3EPZA 3MWYW 2V3CC 3VFZA 2H08A 1ZHFA 2ODNA 3GRPA 4MUXA 4KPEC 4G0VA 4L5JA 3HYTA 2WB1A 3R0VA 4P7KA 5IFKA 4OGKA 2J9FA 2ZB4A 1HKUA 1EUCB 1HKQA 2IZ5A 1SD6A 2MOKA 2QSYA 2ZQYA 2ZS8A 3DZFA 3EZ7A 4M7RA 3OVMA 2F8LA 4KXVA 4QGSA 5L8VA 1ID8A 1KI6B 5ENZA 2MDTA 4LDRA 1MZPA 2ROQA 5JCJD 4FXPA 3LO8A 3Q9SA 4ZTJA 2XVMA 4DV5B 1J1IA 2ECOA 5HILA 4XA8A 4UBOA 1NNLA 1UK9A 2IH5A 3DE5X 1JJ7A 2IXSA 4HLDA 3RC7A 3U7QA 4E6KG 3V1NA 1KY3A 2CG4A 5KTNA 1X1QA 4GFBA 3T35A 3GUVA 1QHGA 3D7RA 5DI9A 3WODF 2PPLA 4NHOA 4OU0A 2CLEB 3FOFC 3LKVA 3ZHTA 2AE1A 2A9VA 1K8QA 1RC8A 3RFVA 3EMDA 2GN6A 1B26A 2AF4C 4TSFD 5G0SA 3QP5A 1F3LA 2ESHA 3DTYA 2RAFA 2Q7DA 4F55A 3INNA 1JN0A 3M2PA 2OHXA 1B1AA 3MM4A 4JL8A 2CV2A 3SM9A 4F84A 4U7PB 1SXHA 3F7TA 1U7UA 2P67A 4UVDA 2IHZA 3AC0A 3JARA 3IT2A 4S0XA 3K0EA 1V7QA 3G2PA 2CFRA 1K9VF 3FXKA 1TZ2A 2HDWA 3JQCA 3EVNA 3LBFA 4LMRA 3T9AA 4H6VA 3U26A 5FPQA 3UIEA 1EXWA 3QBJA 4YAUA 1RWXA 1H88C 2CE2X 2QP9X 3LWBA 3QJYA 2P4HX 3QVMA 3QKIA 4GC9A 3ZIAD 3LP8A 4M3NA 5C1BA 4WFQA 4HNAA 1TMKA 3Q3JB 4N5LA 7REQB 3T06B 3V7UA 1JALA 1UXOA 3EE6A 5HQJA 5FEUA 3NDBB 4INJA 3CQ9A 2CUJA 1VHLA 4E7KA 3LUPA 3S55A 2GO7A 5HE9A 4B6PA 4QTRA 3O93A 1QQTA 1B6RA 5A4DA 3EZFA 2XWBF 1VMEA 4EB3A 2Q49A 2IXDA 2G06A 3ZWMA 3P9ZA 5JYBA 2GM5A 4CLOA 4O6JA 1PX2A 1S8AA 1XMKA 2NYAA 3CPJB 3PEVA 4FFLA 5HFNA 1B1CA 4L07A 4CF5A 2Z1MA 3GEIA 4CT0A 5GZ1A 2HQ1A 4QHTA 4XVCA 2OAZA 5LQNA 1APBA 4CUGA 2V5VA 4MRRA 5JAMA 1E2XA 2K4MA 1L7XA 1SOVA 2P79A 2QVCA 3NB0A 4K88A 1UPAA 2V9KA 2QORA 4OMZA 4QJIA 1N8SA 4CMCA 3VOTA 1DKNA 1H69A 4PHGA 1VLJA 4J4BA 1EJ0A 1GU1A 5F04A 3C97A 4NMWA 1KO5A 2AFIB 2EFCB 4PC6A 1KMIY 3VU8A 4ZAWA 4MV1A 3DPUA 2ZCWA 4GZLA 5BW8A 1N1GA 5LMUB 3MJFA 4KIWA 1ZOPA 3HUTA 2WFLA 5JD5A 1T15A 2M2IA 2IW5A 3OE7A 4B8WA 2I8DA 4BRZA 4AIJA 4R2JA 1QGUA 5REQB 3K4BA 1ATIA 1PTJA 1ZH2A 1QZTA 2DPGA 2HLPA 3L0CA 4J2HA 2ZIZA 5LMZA 5IUJC 1KJYA 2OZEA 2ZPAA 1Z63A 2AVDA 3JALB 3PSAA 3WTYC 1SEUA 1Y4AE 4OK5A 5LBTA 3KCQA 3RTEA 1XRJA 3TW8B 2R7AA 5LQAA 2YKGA 5KYUB 5KU1A 1J9EA 2NUTA 2RHMA 3CDLA 1U1EA 3KAJA 2AG6A 4ZYVA 5JAZA 3AO0B 2G7HA 3B9BA 2FF7A 3E9CA 1ZD8A 3C85A 1KOFA 2P2DA 3KTAA 5EWLA 4ZEWA 1EXDA 3D7LA 4YXWA 3E4CA 1UOEA 3VR6H 5F3WB 3PIIA 3EQ9A 5EF6A 4B3AA 1N2GA 4A82A 5LGTA 1KZ9A 2AG8A 4LI3X 1NMQA 2IY9A 1Z8NA 4MGKR 4NPAA 3R61A 4TM8A 1YB5A 5F52A 4PFJA 4TSRA 3KAKA 4BCBA 2ZKZA 2YHSA 3O8DA 3WTUC 3EG9A 2QSJA 4BS9A 1A9YA 3C1UA 1T2DA 3TAXA 4M0KA 2W00A 4BEHB 3RQ4A 1XWIA 1XYGA 2XLBA 4KPUB 5BSHA 1TUIA 4LYHA 1FX0B 1K97A 4PG7A 4I99C 1ZINA 5FAKA 2GHRA 3SJCA 1EFPB 1SH7A 4YASA 3K4LA 2ZP1A 3DV0B 3RREA 3BILA 4WKBA 1MFPA 5FJIA 4AYBA 3VO8A 2MHCA 5FL7A 1FNDA 3JTEA 3ZCOA 5EIFA 3RTCA 1MO5A 3L5KA 3SC4A 1Q1AA 5IH7A 3EASA 2ISCA 2CW0F 4NZPA 2Q9BA 1B8PA 3WBFA 1HDGO 4YAKA 2XBMA 1VPTA 3NX4A 3PBKA 5DVZA 2DHCA 5C51B 1QTQA 5FBHA 3AVOA 1IXKA 4FPXA 4UVCA 2DUNA 5AW9A 1ENPA 1X1DA 2XAHA 1BQ3A 2A9RA 3V8KA 5B58T 4NCNA 2HTJA 3QIVA 3H1EA 1HDXA 1XZLA 2AS0A 1WP9A 1JG4A 1H6CA 1RWNA 4FTWA 4TL8A 1D2MA 5E0KB 4IIJF 5EG0A 3TLXA 1IHOA 1VMKA 1G5IA 4YUVA 5HUQA 3ISJA 4FYYA 2PBFA 4RVSA 1NURA 2C4TA 5K5QA 1IRGA 3AU9A 3MS2A 4V0QA 5KKAA 1A69A 1BKDR 2P3LA 4OB8A 2L0KA 1YZGA 4NBQA 1CE8A 3UKJA 4G5SA 3UO8B 2JJ1D 3DL0A 2P4EA 2EB7A 2V3VA 1L8XA 4N8DA 5EXSA 5G3YA 1IHXA 1PDNC 4MCIA 4UNNA 5CFZA 4PYJA 2WZCA 3IMCA 4BFWA 3GZ4A 3FIWA 2C4KA 3PCXA 4YJ2A 3KOMA 5FOXA 4D4JA 1ADJA 1HQYE 2MD5A 1Y9EA 3EOAI 5B5SA 3GEDA 5D85A 5AJTA 4MWZA 4MYUA 3ZHBA 3NT4A 1H42A 3VPBA 1BW9A 3CURA 1E4EA 4ND8B 5FL3A 4YCDA 3CS3A 5H82A 1Z5OA 2I4IA 4MR9B 2HOEA 3PKZA 4OXRA 4CCOA 3HA2A 3EIEA 2FOWA 1KI1A 4I9NA 2AFHA 1CY6A 3D1NI 4PZDA 3N2GB 5L53A 1KQGA 5KINB 2P90A 2A58A 5CVEA 1YMUA 2HREA 3AKEA 5C4JJ 2O07A 3QELB 5JYEA 5IT9A 2E5WA 4CM8B 4FOOA 2HR3A 4G2NA 1S7CA 3ERMA 2C2YA 3L8YA 3LBAA 3VAAA 3I61A 2H6BA 1OLXA 1QAQA 3LNQA 4XEHA 2SCUB 2O7NA 2RKBA 4L5YA 3PJGA 4JA2A 2GAAA 4G97A 1W73A 4U63A 3W7BA 4MYCA 1YMQA 1ZICA 2J3KA 4NMHA 3A1TA 4QWMA 4ARZB 5GJBA 2P9BA 5EFOA 4IIEA 4QUDA 4C87A 1P17A 3EDQA 3C1DA 2EDCA 1SBQA 2FPIB 4R6WA 1WDMA 2YHIA 3ZCTA 4FI3F 3FCCA 1LGYA 4JITA 3WFIA 1B9NA 4N7BA 2J0SA 2W2VA 2J0QA 2O2HA 4GT1A 3HYIA 1U2RA 1SIWA 2MSLA 2V7VA 2VJKA 5M3BA 3WYBA 3LA8A 2KLBA 2VT3A 1R1DA 4JDPA 1OSNA 4OB6A 1PKEA 1N92A 2OVFA 3EF1A 3KG2A 4TTAA 4XYGA 1NZJA 3NAQA 4JXKA 4FZVA 2V7FA 1MJFA 1Q91A 5IF3A 4DFDA 3I55I 4FCCA 4Z1OA 4J1TC 5BMVA 1XA4A 3CLSC 1XCJA 4UEOA 3V7YA 3TCKA 2Q1ZB 4M6XA 3MZHA 4O3FA 3VKUA 2Q4OA 3CYFA 1MJGM 1FJGB 1NNEA 2DBYA 4IIJA 3PO3J 3UJ7A 4OUDA 2DUWA 1XTRA 1Y89A 2V26A 4YACA 3L1PA 2L5QA 1RWMA 4EM0B 4YBRA 2QQ9A 3IJEB 1QP0A 2CHGA 4G23A 1IJKA 5BR4A 4AVPA 4Z7NB 4A2CA 1GPYA 3RT9A 4UFPA 4LW8A 3RFXA 4YV2A 4A3IJ 1J0CA 1E6EA 1B8VA 2OF7A 1LPPA 2ECPA 2RCNA 4DCUA 3ENNA 2CMGA 2LZ0A 2XQIA 4KO3S 2ZBKA 2E82A 1SC3A 3GHHA 1ETVA 2P0YA 1OA1A 4W5HA 2DWUA 1VHQA 4LKOA 4DM3A 2BF7A 2HPHA 5JYCA 1R5JA 3S68A 3QX3A 1OYWA 1XA0A 4I14A 3DLHA 3PWTA 2CBGA 4S24A 3CLOA 5DBEX 3U7JA 4B40A 2A0UA 1E3WA 2XVZA 1JSRA 1N0VC 1BIFA 1HGXA 1L5RA 1RXUA 2FWJA 3GK3A 2DA7A 5ERXA 2GETA 3OSZA 5COAA 1ZREA 4QU9A 5LPNA 3RYTC 3UJNA 2ZOSA 2IPLA 4Z4GA 4NEHB 3GD5A 2W5UA 1XRSB 2MMGA 4ZKEA 1WH7A 3A4YA 4GYJA 4KRYA 4QKQA 4G0MA 1KDVA 4DNQA 4JLDA 4IVNA 4Q7JB 3TR0A 2L7KA 1HLVA 3QU4A 1VA5A 3PR2B 1ZFNA 4FZ3A 4EJWA 3GNQA 4XQGA 1I7PA 2FQ3A 2PL1A 2VAPA 2HIGA 3L77A 3WKAA 2ATIA 4BO9A 4CCYB 4BNUA 5KSWB 1Y1LA 4QZVA 3RTGA 2Q2OA 1R66A 2Q1XA 4R79A 1C4OA 1KKLA 3GEBA 4GP9A 1TM3E 2N47A 4D74A 2QD3A 1GLNA 1M74A 3TOAA 3CNBA 3EBOA 1FK8A 4XGNA 1U3WA 4DLNA 1ENHA 2Z98A 1SAUA 1J4AA 5AI0A 4JI8B 3AR7A 1G9XA 1A8QA 3H8VA 1MHPA 3EQ7A 3IOCA 3QF4B 4JUBA 1R5NA 4UNQA 2G71A 3BJAA 5MFPA 5EPEA 1ZJWA 3ZWYA 2DJIA 4NBVA 2X3FA 1NVFA 2YN2A 1O2DA 3F3XA 4IHJB 4EQ6A 3GTQJ 4MFDA 3W79A 2JBAB 1U1DA 4MUJA 4QSHA 2I2XB 3QNWA 1JAYA 4OHPA 5ITZA 2QT0A 5AJUA 1VSVA 1GTJ1 4ND6A 5I7VA 1PVVA 1FL9A 3CC4I 1P45A 1TJNA 2P2YA 1T2AA 3OY2A 4LDPA 5LZ2A 5IYCJ 1FOYA 4R8MA 3GZ6A 1EVJA 3MQ4A 3N1UA 4JYMA 3B36A 1B2LA 3IYLW 1MOPA 4NYJQ 4RKFA 1SG9A 4PS1A 1OAKA 3BDVA 3G73A 2Z99A 1R71A 1FYXA 3DAPA 2JSCA 3E9RA 2OZUA 4FD3A 1XX6A 3G9ZA 4PC1A 5JD3A 3WB0A 3HXQA 3AFHA 4R8SA 1YQGA 5J1YA 1W0JA 3C5CA 1V1JA 3QOXA 5TY0A 3LSKA 3W2WA 3PITA 2WYOA 1JA9A 4DGQA 2WKRA 1WPXA 2P5UA 4HGYA 4H7FA 1V1MB 1E7WA 3N0TA 2VKQA 1HZJA 3AWIA 1G8KA 2YXNA 3WHPA 2VTDA 4KEAA 4HUQB 3HM5A 3G8CA 4X93A 2AG5A 4K7JA 1U5TB 2BEVB 3F5QA 4OO3A 3UK0A 2O3RA 4DA9A 1JF8A 1P18A 2P6OA 5GADl 4R9RA 5F23A 2EG5A 3S2DJ 2EJCA 3HKBA 3F1LA 5IT0A 4FGKA 4ZOLB 2B7EA 3SZLA 2STWA 2DKOA 1P2SA 3KB2A 5A4AA 1GL7A 2ZREA 1E9BA 2XSJC 1UOPA 4US2R 5E6SA 2EKPA 2I5UA 2IZOA 1U0SY 5EMKA 2JFUA 2ZIFA 3ILSA 4YRJA 2HJWA 3OKPA 4AYBN 2WF9A 4DA4A 1RXCA 4B3TB 1USSA 3DZHA 2WUFA 5HKAA 5FWAA 3NKVA 2YX4A 1FFYA 3IUYA 1QFJA 2JCGA 2FG7C 2QX6A 4CMKA 3GA7A 3O91A 2FEXA 2HWYA 5KYNA 2YHUA 1UBKS 2C1EA 3V6MA 3X0DA 3WSVA 5IWCA 1I1GA 3ESZA 1R1UA 3V4VB 1FMWA 2VC1A 1WB4A 2W98A 1F38A 2ZI5A 3AY6A 3RDPA 3B7WA 1L2TA 4EY8A 2OYSA 1TD9A 1USWA 2WC2A 2HYGD 3AR4A 4IDAA 3CF6R 3OKFA 2YUSA 5IAOA 2NNNA 4MS4A 3AEQA 4UQLA 1TCCA 2WWGA 2GPNA 1XCOA 4NYMQ 4F4DA 1QDUA 3PFKA 5FWYB 1G3SA 5L7YA 3CBQA 3OZGA 2PFBA 5C1DA 1JG6A 1FEXA 2ZXWH 1K6XA 1PBNA 2EKLA 4PRLA 2G4VA 4R1TA 3AJDA 2RGBA 4KSYA 3TLYA 4PZEA 1WS6A 1C7ZA 2C4VA 2HGZA 4IXTA 2CLHB 2WKWA 2WJYA 5IN5A 4GX0A 5BSGA 2FX0A 1II8B 4RZXA 1XU9A 1BN6A 4UUOA 1N34B 2FGKA 3H3FA 3IHUA 1QH8B 1KYZA 1MABB 5IM4F 4ZCRA 1CERA 4EG4A 5A5FA 1ZP6A 2JBAA 5DV9A 3V1UA 3W7VA 1DQNA 3TSOA 4JJEA 3ZHRA 4F6RB 1ZMTA 3I4PA 1CIJA 4YWJA 3UW3A 2PUGA 4QHSA 4P7FA 2R5WA 3QVGB 4H1VA 3S28A 4DLYA 4EIWA 3FPGA 3T5TA 4C0KA 4TLLB 5CVIA 1G8JA 2QRLA 2Z8ZA 2ZRMA 3IEXA 3RB8A 4YJ3F 2PDAA 2F6RA 3HHHA 1YR1A 1ZK0A 3R6GA 4ZDWA 3S2IA 4BUJA 5K0CA 3Q3CA 5CDFA 1TYZA 1UL1X 2YY6A 3E7PA 3TKLA 2AXQA 3ZCSA 4TMKA 1OPRA 3REOA 1HYBA 1B0UA 4AIIA 3U7HB 4OX9Y 4WNAA 2HA5A 821PA 1JFFA 1A98A 1BD4A 3K09C 3N97A 4UHDA 5KJ6A 1PVOA 3AVTA 2WV7A 4KFRA 1BOOA 4PSKA 1KU3A 4IOAF 3L2UA 3CR3C 2QB5A 3CUVA 4S04A 5F1PA 5IANA 2GD6A 4AKSA 3JAWB 3SDGA 1IIBA 2W2LA 2ZIWB 1LUAA 4HXEB 4QPCA 2J4CA 2NQ2C 1ABEA 1TAGA 5BYBA 1L8OA 1X1RA 2OLKA 2OV1A 3HKDA 1YI1A 3TXYA 3VBCA 4CM4A 4NLLA 3SCZA 1K7YA 3M9WA 4D80A 5D5XB 3KWFA 3TNYA 4KAJA 4XJSA 1KMCA 5EE3A 1DKMA 3NKLA 5AOVA 1N5LA 2PLWA 3MGAA 5IBRA 1FSZA 2JEZA 4JSRA 1SB9A 2WJWA 3AI7A 3DFFA 4DIUA 2YWDA 3G23A 4PINA 1DXOA 1E63A 3EIUA 1L9KA 1J99A 2OTCA 5KOJA 1MT3A 1GPLA 3RHFA 3GH1A 4W5TA 2EFYA 4P2GA 2E60A 1WSUA 1Z4NA 1K27A 1OIXA 1U0GA 3FCYA 5EY5B 1BDBA 4ZALA 4N3AA 4UNRA 1ZGHA 4JJKA 5B7PA 3QE2A 3U7GA 5C8DA 1VCHA 3EG5A 3NHWA 1ZU4A 3BG6A 4IIFA 3BB3A 3VMFA 1A5TA 4XLHA 2GWRA 3AX6A 4GKAA 3OIQA 4YP5A 5EKXA 4A26A 4TYQA 4EI8A 2DH6A 2XTNA 4XD7D 3VU0A 1MG0A 2XWQA 1PT6A 2G36A 2X77A 1RQ2A 2Q9UA 2WWTA 1DUXC 1TFRA 3KDPA 4U6NA 2L7MP 3JWIA 4BWYA 5KEIA 1C0KA 2F43A 2B92A 4F46A 1K5HA 3NUGA 4CKEB 1GFIA 1MJBA 2XASA 1AK2A 4U9IS 3RUDA 1UHSA 2K7FA 1ISHA 5IMSA 2AXEA 1MPTA 1A9QA 4M0FA 3ZDFA 3IP7A 2ZWOA 3Q40A 4TMYA 3HUDA 3U4AA 4S35A 3KUKA 5TGDA 4AJHA 1G8PA 1PK8A 2XOKD 4YDHB 4KXYA 3RVPA 3SVLA 3HGGA 1F0YA 5C18A 2C9CA 2XNCA 3H9CA 1SFRA 1GUFA 1I36A 1E8MA 2C29D 3BFPA 4BE0A 4DBLE 1GRNA 3DO6A 4CZZA 3LSHA 1PR5A 1IHPA 3FUXA 4ND8A 1Z6RA 4GYGA 4MWSA 4PBRA 4W7HA 1NOKA 4WHMA 2XUKA 2ZWVA 3PG5A 4G26A 2XGJA 2HV9A 2RDPA 2QTAA 2M9HA 3Q72A 2PJUA 5H83A 4I5GA 4TYYA 1EA7A 5JWOA 4M87A 3N6VA 1FFDA 1UAGA 2D4AA 2FGJA 2BMVA 3A0HC 1SVMA 3EGDB 3HXPA 3IIEA 4X54A 1GKIA 4EMTA 3TL3A 1UK7A 2CFIA 2KE5A 2MWMA 2AQIA 4JENA 1XELA 4XKCA 1NKTA 4E0BA 1QFZA 2BJHA 3RNOA 1T8PA 3U3DA 3FCSB 3W5HA 4CNQA 4MI3A 1W0TA 2F00A 2LTAA 1Y3FE 1CGPA 3DMYA 2ELKA 5DTIA 3W2TA 5KOYA 4Q3OA 1G291 1IOWA 1SVNA 2BGUA 1YJBA 2FRDA 3VYUB 3GFLA 2E1PA 1BW9B 1H05A 2FVYA 2AJ8A 1RZ3A 3IBGA 3BJ6A 1OZFA 1DMRA 1B3RA 1XDGA 4KAAA 1R49A 1WY5A 5BT9A 3L6RA 4CM5A 1RM3A 4IXMA 4D9IA 1W4BA 1LTHR 3KQYA 1G5HA 1N6RA 3IURA 4P2BA 2E0IA 1YW9A 3ZGVA 3LDHA 4FM9A 1WABA 1Y5RA 1YU6A 3K4NA 1DJNA 2DTEA 1R5HA 1KDRA 1QWSA 5ES3A 4A0YA 2ZJ0A 5SYAA 5BV8A 2WLTA 3L6CA 4GFDA 4DLLA 1RI2A 3H65A 4NBUA 4YIKA 3BWBA 3K5IA 4K0KB 4MIOA 1Q74A 3RUCA 4TX1A 2GJKA 4LIUA 1AGXA 3D3EA 4TKLA 5CB4A 3NT5A 4GBMA 1N5MA 2ZRJA 4ESFA 3PQ2A 2ZRCA 3C24A 3MK31 1FDTA 2ACJA 1ZLYA 1OTHA 1Z5NA 2VXBA 4IYJA 1RKXA 4U7HA 5JO0A 1ZN7A 1LNWA 2FZKA 1T10A 2CGEA 2RG1A 1KVUA 3AOEC 4RKEA 1DUIA 5LCXA 1MOQA 2I6SA 2MCFA 3KQUA 1KHTA 1Y9AA 1P0FA 1U98A 2VVTA 2BOLA 3UAZA 1HDIA 4PZZA 1GQOA 4RE5A 2IE0A 1R8XA 3AHEA 2F8MA 4OA5A 4E08A 4IMPA 3K0AB 4IGIA 4XRMA 5E17F 1P1RA 1V11B 2TSYB 3ANYB 4BVGA 1GAQA 3KHSA 5IG2A 4P0QB 4CL0A 5DN9A 4HA8A 3AZQA 1T8RA 3QWAA 4LSMA 4Y52J 3BEOA 4JS0A 4RSRA 1L5GB 3FIJA 4P55A 1UINA 1XJ5A 3HEFA 3QPSA 2I4LA 4UEWA 2QSUA 1ODIA 4RIIA 3WZLA 1JT0A 2GLOA 1GFSA 1Q3HA 1TTQB 1ZM2A 2WJJA 4Q4AA 1Z22A 4RFLA 2EYUA 3Q7IA 3P94A 3EG9B 2Y0SN 2EV6A 1KVSA 3TSAA 2R5YB 2WZDA 5DNDA 4JSTA 1NW4A 4JLVA 1L5NA 3ZU6A 3ZLVA 4EELA 2WTAA 5AVUA 2B4KA 3ZNNA 3UCXA 4X66B 3IAS1 2XJ9A 2EQRA 1MB0A 1HW5A 1KQ9A 1NQUA 2OESA 4LVOA 1GTG1 3DKPA 1C2YA 5H4HA 3C74A 3H18A 4DA7A 4HDVA 3NV7A 1EGAA 1P2VA 3TW7A 1G1AA 2P0EA 3ZE6A 3D31A 1DADA 2JGLA 1BVUA 4LWQA 4EITA 2DP4E 2WJPA 4KN6A 1ONNA 1JUSA 3HUEA 2AHQA 3EX7C 4RM2A 2B8TA 1U8AA 2GR9A 3WJ1A 5BYAA 2QLJA 2FKNA 3I9LA 3V8MA 5CW2A 5KS2A 5K6RA 3N8IA 3Q8WA 5I8ZA 5SZJA 1XTTA 4B9EA 4Q7QA 5LOVB 2RKHA 2JQ7A 1YR6A 3BWMA 5HNKA 4HZUB 4C4AA 1O0BA 3TQFA 1I7QB 1I30A 5LLSA 1QP7A 1G3IA 4N5DA 3PDCA 4ZYWA 2ESRA 5I7UA 1XNRB 3U9GA 3OJCA 4DUGD 3C7CB 1NR7A 1YG2A 3FXLA 4IJ6A 4DYVA 3R7BA 1WB5A 5BRNA 1DT3A 1YS6A 3SN6A 3I9MA 3SLKA 3MD9A 2C9MA 2ZIEA 1A9TA 1ZY2A 4A3FJ 2IGNA 1O96A 3BJIC 5AM5A 2V7QA 5H5JA 1AKYA 3VC1A 4CZ2A 2UUPA 1OB5A 2GJ9A 2PAFA 3TOXA 3HABA 2WUVA 3KFXA 5IVPA 3KXDA 1PLLA 4KMMA 4EUHA 2J08A 2IA1A 1M2HA 5CVTA 4Z0TA 3FFXA 3S27A 4N0PA 3KJZA 3EVCA 4ES6A 4NYJR 1LPMA 2E5LB 3ZUPA 1HDOA 5ALEA 4AJ1A 4EGFA 2AQHA 3BJOA 1ESNA 1OXTA 1K4SA 1YK0A 1BX0A 1V5WA 1E64A 2FYTA 3QKRB 4HQFA 1TWHJ 1BRTA 5LNK1 5AO9A 2YVQA 2DHDA 1YOVA 5EDNA 1VKHA 3TDKA 3B9QA 1DWQA 5TPWB 2VQEB 3BG7A 1E8DA 2OLEA 1JJVA 2QUIA 5IVHA 4E2FA 2R6HA 2AEJA 5HS4A 1WSAA 4RGRA 3QOEA 3ZPXA 2OAGA 1W59A 2ZJ7A 5DGDA 2JLSA 3TD6A 4L0QA 2AN1A 4IIDA 2VKDA 2PX9A 4HB4A 4KNVA 1M7BA 4NU8X 4D0RA 2Y8EA 3ANNA 5E6RB 3KL4A 2AI1A 3I76A 4N4NB 1T3TA 4LG3A 1AU9A 2F59A 1Y5IA 2PVCA 2RBGA 4EL0A 1U2QA 5F0FA 1XJ0A 1J0RA 1HF3A 2QRPA 1LK7A 1WHUA 3LPAA 3NHSA 1NYTA 3UW1A 1JIVA 4AW9A 5FA5A 3TQRA 5EEAA 4Q19A 3TJMA 4DRYA 3OIPA 1DTWA 2RHOA 2UU9B 5M3MJ 1VQ7I 1QJ4A 2VL7A 3GLGA 1LNZA 2YWFA 4QFCA 5DMXA 1PNVA 3ETLA 4NAHA 4OH7A 2HZ7A 5HK8A 2O5CA 3JQ8A 3RHZA 2PWPA 2IU3A 3SZGA 2PJZA 4LDAA 3SICE 1ORRA 5JZOA 3KFVA 3BRSA 1KKUA 2HPIA 3FPEA 2VLBA 2OEPA 3CZ5A 3L05A 2QTBA 4ZKDA 5ADUS 4D43A 3S1QJ 4HMPA 5KQPA 1M5TA 4S3MA 5ADVA 2GA9A 4KO2S 2QE6A 4C0LA 1ODSA 3GBVA 1R0WA 2GM4A 1IBSA 2OPBA 3GUHA 3HCNA 1DC4A 3TTUA 1IHUA 5CG2A 2XMBA 4GE0A 3VPDA 1C4WA 2P4WA 3ZGKA 4KK4A 4YRFA 1EHCA 3OECA 4IIYA 4BB6A 4DDKA 4ZI2A 2DKFA 3PNVA 4N39A 3J7AY 2JFQA 1HXHA 3VSCA 1ZCBA 4DXHA 3C8ZA 5GZ6A 3JQEA 2VYNA 2PXCA 4V0KA 1BMFD 5LP6A 3JD0A 1C5KA 1KE1A 2NXNB 1QRUA 2JIZA 1U99A 3BQZA 3ANXA 3B70A 3MJ4A 2XF5A 5IZCC 3HCFA 4DV2B 2BHZA 5A4FS 1YFLA 4PFQA 3WL5A 2P78A 3EIHA 3CG0A 2ZRIA 3ILXA 2QKLB 1OILA 4MA0A 4M98A 4RJ2A 4W5WA 3U17A 2ST1A 3WNZA 5EJCA 4DZJA 5BO5A 1B8UA 2QAIA 2VNHA 2MMCA 2XDAA 1P3JA 3B3JA 1E2QA 3BD6A 3QUBA 4H16A 4JYZA 3VX4A 1D8AA 1JQBA 1XLTA 3CF4A 2FFHA 3F5SA 5JAIA 2W6MA 1HXDA 3DFUA 1U5CA 4B1RA 1N6HA 1WKCA 2X2PA 3KU4A 3ME5A 4MR8B 4PYOA 1NVMB 1XTSA 3EFEA 2MIIA 1L6RA 4A0FA 2NZUG 1ICEA 1GAEO 2F5CA 3BC8A 5CPFA 2QTFA 4HDNA 4MVJE 2BH9A 4XPZA 5B30A 4ONEA 4AVYA 1UBJS 1D0ZA 1J75A 4N4OB 2JFYA 3HSRA 2E4WA 1TMOA 3I6YA 3OZCA 4TKVA 5JIBA 4A15A 2GPWA 2O6HA 4HYEA 4W5JA 1VL8A 3GVCA 5CFOA 1Z38A 5ITSA 1SZDA 1U04A 3SZPA 1L4YA 4KQ6A 3SOPA 1OFIA 2JTVA 2OV3A 2HDOA 2HJGA 3PE4A 4GYKA 2H5LA 4X92A 3DBRA 3H2GA 2BPOA 3D6VA 5ECDA 1WETA 2IF2A 3KR9A 4MWDA 4DG5A 2LC2A 2BKLA 2Q46A 4IDFA 4EJTA 2BMDA 4IP0A 1W4ZA 4GR9A 4V02A 2ZSHB 1H23A 2QIPA 5DEOA 3PU6A 4WASA 5JMWA 2P2ZA 1EK2A 1PTJC 3V5NA 1XL1A 1NATA 4ITUA 5FR2A 1B43A 3HZOA 2QE7D 5ALYA 3DD1A 1N2CE 3FKQA 3PRKE 4RH1A 3A04A 2WPDA 2OFXA 4GXRA 5C0OE 1SAXA 3PQCA 2WU1A 2NOJB 2O6GE 4JVSB 4G8DA 4RJLA 3S4YA 4A9AA 4TVSA 4A4DA 2WTEA 3PFFA 5AR1A 3EWSA 3WK5A 3MKZA 2IRFG 1DBPA 4TTQA 4CYCA 2GZ1A 2FJ1A 3RSFA 4KLZA 3EXG1 2QMOA 3PIDA 4IICA 1TO2E 3NV9A 1J2XA 3CVYA 1U7OA 3K6RA 5KVCA 1BROA 1J23A 2Y2UA 5CDTA 2G6BA 1AS2A 1E92A 3CEPB 3MN2A 3RASA 1KO4A 3B3GA 3NHFA 4TZ0A 1YCHA 1FPMA 4E70A 2HOSA 4KV7A 3KDAA 2AGVA 1E2GA 2QD2A 3EXEB 4B81A 1AO0A 3UTDA 3MLAA 1QFMA 2NQTA 4MI9A 4D5EA 4Q21A 5HM8A 1DG1G 1V47A 1WKBA 2WVGA 3FGOA 2I78A 3QKSA 4FMCF 4I99A 4YQZA 3SSMA 4ZHQB 2VC2B 3G6EI 1SQ0A 3WGIA 3EXIA 2VPRA 2QZJA 4TMTA 2CBZA 1Y6FA 2AVNA 4CLDA 3ORQA 3QOFA 3M1CA 5JALA 1ORVA 1PQUA 4FEGA 2M5WA 3F4KA 5T3UA 1LV7A 4IOLA 1SOUA 3ZTYA 1U1CA 1YR2A 5EIBD 5KX5B 1WB9A 2IODA 2V4UA 5BPIA 3DCNA 3NGXA 3OEED 3C4VA 4BNMA 1IBMB 3ECSA 2R7XA 4GECA 2YX7A 4EABA 3O26A 2XR1A 3M6VA 3KELA 5GY7A 3UOGA 3GMIA 1ZUNA 4EJUA 2ADOA 2QRGA 1HF0A 2KQRA 1A72A 4R7ZA 1T4CB 5LU9A 4O1MA 3HP1A 4JC5A 1RXVA 5L4NA 3L79A 1FOXA 2C8JA 4G63A 4IXWA 1IN6A 2D00A 1M6NA 2H7YA 1XP5A 1NMZA 3VUEA 2JMWA 1E17A 3OICA 3OZIA 1VDMA 4DMFA 1FTGA 2DB3A 1VOTA 4EJ2A 3RV4A 5DV5A 1CRWG 1JLLB 1RR6A 4AIDA 2DBRA 2JEYA 2QK4A 3AUSA 5CHEA 5KVVA 3F46A 1Y48E 1RKTA 5D5VB 3QWHA 1Z39A 3NBUA 4HH3C 1XC7A 1BC5A 3NAZA 5DH9A 4JV5B 1BWRA 4RAOA 3GWZA 5ERIA 1E3PA 2J3EA 4MJ7A 3UN1A 4ID9A 3T9BA 3VTKA 4C1BA 4DJJA 3KOUA 4O5AA 3JW8A 2QD1A 2WAEA 1ON2A 2C7PA 4H4KC 2JVHA 1TLLA 2OUKA 2CN1A 5JHGB 1GGVA 2QRUA 3C1OA 4BBPA 1Y8AA 3UQZA 1DEXA 1RPNA 3Q5GA 3BTLA 3WX0A 2XOKA 4RXUA 4EB8A 3B52X 3VR5D 4PJ0C 5KYGA 5GIPE 2PUEA 2G83A 1AK1A 2XV4S 1QOZA 1A7AA 1MH1A 4JR2A 3CLTC 3K4MA 2G9WA 2WNHA 4M6WA 4Q16A 3OTIA 2WAMA 3B5IA 2VATA 4RS8A 3IDZA 2ODAA 3QPDA 2JA1A 2L4MA 2ZBVA 3OO1A 3OWHA 4QJ5A 3WGKA 1NW8A 4IZHA 1H2WA 1JHQA 5EZGA 1ZQ9A 2ID7A 1E69A 1FSFA 1E0SA 1XF1A 2V7WA 3ITNA 3MJTA 4H2DA 1JU9A 4R0MA 3O8CA 4NH0A 2F3RA 1YVRA 3GZNB 1VKJA 4P4LA 3U81A 3RBAA 4CR8A 3WGQA 4EL5A 1I39A 4PN3A 5HZKA 2MG4A 1KJNA 2H1VA 2QP4A 2ZUBA 2P5KA 2P9EA 1LFUP 2FZ4A 3KXKA 1FVXA 3Q7TA 3R44A 4B8ZA 3HR8A 2J85A 4ZYDA 4L9RA 3ZE0B 4A2PA 1WMAA 4HVLA 1LQUA 1QFYA 4B6EA 4CICA 5FPTA 1JI8A 1Y4ZA 4PVDA 3BDIA 2DZDA 2QW8A 1DJLA 1VYHA 5LWQA 3HE3A 4ZQEA 3SS7X 2CXNA 3ND5A 4DABA 4MKHA 1VQ5I 3DYIA 4L5CA 1XG5A 4OFZA 3TWOA 3E3MA 1EESA 5FUYA 3CVXA 1HFWA 1I1NA 1OR8A 2AK3A 2XTMA 3LDFA 3NTVA 1W7PB 2CV0A 4C1NA 2XJ4A 1EWQA 1HMYA 3HBFA 2Z3YA 5DNYB 1LUJB 3KUUA 3GA5A 4JGGA 3P52A 4OMDA 1EPUA 4XCVA 3SC6A 5FTKA 5LXTA 3GA0A 1BGWA 2ZI7A 1YJ8A 2D0OB 2QXUA 3W1EA 2TMKA 4KREA 4XW2A 3C2BA 4FMCB 4KQJA 5K5EA 1CRPA 2A59A 1PW5A 1VI2A 2IEIA 4LOHA 5EJGA 3PUFA 1HEYA 1W76A 1L4UA 2PT5A 3R3JA 3TCXB 5HOEA 3CWCA 3H5IA 4D8YA 3WIBA 1FUUA 3DR3A 1FP4B 1WCV1 5F1RA 1ZBDA 2DFDA 2EGUA 4MUMA 4UXIA 1QGZA 1ESDA 1JA0A 2O1SA 3TFQA 2D45A 3Q6IA 3TTWA 3OR2C 1A04A 1YI0A 2ZYUX 3A32A 4A6EA 1T3HA 5CQGA 3MGGA 3GO4A 3O8BA 4HNHA 4RWZA 4LIVA 4CCAA 2H18A 4QOGA 4RIGA 1WJBA 4QPJC 2RJNA 4YEDA 4L9WA 4JXJA 3ZHYA 3M4OJ 3G9UA 2BE9A 1G2OA 5LFAA 1P9OA 4UB8C 3QAHA 2X48A 1Y0BA 5AM2A 2BKVA 4X20B 1YBAA 1L3CA 1GLGA 4ZQIA 1HG1A 3W78A 4P0TA 2FUG2 2NU9A 1ORTA 2W2XA 3UHAA 3CKKA 2JK0A 4M9CA 1B8OA 4E1VA 1I6KA 1BA5A 1Z7EA 2ZTHA 4UHKA 4CFSA 3THWB 3NEAA 2RGGA 3GBGA 2ZAMA 4RVFA 3KKMA 5AKLA 3JQ8B 4Q1EA 3OMYA 5ALSA 2KJQA 2PR2A 4QUIA 4Y18A 4LWZA 3UBMA 4D81A 3UJAA 3QXJA 1LV8A 3V00A 3HMQA 3ZGNA 3T1HB 2P69A 3MW8A 1C9EA 1C1XB 5ILVA 1S2LA 1CY4A 2VUSA 3SMQA 1XV5A 3WDSA 5A9RA 1GWNA 4DR4B 4RLSA 1NDUA 2B8EA 2RH9B 2X9QA 4JVNA 4F7WA 1XTAA 4M4SA 3IR6A 2X8JB 3B13B 3HO8A 3PNKA 3GRUA 4NG5A 4UTOA 4BNCA 2FRHA 3GLTA 5DGCA 3VHLB 2G40A 4A5OA 3LTEA 4C3ZA 1L5LA 4EMUA 3L2OB 1YS4A 5K5OA 1AGPA 1P1IA 3Q1LA 4XGKA 3QF7A 1LKXA 1TDJA 4BFSA 3CTAA 1KK2A 1WUTA 1ZM9A 1QHHA 4ZVNA 1IXRC 5B2FA 2ISSD 2ZCVA 5TPWA 3VQTA 1QNFA 2ZWAA 5AYVA 4BVJA 3HXOA 1SC4A 1M8KA 1N9KA 2X4LA 3TKYA 3AHCA 2RGCA 2VUMJ 1K8ZB 1LE8B 2ZRNA 4DLXA 4F4JA 1NJ5A 1HOMA 1QVZA 3DL7A 4M54A 5KYXB 4KQEA 3E6MA 1D2GA 5JZSA 3KX2A 2A33A 4GOMD 1IY1A 4RF3A 4EI2A 2CB0A 5EMNA 2ZE5A 3BIFA 2D2FA 3ICWA 3OFNA 4MVYA 4CEJB 1VSQA 1JQAA 3OFSA 2DTRA 3C3XA 1T4GA 3UAYA 3ZR4B 1CG6A 2CNWA 3ZV5A 1TNDA 4UMVA 2VTBA 4OLHA 3O83A 3THYB 3ZY6A 1V3FA 3UAGA 5DTMA 1QRYA 6ADHA 5HP4A 1IRXA 5BOVA 3EVAA 4BNFA 4HZIA 2M6LA 2EKDA 5C9ZA 5ILUA 3CA8A 1BHSA 2WA2A 4O63O 1JH8A 4CT4B 3B6JA 3L1IA 5HEKA 2RBKA 4N0EA 5JVGF 2PXHA 1D07A 2UVDA 2OGTA 3ML1A 3IVGA 4O08A 1V6SA 3K05A 4M0UA 3DF7A 3HL0A 3H2BA 1UF9A 4LJRA 3TIFA 1X7GA 2CWWA 4IG9A 4E03A 3FDZA 2QPTA 3UMGA 5FORA 3CU5A 4NZMA 5B3AA 1QAOA 4D25A 4UBKA 3R3HA 1JGSA 1C3EA 3PC6A 5JLJA 4E51A 2A5WA 3AF2A 1ULBA 4PANA 1CCWA 1TQIA 1A4IA 2JGRA 2PANA 3WYCA 3TR5A 3ZY5A 1PJTA 1QOPB 2H8WA 1XFAA 1W2WB 2QA4I 2GBLA 4RQAA 1VF9A 4GLFA 5DOVA 5FBLB 4XIJA 5TISC 3R4CA 4B4UA 1GA1A 3V1LA 1R58A 4L5IA 4V03A 2K3PA 4LLLA 3VR5H 3Q3EA 8ABPA 4DMUB 3CCYA 1CUBA 3MWDB 1Z0FA 3FHCB 4N9QA 4YB8A 4EATA 5CUQA 1QZ3A 4ZQBA 4WNIA 1SKMA 2N9UA 5AONA 3I6MA 1ONVA 5DBIA 5AXDA 5LN1A 5ILSA 3I04M 3CCSI 4IBOA 1OC4A 4Q4AB 2ZTSA 2ZR8A 1ZA2A 4CHTA 3RH0A 2YOGA 1X70A 1LX7A 2QRVA 1PLKA 2TECE 3OHPA 1JLSA 5HKLA 1B6SA 2NUAB 2Q7XA 4EG3A 1TTTA 4GQIA 1SQ5A 2Z8XA 5L3ZA 4BU0A 3FAZA 4IRMA 4A91A 4OGGA 2CKMA 4HQOA 5AVJA 5C8ZA 4IJVA 2UYYA 1J9IA 4DNXA 3IA2A 3F3KA 4KB5A 5H1YA 3SK0A 1ULTA 3D5EA 3JRXA 2Z04A 5CCXA 3N8DA 2L9NA 4M1KA 2Q2EB 2LSOA 1PVDA 4XB1A 3GC6A 1CEYA 1H0MA 3QKWA 4PIMA 1HE5A 1ZHHA 4RPHA 5D1HA 2F3QA 2CVZA 3DEAA 3DE2X 3GJ0A 1K8XB 1Z9BA 3HCOA 3QEKA 3QVSA 1GG9A 5BRJA 3Q88A 4XRGA 5BSEA 1E3TA 2CUFA 1MH4A 3L8EA 4BFUA 1RPAA 5GONF 2C42A 2PWYA 2ZYGA 5D8DA 1C81A 2Z6VA 1SCUB 1SOWA 3D2LA 3EW7A 1QIHA 1TMGE 2C5AA 1SRRA 4AWXB 4X6XA 2CW8A 1SD7A 1IG0A 2W22A 4NOMA 1IDN1 4PX2A 4AWXA 1F5SA 4ML3A 5A5DA 5HS8A 2F3TA 3M5CA 1PNQA 4MS1A 2L42A 1VLVA 5FHRA 3ZDEA 2BGLA 2HWUA 2XPVA 2J3LA 2EIKH 1U65A 1Z0AA 1NW5A 1HE2A 3H4MA 2ODPA 3BWGA 3EJ6A 3EYIA 1C0EA 1ETHA 1Z6GA 4IGKA 4LITA 3R2JA 9GPBA 2QLMA 5IUKC 3IXLA 3LFKA 4MV8A 1PFQA 4GLBA 4UZEA 2WICA 3NWOA 5DTJA 3RC8A 3FB4A 3H11A 1I1SA 2X51A 2PMBA 4FE3A 2REBA 4RB1A 2IUUA 1S3SA 1V1MA 4JUFA 3K31A 1ZBQA 4XIYA 2AMYA 2VOOA 1T8IA 3M8JA 2C5SA 3MD2A 3H9JA 3F7MA 3LC0A 1FYEA 5E4YA 2IPMA 3AFOA 2L19A 3WLKX 2Z5UA 1WXXA 2WI8A 2E1NA 5EEGA 5K03A 5K8TA 2ZZMA 1P9LA 1K75A 3UCEA 1ULSA 1CUAA 1G3QA 3HYNA 3MUNA 3IQZA 4UQPA 1DRJA 1EZZA 2K4JA 2WWFA 1C7FA 2JA8J 4GWLA 5G4LA 2G1PA 2GPTA 3I8OA 3KKKA 2YH2A 2G0TA 2XZLA 3LSRA 2C7BA 5IASA 5KVAA 9MHTA 3E81A 1YZYA 2JFGA 1XU7A 2JS7A 2QJFA 1YHNA 1T8WA 2I29A 3JY6A 4KQKA 3FX3A 3QV2A 4B7AA 5IDVA 1JHPA 4QTYA 4Z2AA 3NO4A 2QBYA 4LXQA 2F4OB 1OZGA 2H1HA 1WNTA 4WACA 3MT0A 4C20A 1AU7A 2M98A 5LRSA 3PSFA 2GN4A 5FOWA 3EB9A 2O2CA 3C2QA 4D26A 2GCGA 1U8EA 4BQRA 1OZHA 2VNJA 3O74A 4O0LA 3IP5A 2GK3A 3RW9A 3IPXA 1U8XX 4I66A 3IO3A 5CA1A 3WZMA 3WE2A 1PT8A 3C5HA 4OHCA 3SF8B 1S9HA 1WU7A 4FHTA 1YQWA 5K8LA 1GUBA 2YASA 3BEDA 4CMIB 1I80A 1T0HB 2RHWA 2EF0A 4J19A 3ZW8A 3ORSA 3LY5A 3IKTA 2W83A 4RM3A 1IZ8A 4ZOEA 3WLIA 4UVHA 3LZDA 4C3UA 4YRMA 5AVRA 2VNKA 2QQEA 4Y7DA 4CKEA 5CLQA 1BC8C 4YAJA 1T56A 2QNBA 4F04A 2YX1A 3FVWA 1T95A 3CMAI 3QBEA 1SBIA 1LEAA 3IUPA 1RYBA 3BZBA 2WAQA 2WSSD 3DCIA 4AF7A 2GUWA 1E9VA 2H8GA 2FSSA 2GN0A 3IH4A 3LLMA 1ZG5A 3RS3A 2P91A 3B78A 3MJEA 2KFDA 3PIOF 4NF2A 4WOPA 3HKEA 3IQHX 3K1JA 3DTKA 3H5AA 3L8ZA 3T3PB 4MGRA 3R5HA 4B8YA 3DTIA 2VTBB 2P6UA 1UZCA 1ZM3A 2KS6A 2JGJA 4U6SA 4DQVA 5EE9A 3EZ2A 4DW8A 2VCHA 5AW6A 5JZMA 2I4MA 4PK4A 1JI3A 1V8PA 3V80A 4P98A 4YAIA 1BS9A 1ZJJA 1P33A 1O77A 2CDAA 5SY6A 1MBHA 1JSLA 1RABA 3NEJA 2W85A 4ANFA 3PUIA 4XLPF 4UM5A 4FDTA 2I6XA 4QPQA 2Z33A 3I5AA 3FWEA 4KO1S 4KR0A 2W6ID 5DRTA 3VZBA 3LOCA 1J2JA 1U2GA 4UUQA 3R5FA 3ZTWA 2CMFA 3CT6A 2XA1A 4EV0A 1KGSA 2W4MA 4QX6A 4NJEA 4FGLA 4K46A 1O7JA 3P9IA 4B4WA 2RAEA 3E7XA 2H4WA 2X8WA 2EZ8A 2DLNA 4BXOB 1GILA 1P6QA 1XKXA 1Z8HA 3EWIA 3GZTB 4MRSA 3R7SA 3H3UA 3SGLA 3ZU4A 4IIJB 3KZXA 4ENQA 2KHMA 4KE7A 4D6XA 1M76A 1WZNA 4LNHA 4DMHA 1QCDA 4W97A 1H2HA 1M1YE 4ZYGA 2C95A 1T5LA 2CO5A 4K6OA 4WBXC 1GPWB 2HQNA 4CQLB 4CKCA 2JLWA 1XZFA 1GPAA 2DFEA 1X8LA 4I50F 4ZANA 5CFMA 3KR0A 1I94B 3ZI4A 3GIWA 2ATXA 1ZR4A 3R74A 1AHPA 1PNRA 5HR5A 2BR5A 1DRKA 2VRCD 1V3VA 2ZRDA 1NY6A 3I4MJ 5BSVA 1IM2A 5CJ9A 1LDMA 1NRWA 2AEMA 2JIMA 2J3JA 4ME6A 3ND7A 4XKJA 3ILHA 1NTCA 3A1SA 2A0WA 3QY0A 2P5YA 3QEMB 2GJAA 5KVRA 2BSXA 3S5UA 3RTRA 3H86A 2XD9A 3D6AA 4C21A 3R0XA 3BIOA 3P9RA 3WLOA 5CB8A 2VNAA 4TLCA 1UK6A 2XWSA 5DT9A 2C0PA 1J8FA 2Y92A 3ORRA 1JQJC 1NG7A 1H3FA 4E31A 3I54A 2FPOA 1UQUA 2BFOA 4O2BA 5FBQB 4ENSA 4FSXA 1GN9A 2CNOA 1NF9A 2E5FA